F485913

General Info

Members Datasets Scaffolds Average Seq Length
926 511 708 88

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10547243|Ga0075364_105472432
Length 83
Sequence MSEILTHDPIPGFEAPVHRALTEPILLGGAPRAVAITNGTLAAVVGLGLRLWIHMAAVWAARRDAQFVDVVRRHLRYPSHLGV

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
6 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
7 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2516143018 Ensifer sp. BR816 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
21 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
22 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
23 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
24 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
25 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2643221683 Variovorax sp. Root473 Isolate Unclassified
29 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2818991435 Caulobacter henricii 536 Isolate Unclassified
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
44 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
45 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
46 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
47 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
50 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
51 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
52 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
53 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
54 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
55 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
56 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
57 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
58 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
59 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
60 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
61 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
62 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
63 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
64 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
65 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
66 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
67 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
68 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
69 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
70 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
71 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
72 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
73 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
74 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
75 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
76 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
77 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
78 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
79 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
80 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
81 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
82 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
83 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
84 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
85 2904456579 Variovorax sp. 2002 Isolate Unclassified
86 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
87 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
88 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
89 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
90 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
91 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
92 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
93 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
94 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
95 2922368715
96 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
97 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
98 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
99 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
100 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
101 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
102 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
103 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
104 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
105 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
106 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
107 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
108 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
109 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
110 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
111 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
112 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
113 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
114 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
115 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
116 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
117 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
118 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
119 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
120 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
121 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
122 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
123 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
124 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
125 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
126 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
127 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
128 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
129 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
130 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
131 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
132 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
133 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
134 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
135 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
136 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
137 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
138 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
139 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
140 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
141 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
142 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
143 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
144 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
145 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
146 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
147 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
148 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
149 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
150 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
151 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
152 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
153 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
154 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
155 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
156 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
157 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
158 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
159 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
160 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
161 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
162 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
163 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
164 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
165 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
166 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
167 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
168 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
169 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
170 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
171 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
172 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
173 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
174 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
175 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
176 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
177 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
178 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
179 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
180 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
181 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
182 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
183 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
184 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
185 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
186 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
187 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
188 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
189 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
190 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
191 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
192 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
193 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
194 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
195 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
196 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
197 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
198 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
199 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
200 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
201 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
202 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
203 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
204 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
205 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
206 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
207 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
208 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
209 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
210 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
211 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
212 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
213 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
214 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
215 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
216 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
217 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
218 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
219 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
220 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
221 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
222 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
223 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
224 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
225 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
226 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
227 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
228 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
229 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
230 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
231 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
232 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
233 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
234 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
235 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
236 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
237 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
238 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
239 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
240 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
241 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
242 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
243 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
244 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
245 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
246 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
247 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
248 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
249 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
250 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
251 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
252 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
253 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
254 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
255 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
256 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
257 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
258 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
259 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
260 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
261 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
262 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
263 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
264 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
267 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
268 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
270 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
271 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
