F485913
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 926 | 511 | 708 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10547243|Ga0075364_105472432 |
| Length | 83 |
| Sequence | MSEILTHDPIPGFEAPVHRALTEPILLGGAPRAVAITNGTLAAVVGLGLRLWIHMAAVWAARRDAQFVDVVRRHLRYPSHLGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 5 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 6 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 7 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 8 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 9 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 19 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 20 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 21 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 22 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 23 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 24 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 25 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 26 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 29 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 30 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 31 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 32 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 33 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 34 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 35 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 39 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 40 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 41 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 42 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 43 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 44 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 45 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 46 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 47 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 50 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 51 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 52 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 53 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 54 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 55 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 56 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 57 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 58 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 59 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 60 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 61 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 62 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 63 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 64 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 65 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 66 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 67 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 68 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 69 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 70 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 71 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 72 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 73 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 74 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 75 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 76 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 77 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 78 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 79 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 80 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 81 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 82 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 83 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 84 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 85 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 86 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 87 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 88 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 89 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 90 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 91 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 92 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 93 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 94 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 95 | 2922368715 | |||
| 96 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 97 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 98 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 99 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 100 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 101 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 102 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 103 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 104 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 105 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 106 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 107 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 108 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 109 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 110 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 111 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 112 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 113 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 114 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 115 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 116 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 117 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 118 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 119 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 120 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 121 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 122 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 123 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 124 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 125 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 126 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 127 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 128 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 129 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 130 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 131 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 132 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 133 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 134 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 135 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 136 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 137 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 138 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 139 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 140 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 141 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 142 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 143 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 144 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 145 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 146 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 147 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 148 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 149 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 150 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 151 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 152 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 153 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 154 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 155 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 156 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 157 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 158 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 159 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 160 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 161 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 162 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 163 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 164 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 165 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 166 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 167 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 168 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 169 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 170 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 171 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 174 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 177 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 184 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 189 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 191 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 192 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 194 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 197 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 200 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 201 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 202 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 203 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 204 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 205 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 206 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 207 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 208 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 209 