272 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
312 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
313 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
314 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
315 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
320 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
321 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
322 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
323 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
324 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
325 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
326 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
327 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
328 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
329 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
330 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
331 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
332 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
333 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
334 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
335 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
336 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
337 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
338 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
339 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
340 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
341 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
342 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
343 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
344 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
345 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
346 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
347 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
348 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
349 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
350 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
351 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
352 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
353 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
354 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
355 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
356 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
357 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
358 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
359 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
360 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
361 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
362 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
363 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
364 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
365 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
366 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
367 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
368 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
369 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
370 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
371 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
372 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
373 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
374 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
375 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
376 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
377 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
378 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
379 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
380 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
381 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
382 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
383 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
384 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
385 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
386 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
387 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
388 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
389 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
390 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
391 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
392 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
393 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
394 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
395 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
396 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
397 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
398 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
399 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
400 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
401 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
402 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
403 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
404 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
405 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
406 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
407 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
408 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
409 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
410 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
411 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
412 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
413 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
414 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
415 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
416 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
417 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
418 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
419 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
420 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
421 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
422 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
423 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
424 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
425 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
426 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
427 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
428 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
429 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
430 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
431 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
432 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
433 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
434 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
435 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
451 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
452 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
453 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
454 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
455 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
456 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
457 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
458 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
459 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
460 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
461 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
462 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
463 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
464 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
467 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
470 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
471 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
472 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
473 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
474 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
475 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
476 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
477 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
478 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
479 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
480 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
481 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
482 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
483 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
484 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
485 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
486 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
487 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
488 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
489 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
490 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
491 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
492 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
493 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
494 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
495 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
496 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
497 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
498 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
499 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
500 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
501 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
502 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
503 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
504 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
505 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
506 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
507 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
508 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
509 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
510 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
511 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.54
Metatranscriptomes 0
Isolates 23.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.05
Nodule 19.22
Rhizoplane 3.67
Rhizosphere 56.8
Stem 0
Stem Tuber 0.11
Unclassified 14.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1033777 3300002074 Bacteria 638
2 JGI25150J39212_1000241 3300002774 Bacteria 29238
3 JGI25151J46595_10048672 3300003187 Bacteria 1462
4 JGI25165J46597_1000078 3300003214 Bacteria 179320
5 JGI25153J46596_10000109 3300003215 Bacteria 93661
6 JGI25153J46596_10080839 3300003215 Bacteria 811
7 rootH2_10005575 3300003320 Bacteria 33191
8 JGI25160J50197_1007209 3300003354 Bacteria 4378
9 Ga0055539_1007703 3300003752 Bacteria 1357
10 JGI25405J52794_10004874 3300003911 Bacteria 2405
11 JGI25405J52794_10049593 3300003911 Bacteria 898
12 Ga0065165_1003688 3300005262 Bacteria 10405
13 Ga0065165_1100151 3300005262 Bacteria 726
14 Ga0070683_100430387 3300005329 Bacteria 1259
15 Ga0070670_100901191 3300005331 Bacteria 802
16 Ga0068869_100920507 3300005334 Bacteria 757
17 Ga0070666_10000070 3300005335 Bacteria 75681
18 Ga0070666_10234077 3300005335 Bacteria 1298
19 Ga0070660_100597097 3300005339 Bacteria 923
20 Ga0070689_100553301 3300005340 Bacteria 992
21 Ga0070661_100315783 3300005344 Bacteria 1219
22 Ga0070668_100000213 3300005347 Bacteria 37697
23 Ga0070675_101168365 3300005354 Bacteria 708
24 Ga0070674_100301410 3300005356 Bacteria 1278
25 Ga0070667_100000265 3300005367 Bacteria 59228
26 Ga0070667_100004158 3300005367 Bacteria 12232
27 Ga0070667_100341773 3300005367 Bacteria 1354
28 Ga0070667_101022885 3300005367 Bacteria 771
29 Ga0070714_100123365 3300005435 Bacteria 2307
30 Ga0070713_100904326 3300005436 Bacteria 849
31 Ga0070710_10437540 3300005437 Bacteria 884
32 Ga0070711_100822773 3300005439 Bacteria 789
33 Ga0070708_100000110 3300005445 Bacteria 54449
34 Ga0070708_100886377 3300005445 Bacteria 838
35 Ga0070663_100377712 3300005455 Bacteria 1153
36 Ga0070681_11038737 3300005458 Bacteria 740
37 Ga0070706_100119639 3300005467 Bacteria 2455
38 Ga0070706_101973261 3300005467 Bacteria 529
39 Ga0070707_100089793 3300005468 Bacteria 2973
40 Ga0070698_100114061 3300005471 Bacteria 2667
41 Ga0070699_100002841 3300005518 Bacteria 15448
42 Ga0070699_101053102 3300005518 Bacteria 746
43 Ga0070679_100328060 3300005530 Bacteria 1479
44 Ga0070684_100014485 3300005535 Bacteria 6391
45 Ga0070697_100412149 3300005536 Bacteria 1173
46 Ga0070697_101253889 3300005536 Bacteria 661
47 Ga0068853_100486359 3300005539 Bacteria 1164
48 Ga0070672_101261214 3300005543 Bacteria 659
49 Ga0070665_100010760 3300005548 Bacteria 9256
50 Ga0070665_100075943 3300005548 Bacteria 3367
51 Ga0070665_100132284 3300005548 Bacteria 2497
52 Ga0070665_100603004 3300005548 Bacteria 1111
53 Ga0070665_101784949 3300005548 Bacteria 622
54 Ga0068855_100842910 3300005563 Bacteria 972
55 Ga0068855_101341809 3300005563 Bacteria 739
56 Ga0068857_101509262 3300005577 Bacteria 655
57 Ga0068856_100757682 3300005614 Bacteria 991
58 Ga0068856_100945012 3300005614 Bacteria 881
59 Ga0068856_102255983 3300005614 Bacteria 553
60 Ga0068852_101643689 3300005616 Bacteria 665
61 Ga0068859_100259523 3300005617 Bacteria 1829
62 Ga0068864_100431590 3300005618 Bacteria 1257
63 Ga0068866_10735332 3300005718 Bacteria 680
64 Ga0068861_100701407 3300005719 Bacteria 940
65 Ga0068863_100000182 3300005841 Bacteria 67022
66 Ga0068858_101023872 3300005842 Bacteria 809
67 Ga0068862_100459509 3300005844 Bacteria 1202
68 Ga0068862_100584170 3300005844 Bacteria 1070
69 Ga0081455_10000553 3300005937 Bacteria 48602
70 Ga0081455_10021584 3300005937 Bacteria 6036