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 210 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 211 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 212 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 213 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 215 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 216 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 217 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 218 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 219 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 220 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 221 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 222 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 223 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 224 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 225 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 227 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 228 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 229 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 230 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 231 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 243 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 254 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 256 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 257 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 258 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 259 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 260 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 261 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 262 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 263 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 264 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 267 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 312 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 313 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 314 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 315 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 320 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 321 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 322 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 323 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 324 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 325 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 326 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 327 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 328 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 329 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 330 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 331 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 332 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 333 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 334 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 335 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 336 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 337 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 338 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 339 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 340 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 341 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 342 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 343 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 344 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 345 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 346 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 347 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 348 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 349 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 350 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 351 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 352 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 353 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 354 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 355 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 356 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 357 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 358 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 359 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 360 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 361 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 362 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 363 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 364 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 365 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 366 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 367 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 368 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 369 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 370 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 371 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 372 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 373 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 374 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 375 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 376 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 377 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 378 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 379 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 380 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 381 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 413 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 414 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 415 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 416 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 417 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 418 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 419 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 420 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 421 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 422 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 423 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 424 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 425 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 426 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 427 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 428 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 429 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 430 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 431 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 432 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 433 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 434 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 471 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 476 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 478 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 479 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 480 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 481 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 482 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 483 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 485 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 486 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 487 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 490 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 491 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 492 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 493 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 494 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 495 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 496 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 497 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 498 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 499 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 500 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 501 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 502 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 503 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 504 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 505 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 506 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 507 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 508 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 509 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 510 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 511 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.54 |
| Metatranscriptomes | 0 |
| Isolates | 23.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.05 |
| Nodule | 19.22 |
| Rhizoplane | 3.67 |
| Rhizosphere | 56.8 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 14.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1033777 | 3300002074 | Bacteria | 638 |
| 2 | JGI25150J39212_1000241 | 3300002774 | Bacteria | 29238 |
| 3 | JGI25151J46595_10048672 | 3300003187 | Bacteria | 1462 |
| 4 | JGI25165J46597_1000078 | 3300003214 | Bacteria | 179320 |
| 5 | JGI25153J46596_10000109 | 3300003215 | Bacteria | 93661 |
| 6 | JGI25153J46596_10080839 | 3300003215 | Bacteria | 811 |
| 7 | rootH2_10005575 | 3300003320 | Bacteria | 33191 |
| 8 | JGI25160J50197_1007209 | 3300003354 | Bacteria | 4378 |
| 9 | Ga0055539_1007703 | 3300003752 | Bacteria | 1357 |
| 10 | JGI25405J52794_10004874 | 3300003911 | Bacteria | 2405 |
| 11 | JGI25405J52794_10049593 | 3300003911 | Bacteria | 898 |
| 12 | Ga0065165_1003688 | 3300005262 | Bacteria | 10405 |
| 13 | Ga0065165_1100151 | 3300005262 | Bacteria | 726 |