71 Ga0081455_10252359 3300005937 Bacteria 1289
72 Ga0081455_10984546 3300005937 Bacteria 522
73 Ga0081540_1060731 3300005983 Bacteria 1806
74 Ga0081539_10000412 3300005985 Bacteria 91177
75 Ga0081539_10002962 3300005985 Bacteria 22308
76 Ga0070717_10249288 3300006028 Bacteria 1568
77 Ga0075365_10104210 3300006038 Bacteria 1945
78 Ga0075365_10930555 3300006038 Bacteria 613
79 Ga0075368_10440705 3300006042 Bacteria 576
80 Ga0075364_10547243 3300006051 Bacteria 791
81 Ga0075432_10474177 3300006058 Bacteria 553
82 Ga0070712_100167703 3300006175 Bacteria 1701
83 Ga0070712_100234107 3300006175 Bacteria 1460
84 Ga0075362_10672043 3300006177 Bacteria 539
85 Ga0075369_10066805 3300006186 Bacteria 1578
86 Ga0075428_100103244 3300006844 Bacteria 3109
87 Ga0075431_100649301 3300006847 Bacteria 1036
88 Ga0075429_100227466 3300006880 Bacteria 1634
89 Ga0075429_100430258 3300006880 Bacteria 1156
90 Ga0068865_101170254 3300006881 Bacteria 680
91 Ga0097620_100259504 3300006931 Bacteria 1829
92 Ga0099824_1017053 3300006942 Bacteria 6413
93 Ga0099824_1026543 3300006942 Bacteria 2965
94 Ga0099822_1005508 3300006943 Bacteria 16531
95 Ga0099822_1040047 3300006943 Bacteria 2638
96 Ga0099823_1006666 3300006944 Bacteria 11679
97 Ga0099823_1008537 3300006944 Bacteria 10423
98 Ga0099794_10600897 3300007265 Bacteria 583
99 Ga0099795_10002155 3300007788 Bacteria 4545
100 Ga0099795_10363680 3300007788 Bacteria 650
101 Ga0099795_10557850 3300007788 Bacteria 541
102 Ga0105240_10441959 3300009093 Bacteria 1457
103 Ga0105240_10454237 3300009093 Bacteria 1433
104 Ga0105240_11082509 3300009093 Bacteria 854
105 Ga0105240_11638491 3300009093 Bacteria 673
106 Ga0111539_10636226 3300009094 Bacteria 1242
107 Ga0105247_10261431 3300009101 Bacteria 1187
108 Ga0105247_10490664 3300009101 Bacteria 893
109 Ga0114129_10382564 3300009147 Bacteria 1858
110 Ga0105243_10616584 3300009148 Bacteria 1047
111 Ga0105241_11020926 3300009174 Bacteria 775
112 Ga0105242_12156190 3300009176 Bacteria 602
113 Ga0105248_10514797 3300009177 Bacteria 1349
114 Ga0105237_10001960 3300009545 Bacteria 26199
115 Ga0105237_11128908 3300009545 Bacteria 791
116 Ga0105237_11215390 3300009545 Bacteria 760
117 Ga0105237_11419272 3300009545 Bacteria 701
118 Ga0105238_10007211 3300009551 Bacteria 11128
119 Ga0105238_10009768 3300009551 Bacteria 9609
120 Ga0105249_12491139 3300009553 Bacteria 590
121 Ga0099796_10031166 3300010159 Bacteria 1737
122 Ga0099796_10316587 3300010159 Bacteria 665
123 Ga0099796_10327338 3300010159 Bacteria 655
124 Ga0105239_10000851 3300010375 Bacteria 43464
125 Ga0105239_10216212 3300010375 Bacteria 2149
126 Ga0105239_10751148 3300010375 Bacteria 1116
127 Ga0105239_10911899 3300010375 Bacteria 1009
128 Ga0105239_11558967 3300010375 Bacteria 764
129 Ga0105246_10129507 3300011119 Bacteria 1882
130 Ga0105246_10736472 3300011119 Bacteria 868
131 Ga0105246_10738613 3300011119 Bacteria 867
132 Ga0157373_10333726 3300013100 Bacteria 1080
133 Ga0157370_10357239 3300013104 Bacteria 1346
134 Ga0157370_11923943 3300013104 Bacteria 530
135 Ga0157369_10244210 3300013105 Bacteria 1875
136 Ga0157378_11229318 3300013297 Bacteria 789
137 Ga0157378_13191711 3300013297 Bacteria 509
138 Ga0163162_10257491 3300013306 Bacteria 1877
139 Ga0163162_10305437 3300013306 Bacteria 1723
140 Ga0163162_11851734 3300013306 Bacteria 690
141 Ga0157372_10765329 3300013307 Bacteria 1123
142 Ga0157372_10953985 3300013307 Bacteria 994
143 Ga0157375_10005116 3300013308 Bacteria 11384
144 Ga0157375_13333320 3300013308 Bacteria 535
145 Ga0163163_10000007 3300014325 Bacteria 288439
146 Ga0182008_10085263 3300014497 Bacteria 1556
147 Ga0157379_10477846 3300014968 Bacteria 1153
148 Ga0214544_1006236 3300021320 Bacteria 22202
149 Ga0214544_1010201 3300021320 Bacteria 14017
150 Ga0214544_1034719 3300021320 Bacteria 1397
151 Ga0214542_1006137 3300021321 Bacteria 22200
152 Ga0214542_1021169 3300021321 Bacteria 4560
153 Ga0214542_1029560 3300021321 Bacteria 2229
154 Ga0214542_1037224 3300021321 Bacteria 1397
155 Ga0214545_1005727 3300021324 Bacteria 22200
156 Ga0214543_1005902 3300021327 Bacteria 22184
157 Ga0214543_1015885 3300021327 Bacteria 8132
158 Ga0214543_1024724 3300021327 Bacteria 3640
159 Ga0213872_10111817 3300021361 Bacteria 1213
160 Ga0213874_10030608 3300021377 Bacteria 1552
161 Ga0213876_10013411 3300021384 Bacteria 4353
162 Ga0213875_10007585 3300021388 Bacteria 5594
163 Ga0213875_10016645 3300021388 Bacteria 3563
164 Ga0213875_10081267 3300021388 Bacteria 1512
165 Ga0207425_1000073 3300025245 Bacteria 113233
166 Ga0209677_101722 3300025253 Bacteria 9099
167 Ga0209677_125457 3300025253 Bacteria 639
168 Ga0209148_1000126 3300025254 Bacteria 181590
169 Ga0209148_1001202 3300025254 Bacteria 14746
170 Ga0209129_1000352 3300025258 Bacteria 38789
171 Ga0209233_1000150 3300025261 Bacteria 179401
172 Ga0209233_1016987 3300025261 Bacteria 1992
173 Ga0209455_1000280 3300025272 Bacteria 55431
174 Ga0209455_1025699 3300025272 Bacteria 1066
175 Ga0209025_1000202 3300025294 Bacteria 145750
176 Ga0209758_1000138 3300025297 Bacteria 175187
177 Ga0209758_1000242 3300025297 Bacteria 113233
178 Ga0209758_1000825 3300025297 Bacteria 43413
179 Ga0209758_1002094 3300025297 Bacteria 21207
180 Ga0207426_1001196 3300025302 Bacteria 23050
181 Ga0207688_10011238 3300025901 Bacteria 4871
182 Ga0207688_10232773 3300025901 Bacteria 1112
183 Ga0207680_10000044 3300025903 Bacteria 64236
184 Ga0207680_10056518 3300025903 Bacteria 2370
185 Ga0207647_10147677 3300025904 Bacteria 1375
186 Ga0207647_10255536 3300025904 Bacteria 1004
187 Ga0207647_10394698 3300025904 Bacteria 780
188 Ga0207647_10410330 3300025904 Bacteria 762
189 Ga0207645_10269951 3300025907 Bacteria 1128
190 Ga0207705_10119611 3300025909 Bacteria 1953
191 Ga0207684_10190504 3300025910 Bacteria 1769
192 Ga0207654_11082846 3300025911 Bacteria 584
193 Ga0207695_10211799 3300025913 Bacteria 1848
194 Ga0207695_10283950 3300025913 Bacteria 1549
195 Ga0207695_10331732 3300025913 Bacteria 1410
196 Ga0207695_10335354 3300025913 Bacteria 1400
197 Ga0207671_10000106 3300025914 Bacteria 129102
198 Ga0207693_10489409 3300025915 Bacteria 960
199 Ga0207693_10810526 3300025915 Bacteria 721
200 Ga0207660_11431873 3300025917 Bacteria 559
201 Ga0207662_10220112 3300025918 Bacteria 1236
202 Ga0207657_10000052 3300025919 Bacteria 108384
203 Ga0207657_10741033 3300025919 Bacteria 762
204 Ga0207646_10043207 3300025922 Bacteria 4048
205 Ga0207681_10657165 3300025923 Bacteria 869
206 Ga0207694_10005525 3300025924 Bacteria 9695
207 Ga0207694_10044212 3300025924 Bacteria 3440
208 Ga0207650_10693081 3300025925 Bacteria 860
209 Ga0207659_10309274 3300025926 Bacteria 1301
210 Ga0207664_10473053 3300025929 Bacteria 1120
211 Ga0207690_11149789 3300025932 Bacteria 647
212 Ga0207686_10545233 3300025934 Bacteria 906
213 Ga0207686_11321418 3300025934 Bacteria 592
214 Ga0207670_10500582 3300025936 Bacteria 986
215 Ga0207669_10492310 3300025937 Bacteria 979
216 Ga0207669_10860249 3300025937 Bacteria 755
217 Ga0207711_10481755 3300025941 Bacteria 1156
218 Ga0207689_10049823 3300025942 Bacteria 3455
219 Ga0207661_10003110 3300025944 Bacteria 11487
220 Ga0207661_10433553 3300025944 Bacteria 1195
221 Ga0207667_10429990 3300025949 Bacteria 1343
222 Ga0207667_10685710 3300025949 Bacteria 1028
223 Ga0207667_10746048 3300025949 Bacteria 979
224 Ga0207668_10000141 3300025972 Bacteria 49147
225 Ga0207668_10509811 3300025972 Bacteria 1036
226 Ga0207640_10365282 3300025981 Bacteria 1164
227 Ga0207658_10000703 3300025986 Bacteria 29036
228 Ga0207658_10002689 3300025986 Bacteria 12840
229 Ga0207658_11662465 3300025986 Bacteria 583
230 Ga0207703_10208854 3300026035 Bacteria 1739
231 Ga0207639_10014746 3300026041 Bacteria 5505
232 Ga0207678_10157371 3300026067 Bacteria 1940
233 Ga0207702_10225493 3300026078 Bacteria 1748
234 Ga0207641_10000102 3300026088 Bacteria 122366
235 Ga0207676_10402596 3300026095 Bacteria 1279
236 Ga0207674_11828357 3300026116 Bacteria 574
237 Ga0207675_100010642 3300026118 Bacteria 8619
238 Ga0207698_10416023 3300026142 Bacteria 1289
239 Ga0207698_10701812 3300026142 Bacteria 1007
240 Ga0209389_1000003 3300027296 Bacteria 268927
241 Ga0209389_1000055 3300027296 Bacteria 108798
242 Ga0209389_1000263 3300027296 Bacteria 33281
243 Ga0209389_1000404 3300027296 Bacteria 25712
244 Ga0209389_1005813 3300027296 Bacteria 10594
245 Ga0209589_1000008 3300027357 Bacteria 259970
246 Ga0209589_1000024 3300027357 Bacteria 169886
247 Ga0209589_1003752 3300027357 Bacteria 26510
248 Ga0209489_100123 3300027361 Bacteria 113105
249 Ga0209489_100474 3300027361 Bacteria 75317
250 Ga0209489_102905 3300027361 Bacteria 34209
251 Ga0209489_103245 3300027361 Bacteria 31992
252 Ga0209489_104558 3300027361 Bacteria 25379
253 Ga0209700_100029 3300027363 Bacteria 214607
254 Ga0209700_100046 3300027363 Bacteria 159296
255 Ga0209179_1002531 3300027512 Bacteria 2486
256 Ga0209588_1055409 3300027671 Bacteria 1281
257 Ga0268266_10000989 3300028379 Bacteria 35805
258 Ga0268266_10037067 3300028379 Bacteria 4154
259 Ga0268266_11017250 3300028379 Bacteria 802
260 Ga0268265_10233430 3300028380 Bacteria 1618
261 Ga0265337_1003812 3300028556 Bacteria 6409
262 Ga0265334_10014683 3300028573 Bacteria 3262
263 Ga0265334_10086606 3300028573 Bacteria 1148
264 Ga0265334_10235687 3300028573 Bacteria 631
265 Ga0265336_10082297 3300028666 Bacteria 960
266 Ga0307515_10048747 3300028794 Bacteria 6397
267 Ga0307515_10591461 3300028794 Bacteria 720
268 Ga0265338_10018504 3300028800 Bacteria 7456
269 Ga0265338_10075675 3300028800 Bacteria 2855
270 Ga0265330_10364716 3300031235 Bacteria 610
271 Ga0265332_10171240 3300031238 Bacteria 906
272 Ga0265328_10009339 3300031239 Bacteria 3997
273 Ga0265320_10470912 3300031240 Bacteria 555
274 Ga0265325_10186561 3300031241 Bacteria 963
275 Ga0265325_10186921 3300031241 Bacteria 962
276 Ga0265325_10196001 3300031241 Bacteria 934
277 Ga0265329_10008887 3300031242 Bacteria 3784
278 Ga0265340_10191773 3300031247 Bacteria 921
279 Ga0265339_10002251 3300031249 Bacteria 13948
280 Ga0265339_10012366 3300031249 Bacteria 5214
281 Ga0265339_10050078 3300031249 Bacteria 2285
282 Ga0265339_10126577 3300031249 Bacteria 1309
283 Ga0265331_10001163 3300031250 Bacteria 20063
284 Ga0265327_10303580 3300031251 Bacteria 702
285 Ga0265316_10015583 3300031344 Bacteria 6637
286 Ga0265316_10203112 3300031344 Bacteria 1468
287 Ga0265313_10009740 3300031595 Bacteria 6193
288 Ga0265313_10053628 3300031595 Bacteria 1918
289 Ga0265314_10010467 3300031711 Bacteria 7732
290 Ga0265314_10024861 3300031711 Bacteria 4532
291 Ga0265314_10105927 3300031711 Bacteria 1797
292 Ga0265342_10021504 3300031712 Bacteria 4117
293 Ga0265342_10467673 3300031712 Bacteria 646
294 Ga0265342_10568331 3300031712 Bacteria 574
295 Ga0307409_100962040 3300031995 Bacteria 870
296 Ga0307416_100218133 3300032002 Bacteria 1827
297 Ga0307416_101037419 3300032002 Bacteria 924
298 Ga0307416_103807609 3300032002 Bacteria 505
299 Ga0307414_10164372 3300032004 Bacteria 1767
300 Ga0307414_10398990 3300032004 Bacteria 1194
301 Ga0307414_10650244 3300032004 Bacteria 950
302 Ga0307415_102040736 3300032126 Bacteria 559
303 Ga0307510_10446701 3300033180 Bacteria 734
304 Ga0315911_1000006 3300033442 Bacteria 414563
305 Ga0315911_1000026 3300033442 Bacteria 88844
306 Ga0373936_0043642 3300035113 Bacteria 1803
307 Ga0373936_0074239 3300035113 Bacteria 1407
308 Ga0373936_0206679 3300035113 Bacteria 868
309 Ga0373954_0031430 3300035118 Bacteria 2452
310 Ga0373935_0182472 3300035692 Bacteria 1442
311 Ga0373927_0074351 3300035695 Bacteria 2200
312 Ga0373927_0093766 3300035695 Bacteria 1951
313 Ga0373927_0097680 3300035695 Bacteria 1909
314 Ga0373927_0550939 3300035695 Bacteria 762
315 Ga0373927_1024575 3300035695 Bacteria 544
316 Ga0373933_0248011 3300035724 Bacteria 1146
317 Ga0373947_0653031 3300035725 Bacteria 717
318 Ga0373947_0697673 3300035725 Bacteria 692
319 Ga0373937_0062495 3300036401 Bacteria 3424
320 Ga0373925_0565612 3300037068 Bacteria 935
321 Ga0373925_1128605 3300037068 Bacteria 645
322 Ga0395899_0370824 3300037312 Bacteria 953
323 Ga0395899_0497615 3300037312 Bacteria 791
324 Ga0395900_0002291 3300037418 Bacteria 21262
325 Ga0395900_0184311 3300037418 Bacteria 2119
326 Ga0395900_0506319 3300037418 Bacteria 1157
327 Ga0395898_0019531 3300037466 Bacteria 6895
328 Ga0395898_0292056 3300037466 Bacteria 1555
329 Ga0395905_0003413 3300037471 Bacteria 16995
330 Ga0395905_0535534 3300037471 Bacteria 1072
331 Ga0395905_0772097 3300037471 Bacteria 864
332 Ga0395905_0796729 3300037471 Bacteria 848
333 Ga0436364_0117958 3300037853 Unclassified 814
334 Ga0436364_0167314 3300037853 Bacteria 105007
335 Ga0436364_0226891 3300037853 Bacteria 40228
336 Ga0436364_0494866 3300037853 Bacteria 1106
337 Ga0436364_0543304 3300037853 Bacteria 2326
338 Ga0436364_0749918 3300037853 Bacteria 963
339 Ga0436364_0793320 3300037853 Bacteria 621
340 Ga0436364_1440006 3300037853 Bacteria 636
341 Ga0395901_0065231 3300038443 Bacteria 3791
342 Ga0395901_0160060 3300038443 Bacteria 2365
343 Ga0395901_0173114 3300038443 Bacteria 2265
344 Ga0395901_0186637 3300038443 Bacteria 2174
345 Ga0395901_0619233 3300038443 Bacteria 1089
346 Ga0395901_1110613 3300038443 Bacteria 761
347 Ga0395901_1522481 3300038443 Bacteria 624
348 Ga0436365_0623764 3300039437 Bacteria 1827
349 Ga0436365_1174990 3300039437 Bacteria 1553
350 Ga0436365_1331505 3300039437 Bacteria 622
351 Ga0436365_1547453 3300039437 Bacteria 851
352 Ga0436365_1665747 3300039437 Bacteria 1814
353 Ga0436365_1860902 3300039437 Bacteria 507
354 Ga0436365_1876159 3300039437 Bacteria 1032
355 Ga0436360_0251747 3300039438 Bacteria 664
356 Ga0436360_0575218 3300039438 Bacteria 859
357 Ga0436360_0776894 3300039438 Bacteria 537
358 Ga0436360_0797411 3300039438 Bacteria 920
359 Ga0436360_0859224 3300039438 Bacteria 760
360 Ga0436360_1077870 3300039438 Unclassified 715
361 Ga0436360_1246931 3300039438 Bacteria 1193
362 Ga0436360_1247036 3300039438 Bacteria 2658
363 Ga0436361_0065056 3300039447 Bacteria 517
364 Ga0436361_0115207 3300039447 Bacteria 727
365 Ga0436361_0185942 3300039447 Bacteria 1162
366 Ga0436361_0224260 3300039447 Bacteria 4624
367 Ga0436361_0289583 3300039447 Bacteria 3382
368 Ga0436361_0456415 3300039447 Bacteria 1668
369 Ga0436361_0778911 3300039447 Bacteria 1080
370 Ga0436361_0820693 3300039447 Bacteria 506
371 Ga0436361_1081026 3300039447 Bacteria 565
372 Ga0436363_0283155 3300039450 Bacteria 1931
373 Ga0436363_0469747 3300039450 Bacteria 1128
374 Ga0436363_0590522 3300039450 Bacteria 897
375 Ga0436363_0832663 3300039450 Bacteria 539
376 Ga0436363_0865732 3300039450 Bacteria 1864
377 Ga0436363_0950379 3300039450 Bacteria 3933
378 Ga0436363_0992069 3300039450 Bacteria 687
379 Ga0436363_1098882 3300039450 Bacteria 1854
380 Ga0439438_025844 3300041405 Bacteria 1596
381 Ga0439447_028871 3300041407 Bacteria 1407
382 Ga0451791_1597435 3300041451 Bacteria 867
383 Ga0451802_0643512 3300041460 Bacteria 607
384 Ga0451837_0898365 3300041494 Bacteria 2450
385 Ga0451845_0978265 3300041501 Bacteria 650
386 Ga0451847_0700671 3300041503 Bacteria 500
387 Ga0451855_0984920 3300041511 Bacteria 70555
388 Ga0451853_0961848 3300041512 Bacteria 693
389 Ga0451853_3701895 3300041512 Bacteria 631
390 Ga0439448_0289099 3300042005 Bacteria 581
391 Ga0439434_0032895 3300042435 Bacteria 1579
392 Ga0466969_0419942 3300044656 Bacteria 608
393 Ga0466969_0462719 3300044656 Bacteria 577
394 Ga0466966_0001036 3300044684 Bacteria 17796
395 Ga0466966_0001850 3300044684 Bacteria 13717
396 Ga0466961_0000004 3300044693 Bacteria 175855
397 Ga0466961_0136286 3300044693 Bacteria 1538
398 Ga0466961_0282653 3300044693 Bacteria 1015
399 Ga0466963_0045911 3300044694 Bacteria 2879
400 Ga0466960_0568302 3300044901 Bacteria 670
401 Ga0451576_0002567 3300045051 Bacteria 26795
402 Ga0451576_1151414 3300045051 Bacteria 811
403 Ga0466958_1166610 3300045836 Bacteria 503
404 Ga0466967_1145459 3300045976 Bacteria 775
405 Ga0495603_0505824 3300046455 Bacteria 692
406 Ga0495629_0500025 3300046459 Bacteria 820
407 Ga0495638_0108565 3300046460 Bacteria 1651
408 Ga0495651_0837574 3300046462 Bacteria 566
409 Ga0495653_0923002 3300046463 Bacteria 519
410 Ga0495664_0316564 3300046477 Bacteria 941
411 Ga0495664_0431967 3300046477 Bacteria 789
412 Ga0495584_0321807 3300046491 Bacteria 785
413 Ga0495606_0305319 3300046507 Bacteria 861
414 Ga0495606_0669266 3300046507 Bacteria 500
415 Ga0495632_0000023 3300046519 Bacteria 180933
416 Ga0495643_0238648 3300046522 Bacteria 854
417 Ga0495648_0009994 3300046524 Bacteria 7278
418 Ga0495648_0055254 3300046524 Bacteria 2394
419 Ga0495663_0000059 3300046525 Bacteria 51157
420 Ga0495652_0091821 3300046529 Bacteria 2481
421 Ga0495654_0378927 3300046530 Bacteria 565
422 Ga0495640_0108583 3300046533 Bacteria 1815
423 Ga0495622_0139512 3300046557 Bacteria 1101
424 Ga0495633_0003846 3300046558 Bacteria 9814
425 Ga0495633_0007824 3300046558 Bacteria 6101
426 Ga0495625_0458757 3300046660 Bacteria 786
427 Ga0495669_0471668 3300046684 Bacteria 610
428 Ga0495671_0015899 3300046692 Bacteria 4027
429 Ga0495649_0351381 3300046694 Bacteria 745
430 Ga0495604_0590913 3300047317 Bacteria 713
431 Ga0495674_0570706 3300047319 Bacteria 899
432 Ga0495674_0878913 3300047319 Bacteria 693
433 Ga0495672_0000160 3300047320 Bacteria 98077
434 Ga0495672_0095259 3300047320 Bacteria 1626
435 Ga0495672_0162682 3300047320 Bacteria 1145
436 Ga0495672_0314138 3300047320 Bacteria 738
437 Ga0495676_0354450 3300047321 Bacteria 980
438 Ga0495676_0368815 3300047321 Bacteria 957
439 Ga0495673_0014778 3300047469 Bacteria 4049
440 Ga0495673_0181500 3300047469 Bacteria 797
441 Ga0495686_0330915 3300047472 Bacteria 832
442 Ga0495686_0442986 3300047472 Bacteria 691
443 Ga0495593_0209360 3300047673 Bacteria 979
444 Ga0495602_0242960 3300048088 Bacteria 1346
445 Ga0496100_0757863 3300048903 Bacteria 759
446 Ga0496100_1414261 3300048903 Bacteria 549
447 Ga0496101_0937427 3300048904 Bacteria 681
448 Ga0496102_0262378 3300048905 Bacteria 1629
449 Ga0496103_0889972 3300048906 Bacteria 558
450 Ga0496104_0000255 3300048907 Bacteria 47426
451 Ga0496104_0055706 3300048907 Bacteria 3739
452 Ga0496104_0086120 3300048907 Bacteria 3000
453 Ga0496104_0164093 3300048907 Bacteria 2130
454 Ga0496104_0471618 3300048907 Bacteria 1167
455 Ga0496105_0000078 3300048908 Bacteria 74087
456 Ga0496105_0211950 3300048908 Bacteria 1579
457 Ga0496105_0226167 3300048908 Bacteria 1522
458 Ga0496105_0490527 3300048908 Bacteria 965
459 Ga0496106_0246673 3300048909 Bacteria 1427
460 Ga0496106_1370034 3300048909 Bacteria 547
461 Ga0496107_0052424 3300048910 Bacteria 2943
462 Ga0496107_0610407 3300048910 Bacteria 806
463 Ga0496107_1106293 3300048910 Bacteria 572
464 Ga0496110_0269347 3300048913 Bacteria 1551
465 Ga0496111_1156004 3300048914 Bacteria 550
466 Ga0496112_0603030 3300048915 Bacteria 1030
467 Ga0496112_1663298 3300048915 Bacteria 551
468 Ga0496113_0425242 3300048916 Bacteria 1067
469 Ga0496113_0465982 3300048916 Bacteria 1015
470 Ga0496113_1107659 3300048916 Bacteria 621
471 Ga0496114_0433386 3300048917 Bacteria 1164
472 Ga0496115_0253250 3300048918 Bacteria 1449
473 Ga0496115_1106464 3300048918 Bacteria 600
474 Ga0496116_0030535 3300048919 Bacteria 3869
475 Ga0496116_0153683 3300048919 Bacteria 1274
476 Ga0496117_0000405 3300048920 Bacteria 72837
477 Ga0496117_0001136 3300048920 Bacteria 40156
478 Ga0496117_0015195 3300048920 Bacteria 6584
479 Ga0496117_0561311 3300048920 Bacteria 541
480 Ga0496118_0000402 3300048921 Bacteria 73078
481 Ga0496118_0002991 3300048921 Bacteria 21861
482 Ga0496118_0003441 3300048921 Bacteria 19922
483 Ga0496119_0022321 3300048922 Bacteria 4536
484 Ga0496119_0038153 3300048922 Bacteria 3109
485 Ga0496119_0049885 3300048922 Bacteria 2584
486 Ga0496119_0145636 3300048922 Bacteria 1275
487 Ga0496120_0051428 3300048923 Bacteria 2353
488 Ga0496120_0091820 3300048923 Bacteria 1620
489 Ga0496120_0245596 3300048923 Bacteria 843
490 Ga0496121_0009861 3300048924 Bacteria 10897
491 Ga0496121_0089649 3300048924 Bacteria 2407
492 Ga0496121_0148849 3300048924 Bacteria 1726
493 Ga0496121_0220649 3300048924 Bacteria 1335
494 Ga0496121_0422852 3300048924 Bacteria 866
495 Ga0496121_0560154 3300048924 Bacteria 713
496 Ga0496121_0600945 3300048924 Bacteria 679
497 Ga0496121_0702466 3300048924 Bacteria 608
498 Ga0496122_0000921 3300048925 Bacteria 53852
499 Ga0496122_0029876 3300048925 Bacteria 4583
500 Ga0496123_0001350 3300048926 Bacteria 34582
501 Ga0496123_0513572 3300048926 Bacteria 521
502 Ga0496125_0066170 3300048928 Bacteria 2858
503 Ga0496126_0000296 3300048929 Bacteria 106143
504 Ga0496126_0043240 3300048929 Bacteria 4156
505 Ga0496126_0117776 3300048929 Bacteria 2307
506 Ga0496126_0326282 3300048929 Bacteria 1261
507 Ga0496126_0537753 3300048929 Bacteria 929
508 Ga0496126_1140000 3300048929 Bacteria 577
509 Ga0495682_0368803 3300049460 Bacteria 506
510 Ga0501031_0000005 3300049568 Bacteria 183960
511 Ga0501031_0000157 3300049568 Bacteria 38675
512 Ga0501031_0000803 3300049568 Bacteria 18908
513 Ga0501031_0103161 3300049568 Bacteria 1861
514 Ga0501032_0000069 3300049569 Bacteria 86501
515 Ga0501032_0000337 3300049569 Bacteria 39238
516 Ga0501032_0000772 3300049569 Bacteria 25963
517 Ga0501032_0001324 3300049569 Bacteria 19785
518 Ga0501032_0001526 3300049569 Bacteria 18457
519 Ga0501032_0007316 3300049569 Bacteria 8075
520 Ga0501032_0112590 3300049569 Bacteria 1800
521 Ga0501032_0168350 3300049569 Bacteria 1437
522 Ga0501032_0208243 3300049569 Bacteria 1275
523 Ga0501032_0433984 3300049569 Bacteria 842
524 Ga0501033_0000062 3300049570 Bacteria 102791
525 Ga0501033_0000129 3300049570 Bacteria 73102
526 Ga0501033_0000170 3300049570 Bacteria 62524
527 Ga0501033_0000175 3300049570 Bacteria 60845
528 Ga0501033_0000663 3300049570 Bacteria 31796
529 Ga0501033_0020512 3300049570 Bacteria 4994
530 Ga0501033_0155430 3300049570 Bacteria 1648
531 Ga0501033_0288899 3300049570 Bacteria 1156
532 Ga0501033_0308486 3300049570 Bacteria 1113
533 Ga0501034_0000494 3300049571 Bacteria 64049
534 Ga0501034_0000612 3300049571 Bacteria 56135
535 Ga0501034_0001942 3300049571 Bacteria 26190
536 Ga0501034_0002799 3300049571 Bacteria 20395
537 Ga0501034_0005998 3300049571 Bacteria 13142
538 Ga0501034_0039402 3300049571 Bacteria 4787
539 Ga0501034_0041000 3300049571 Bacteria 4684
540 Ga0501034_0404161 3300049571 Bacteria 1288
541 Ga0501036_0000014 3300049572 Bacteria 148705
542 Ga0501036_0000079 3300049572 Bacteria 60047
543 Ga0501036_0000086 3300049572 Bacteria 58349
544 Ga0501036_0000367 3300049572 Bacteria 31733
545 Ga0501036_0855613 3300049572 Bacteria 747
546 Ga0501037_0000042 3300049573 Bacteria 118407
547 Ga0501037_0000087 3300049573 Bacteria 85372
548 Ga0501037_0001088 3300049573 Bacteria 20159
549 Ga0501037_0004449 3300049573 Bacteria 10179
550 Ga0501037_0004889 3300049573 Bacteria 9746
551 Ga0501037_0029061 3300049573 Bacteria 4083
552 Ga0501038_0000024 3300049574 Bacteria 148705
553 Ga0501038_0000067 3300049574 Bacteria 85978
554 Ga0501038_0000095 3300049574 Bacteria 74178
555 Ga0501038_0000157 3300049574 Bacteria 58169
556 Ga0501038_0000284 3300049574 Bacteria 43096
557 Ga0501038_0168268 3300049574 Bacteria 1776
558 Ga0501038_0241953 3300049574 Bacteria 1432
559 Ga0501038_0467044 3300049574 Bacteria 969
560 Ga0501039_0000059 3300049575 Bacteria 85852
561 Ga0501039_0000122 3300049575 Bacteria 53871
562 Ga0501039_0002627 3300049575 Bacteria 13413
563 Ga0501039_0005126 3300049575 Bacteria 9927
564 Ga0501039_0145994 3300049575 Bacteria 1859
565 Ga0501039_0343248 3300049575 Bacteria 1173
566 Ga0501040_0004151 3300049576 Bacteria 9428
567 Ga0501040_0144228 3300049576 Bacteria 1678
568 Ga0501040_1168246 3300049576 Bacteria 558
569 Ga0501041_0588314 3300049577 Bacteria 710
570 Ga0501041_0695230 3300049577 Bacteria 651
571 Ga0501042_0017225 3300049578 Bacteria 4980
572 Ga0501042_0037725 3300049578 Bacteria 3430
573 Ga0501043_0000178 3300049579 Bacteria 56959
574 Ga0501043_0000289 3300049579 Bacteria 45306
575 Ga0501043_0000925 3300049579 Bacteria 26012
576 Ga0501043_0001213 3300049579 Bacteria 22701
577 Ga0501043_0170211 3300049579 Bacteria 1699
578 Ga0501043_0417172 3300049579 Bacteria 1012
579 Ga0501046_0000260 3300049580 Bacteria 53763
580 Ga0501046_0008310 3300049580 Bacteria 9057
581 Ga0501046_0014331 3300049580 Bacteria 6694
582 Ga0501046_0028877 3300049580 Bacteria 4513
583 Ga0501046_0080485 3300049580 Bacteria 2517
584 Ga0501046_0119988 3300049580 Bacteria 2001
585 Ga0501046_1085899 3300049580 Bacteria 553
586 Ga0501047_0000146 3300049581 Bacteria 85790
587 Ga0501047_0001569 3300049581 Bacteria 22336
588 Ga0501047_0002832 3300049581 Bacteria 16443
589 Ga0501047_0006906 3300049581 Bacteria 10663
590 Ga0501047_0037975 3300049581 Bacteria 4658
591 Ga0501047_0084365 3300049581 Bacteria 3053
592 Ga0501047_0285115 3300049581 Bacteria 1496
593 Ga0501047_0301892 3300049581 Bacteria 1443
594 Ga0501048_0000034 3300049582 Bacteria 64683
595 Ga0501048_0000722 3300049582 Bacteria 24211
596 Ga0501048_0068470 3300049582 Bacteria 2507
597 Ga0501048_0565409 3300049582 Bacteria 816
598 Ga0501067_0000594 3300049583 Bacteria 19485
599 Ga0501067_0003934 3300049583 Bacteria 8202
600 Ga0501068_0000552 3300049584 Bacteria 19000
601 Ga0501068_0003289 3300049584 Bacteria 8662
602 Ga0501068_0726980 3300049584 Bacteria 649
603 Ga0501069_0000046 3300049585 Bacteria 74811
604 Ga0501069_0000318 3300049585 Bacteria 21973
605 Ga0501070_0000073 3300049586 Bacteria 85801
606 Ga0501070_0002481 3300049586 Bacteria 16173
607 Ga0501070_0003509 3300049586 Bacteria 13567
608 Ga0501070_0034036 3300049586 Bacteria 4262
609 Ga0501070_0050594 3300049586 Bacteria 3449
610 Ga0501070_0148156 3300049586 Bacteria 1937
611 Ga0501070_0160607 3300049586 Bacteria 1853
612 Ga0501070_0656183 3300049586 Bacteria 833
613 Ga0501070_1052303 3300049586 Bacteria 629
614 Ga0501070_1116270 3300049586 Bacteria 608
615 Ga0501070_1165427 3300049586 Bacteria 592
616 Ga0501070_1452347 3300049586 Bacteria 520
617 Ga0501070_1483054 3300049586 Bacteria 514
618 Ga0501071_0000441 3300049587 Bacteria 20869
619 Ga0501071_0018761 3300049587 Bacteria 4795
620 Ga0501072_0000658 3300049588 Bacteria 24912
621 Ga0501072_0004362 3300049588 Bacteria 10735
622 Ga0501072_0944866 3300049588 Bacteria 673
623 Ga0501073_0000239 3300049589 Bacteria 36296
624 Ga0501073_0000323 3300049589 Bacteria 32000
625 Ga0501073_0129600 3300049589 Bacteria 1748
626 Ga0501073_1178992 3300049589 Bacteria 526
627 Ga0501074_0000025 3300049590 Bacteria 68500
628 Ga0501074_0000093 3300049590 Bacteria 42750
629 Ga0501074_0212978 3300049590 Bacteria 1376
630 Ga0501074_0934344 3300049590 Bacteria 610
631 Ga0501075_0718076 3300049591 Bacteria 761
632 Ga0501076_0156590 3300049592 Bacteria 1855
633 Ga0501076_0494943 3300049592 Bacteria 1008
634 Ga0501077_0051655 3300049593 Bacteria 2612
635 Ga0501079_0000862 3300049741 Bacteria 20762
636 Ga0501079_0001388 3300049741 Bacteria 17070
637 Ga0501079_0542036 3300049741 Bacteria 915
638 Ga0501080_0000037 3300049742 Bacteria 82435
639 Ga0501080_0000635 3300049742 Bacteria 27889
640 Ga0501080_0050016 3300049742 Bacteria 3891
641 Ga0501080_0345173 3300049742 Bacteria 1345
642 Ga0501080_0362973 3300049742 Bacteria 1307
643 Ga0501080_0544921 3300049742 Bacteria 1034
644 Ga0501080_1510352 3300049742 Bacteria 571
645 Ga0501083_0000350 3300049744 Bacteria 29150
646 Ga0501083_0004275 3300049744 Bacteria 10051
647 Ga0501083_1075206 3300049744 Bacteria 524
648 Ga0501035_0000045 3300049822 Bacteria 148705
649 Ga0501035_0000141 3300049822 Bacteria 87831
650 Ga0501035_0000172 3300049822 Bacteria 79203
651 Ga0501035_0002255 3300049822 Bacteria 19067
652 Ga0501035_0003323 3300049822 Bacteria 15404
653 Ga0501035_0248701 3300049822 Bacteria 1510
654 Ga0501035_0269648 3300049822 Bacteria 1441
655 Ga0501035_0370745 3300049822 Bacteria 1195
656 Ga0501035_1221369 3300049822 Bacteria 582
657 Ga0501044_0000044 3300049823 Bacteria 148705