| 14 | Ga0070683_100430387 | 3300005329 | Bacteria | 1259 |
| 15 | Ga0070670_100901191 | 3300005331 | Bacteria | 802 |
| 16 | Ga0068869_100920507 | 3300005334 | Bacteria | 757 |
| 17 | Ga0070666_10000070 | 3300005335 | Bacteria | 75681 |
| 18 | Ga0070666_10234077 | 3300005335 | Bacteria | 1298 |
| 19 | Ga0070660_100597097 | 3300005339 | Bacteria | 923 |
| 20 | Ga0070689_100553301 | 3300005340 | Bacteria | 992 |
| 21 | Ga0070661_100315783 | 3300005344 | Bacteria | 1219 |
| 22 | Ga0070668_100000213 | 3300005347 | Bacteria | 37697 |
| 23 | Ga0070675_101168365 | 3300005354 | Bacteria | 708 |
| 24 | Ga0070674_100301410 | 3300005356 | Bacteria | 1278 |
| 25 | Ga0070667_100000265 | 3300005367 | Bacteria | 59228 |
| 26 | Ga0070667_100004158 | 3300005367 | Bacteria | 12232 |
| 27 | Ga0070667_100341773 | 3300005367 | Bacteria | 1354 |
| 28 | Ga0070667_101022885 | 3300005367 | Bacteria | 771 |
| 29 | Ga0070714_100123365 | 3300005435 | Bacteria | 2307 |
| 30 | Ga0070713_100904326 | 3300005436 | Bacteria | 849 |
| 31 | Ga0070710_10437540 | 3300005437 | Bacteria | 884 |
| 32 | Ga0070711_100822773 | 3300005439 | Bacteria | 789 |
| 33 | Ga0070708_100000110 | 3300005445 | Bacteria | 54449 |
| 34 | Ga0070708_100886377 | 3300005445 | Bacteria | 838 |
| 35 | Ga0070663_100377712 | 3300005455 | Bacteria | 1153 |
| 36 | Ga0070681_11038737 | 3300005458 | Bacteria | 740 |
| 37 | Ga0070706_100119639 | 3300005467 | Bacteria | 2455 |
| 38 | Ga0070706_101973261 | 3300005467 | Bacteria | 529 |
| 39 | Ga0070707_100089793 | 3300005468 | Bacteria | 2973 |
| 40 | Ga0070698_100114061 | 3300005471 | Bacteria | 2667 |
| 41 | Ga0070699_100002841 | 3300005518 | Bacteria | 15448 |
| 42 | Ga0070699_101053102 | 3300005518 | Bacteria | 746 |
| 43 | Ga0070679_100328060 | 3300005530 | Bacteria | 1479 |
| 44 | Ga0070684_100014485 | 3300005535 | Bacteria | 6391 |
| 45 | Ga0070697_100412149 | 3300005536 | Bacteria | 1173 |
| 46 | Ga0070697_101253889 | 3300005536 | Bacteria | 661 |
| 47 | Ga0068853_100486359 | 3300005539 | Bacteria | 1164 |
| 48 | Ga0070672_101261214 | 3300005543 | Bacteria | 659 |
| 49 | Ga0070665_100010760 | 3300005548 | Bacteria | 9256 |
| 50 | Ga0070665_100075943 | 3300005548 | Bacteria | 3367 |
| 51 | Ga0070665_100132284 | 3300005548 | Bacteria | 2497 |
| 52 | Ga0070665_100603004 | 3300005548 | Bacteria | 1111 |
| 53 | Ga0070665_101784949 | 3300005548 | Bacteria | 622 |
| 54 | Ga0068855_100842910 | 3300005563 | Bacteria | 972 |
| 55 | Ga0068855_101341809 | 3300005563 | Bacteria | 739 |
| 56 | Ga0068857_101509262 | 3300005577 | Bacteria | 655 |
| 57 | Ga0068856_100757682 | 3300005614 | Bacteria | 991 |
| 58 | Ga0068856_100945012 | 3300005614 | Bacteria | 881 |
| 59 | Ga0068856_102255983 | 3300005614 | Bacteria | 553 |
| 60 | Ga0068852_101643689 | 3300005616 | Bacteria | 665 |
| 61 | Ga0068859_100259523 | 3300005617 | Bacteria | 1829 |
| 62 | Ga0068864_100431590 | 3300005618 | Bacteria | 1257 |
| 63 | Ga0068866_10735332 | 3300005718 | Bacteria | 680 |
| 64 | Ga0068861_100701407 | 3300005719 | Bacteria | 940 |
| 65 | Ga0068863_100000182 | 3300005841 | Bacteria | 67022 |
| 66 | Ga0068858_101023872 | 3300005842 | Bacteria | 809 |
| 67 | Ga0068862_100459509 | 3300005844 | Bacteria | 1202 |
| 68 | Ga0068862_100584170 | 3300005844 | Bacteria | 1070 |
| 69 | Ga0081455_10000553 | 3300005937 | Bacteria | 48602 |
| 70 | Ga0081455_10021584 | 3300005937 | Bacteria | 6036 |
| 71 | Ga0081455_10252359 | 3300005937 | Bacteria | 1289 |
| 72 | Ga0081455_10984546 | 3300005937 | Bacteria | 522 |
| 73 | Ga0081540_1060731 | 3300005983 | Bacteria | 1806 |
| 74 | Ga0081539_10000412 | 3300005985 | Bacteria | 91177 |
| 75 | Ga0081539_10002962 | 3300005985 | Bacteria | 22308 |
| 76 | Ga0070717_10249288 | 3300006028 | Bacteria | 1568 |
| 77 | Ga0075365_10104210 | 3300006038 | Bacteria | 1945 |
| 78 | Ga0075365_10930555 | 3300006038 | Bacteria | 613 |
| 79 | Ga0075368_10440705 | 3300006042 | Bacteria | 576 |
| 80 | Ga0075364_10547243 | 3300006051 | Bacteria | 791 |
| 81 | Ga0075432_10474177 | 3300006058 | Bacteria | 553 |
| 82 | Ga0070712_100167703 | 3300006175 | Bacteria | 1701 |
| 83 | Ga0070712_100234107 | 3300006175 | Bacteria | 1460 |
| 84 | Ga0075362_10672043 | 3300006177 | Bacteria | 539 |
| 85 | Ga0075369_10066805 | 3300006186 | Bacteria | 1578 |
| 86 | Ga0075428_100103244 | 3300006844 | Bacteria | 3109 |
| 87 | Ga0075431_100649301 | 3300006847 | Bacteria | 1036 |
| 88 | Ga0075429_100227466 | 3300006880 | Bacteria | 1634 |
| 89 | Ga0075429_100430258 | 3300006880 | Bacteria | 1156 |
| 90 | Ga0068865_101170254 | 3300006881 | Bacteria | 680 |
| 91 | Ga0097620_100259504 | 3300006931 | Bacteria | 1829 |
| 92 | Ga0099824_1017053 | 3300006942 | Bacteria | 6413 |
| 93 | Ga0099824_1026543 | 3300006942 | Bacteria | 2965 |
| 94 | Ga0099822_1005508 | 3300006943 | Bacteria | 16531 |
| 95 | Ga0099822_1040047 | 3300006943 | Bacteria | 2638 |
| 96 | Ga0099823_1006666 | 3300006944 | Bacteria | 11679 |
| 97 | Ga0099823_1008537 | 3300006944 | Bacteria | 10423 |
| 98 | Ga0099794_10600897 | 3300007265 | Bacteria | 583 |
| 99 | Ga0099795_10002155 | 3300007788 | Bacteria | 4545 |
| 100 | Ga0099795_10363680 | 3300007788 | Bacteria | 650 |
| 101 | Ga0099795_10557850 | 3300007788 | Bacteria | 541 |
| 102 | Ga0105240_10441959 | 3300009093 | Bacteria | 1457 |
| 103 | Ga0105240_10454237 | 3300009093 | Bacteria | 1433 |
| 104 | Ga0105240_11082509 | 3300009093 | Bacteria | 854 |
| 105 | Ga0105240_11638491 | 3300009093 | Bacteria | 673 |
| 106 | Ga0111539_10636226 | 3300009094 | Bacteria | 1242 |
| 107 | Ga0105247_10261431 | 3300009101 | Bacteria | 1187 |
| 108 | Ga0105247_10490664 | 3300009101 | Bacteria | 893 |
| 109 | Ga0114129_10382564 | 3300009147 | Bacteria | 1858 |
| 110 | Ga0105243_10616584 | 3300009148 | Bacteria | 1047 |
| 111 | Ga0105241_11020926 | 3300009174 | Bacteria | 775 |
| 112 | Ga0105242_12156190 | 3300009176 | Bacteria | 602 |
| 113 | Ga0105248_10514797 | 3300009177 | Bacteria | 1349 |
| 114 | Ga0105237_10001960 | 3300009545 | Bacteria | 26199 |
| 115 | Ga0105237_11128908 | 3300009545 | Bacteria | 791 |
| 116 | Ga0105237_11215390 | 3300009545 | Bacteria | 760 |
| 117 | Ga0105237_11419272 | 3300009545 | Bacteria | 701 |
| 118 | Ga0105238_10007211 | 3300009551 | Bacteria | 11128 |
| 119 | Ga0105238_10009768 | 3300009551 | Bacteria | 9609 |
| 120 | Ga0105249_12491139 | 3300009553 | Bacteria | 590 |
| 121 | Ga0099796_10031166 | 3300010159 | Bacteria | 1737 |
| 122 | Ga0099796_10316587 | 3300010159 | Bacteria | 665 |
| 123 | Ga0099796_10327338 | 3300010159 | Bacteria | 655 |
| 124 | Ga0105239_10000851 | 3300010375 | Bacteria | 43464 |
| 125 | Ga0105239_10216212 | 3300010375 | Bacteria | 2149 |
| 126 | Ga0105239_10751148 | 3300010375 | Bacteria | 1116 |
| 127 | Ga0105239_10911899 | 3300010375 | Bacteria | 1009 |
| 128 | Ga0105239_11558967 | 3300010375 | Bacteria | 764 |
| 129 | Ga0105246_10129507 | 3300011119 | Bacteria | 1882 |
| 130 | Ga0105246_10736472 | 3300011119 | Bacteria | 868 |
| 131 | Ga0105246_10738613 | 3300011119 | Bacteria | 867 |
| 132 | Ga0157373_10333726 | 3300013100 | Bacteria | 1080 |
| 133 | Ga0157370_10357239 | 3300013104 | Bacteria | 1346 |
| 134 | Ga0157370_11923943 | 3300013104 | Bacteria | 530 |
| 135 | Ga0157369_10244210 | 3300013105 | Bacteria | 1875 |
| 136 | Ga0157378_11229318 | 3300013297 | Bacteria | 789 |
| 137 | Ga0157378_13191711 | 3300013297 | Bacteria | 509 |
| 138 | Ga0163162_10257491 | 3300013306 | Bacteria | 1877 |
| 139 | Ga0163162_10305437 | 3300013306 | Bacteria | 1723 |
| 140 | Ga0163162_11851734 | 3300013306 | Bacteria | 690 |
| 141 | Ga0157372_10765329 | 3300013307 | Bacteria | 1123 |
| 142 | Ga0157372_10953985 | 3300013307 | Bacteria | 994 |
| 143 | Ga0157375_10005116 | 3300013308 | Bacteria | 11384 |
| 144 | Ga0157375_13333320 | 3300013308 | Bacteria | 535 |
| 145 | Ga0163163_10000007 | 3300014325 | Bacteria | 288439 |
| 146 | Ga0182008_10085263 | 3300014497 | Bacteria | 1556 |
| 147 | Ga0157379_10477846 | 3300014968 | Bacteria | 1153 |
| 148 | Ga0214544_1006236 | 3300021320 | Bacteria | 22202 |
| 149 | Ga0214544_1010201 | 3300021320 | Bacteria | 14017 |
| 150 | Ga0214544_1034719 | 3300021320 | Bacteria | 1397 |
| 151 | Ga0214542_1006137 | 3300021321 | Bacteria | 22200 |
| 152 | Ga0214542_1021169 | 3300021321 | Bacteria | 4560 |
| 153 | Ga0214542_1029560 | 3300021321 | Bacteria | 2229 |
| 154 | Ga0214542_1037224 | 3300021321 | Bacteria | 1397 |
| 155 | Ga0214545_1005727 | 3300021324 | Bacteria | 22200 |
| 156 | Ga0214543_1005902 | 3300021327 | Bacteria | 22184 |
| 157 | Ga0214543_1015885 | 3300021327 | Bacteria | 8132 |
| 158 | Ga0214543_1024724 | 3300021327 | Bacteria | 3640 |
| 159 | Ga0213872_10111817 | 3300021361 | Bacteria | 1213 |
| 160 | Ga0213874_10030608 | 3300021377 | Bacteria | 1552 |
| 161 | Ga0213876_10013411 | 3300021384 | Bacteria | 4353 |
| 162 | Ga0213875_10007585 | 3300021388 | Bacteria | 5594 |
| 163 | Ga0213875_10016645 | 3300021388 | Bacteria | 3563 |
| 164 | Ga0213875_10081267 | 3300021388 | Bacteria | 1512 |
| 165 | Ga0207425_1000073 | 3300025245 | Bacteria | 113233 |
| 166 | Ga0209677_101722 | 3300025253 | Bacteria | 9099 |
| 167 | Ga0209677_125457 | 3300025253 | Bacteria | 639 |
| 168 | Ga0209148_1000126 | 3300025254 | Bacteria | 181590 |
| 169 | Ga0209148_1001202 | 3300025254 | Bacteria | 14746 |
| 170 | Ga0209129_1000352 | 3300025258 | Bacteria | 38789 |
| 171 | Ga0209233_1000150 | 3300025261 | Bacteria | 179401 |
| 172 | Ga0209233_1016987 | 3300025261 | Bacteria | 1992 |
| 173 | Ga0209455_1000280 | 3300025272 | Bacteria | 55431 |
| 174 | Ga0209455_1025699 | 3300025272 | Bacteria | 1066 |
| 175 | Ga0209025_1000202 | 3300025294 | Bacteria | 145750 |
| 176 | Ga0209758_1000138 | 3300025297 | Bacteria | 175187 |
| 177 | Ga0209758_1000242 | 3300025297 | Bacteria | 113233 |
| 178 | Ga0209758_1000825 | 3300025297 | Bacteria | 43413 |
| 179 | Ga0209758_1002094 | 3300025297 | Bacteria | 21207 |
| 180 | Ga0207426_1001196 | 3300025302 | Bacteria | 23050 |
| 181 | Ga0207688_10011238 | 3300025901 | Bacteria | 4871 |