658 Ga0501044_0000151 3300049823 Bacteria 85867
659 Ga0501044_0001408 3300049823 Bacteria 28203
660 Ga0501044_0006037 3300049823 Bacteria 13370
661 Ga0501044_0016838 3300049823 Bacteria 7842
662 Ga0501044_0046475 3300049823 Bacteria 4494
663 Ga0501044_0133777 3300049823 Bacteria 2472
664 Ga0501044_0162676 3300049823 Bacteria 2207
665 Ga0501044_0319675 3300049823 Bacteria 1477
666 Ga0501044_0385583 3300049823 Bacteria 1316
667 Ga0501044_0800658 3300049823 Bacteria 822
668 Ga0501045_0000540 3300049824 Bacteria 23669
669 Ga0501045_0033573 3300049824 Bacteria 3721
670 Ga0501045_0376772 3300049824 Bacteria 1056
671 nmdc:mga03n38_13425_c1 3300050490 Bacteria 3111
672 nmdc:mga00v17_36982_c1 3300050491 Bacteria 2912
673 nmdc:mga0yw44_293469_c1 3300050492 Bacteria 1088
674 nmdc:mga0yw44_364359_c1 3300050492 Bacteria 974
675 nmdc:mga0yw44_405537_c1 3300050492 Bacteria 922
676 nmdc:mga0yw44_446_c1 3300050492 Bacteria 14563
677 nmdc:mga0yw44_59982_c1 3300050492 Bacteria 2329
678 nmdc:mga06z11_5260_c2 3300050494 Bacteria 2482
679 nmdc:mga07m45_278897_c1 3300050496 Bacteria 638
680 nmdc:mga05p37_1942916_c1 3300050507 Bacteria 560
681 nmdc:mga0n895_821034_c1 3300050512 Bacteria 919
682 nmdc:mga0n895_838897_c1 3300050512 Bacteria 907
683 nmdc:mga0rr50_474993_c1 3300050513 Bacteria 1061
684 nmdc:mga0sz30_248264_c1 3300050516 Bacteria 792
685 Ga0495612_0227018 3300053078 Bacteria 828
686 Ga0500610_0272263 3300053079 Bacteria 765
687 Ga0500572_087132 3300053111 Bacteria 985
688 Ga0500607_206381 3300053121 Bacteria 837
689 Ga0500608_369581 3300053122 Bacteria 500
690 Ga0500559_0016276 3300053136 Bacteria 3140
691 Ga0500559_0064957 3300053136 Bacteria 1634
692 Ga0500590_098151 3300053148 Bacteria 1411
693 Ga0500590_140551 3300053148 Bacteria 1104
694 Ga0500627_0000048 3300053158 Bacteria 58964
695 Ga0500627_0310374 3300053158 Bacteria 687
696 Ga0500630_146903 3300053159 Bacteria 1005
697 Ga0500639_000710 3300053163 Bacteria 16832
698 Ga0500639_342776 3300053163 Bacteria 534
699 Ga0500636_0017863 3300053177 Bacteria 4192
700 Ga0501084_0002854 3300054114 Bacteria 13967
701 Ga0501084_0024934 3300054114 Bacteria 4990
702 Ga0501082_0000355 3300060353 Bacteria 40463
703 Ga0501082_0004972 3300060353 Bacteria 11605
704 Ga0501082_0574454 3300060353 Bacteria 986
705 Ga0501082_0619322 3300060353 Bacteria 947
706 Ga0530510_0471544 3300061734 Bacteria 950
707 Ga0530510_1454721 3300061734 Bacteria 526
708 Ga0530510_1493614 3300061734 Bacteria 519

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007788 Ga0099795_10363680 Ga0099795_103636801 77
2 3300010159 Ga0099796_10316587 Ga0099796_103165871 77
3 3300006051 Ga0075364_10547243 Ga0075364_105472432 78
4 3300006844 Ga0075428_100103244 Ga0075428_1001032442 79
5 3300006880 Ga0075429_100430258 Ga0075429_1004302583 79
6 3300027671 Ga0209588_1055409 Ga0209588_10554092 79
7 3300041405 Ga0439438_025844 Ga0439438_025844_558_830 79
8 3300041407 Ga0439447_028871 Ga0439447_028871_805_1077 79
9 3300042435 Ga0439434_0032895 Ga0439434_0032895_928_1200 79
10 3300049569 Ga0501032_0007316 Ga0501032_0007316_5240_5512 79
11 3300049573 Ga0501037_0029061 Ga0501037_0029061_3271_3543 79
12 3300046692 Ga0495671_0015899 Ga0495671_0015899_228_500 80
13 3300047469 Ga0495673_0014778 Ga0495673_0014778_3586_3858 80
14 3300031712 Ga0265342_10568331 Ga0265342_105683312 82
15 3300049570 Ga0501033_0020512 Ga0501033_0020512_2513_2782 82
16 3300049574 Ga0501038_0467044 Ga0501038_0467044_10_279 82
17 3300041503 Ga0451847_0700671 Ga0451847_0700671_66_377 83
18 iso_pu_bacteria 2507262055 2507510378 83
19 iso_pu_bacteria 2508501042 2508693131 83
20 iso_pu_bacteria 2513237090 2513613739 83
21 iso_pu_bacteria 2513237094 2513639883 83
22 iso_pu_bacteria 2513237094 2513641203 83
23 iso_pu_bacteria 2513237098 2513678672 83
24 iso_pu_bacteria 2513237137 2513863451 83
25 iso_pu_bacteria 2513237161 2514013784 83
26 iso_pu_bacteria 2513237161 2514014842 83
27 iso_pu_bacteria 2515154112 2515628599 83
28 iso_pu_bacteria 2517572143 2517890874 83
29 iso_pu_bacteria 2517572143 2517894309 83
30 iso_pu_bacteria 2528768022 2528855998 83
31 iso_pu_bacteria 2617270735 2617350391 83
32 iso_pu_bacteria 2617270741 2617379372 83
33 iso_pu_bacteria 2643221683 2644464671 83
34 iso_pu_bacteria 2728368998 2728753564 83
35 iso_pu_bacteria 2744054633 2745079409 83
36 iso_pu_bacteria 2791355197 2793066202 83
37 iso_pu_bacteria 2824600985 2824601460 83
38 iso_pu_bacteria 2824609381 2824613243 83
39 iso_pu_bacteria 2824617872 2824619954 83
40 iso_pu_bacteria 2824626560 2824628702 83
41 iso_pu_bacteria 2824635225 2824636512 83
42 iso_pu_bacteria 2824644064 2824645795 83
43 iso_pu_bacteria 2824653114 2824656520 83
44 iso_pu_bacteria 2824661429 2824664210 83
45 iso_pu_bacteria 2824671348 2824673116 83
46 iso_pu_bacteria 2824679649 2824680557 83
47 iso_pu_bacteria 2824687955 2824689836 83
48 iso_pu_bacteria 2824696289 2824698097 83
49 iso_pu_bacteria 2824704595 2824712282 83
50 iso_pu_bacteria 2824714736 2824716107 83
51 iso_pu_bacteria 2824723954 2824725833 83
52 iso_pu_bacteria 2824746037 2824746182 83
53 iso_pu_bacteria 2824773399 2824778752 83
54 iso_pu_bacteria 2838122688 2838128084 83
55 iso_pu_bacteria 2838122688 2838130575 83
56 iso_pu_bacteria 2841941048 2841947520 83
57 iso_pu_bacteria 2841949485 2841953749 83
58 iso_pu_bacteria 2841957949 2841959009 83
59 iso_pu_bacteria 2841957949 2841961757 83
60 iso_pu_bacteria 2841966195 2841971547 83
61 iso_pu_bacteria 2841974524 2841981073 83
62 iso_pu_bacteria 2841983080 2841986732 83
63 iso_pu_bacteria 2847939898 2847941003 83
64 iso_pu_bacteria 2856328259 2856330721 83
65 iso_pu_bacteria 2856334872 2856335373 83
66 iso_pu_bacteria 2869271264 2869275947 83
67 iso_pu_bacteria 2874123672 2874125402 83
68 iso_pu_bacteria 2874612657 2874619922 83
69 iso_pu_bacteria 2874620515 2874623660 83
70 iso_pu_bacteria 2874628541 2874635690 83
71 iso_pu_bacteria 2874645413 2874646464 83
72 iso_pu_bacteria 2876399893 2876400193 83
73 iso_pu_bacteria 2879083081 2879085088 83
74 iso_pu_bacteria 2879083081 2879090891 83
75 iso_pu_bacteria 2881665667 2881671424 83
76 iso_pu_bacteria 2885366525 2885374278 83
77 iso_pu_bacteria 2885409591 2885417903 83
78 iso_pu_bacteria 2889016732 2889020853 83
79 iso_pu_bacteria 2903748898 2903752418 83
80 iso_pu_bacteria 2903768456 2903771959 83
81 iso_pu_bacteria 2904666416 2904670471 83
82 iso_pu_bacteria 2904690495 2904694113 83
83 iso_pu_bacteria 2906626472 2906633863 83
84 iso_pu_bacteria 2906635258 2906638275 83
85 iso_pu_bacteria 2906635258 2906641297 83
86 iso_pu_bacteria 2906643746 2906644657 83
87 iso_pu_bacteria 2906643746 2906649567 83
88 iso_pu_bacteria 2908756301 2908764527 83
89 iso_pu_bacteria 2908775508 2908781909 83
90 iso_pu_bacteria 2922368715 2922377825 83
91 iso_pu_bacteria 2922393267 2922399056 83
92 iso_pu_bacteria 2924762789 2924766330 83
93 iso_pu_bacteria 2932784394 2932792111 83
94 iso_pu_bacteria 2932809354 2932814523 83
95 iso_pu_bacteria 2935616580 2935623363 83
96 iso_pu_bacteria 2935630451 2935637298 83
97 iso_pu_bacteria 2935638405 2935646634 83
98 iso_pu_bacteria 2935648319 2935652498 83
99 iso_pu_bacteria 2935656913 2935661080 83
100 iso_pu_bacteria 2935732158 2935733541 83
101 iso_pu_bacteria 2935741537 2935742920 83
102 iso_pu_bacteria 2935760218 2935764832 83
103 iso_pu_bacteria 2935827899 2935835900 83
104 iso_pu_bacteria 2935855204 2935861637 83
105 iso_pu_bacteria 2935883170 2935887849 83
106 iso_pu_bacteria 2935975950 2935979742 83
107 iso_pu_bacteria 2935984226 2935988885 83
108 iso_pu_bacteria 2936011229 2936015137 83
109 iso_pu_bacteria 2936019824 2936023282 83
110 iso_pu_bacteria 2936028420 2936032265 83
111 iso_pu_bacteria 2936046547 2936050126 83
112 iso_pu_bacteria 2936055302 2936061772 83
113 iso_pu_bacteria 2937836603 2937838650 83
114 iso_pu_bacteria 2941507105 2941513969 83
115 iso_pu_bacteria 2941515067 2941521930 83
116 iso_pu_bacteria 2941523033 2941529599 83
117 iso_pu_bacteria 2941531003 2941538359 83
118 iso_pu_bacteria 2958122699 2958124763 83
119 iso_pu_bacteria 2961064222 2961068359 83
120 iso_pu_bacteria 2961136820 2961140438 83
121 iso_pu_bacteria 2965025482 2965028474 83
122 iso_pu_bacteria 2965032056 2965038446 83
123 iso_pu_bacteria 2965102966 2965104971 83
124 iso_pu_bacteria 2965119406 2965121658 83
125 iso_pu_bacteria 2970547951 2970554903 83
126 iso_pu_bacteria 2977872689 2977879421 83
127 iso_pu_bacteria 2977957713 2977962267 83
128 iso_pu_bacteria 2987666974 2987672181 83
129 iso_pu_bacteria 3004239961 3004241399 83
130 iso_pu_bacteria 3005474847 3005477859 83
131 iso_pu_bacteria 3005474847 3005481914 83
132 iso_pu_bacteria 3005474847 3005483064 83
133 iso_pu_bacteria 3005587118 3005589152 83
134 iso_pu_bacteria 8016511872 8016515650 83
135 iso_pu_bacteria 8016583857 8016590369 83
136 iso_pu_bacteria 8016630954 8016633301 83
137 iso_pu_bacteria 8017057580 8017060845 83
138 iso_pu_bacteria 8019586578 8019594594 83
139 iso_pu_bacteria 8019619141 8019626095 83
140 iso_pu_bacteria 8019629233 8019636391 83
141 iso_pu_bacteria 8019648815 8019658704 83
142 iso_pu_bacteria 8019659431 8019664170 83
143 iso_pu_bacteria 8019668869 8019673765 83
144 iso_pu_bacteria 8019678201 8019682354 83
145 iso_pu_bacteria 8056967851 8056974230 83
146 3300005445 Ga0070708_100000110 Ga0070708_10000011017 84
147 3300013307 Ga0157372_10765329 Ga0157372_107653292 84
148 3300049580 Ga0501046_0080485 Ga0501046_0080485_288_542 84
149 3300049589 Ga0501073_1178992 Ga0501073_1178992_168_422 84
150 3300049742 Ga0501080_0345173 Ga0501080_0345173_326_580 84
151 iso_pu_bacteria 2880518877 2880521113 84
152 iso_pu_bacteria 2928115317 2928118117 84
153 iso_pu_bacteria 641228493 641334980 84
154 iso_pu_bacteria 643348555 643390533 84
155 3300049586 Ga0501070_1483054 Ga0501070_1483054_35_304 85
156 iso_pu_bacteria 2643221683 2644468644 85
157 iso_pu_bacteria 2643221713 2644619811 85
158 iso_pu_bacteria 2728369097 2729147703 85
159 iso_pu_bacteria 2818991435 2819536227 85
160 iso_pu_bacteria 2854601825 2854602876 85
161 iso_pu_bacteria 8011350971 8011352409 85
162 3300005718 Ga0068866_10735332 Ga0068866_107353322 86
163 3300009176 Ga0105242_12156190 Ga0105242_121561902 86
164 3300025934 Ga0207686_11321418 Ga0207686_113214181 86
165 3300025937 Ga0207669_10860249 Ga0207669_108602492 86
166 3300046529 Ga0495652_0091821 Ga0495652_0091821_1298_1567 86
167 3300048088 Ga0495602_0242960 Ga0495602_0242960_44_313 86
168 3300049581 Ga0501047_0285115 Ga0501047_0285115_870_1136 86
169 3300049592 Ga0501076_0156590 Ga0501076_0156590_1061_1333 86
170 3300049742 Ga0501080_1510352 Ga0501080_1510352_190_462 86
171 3300061734 Ga0530510_1493614 Ga0530510_1493614_182_454 86
172 iso_pu_bacteria 2503198000 2503200870 86
173 iso_pu_bacteria 2599185226 2599671616 86
174 iso_pu_bacteria 2599185227 2599681371 86
175 iso_pu_bacteria 2599185229 2599693226 86
176 iso_pu_bacteria 2600255389 2602010874 86
177 iso_pu_bacteria 2937843397 2937843861 86
178 iso_pu_bacteria 641228493 641334097 86
179 iso_pu_bacteria 651053060 651176321 86
180 3300002074 JGI24748J21848_1033777 JGI24748J21848_10337772 87
181 3300002774 JGI25150J39212_1000241 JGI25150J39212_10002418 87
182 3300003187 JGI25151J46595_10048672 JGI25151J46595_100486723 87
183 3300003214 JGI25165J46597_1000078 JGI25165J46597_100007849 87
184 3300003215 JGI25153J46596_10000109 JGI25153J46596_1000010963 87
185 3300003215 JGI25153J46596_10080839 JGI25153J46596_100808391 87
186 3300003320 rootH2_10005575 rootH2_1000557512 87
187 3300003354 JGI25160J50197_1007209 JGI25160J50197_10072092 87
188 3300003752 Ga0055539_1007703 Ga0055539_10077032 87
189 3300003911 JGI25405J52794_10004874 JGI25405J52794_100048741 87
190 3300003911 JGI25405J52794_10049593 JGI25405J52794_100495931 87
191 3300005262 Ga0065165_1003688 Ga0065165_10036887 87
192 3300005262 Ga0065165_1100151 Ga0065165_11001512 87
193 3300005329 Ga0070683_100430387 Ga0070683_1004303871 87
194 3300005331 Ga0070670_100901191 Ga0070670_1009011912 87
195 3300005334 Ga0068869_100920507 Ga0068869_1009205071 87
196 3300005335 Ga0070666_10000070 Ga0070666_1000007071 87
197 3300005335 Ga0070666_10234077 Ga0070666_102340772 87
198 3300005339 Ga0070660_100597097 Ga0070660_1005970973 87
199 3300005340 Ga0070689_100553301 Ga0070689_1005533012 87
200 3300005344 Ga0070661_100315783 Ga0070661_1003157832 87
201 3300005347 Ga0070668_100000213 Ga0070668_10000021327 87
202 3300005354 Ga0070675_101168365 Ga0070675_1011683652 87
203 3300005356 Ga0070674_100301410 Ga0070674_1003014101 87
204 3300005367 Ga0070667_100000265 Ga0070667_10000026547 87
205 3300005367 Ga0070667_100004158 Ga0070667_1000041586 87
206 3300005367 Ga0070667_100341773 Ga0070667_1003417732 87
207 3300005367 Ga0070667_101022885 Ga0070667_1010228852 87
208 3300005435 Ga0070714_100123365 Ga0070714_1001233652 87
209 3300005436 Ga0070713_100904326 Ga0070713_1009043262 87
210 3300005437 Ga0070710_10437540 Ga0070710_104375403 87
211 3300005439 Ga0070711_100822773 Ga0070711_1008227732 87
212 3300005445 Ga0070708_100886377 Ga0070708_1008863772 87
213 3300005455 Ga0070663_100377712 Ga0070663_1003777123 87
214 3300005458 Ga0070681_11038737 Ga0070681_110387371 87
215 3300005467 Ga0070706_100119639 Ga0070706_1001196391 87
216 3300005467 Ga0070706_101973261 Ga0070706_1019732611 87
217 3300005468 Ga0070707_100089793 Ga0070707_1000897931 87
218 3300005471 Ga0070698_100114061 Ga0070698_1001140612 87
219 3300005518 Ga0070699_100002841 Ga0070699_10000284112 87
220 3300005518 Ga0070699_101053102 Ga0070699_1010531022 87
221 3300005530 Ga0070679_100328060 Ga0070679_1003280602 87
222 3300005535 Ga0070684_100014485 Ga0070684_1000144857 87
223 3300005536 Ga0070697_100412149 Ga0070697_1004121492 87
224 3300005536 Ga0070697_101253889 Ga0070697_1012538892 87
225 3300005539 Ga0068853_100486359 Ga0068853_1004863593 87
226 3300005543 Ga0070672_101261214 Ga0070672_1012612142 87
227 3300005548 Ga0070665_100010760 Ga0070665_1000107608 87
228 3300005548 Ga0070665_100075943 Ga0070665_1000759433 87
229 3300005548 Ga0070665_100132284 Ga0070665_1001322843 87
230 3300005548 Ga0070665_100603004 Ga0070665_1006030041 87
231 3300005548 Ga0070665_101784949 Ga0070665_1017849492 87
232 3300005563 Ga0068855_100842910 Ga0068855_1008429102 87
233 3300005563 Ga0068855_101341809 Ga0068855_1013418092 87
234 3300005577 Ga0068857_101509262 Ga0068857_1015092621 87
235 3300005614 Ga0068856_100757682 Ga0068856_1007576822 87
236 3300005614 Ga0068856_100945012 Ga0068856_1009450122 87
237 3300005614 Ga0068856_102255983 Ga0068856_1022559832 87
238 3300005616 Ga0068852_101643689 Ga0068852_1016436892 87
239 3300005617 Ga0068859_100259523 Ga0068859_1002595233 87
240 3300005618 Ga0068864_100431590 Ga0068864_1004315903 87
241 3300005719 Ga0068861_100701407 Ga0068861_1007014073 87
242 3300005841 Ga0068863_100000182 Ga0068863_10000018217 87
243 3300005842 Ga0068858_101023872 Ga0068858_1010238722 87
244 3300005844 Ga0068862_100459509 Ga0068862_1004595091 87
245 3300005844 Ga0068862_100584170 Ga0068862_1005841702 87
246 3300005937 Ga0081455_10000553 Ga0081455_1000055333 87
247 3300005937 Ga0081455_10021584 Ga0081455_100215846 87
248 3300005937 Ga0081455_10252359 Ga0081455_102523593 87
249 3300005937 Ga0081455_10984546 Ga0081455_109845462 87
250 3300005983 Ga0081540_1060731 Ga0081540_10607313 87
251 3300005985 Ga0081539_10000412 Ga0081539_1000041281 87
252 3300005985 Ga0081539_10002962 Ga0081539_1000296212 87
253 3300006028 Ga0070717_10249288 Ga0070717_102492883 87
254 3300006038 Ga0075365_10104210 Ga0075365_101042102 87
255 3300006038 Ga0075365_10930555 Ga0075365_109305551 87
256 3300006042 Ga0075368_10440705 Ga0075368_104407052 87
257 3300006058 Ga0075432_10474177 Ga0075432_104741772 87
258 3300006175 Ga0070712_100167703 Ga0070712_1001677032 87
259 3300006175 Ga0070712_100234107 Ga0070712_1002341072 87
260 3300006177 Ga0075362_10672043 Ga0075362_106720432 87
261 3300006186 Ga0075369_10066805 Ga0075369_100668053 87
262 3300006847 Ga0075431_100649301 Ga0075431_1006493011 87
263 3300006880 Ga0075429_100227466 Ga0075429_1002274662 87
264 3300006881 Ga0068865_101170254 Ga0068865_1011702542 87
265 3300006931 Ga0097620_100259504 Ga0097620_1002595043 87
266 3300006942 Ga0099824_1017053 Ga0099824_10170531 87
267 3300006942 Ga0099824_1026543 Ga0099824_10265433 87
268 3300006943 Ga0099822_1005508 Ga0099822_100550818 87
269 3300006943 Ga0099822_1040047 Ga0099822_10400473 87
270 3300006944 Ga0099823_1006666 Ga0099823_100666616 87
271 3300006944 Ga0099823_1008537 Ga0099823_10085373 87
272 3300007265 Ga0099794_10600897 Ga0099794_106008972 87
273 3300007788 Ga0099795_10002155 Ga0099795_100021553 87
274 3300007788 Ga0099795_10557850 Ga0099795_105578502 87
275 3300009093 Ga0105240_10441959 Ga0105240_104419592 87
276 3300009093 Ga0105240_10454237 Ga0105240_104542371 87
277 3300009093 Ga0105240_11082509 Ga0105240_110825092 87
278 3300009093 Ga0105240_11638491 Ga0105240_116384912 87
279 3300009094 Ga0111539_10636226 Ga0111539_106362262 87
280 3300009101 Ga0105247_10261431 Ga0105247_102614313 87
281 3300009101 Ga0105247_10490664 Ga0105247_104906642 87
282 3300009147 Ga0114129_10382564 Ga0114129_103825643 87
283 3300009148 Ga0105243_10616584 Ga0105243_106165842 87
284 3300009174 Ga0105241_11020926 Ga0105241_110209261 87
285 3300009177 Ga0105248_10514797 Ga0105248_105147972 87
286 3300009545 Ga0105237_10001960 Ga0105237_1000196023 87
287 3300009545 Ga0105237_11128908 Ga0105237_111289081 87
288 3300009545 Ga0105237_11215390 Ga0105237_112153903 87
289 3300009545 Ga0105237_11419272 Ga0105237_114192721 87
290 3300009551 Ga0105238_10007211 Ga0105238_1000721110 87
291 3300009551 Ga0105238_10009768 Ga0105238_100097687 87
292 3300009553 Ga0105249_12491139 Ga0105249_124911392 87
293 3300010159 Ga0099796_10031166 Ga0099796_100311662 87
294 3300010159 Ga0099796_10327338 Ga0099796_103273382 87
295 3300010375 Ga0105239_10000851 Ga0105239_1000085126 87
296 3300010375 Ga0105239_10216212 Ga0105239_102162123 87
297 3300010375 Ga0105239_10751148 Ga0105239_107511483 87
298 3300010375 Ga0105239_10911899 Ga0105239_109118992 87
299 3300010375 Ga0105239_11558967 Ga0105239_115589672 87
300 3300011119 Ga0105246_10129507 Ga0105246_101295072 87
301 3300011119 Ga0105246_10736472 Ga0105246_107364722 87
302 3300011119 Ga0105246_10738613 Ga0105246_107386133 87
303 3300013100 Ga0157373_10333726 Ga0157373_103337262 87
304 3300013104 Ga0157370_10357239 Ga0157370_103572392 87
305 3300013104 Ga0157370_11923943 Ga0157370_119239432 87
306 3300013105 Ga0157369_10244210 Ga0157369_102442102 87
307 3300013297 Ga0157378_11229318 Ga0157378_112293182 87
308 3300013297 Ga0157378_13191711 Ga0157378_131917112 87
309 3300013306 Ga0163162_10257491 Ga0163162_102574912 87
310 3300013306 Ga0163162_10305437 Ga0163162_103054372 87
311 3300013306 Ga0163162_11851734 Ga0163162_118517342 87
312 3300013307 Ga0157372_10953985 Ga0157372_109539852 87
313 3300013308 Ga0157375_10005116 Ga0157375_100051162 87
314 3300013308 Ga0157375_13333320 Ga0157375_133333202 87
315 3300014325 Ga0163163_10000007 Ga0163163_10000007172 87
316 3300014497 Ga0182008_10085263 Ga0182008_100852632 87
317 3300014968 Ga0157379_10477846 Ga0157379_104778462 87
318 3300021320 Ga0214544_1006236 Ga0214544_100623617 87
319 3300021320 Ga0214544_1010201 Ga0214544_101020116 87
320 3300021320 Ga0214544_1034719 Ga0214544_10347192 87
321 3300021321 Ga0214542_1006137 Ga0214542_10061376 87
322 3300021321 Ga0214542_1021169 Ga0214542_10211693 87
323 3300021321 Ga0214542_1029560 Ga0214542_10295602 87
324 3300021321 Ga0214542_1037224 Ga0214542_10372242 87
325 3300021324 Ga0214545_1005727 Ga0214545_10057276 87
326 3300021327 Ga0214543_1005902 Ga0214543_100590217 87
327 3300021327 Ga0214543_1015885 Ga0214543_10158853 87
328 3300021327 Ga0214543_1024724 Ga0214543_10247242 87
329 3300021361 Ga0213872_10111817 Ga0213872_101118172 87
330 3300021377 Ga0213874_10030608 Ga0213874_100306083 87
331 3300021384 Ga0213876_10013411 Ga0213876_100134115 87
332 3300021388 Ga0213875_10007585 Ga0213875_100075852 87
333 3300021388 Ga0213875_10016645 Ga0213875_100166455 87
334 3300021388 Ga0213875_10081267 Ga0213875_100812671 87
335 3300025245 Ga0207425_1000073 Ga0207425_100007343 87
336 3300025253 Ga0209677_101722 Ga0209677_1017223 87
337 3300025253 Ga0209677_125457 Ga0209677_1254572 87
338 3300025254 Ga0209148_1000126 Ga0209148_1000126106 87
339 3300025254 Ga0209148_1001202 Ga0209148_10012025 87
340 3300025258 Ga0209129_1000352 Ga0209129_100035222 87
341 3300025261 Ga0209233_1000150 Ga0209233_1000150133 87
342 3300025261 Ga0209233_1016987 Ga0209233_10169873 87
343 3300025272 Ga0209455_1000280 Ga0209455_10002802 87
344 3300025272 Ga0209455_1025699 Ga0209455_10256993 87
345 3300025294 Ga0209025_1000202 Ga0209025_100020254 87
346 3300025297 Ga0209758_1000138 Ga0209758_100013852 87
347 3300025297 Ga0209758_1000242 Ga0209758_100024243 87
348 3300025297 Ga0209758_1000825 Ga0209758_100082532 87
349 3300025297 Ga0209758_1002094 Ga0209758_10020948 87
350 3300025302 Ga0207426_1001196 Ga0207426_100119618 87
351 3300025901 Ga0207688_10011238 Ga0207688_100112382 87
352 3300025901 Ga0207688_10232773 Ga0207688_102327732 87
353 3300025903 Ga0207680_10000044 Ga0207680_1000004448 87
354 3300025903 Ga0207680_10056518 Ga0207680_100565183 87
355 3300025904 Ga0207647_10147677 Ga0207647_101476772 87
356 3300025904 Ga0207647_10255536 Ga0207647_102555362 87
357 3300025904 Ga0207647_10394698 Ga0207647_103946982 87
358 3300025904 Ga0207647_10410330 Ga0207647_104103302 87
359 3300025907 Ga0207645_10269951 Ga0207645_102699513 87
360 3300025909 Ga0207705_10119611 Ga0207705_101196112 87
361 3300025910 Ga0207684_10190504 Ga0207684_101905043 87
362 3300025911 Ga0207654_11082846 Ga0207654_110828462 87
363 3300025913 Ga0207695_10211799 Ga0207695_102117993 87
364 3300025913 Ga0207695_10283950 Ga0207695_102839503 87
365 3300025913 Ga0207695_10331732 Ga0207695_103317321 87
366 3300025913 Ga0207695_10335354 Ga0207695_103353542 87
367 3300025914 Ga0207671_10000106 Ga0207671_10000106118 87
368 3300025915 Ga0207693_10489409 Ga0207693_104894092 87
369 3300025915 Ga0207693_10810526 Ga0207693_108105262 87
370 3300025917 Ga0207660_11431873 Ga0207660_114318731 87
371 3300025918 Ga0207662_10220112 Ga0207662_102201122 87
372 3300025919 Ga0207657_10000052 Ga0207657_1000005298 87
373 3300025919 Ga0207657_10741033 Ga0207657_107410332 87
374 3300025922 Ga0207646_10043207 Ga0207646_100432071 87
375 3300025923 Ga0207681_10657165 Ga0207681_106571652 87
376 3300025924 Ga0207694_10005525 Ga0207694_100055257 87
377 3300025924 Ga0207694_10044212 Ga0207694_100442125 87
378 3300025925 Ga0207650_10693081 Ga0207650_106930812 87
379 3300025926 Ga0207659_10309274 Ga0207659_103092742 87
380 3300025929 Ga0207664_10473053 Ga0207664_104730532 87
381 3300025932 Ga0207690_11149789 Ga0207690_111497891 87
382 3300025934 Ga0207686_10545233 Ga0207686_105452333 87
383 3300025936 Ga0207670_10500582 Ga0207670_105005822 87
384 3300025937 Ga0207669_10492310 Ga0207669_104923102 87
385 3300025941 Ga0207711_10481755 Ga0207711_104817553 87
386 3300025942 Ga0207689_10049823 Ga0207689_100498232 87
387 3300025944 Ga0207661_10003110 Ga0207661_100031105 87
388 3300025944 Ga0207661_10433553 Ga0207661_104335532 87
389 3300025949 Ga0207667_10429990 Ga0207667_104299902 87
390 3300025949 Ga0207667_10685710 Ga0207667_106857102 87
391 3300025949 Ga0207667_10746048 Ga0207667_107460482 87
392 3300025972 Ga0207668_10000141 Ga0207668_1000014122 87
393 3300025972 Ga0207668_10509811 Ga0207668_105098112 87
394 3300025981 Ga0207640_10365282 Ga0207640_103652822 87
395 3300025986 Ga0207658_10000703 Ga0207658_1000070324 87
396 3300025986 Ga0207658_10002689 Ga0207658_100026898 87
397 3300025986 Ga0207658_11662465 Ga0207658_116624652 87
398 3300026035 Ga0207703_10208854 Ga0207703_102088543 87
399 3300026041 Ga0207639_10014746 Ga0207639_100147463 87
400 3300026067 Ga0207678_10157371 Ga0207678_101573713 87
401 3300026078 Ga0207702_10225493 Ga0207702_102254932 87
402 3300026088 Ga0207641_10000102 Ga0207641_1000010254 87
403 3300026095 Ga0207676_10402596 Ga0207676_104025962 87
404 3300026116 Ga0207674_11828357 Ga0207674_118283571 87
405 3300026118 Ga0207675_100010642 Ga0207675_1000106422 87
406 3300026142 Ga0207698_10416023 Ga0207698_104160232 87
407 3300026142 Ga0207698_10701812 Ga0207698_107018122 87
408 3300027296 Ga0209389_1000003 Ga0209389_1000003222 87
409 3300027296 Ga0209389_1000055 Ga0209389_1000055116 87
410 3300027296 Ga0209389_1000263 Ga0209389_100026322 87
411 3300027296 Ga0209389_1000404 Ga0209389_10004046 87
412 3300027296 Ga0209389_1005813 Ga0209389_10058133 87
413 3300027357 Ga0209589_1000008 Ga0209589_100000822 87
414 3300027357 Ga0209589_1000024 Ga0209589_100002415 87
415 3300027357 Ga0209589_1003752 Ga0209589_10037526 87
416 3300027361 Ga0209489_100123 Ga0209489_1001238 87
417 3300027361 Ga0209489_100474 Ga0209489_10047439 87
418 3300027361 Ga0209489_102905 Ga0209489_10290530 87
419 3300027361 Ga0209489_103245 Ga0209489_10324522 87
420 3300027361 Ga0209489_104558 Ga0209489_10455815 87
421 3300027363 Ga0209700_100029 Ga0209700_100029208 87
422 3300027363 Ga0209700_100046 Ga0209700_100046137 87
423 3300027512 Ga0209179_1002531 Ga0209179_10025312 87
424 3300028379 Ga0268266_10000989 Ga0268266_1000098936 87
425 3300028379 Ga0268266_10037067 Ga0268266_100370674 87
426 3300028379 Ga0268266_11017250 Ga0268266_110172502 87
427 3300028380 Ga0268265_10233430 Ga0268265_102334302 87
428 3300028556 Ga0265337_1003812 Ga0265337_10038125 87
429 3300028573 Ga0265334_10014683 Ga0265334_100146833 87
430 3300028573 Ga0265334_10086606 Ga0265334_100866061 87
431 3300028573 Ga0265334_10235687 Ga0265334_102356872 87
432 3300028666 Ga0265336_10082297 Ga0265336_100822972 87
433 3300028794 Ga0307515_10048747 Ga0307515_100487473 87
434 3300028794 Ga0307515_10591461 Ga0307515_105914612 87
435 3300028800 Ga0265338_10018504 Ga0265338_100185046 87
436 3300028800 Ga0265338_10075675 Ga0265338_100756752 87
437 3300031235 Ga0265330_10364716 Ga0265330_103647162 87
438 3300031238 Ga0265332_10171240 Ga0265332_101712402 87
439 3300031239 Ga0265328_10009339 Ga0265328_100093393 87
440 3300031240 Ga0265320_10470912 Ga0265320_104709122 87
441 3300031241 Ga0265325_10186561 Ga0265325_101865612 87
442 3300031241 Ga0265325_10186921 Ga0265325_101869212 87
443 3300031241 Ga0265325_10196001 Ga0265325_101960012 87
444 3300031242 Ga0265329_10008887 Ga0265329_100088873 87
445 3300031247 Ga0265340_10191773 Ga0265340_101917733 87
446 3300031249 Ga0265339_10002251 Ga0265339_100022518 87
447 3300031249 Ga0265339_10012366 Ga0265339_100123663 87
448 3300031249 Ga0265339_10050078 Ga0265339_100500783 87
449 3300031249 Ga0265339_10126577 Ga0265339_101265773 87
450 3300031250 Ga0265331_10001163 Ga0265331_1000116315 87
451 3300031251 Ga0265327_10303580 Ga0265327_103035802 87
452 3300031344 Ga0265316_10015583 Ga0265316_100155834 87
453 3300031344 Ga0265316_10203112 Ga0265316_102031123 87
454 3300031595 Ga0265313_10009740 Ga0265313_100097403 87
455 3300031595 Ga0265313_10053628 Ga0265313_100536283 87
456 3300031711 Ga0265314_10010467 Ga0265314_100104675 87
457 3300031711 Ga0265314_10024861 Ga0265314_100248615 87
458 3300031711 Ga0265314_10105927 Ga0265314_101059273 87
459 3300031712 Ga0265342_10021504 Ga0265342_100215043 87
460 3300031712 Ga0265342_10467673 Ga0265342_104676731 87
461 3300031995 Ga0307409_100962040 Ga0307409_1009620402 87
462 3300032002 Ga0307416_100218133 Ga0307416_1002181333 87
463 3300032002 Ga0307416_101037419 Ga0307416_1010374192 87
464 3300032002 Ga0307416_103807609 Ga0307416_1038076091 87
465 3300032004 Ga0307414_10164372 Ga0307414_101643722 87
466 3300032004 Ga0307414_10398990 Ga0307414_103989903 87
467 3300032004 Ga0307414_10650244 Ga0307414_106502442 87
468 3300032126 Ga0307415_102040736 Ga0307415_1020407362 87
469 3300033180 Ga0307510_10446701 Ga0307510_104467012 87
470 3300033442 Ga0315911_1000006 Ga0315911_1000006201 87
471 3300033442 Ga0315911_1000026 Ga0315911_100002643 87
472 3300035113 Ga0373936_0043642 Ga0373936_0043642_790_1068 87
473 3300035113 Ga0373936_0074239 Ga0373936_0074239_168_437 87
474 3300035113 Ga0373936_0206679 Ga0373936_0206679_484_762 87
475 3300035118 Ga0373954_0031430 Ga0373954_0031430_1223_1492 87
476 3300035692 Ga0373935_0182472 Ga0373935_0182472_218_496 87
477 3300035695 Ga0373927_0074351 Ga0373927_0074351_645_923 87
478 3300035695 Ga0373927_0093766 Ga0373927_0093766_1653_1931 87
479 3300035695 Ga0373927_0097680 Ga0373927_0097680_951_1229 87
480 3300035695 Ga0373927_0550939 Ga0373927_0550939_314_592 87
481 3300035695 Ga0373927_1024575 Ga0373927_1024575_16_294 87
482 3300035724 Ga0373933_0248011 Ga0373933_0248011_79_348 87
483 3300035725 Ga0373947_0653031 Ga0373947_0653031_212_490 87
484 3300035725 Ga0373947_0697673 Ga0373947_0697673_85_363 87
485 3300036401 Ga0373937_0062495 Ga0373937_0062495_1631_1900 87
486 3300037068 Ga0373925_0565612 Ga0373925_0565612_215_493 87
487 3300037068 Ga0373925_1128605 Ga0373925_1128605_139_417 87
488 3300037312 Ga0395899_0370824 Ga0395899_0370824_560_838 87
489 3300037312 Ga0395899_0497615 Ga0395899_0497615_262_528 87
490 3300037418 Ga0395900_0002291 Ga0395900_0002291_6115_6378 87
491 3300037418 Ga0395900_0184311 Ga0395900_0184311_843_1121 87
492 3300037418 Ga0395900_0506319 Ga0395900_0506319_772_1047 87
493 3300037466 Ga0395898_0019531 Ga0395898_0019531_590_865 87
494 3300037466 Ga0395898_0292056 Ga0395898_0292056_47_310 87
495 3300037471 Ga0395905_0003413 Ga0395905_0003413_12117_12392 87
496 3300037471 Ga0395905_0535534 Ga0395905_0535534_468_734 87
497 3300037471 Ga0395905_0772097 Ga0395905_0772097_275_538 87
498 3300037471 Ga0395905_0796729 Ga0395905_0796729_56_319 87
499 3300037853 Ga0436364_0117958 Ga0436364_0117958_29_307 87
500 3300037853 Ga0436364_0167314 Ga0436364_0167314_11627_11902 87
501 3300037853 Ga0436364_0226891 Ga0436364_0226891_24132_24401 87
502 3300037853 Ga0436364_0494866 Ga0436364_0494866_53_316 87
503 3300037853 Ga0436364_0543304 Ga0436364_0543304_22_297 87
504 3300037853 Ga0436364_0749918 Ga0436364_0749918_81_356 87
505 3300037853 Ga0436364_0793320 Ga0436364_0793320_247_510 87
506 3300037853 Ga0436364_1440006 Ga0436364_1440006_91_369 87
507 3300038443 Ga0395901_0065231 Ga0395901_0065231_2516_2782 87
508 3300038443 Ga0395901_0160060 Ga0395901_0160060_318_593 87
509 3300038443 Ga0395901_0173114 Ga0395901_0173114_459_740 87
510 3300038443 Ga0395901_0186637 Ga0395901_0186637_613_876 87
511 3300038443 Ga0395901_0619233 Ga0395901_0619233_83_361 87
512 3300038443 Ga0395901_1110613 Ga0395901_1110613_112_390 87
513 3300038443 Ga0395901_1522481 Ga0395901_1522481_155_418 87
514 3300039437 Ga0436365_0623764 Ga0436365_0623764_1344_1613 87
515 3300039437 Ga0436365_1174990 Ga0436365_1174990_1071_1343 87
516 3300039437 Ga0436365_1331505 Ga0436365_1331505_168_446 87
517 3300039437 Ga0436365_1547453 Ga0436365_1547453_100_378 87
518 3300039437 Ga0436365_1665747 Ga0436365_1665747_93_365 87
519 3300039437 Ga0436365_1860902 Ga0436365_1860902_119_397 87
520 3300039437 Ga0436365_1876159 Ga0436365_1876159_32_304 87
521 3300039438 Ga0436360_0251747 Ga0436360_0251747_373_642 87
522 3300039438 Ga0436360_0575218 Ga0436360_0575218_563_835 87
523 3300039438 Ga0436360_0776894 Ga0436360_0776894_103_372 87
524 3300039438 Ga0436360_0797411 Ga0436360_0797411_502_771 87
525 3300039438 Ga0436360_0859224 Ga0436360_0859224_220_489 87
526 3300039438 Ga0436360_1077870 Ga0436360_1077870_81_353 87
527 3300039438 Ga0436360_1246931 Ga0436360_1246931_536_805 87
528 3300039438 Ga0436360_1247036 Ga0436360_1247036_679_948 87
529 3300039447 Ga0436361_0065056 Ga0436361_0065056_53_325 87
530 3300039447 Ga0436361_0115207 Ga0436361_0115207_405_674 87
531 3300039447 Ga0436361_0185942 Ga0436361_0185942_866_1135 87
532 3300039447 Ga0436361_0224260 Ga0436361_0224260_977_1255 87
533 3300039447 Ga0436361_0289583 Ga0436361_0289583_2691_2960 87
534 3300039447 Ga0436361_0456415 Ga0436361_0456415_1365_1634 87
535 3300039447 Ga0436361_0778911 Ga0436361_0778911_21_290 87
536 3300039447 Ga0436361_0820693 Ga0436361_0820693_37_309 87
537 3300039447 Ga0436361_1081026 Ga0436361_1081026_102_371 87
538 3300039450 Ga0436363_0283155 Ga0436363_0283155_929_1207 87
539 3300039450 Ga0436363_0469747 Ga0436363_0469747_472_744 87
540 3300039450 Ga0436363_0590522 Ga0436363_0590522_49_321 87
541 3300039450 Ga0436363_0832663 Ga0436363_0832663_239_514 87
542 3300039450 Ga0436363_0865732 Ga0436363_0865732_1473_1751 87
543 3300039450 Ga0436363_0950379 Ga0436363_0950379_2573_2848 87
544 3300039450 Ga0436363_0992069 Ga0436363_0992069_68_337 87
545 3300039450 Ga0436363_1098882 Ga0436363_1098882_161_439 87
546 3300041451 Ga0451791_1597435 Ga0451791_1597435_110_373 87
547 3300041460 Ga0451802_0643512 Ga0451802_0643512_241_510 87
548 3300041494 Ga0451837_0898365 Ga0451837_0898365_1973_2254 87
549 3300041501 Ga0451845_0978265 Ga0451845_0978265_358_621 87
550 3300041511 Ga0451855_0984920 Ga0451855_0984920_14910_15173 87
551 3300041512 Ga0451853_0961848 Ga0451853_0961848_374_637 87
552 3300041512 Ga0451853_3701895 Ga0451853_3701895_50_331 87
553 3300042005 Ga0439448_0289099 Ga0439448_0289099_254_529 87
554 3300044656 Ga0466969_0419942 Ga0466969_0419942_278_541 87
555 3300044656 Ga0466969_0462719 Ga0466969_0462719_22_285 87
556 3300044684 Ga0466966_0001036 Ga0466966_0001036_7228_7491 87
557 3300044684 Ga0466966_0001850 Ga0466966_0001850_4113_4376 87
558 3300044693 Ga0466961_0000004 Ga0466961_0000004_118718_118981 87
559 3300044693 Ga0466961_0136286 Ga0466961_0136286_247_510 87
560 3300044693 Ga0466961_0282653 Ga0466961_0282653_740_1003 87
561 3300044694 Ga0466963_0045911 Ga0466963_0045911_290_559 87
562 3300044901 Ga0466960_0568302 Ga0466960_0568302_218_481 87
563 3300045051 Ga0451576_0002567 Ga0451576_0002567_19328_19600 87
564 3300045051 Ga0451576_1151414 Ga0451576_1151414_65_337 87
565 3300045836 Ga0466958_1166610 Ga0466958_1166610_172_435 87
566 3300045976 Ga0466967_1145459 Ga0466967_1145459_103_372 87
567 3300046455 Ga0495603_0505824 Ga0495603_0505824_289_552 87
568 3300046459 Ga0495629_0500025 Ga0495629_0500025_131_409 87
569 3300046460 Ga0495638_0108565 Ga0495638_0108565_591_854 87
570 3300046462 Ga0495651_0837574 Ga0495651_0837574_155_424 87
571 3300046463 Ga0495653_0923002 Ga0495653_0923002_48_326 87
572 3300046477 Ga0495664_0316564 Ga0495664_0316564_392_670 87
573 3300046477 Ga0495664_0431967 Ga0495664_0431967_185_448 87
574 3300046491 Ga0495584_0321807 Ga0495584_0321807_413_676 87
575 3300046507 Ga0495606_0305319 Ga0495606_0305319_302_565 87
576 3300046507 Ga0495606_0669266 Ga0495606_0669266_154_417 87
577 3300046519 Ga0495632_0000023 Ga0495632_0000023_145301_145564 87
578 3300046522 Ga0495643_0238648 Ga0495643_0238648_236_499 87
579 3300046524 Ga0495648_0009994 Ga0495648_0009994_1811_2086 87
580 3300046524 Ga0495648_0055254 Ga0495648_0055254_305_586 87
581 3300046525 Ga0495663_0000059 Ga0495663_0000059_35370_35633 87
582 3300046530 Ga0495654_0378927 Ga0495654_0378927_288_551 87
583 3300046533 Ga0495640_0108583 Ga0495640_0108583_122_400 87
584 3300046557 Ga0495622_0139512 Ga0495622_0139512_494_757 87
585 3300046558 Ga0495633_0003846 Ga0495633_0003846_2099_2371 87
586 3300046558 Ga0495633_0007824 Ga0495633_0007824_4412_4675 87
587 3300046660 Ga0495625_0458757 Ga0495625_0458757_147_410 87
588 3300046684 Ga0495669_0471668 Ga0495669_0471668_309_572 87
589 3300046694 Ga0495649_0351381 Ga0495649_0351381_139_402 87
590 3300047317 Ga0495604_0590913 Ga0495604_0590913_117_386 87
591 3300047319 Ga0495674_0570706 Ga0495674_0570706_504_779 87
592 3300047319 Ga0495674_0878913 Ga0495674_0878913_89_358 87
593 3300047320 Ga0495672_0000160 Ga0495672_0000160_77319_77582 87
594 3300047320 Ga0495672_0095259 Ga0495672_0095259_1246_1524 87
595 3300047320 Ga0495672_0162682 Ga0495672_0162682_563_826 87
596 3300047320 Ga0495672_0314138 Ga0495672_0314138_124_387 87
597 3300047321 Ga0495676_0354450 Ga0495676_0354450_291_569 87
598 3300047321 Ga0495676_0368815 Ga0495676_0368815_123_401 87
599 3300047469 Ga0495673_0181500 Ga0495673_0181500_151_414 87
600 3300047472 Ga0495686_0330915 Ga0495686_0330915_498_761 87
601 3300047472 Ga0495686_0442986 Ga0495686_0442986_135_398 87
602 3300047673 Ga0495593_0209360 Ga0495593_0209360_195_473 87
603 3300048903 Ga0496100_0757863 Ga0496100_0757863_309_587 87
604 3300048903 Ga0496100_1414261 Ga0496100_1414261_274_537 87
605 3300048904 Ga0496101_0937427 Ga0496101_0937427_136_414 87
606 3300048905 Ga0496102_0262378 Ga0496102_0262378_1309_1572 87
607 3300048906 Ga0496103_0889972 Ga0496103_0889972_247_522 87
608 3300048907 Ga0496104_0000255 Ga0496104_0000255_36235_36510 87
609 3300048907 Ga0496104_0055706 Ga0496104_0055706_1577_1858 87
610 3300048907 Ga0496104_0086120 Ga0496104_0086120_1617_1880 87
611 3300048907 Ga0496104_0164093 Ga0496104_0164093_1673_1951 87
612 3300048907 Ga0496104_0471618 Ga0496104_0471618_858_1136 87
613 3300048908 Ga0496105_0000078 Ga0496105_0000078_62876_63151 87
614 3300048908 Ga0496105_0211950 Ga0496105_0211950_721_999 87
615 3300048908 Ga0496105_0226167 Ga0496105_0226167_10_273 87
616 3300048908 Ga0496105_0490527 Ga0496105_0490527_109_387 87
617 3300048909 Ga0496106_0246673 Ga0496106_0246673_923_1186 87
618 3300048909 Ga0496106_1370034 Ga0496106_1370034_139_420 87
619 3300048910 Ga0496107_0052424 Ga0496107_0052424_1164_1442 87
620 3300048910 Ga0496107_0610407 Ga0496107_0610407_64_327 87
621 3300048910 Ga0496107_1106293 Ga0496107_1106293_212_475 87
622 3300048913 Ga0496110_0269347 Ga0496110_0269347_181_444 87
623 3300048914 Ga0496111_1156004 Ga0496111_1156004_250_528 87
624 3300048915 Ga0496112_0603030 Ga0496112_0603030_283_561 87
625 3300048915 Ga0496112_1663298 Ga0496112_1663298_69_341 87
626 3300048916 Ga0496113_0425242 Ga0496113_0425242_732_995 87
627 3300048916 Ga0496113_0465982 Ga0496113_0465982_37_315 87
628 3300048916 Ga0496113_1107659 Ga0496113_1107659_162_428 87
629 3300048917 Ga0496114_0433386 Ga0496114_0433386_255_533 87
630 3300048918 Ga0496115_0253250 Ga0496115_0253250_1022_1300 87
631 3300048918 Ga0496115_1106464 Ga0496115_1106464_173_436 87
632 3300048919 Ga0496116_0030535 Ga0496116_0030535_2621_2902 87
633 3300048919 Ga0496116_0153683 Ga0496116_0153683_759_1040 87
634 3300048920 Ga0496117_0000405 Ga0496117_0000405_62701_62982 87
635 3300048920 Ga0496117_0001136 Ga0496117_0001136_25461_25742 87
636 3300048920 Ga0496117_0015195 Ga0496117_0015195_6277_6558 87
637 3300048920 Ga0496117_0561311 Ga0496117_0561311_220_489 87
638 3300048921 Ga0496118_0000402 Ga0496118_0000402_10059_10340 87
639 3300048921 Ga0496118_0002991 Ga0496118_0002991_4015_4296 87
640 3300048921 Ga0496118_0003441 Ga0496118_0003441_16695_16976 87
641 3300048922 Ga0496119_0022321 Ga0496119_0022321_3750_4031 87
642 3300048922 Ga0496119_0038153 Ga0496119_0038153_2564_2845 87
643 3300048922 Ga0496119_0049885 Ga0496119_0049885_1384_1665 87
644 3300048922 Ga0496119_0145636 Ga0496119_0145636_448_729 87
645 3300048923 Ga0496120_0051428 Ga0496120_0051428_1211_1492 87
646 3300048923 Ga0496120_0091820 Ga0496120_0091820_961_1242 87
647 3300048923 Ga0496120_0245596 Ga0496120_0245596_143_418 87
648 3300048924 Ga0496121_0009861 Ga0496121_0009861_9510_9791 87
649 3300048924 Ga0496121_0089649 Ga0496121_0089649_567_830 87
650 3300048924 Ga0496121_0148849 Ga0496121_0148849_435_716 87
651 3300048924 Ga0496121_0220649 Ga0496121_0220649_667_930 87
652 3300048924 Ga0496121_0422852 Ga0496121_0422852_109_384 87
653 3300048924 Ga0496121_0560154 Ga0496121_0560154_261_533 87
654 3300048924 Ga0496121_0600945 Ga0496121_0600945_193_462 87
655 3300048924 Ga0496121_0702466 Ga0496121_0702466_277_540 87
656 3300048925 Ga0496122_0000921 Ga0496122_0000921_40427_40708 87
657 3300048925 Ga0496122_0029876 Ga0496122_0029876_1551_1814 87
658 3300048926 Ga0496123_0001350 Ga0496123_0001350_22017_22298 87
659 3300048926 Ga0496123_0513572 Ga0496123_0513572_161_430 87
660 3300048928 Ga0496125_0066170 Ga0496125_0066170_1816_2097 87
661 3300048929 Ga0496126_0000296 Ga0496126_0000296_81590_81859 87
662 3300048929 Ga0496126_0043240 Ga0496126_0043240_721_1002 87
663 3300048929 Ga0496126_0117776 Ga0496126_0117776_208_471 87
664 3300048929 Ga0496126_0326282 Ga0496126_0326282_507_770 87
665 3300048929 Ga0496126_0537753 Ga0496126_0537753_64_327 87
666 3300048929 Ga0496126_1140000 Ga0496126_1140000_165_434 87
667 3300049460 Ga0495682_0368803 Ga0495682_0368803_182_445 87
668 3300049568 Ga0501031_0000005 Ga0501031_0000005_147448_147723 87
669 3300049568 Ga0501031_0000157 Ga0501031_0000157_9156_9419 87
670 3300049568 Ga0501031_0000803 Ga0501031_0000803_9027_9290 87
671 3300049568 Ga0501031_0103161 Ga0501031_0103161_1588_1851 87
672 3300049569 Ga0501032_0000069 Ga0501032_0000069_19214_19477 87
673 3300049569 Ga0501032_0000337 Ga0501032_0000337_3440_3715 87
674 3300049569 Ga0501032_0000772 Ga0501032_0000772_19765_20028 87
675 3300049569 Ga0501032_0001324 Ga0501032_0001324_8824_9087 87
676 3300049569 Ga0501032_0001526 Ga0501032_0001526_10675_10938 87
677 3300049569 Ga0501032_0112590 Ga0501032_0112590_1026_1289 87
678 3300049569 Ga0501032_0168350 Ga0501032_0168350_108_377 87
679 3300049569 Ga0501032_0208243 Ga0501032_0208243_954_1217 87
680 3300049569 Ga0501032_0433984 Ga0501032_0433984_486_749 87
681 3300049570 Ga0501033_0000062 Ga0501033_0000062_19214_19477 87
682 3300049570 Ga0501033_0000129 Ga0501033_0000129_69703_69978 87
683 3300049570 Ga0501033_0000170 Ga0501033_0000170_34095_34358 87
684 3300049570 Ga0501033_0000175 Ga0501033_0000175_6351_6614 87
685 3300049570 Ga0501033_0000663 Ga0501033_0000663_18264_18527 87
686 3300049570 Ga0501033_0155430 Ga0501033_0155430_885_1148 87
687 3300049570 Ga0501033_0288899 Ga0501033_0288899_700_963 87
688 3300049570 Ga0501033_0308486 Ga0501033_0308486_114_383 87
689 3300049571 Ga0501034_0000494 Ga0501034_0000494_19745_20008 87
690 3300049571 Ga0501034_0000612 Ga0501034_0000612_16745_17011 87
691 3300049571 Ga0501034_0001942 Ga0501034_0001942_6714_6977 87
692 3300049571 Ga0501034_0002799 Ga0501034_0002799_10579_10854 87
693 3300049571 Ga0501034_0005998 Ga0501034_0005998_6535_6798 87
694 3300049571 Ga0501034_0039402 Ga0501034_0039402_2894_3157 87
695 3300049571 Ga0501034_0041000 Ga0501034_0041000_3845_4108 87
696 3300049571 Ga0501034_0404161 Ga0501034_0404161_454_717 87
697 3300049572 Ga0501036_0000014 Ga0501036_0000014_35524_35799 87
698 3300049572 Ga0501036_0000079 Ga0501036_0000079_11422_11685 87
699 3300049572 Ga0501036_0000086 Ga0501036_0000086_19214_19477 87
700 3300049572 Ga0501036_0000367 Ga0501036_0000367_6400_6663 87
701 3300049572 Ga0501036_0855613 Ga0501036_0855613_377_640 87
702 3300049573 Ga0501037_0000042 Ga0501037_0000042_5226_5501 87
703 3300049573 Ga0501037_0000087 Ga0501037_0000087_62639_62902 87
704 3300049573 Ga0501037_0001088 Ga0501037_0001088_7585_7848 87
705 3300049573 Ga0501037_0004449 Ga0501037_0004449_2493_2756 87
706 3300049573 Ga0501037_0004889 Ga0501037_0004889_6226_6489 87
707 3300049574 Ga0501038_0000024 Ga0501038_0000024_35524_35799 87
708 3300049574 Ga0501038_0000067 Ga0501038_0000067_66325_66588 87
709 3300049574 Ga0501038_0000095 Ga0501038_0000095_66383_66646 87
710 3300049574 Ga0501038_0000157 Ga0501038_0000157_6336_6599 87
711 3300049574 Ga0501038_0000284 Ga0501038_0000284_28136_28399 87
712 3300049574 Ga0501038_0168268 Ga0501038_0168268_1034_1309 87
713 3300049574 Ga0501038_0241953 Ga0501038_0241953_996_1259 87
714 3300049575 Ga0501039_0000059 Ga0501039_0000059_19214_19477 87
715 3300049575 Ga0501039_0000122 Ga0501039_0000122_18073_18348 87
716 3300049575 Ga0501039_0002627 Ga0501039_0002627_6744_7007 87
717 3300049575 Ga0501039_0005126 Ga0501039_0005126_8087_8350 87
718 3300049575 Ga0501039_0145994 Ga0501039_0145994_1260_1523 87
719 3300049575 Ga0501039_0343248 Ga0501039_0343248_480_743 87
720 3300049576 Ga0501040_0004151 Ga0501040_0004151_8146_8421 87
721 3300049576 Ga0501040_0144228 Ga0501040_0144228_1109_1372 87
722 3300049576 Ga0501040_1168246 Ga0501040_1168246_210_473 87
723 3300049577 Ga0501041_0588314 Ga0501041_0588314_306_569 87
724 3300049577 Ga0501041_0695230 Ga0501041_0695230_265_543 87
725 3300049578 Ga0501042_0017225 Ga0501042_0017225_3976_4239 87
726 3300049578 Ga0501042_0037725 Ga0501042_0037725_3138_3401 87
727 3300049579 Ga0501043_0000178 Ga0501043_0000178_8352_8615 87
728 3300049579 Ga0501043_0000289 Ga0501043_0000289_28362_28625 87
729 3300049579 Ga0501043_0000925 Ga0501043_0000925_19399_19662 87
730 3300049579 Ga0501043_0001213 Ga0501043_0001213_11634_11897 87
731 3300049579 Ga0501043_0170211 Ga0501043_0170211_130_405 87
732 3300049579 Ga0501043_0417172 Ga0501043_0417172_369_632 87
733 3300049580 Ga0501046_0000260 Ga0501046_0000260_28294_28557 87
734 3300049580 Ga0501046_0008310 Ga0501046_0008310_6744_7007 87
735 3300049580 Ga0501046_0014331 Ga0501046_0014331_2458_2721 87
736 3300049580 Ga0501046_0028877 Ga0501046_0028877_1744_2019 87
737 3300049580 Ga0501046_0119988 Ga0501046_0119988_177_452 87
738 3300049580 Ga0501046_1085899 Ga0501046_1085899_195_473 87
739 3300049581 Ga0501047_0000146 Ga0501047_0000146_19214_19477 87
740 3300049581 Ga0501047_0001569 Ga0501047_0001569_7192_7470 87
741 3300049581 Ga0501047_0002832 Ga0501047_0002832_3760_4023 87
742 3300049581 Ga0501047_0006906 Ga0501047_0006906_1672_1947 87
743 3300049581 Ga0501047_0037975 Ga0501047_0037975_3258_3521 87
744 3300049581 Ga0501047_0084365 Ga0501047_0084365_1912_2187 87
745 3300049581 Ga0501047_0301892 Ga0501047_0301892_964_1227 87
746 3300049582 Ga0501048_0000034 Ga0501048_0000034_38609_38872 87
747 3300049582 Ga0501048_0000722 Ga0501048_0000722_6921_7184 87
748 3300049582 Ga0501048_0068470 Ga0501048_0068470_1361_1624 87
749 3300049582 Ga0501048_0565409 Ga0501048_0565409_31_306 87
750 3300049583 Ga0501067_0000594 Ga0501067_0000594_16250_16513 87
751 3300049583 Ga0501067_0003934 Ga0501067_0003934_4293_4556 87
752 3300049584 Ga0501068_0000552 Ga0501068_0000552_17039_17302 87
753 3300049584 Ga0501068_0003289 Ga0501068_0003289_7520_7783 87
754 3300049584 Ga0501068_0726980 Ga0501068_0726980_54_317 87
755 3300049585 Ga0501069_0000046 Ga0501069_0000046_22958_23221 87
756 3300049585 Ga0501069_0000318 Ga0501069_0000318_17273_17536 87
757 3300049586 Ga0501070_0000073 Ga0501070_0000073_66325_66588 87
758 3300049586 Ga0501070_0002481 Ga0501070_0002481_5590_5853 87
759 3300049586 Ga0501070_0003509 Ga0501070_0003509_5067_5330 87
760 3300049586 Ga0501070_0034036 Ga0501070_0034036_1221_1490 87
761 3300049586 Ga0501070_0050594 Ga0501070_0050594_176_451 87
762 3300049586 Ga0501070_0148156 Ga0501070_0148156_1145_1408 87
763 3300049586 Ga0501070_0160607 Ga0501070_0160607_190_453 87
764 3300049586 Ga0501070_0656183 Ga0501070_0656183_471_746 87
765 3300049586 Ga0501070_1052303 Ga0501070_1052303_223_492 87
766 3300049586 Ga0501070_1116270 Ga0501070_1116270_238_516 87
767 3300049586 Ga0501070_1165427 Ga0501070_1165427_178_456 87
768 3300049586 Ga0501070_1452347 Ga0501070_1452347_41_310 87
769 3300049587 Ga0501071_0000441 Ga0501071_0000441_17076_17339 87
770 3300049587 Ga0501071_0018761 Ga0501071_0018761_2606_2869 87
771 3300049588 Ga0501072_0000658 Ga0501072_0000658_21003_21266 87
772 3300049588 Ga0501072_0004362 Ga0501072_0004362_9417_9680 87
773 3300049588 Ga0501072_0944866 Ga0501072_0944866_111_374 87
774 3300049589 Ga0501073_0000239 Ga0501073_0000239_29290_29553 87
775 3300049589 Ga0501073_0000323 Ga0501073_0000323_13262_13525 87
776 3300049589 Ga0501073_0129600 Ga0501073_0129600_654_917 87
777 3300049590 Ga0501074_0000025 Ga0501074_0000025_19655_19918 87
778 3300049590 Ga0501074_0000093 Ga0501074_0000093_10219_10482 87
779 3300049590 Ga0501074_0212978 Ga0501074_0212978_203_466 87
780 3300049590 Ga0501074_0934344 Ga0501074_0934344_112_375 87
781 3300049591 Ga0501075_0718076 Ga0501075_0718076_260_523 87
782 3300049592 Ga0501076_0494943 Ga0501076_0494943_323_586 87
783 3300049593 Ga0501077_0051655 Ga0501077_0051655_795_1058 87
784 3300049741 Ga0501079_0000862 Ga0501079_0000862_2582_2845 87
785 3300049741 Ga0501079_0001388 Ga0501079_0001388_14610_14873 87
786 3300049741 Ga0501079_0542036 Ga0501079_0542036_584_847 87
787 3300049742 Ga0501080_0000037 Ga0501080_0000037_15779_16042 87
788 3300049742 Ga0501080_0000635 Ga0501080_0000635_6744_7007 87
789 3300049742 Ga0501080_0050016 Ga0501080_0050016_338_601 87
790 3300049742 Ga0501080_0362973 Ga0501080_0362973_133_402 87
791 3300049742 Ga0501080_0544921 Ga0501080_0544921_253_528 87
792 3300049744 Ga0501083_0000350 Ga0501083_0000350_27031_27294 87
793 3300049744 Ga0501083_0004275 Ga0501083_0004275_7596_7859 87
794 3300049744 Ga0501083_1075206 Ga0501083_1075206_236_502 87
795 3300049822 Ga0501035_0000045 Ga0501035_0000045_112907_113182 87
796 3300049822 Ga0501035_0000141 Ga0501035_0000141_66315_66578 87
797 3300049822 Ga0501035_0000172 Ga0501035_0000172_72433_72696 87
798 3300049822 Ga0501035_0002255 Ga0501035_0002255_559_822 87
799 3300049822 Ga0501035_0003323 Ga0501035_0003323_11311_11589 87
800 3300049822 Ga0501035_0248701 Ga0501035_0248701_461_730 87
801 3300049822 Ga0501035_0269648 Ga0501035_0269648_758_1027 87
802 3300049822 Ga0501035_0370745 Ga0501035_0370745_615_890 87
803 3300049822 Ga0501035_1221369 Ga0501035_1221369_171_434 87
804 3300049823 Ga0501044_0000044 Ga0501044_0000044_35524_35799 87
805 3300049823 Ga0501044_0000151 Ga0501044_0000151_66391_66654 87
806 3300049823 Ga0501044_0001408 Ga0501044_0001408_6508_6771 87
807 3300049823 Ga0501044_0006037 Ga0501044_0006037_559_822 87
808 3300049823 Ga0501044_0016838 Ga0501044_0016838_5622_5900 87
809 3300049823 Ga0501044_0046475 Ga0501044_0046475_3292_3567 87
810 3300049823 Ga0501044_0133777 Ga0501044_0133777_1756_2019 87
811 3300049823 Ga0501044_0162676 Ga0501044_0162676_299_562 87
812 3300049823 Ga0501044_0319675 Ga0501044_0319675_482_751 87
813 3300049823 Ga0501044_0385583 Ga0501044_0385583_432_710 87
814 3300049823 Ga0501044_0800658 Ga0501044_0800658_73_336 87
815 3300049824 Ga0501045_0000540 Ga0501045_0000540_6350_6613 87
816 3300049824 Ga0501045_0033573 Ga0501045_0033573_1525_1788 87
817 3300049824 Ga0501045_0376772 Ga0501045_0376772_533_808 87
818 3300050490 nmdc:mga03n38_13425_c1 nmdc:mga03n38_13425_c1_2250_2531 87
819 3300050491 nmdc:mga00v17_36982_c1 nmdc:mga00v17_36982_c1_1816_2097 87
820 3300050492 nmdc:mga0yw44_293469_c1 nmdc:mga0yw44_293469_c1_376_654 87
821 3300050492 nmdc:mga0yw44_364359_c1 nmdc:mga0yw44_364359_c1_364_627 87
822 3300050492 nmdc:mga0yw44_405537_c1 nmdc:mga0yw44_405537_c1_555_818 87
823 3300050492 nmdc:mga0yw44_446_c1 nmdc:mga0yw44_446_c1_11470_11751 87
824 3300050492 nmdc:mga0yw44_59982_c1 nmdc:mga0yw44_59982_c1_262_525 87
825 3300050494 nmdc:mga06z11_5260_c2 nmdc:mga06z11_5260_c2_1282_1563 87
826 3300050496 nmdc:mga07m45_278897_c1 nmdc:mga07m45_278897_c1_341_622 87
827 3300050507 nmdc:mga05p37_1942916_c1 nmdc:mga05p37_1942916_c1_168_446 87
828 3300050512 nmdc:mga0n895_821034_c1 nmdc:mga0n895_821034_c1_47_328 87
829 3300050512 nmdc:mga0n895_838897_c1 nmdc:mga0n895_838897_c1_564_842 87
830 3300050513 nmdc:mga0rr50_474993_c1 nmdc:mga0rr50_474993_c1_202_480 87
831 3300050516 nmdc:mga0sz30_248264_c1 nmdc:mga0sz30_248264_c1_380_655 87
832 3300053078 Ga0495612_0227018 Ga0495612_0227018_371_634 87
833 3300053079 Ga0500610_0272263 Ga0500610_0272263_175_459 87
834 3300053111 Ga0500572_087132 Ga0500572_087132_611_874 87
835 3300053121 Ga0500607_206381 Ga0500607_206381_200_463 87
836 3300053122 Ga0500608_369581 Ga0500608_369581_185_448 87
837 3300053136 Ga0500559_0016276 Ga0500559_0016276_1709_1972 87
838 3300053136 Ga0500559_0064957 Ga0500559_0064957_1218_1487 87
839 3300053148 Ga0500590_098151 Ga0500590_098151_818_1081 87
840 3300053148 Ga0500590_140551 Ga0500590_140551_498_767 87
841 3300053158 Ga0500627_0000048 Ga0500627_0000048_54269_54538 87
842 3300053158 Ga0500627_0310374 Ga0500627_0310374_266_529 87
843 3300053159 Ga0500630_146903 Ga0500630_146903_95_364 87
844 3300053163 Ga0500639_000710 Ga0500639_000710_1711_1980 87
845 3300053163 Ga0500639_342776 Ga0500639_342776_22_285 87
846 3300053177 Ga0500636_0017863 Ga0500636_0017863_3242_3517 87
847 3300054114 Ga0501084_0002854 Ga0501084_0002854_12091_12354 87
848 3300054114 Ga0501084_0024934 Ga0501084_0024934_2403_2666 87
849 3300060353 Ga0501082_0000355 Ga0501082_0000355_30823_31086 87
850 3300060353 Ga0501082_0004972 Ga0501082_0004972_2411_2674 87
851 3300060353 Ga0501082_0574454 Ga0501082_0574454_496_759 87
852 3300060353 Ga0501082_0619322 Ga0501082_0619322_628_903 87
853 3300061734 Ga0530510_0471544 Ga0530510_0471544_577_840 87
854 3300061734 Ga0530510_1454721 Ga0530510_1454721_34_297 87
855 iso_pu_bacteria 2510461069 2510840207 87
856 iso_pu_bacteria 2512564014 2512643129 87
857 iso_pu_bacteria 2513237086 2513587407 87
858 iso_pu_bacteria 2513237087 2513592869 87
859 iso_pu_bacteria 2513237137 2513863418 87
860 iso_pu_bacteria 2513237137 2513864015 87
861 iso_pu_bacteria 2513237137 2513864337 87
862 iso_pu_bacteria 2513237139 2513879740 87
863 iso_pu_bacteria 2515154112 2515630447 87
864 iso_pu_bacteria 2516143018 2516205842 87
865 iso_pu_bacteria 2517093001 2517108042 87
866 iso_pu_bacteria 2517572143 2517887621 87
867 iso_pu_bacteria 2524023210 2524471174 87
868 iso_pu_bacteria 2537561587 2537876283 87
869 iso_pu_bacteria 2558860100 2558860116 87
870 iso_pu_bacteria 2802429603 2805922871 87
871 iso_pu_bacteria 2824746037 2824749504 87
872 iso_pu_bacteria 2841734538 2841739822 87
873 iso_pu_bacteria 2841941048 2841949314 87
874 iso_pu_bacteria 2841949485 2841957603 87
875 iso_pu_bacteria 2841974524 2841981412 87
876 iso_pu_bacteria 2842348783 2842353381 87
877 iso_pu_bacteria 2842357229 2842362954 87
878 iso_pu_bacteria 2847930680 2847931650 87
879 iso_pu_bacteria 2847939898 2847942908 87
880 iso_pu_bacteria 2885366525 2885370898 87
881 iso_pu_bacteria 2888378607 2888378947 87
882 iso_pu_bacteria 2891088606 2891091104 87
883 iso_pu_bacteria 2891088606 2891093067 87
884 iso_pu_bacteria 2904456579 2904457263 87
885 iso_pu_bacteria 2908775508 2908775568 87
886 iso_pu_bacteria 2909399089 2909401321 87
887 iso_pu_bacteria 2921201388 2921204170 87
888 iso_pu_bacteria 2921201388 2921204181 87
889 iso_pu_bacteria 2924207177 2924213175 87
890 iso_pu_bacteria 2929624759 2929633516 87
891 iso_pu_bacteria 2935675223 2935684680 87
892 iso_pu_bacteria 2935703347 2935712846 87
893 iso_pu_bacteria 2935769743 2935775723 87
894 iso_pu_bacteria 2935785616 2935792640 87
895 iso_pu_bacteria 2935793552 2935800680 87
896 iso_pu_bacteria 2935975950 2935982902 87
897 iso_pu_bacteria 2935992306 2936001301 87
898 iso_pu_bacteria 2936055302 2936055758 87
899 iso_pu_bacteria 2937063883 2937070220 87
900 iso_pu_bacteria 2937106411 2937107067 87
901 iso_pu_bacteria 2937106411 2937108153 87
902 iso_pu_bacteria 2941531003 2941537586 87
903 iso_pu_bacteria 2945972063 2945976203 87
904 iso_pu_bacteria 2960637947 2960643157 87
905 iso_pu_bacteria 2964628898 2964629386 87
906 iso_pu_bacteria 2964663802 2964669044 87
907 iso_pu_bacteria 2964719344 2964724886 87
908 iso_pu_bacteria 2967664464 2967664770 87
909 iso_pu_bacteria 2967664464 2967666565 87
910 iso_pu_bacteria 2967996073 2968002693 87
911 iso_pu_bacteria 2970033650 2970039059 87
912 iso_pu_bacteria 2970068827 2970074217 87
913 iso_pu_bacteria 2970082768 2970087708 87
914 iso_pu_bacteria 2977986579 2977987225 87
915 iso_pu_bacteria 3005710791 3005717076 87
916 iso_pu_bacteria 643348555 643392334 87
917 iso_pu_bacteria 8016622563 8016630928 87
918 iso_pu_bacteria 8019538911 8019542106 87
919 iso_pu_bacteria 8019547302 8019547555 87
920 iso_pu_bacteria 8019586578 8019592614 87
921 iso_pu_bacteria 8019619141 8019622325 87
922 iso_pu_bacteria 8019629233 8019630986 87
923 iso_pu_bacteria 8019638758 8019639636 87
924 iso_pu_bacteria 8019678201 8019687771 87
925 iso_pu_bacteria 8023680758 8023688463 87
926 iso_pu_bacteria 8055742211 8055743068 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05101

VirB3

Type IV secretory pathway, VirB3-like protein

13

80

0.87

Feature Viewer

pLDDT pTM Quality
78.92 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map