| 182 | Ga0207688_10232773 | 3300025901 | Bacteria | 1112 |
| 183 | Ga0207680_10000044 | 3300025903 | Bacteria | 64236 |
| 184 | Ga0207680_10056518 | 3300025903 | Bacteria | 2370 |
| 185 | Ga0207647_10147677 | 3300025904 | Bacteria | 1375 |
| 186 | Ga0207647_10255536 | 3300025904 | Bacteria | 1004 |
| 187 | Ga0207647_10394698 | 3300025904 | Bacteria | 780 |
| 188 | Ga0207647_10410330 | 3300025904 | Bacteria | 762 |
| 189 | Ga0207645_10269951 | 3300025907 | Bacteria | 1128 |
| 190 | Ga0207705_10119611 | 3300025909 | Bacteria | 1953 |
| 191 | Ga0207684_10190504 | 3300025910 | Bacteria | 1769 |
| 192 | Ga0207654_11082846 | 3300025911 | Bacteria | 584 |
| 193 | Ga0207695_10211799 | 3300025913 | Bacteria | 1848 |
| 194 | Ga0207695_10283950 | 3300025913 | Bacteria | 1549 |
| 195 | Ga0207695_10331732 | 3300025913 | Bacteria | 1410 |
| 196 | Ga0207695_10335354 | 3300025913 | Bacteria | 1400 |
| 197 | Ga0207671_10000106 | 3300025914 | Bacteria | 129102 |
| 198 | Ga0207693_10489409 | 3300025915 | Bacteria | 960 |
| 199 | Ga0207693_10810526 | 3300025915 | Bacteria | 721 |
| 200 | Ga0207660_11431873 | 3300025917 | Bacteria | 559 |
| 201 | Ga0207662_10220112 | 3300025918 | Bacteria | 1236 |
| 202 | Ga0207657_10000052 | 3300025919 | Bacteria | 108384 |
| 203 | Ga0207657_10741033 | 3300025919 | Bacteria | 762 |
| 204 | Ga0207646_10043207 | 3300025922 | Bacteria | 4048 |
| 205 | Ga0207681_10657165 | 3300025923 | Bacteria | 869 |
| 206 | Ga0207694_10005525 | 3300025924 | Bacteria | 9695 |
| 207 | Ga0207694_10044212 | 3300025924 | Bacteria | 3440 |
| 208 | Ga0207650_10693081 | 3300025925 | Bacteria | 860 |
| 209 | Ga0207659_10309274 | 3300025926 | Bacteria | 1301 |
| 210 | Ga0207664_10473053 | 3300025929 | Bacteria | 1120 |
| 211 | Ga0207690_11149789 | 3300025932 | Bacteria | 647 |
| 212 | Ga0207686_10545233 | 3300025934 | Bacteria | 906 |
| 213 | Ga0207686_11321418 | 3300025934 | Bacteria | 592 |
| 214 | Ga0207670_10500582 | 3300025936 | Bacteria | 986 |
| 215 | Ga0207669_10492310 | 3300025937 | Bacteria | 979 |
| 216 | Ga0207669_10860249 | 3300025937 | Bacteria | 755 |
| 217 | Ga0207711_10481755 | 3300025941 | Bacteria | 1156 |
| 218 | Ga0207689_10049823 | 3300025942 | Bacteria | 3455 |
| 219 | Ga0207661_10003110 | 3300025944 | Bacteria | 11487 |
| 220 | Ga0207661_10433553 | 3300025944 | Bacteria | 1195 |
| 221 | Ga0207667_10429990 | 3300025949 | Bacteria | 1343 |
| 222 | Ga0207667_10685710 | 3300025949 | Bacteria | 1028 |
| 223 | Ga0207667_10746048 | 3300025949 | Bacteria | 979 |
| 224 | Ga0207668_10000141 | 3300025972 | Bacteria | 49147 |
| 225 | Ga0207668_10509811 | 3300025972 | Bacteria | 1036 |
| 226 | Ga0207640_10365282 | 3300025981 | Bacteria | 1164 |
| 227 | Ga0207658_10000703 | 3300025986 | Bacteria | 29036 |
| 228 | Ga0207658_10002689 | 3300025986 | Bacteria | 12840 |
| 229 | Ga0207658_11662465 | 3300025986 | Bacteria | 583 |
| 230 | Ga0207703_10208854 | 3300026035 | Bacteria | 1739 |
| 231 | Ga0207639_10014746 | 3300026041 | Bacteria | 5505 |
| 232 | Ga0207678_10157371 | 3300026067 | Bacteria | 1940 |
| 233 | Ga0207702_10225493 | 3300026078 | Bacteria | 1748 |
| 234 | Ga0207641_10000102 | 3300026088 | Bacteria | 122366 |
| 235 | Ga0207676_10402596 | 3300026095 | Bacteria | 1279 |
| 236 | Ga0207674_11828357 | 3300026116 | Bacteria | 574 |
| 237 | Ga0207675_100010642 | 3300026118 | Bacteria | 8619 |
| 238 | Ga0207698_10416023 | 3300026142 | Bacteria | 1289 |
| 239 | Ga0207698_10701812 | 3300026142 | Bacteria | 1007 |
| 240 | Ga0209389_1000003 | 3300027296 | Bacteria | 268927 |
| 241 | Ga0209389_1000055 | 3300027296 | Bacteria | 108798 |
| 242 | Ga0209389_1000263 | 3300027296 | Bacteria | 33281 |
| 243 | Ga0209389_1000404 | 3300027296 | Bacteria | 25712 |
| 244 | Ga0209389_1005813 | 3300027296 | Bacteria | 10594 |
| 245 | Ga0209589_1000008 | 3300027357 | Bacteria | 259970 |
| 246 | Ga0209589_1000024 | 3300027357 | Bacteria | 169886 |
| 247 | Ga0209589_1003752 | 3300027357 | Bacteria | 26510 |
| 248 | Ga0209489_100123 | 3300027361 | Bacteria | 113105 |
| 249 | Ga0209489_100474 | 3300027361 | Bacteria | 75317 |
| 250 | Ga0209489_102905 | 3300027361 | Bacteria | 34209 |
| 251 | Ga0209489_103245 | 3300027361 | Bacteria | 31992 |
| 252 | Ga0209489_104558 | 3300027361 | Bacteria | 25379 |
| 253 | Ga0209700_100029 | 3300027363 | Bacteria | 214607 |
| 254 | Ga0209700_100046 | 3300027363 | Bacteria | 159296 |
| 255 | Ga0209179_1002531 | 3300027512 | Bacteria | 2486 |
| 256 | Ga0209588_1055409 | 3300027671 | Bacteria | 1281 |
| 257 | Ga0268266_10000989 | 3300028379 | Bacteria | 35805 |
| 258 | Ga0268266_10037067 | 3300028379 | Bacteria | 4154 |
| 259 | Ga0268266_11017250 | 3300028379 | Bacteria | 802 |
| 260 | Ga0268265_10233430 | 3300028380 | Bacteria | 1618 |
| 261 | Ga0265337_1003812 | 3300028556 | Bacteria | 6409 |
| 262 | Ga0265334_10014683 | 3300028573 | Bacteria | 3262 |
| 263 | Ga0265334_10086606 | 3300028573 | Bacteria | 1148 |
| 264 | Ga0265334_10235687 | 3300028573 | Bacteria | 631 |
| 265 | Ga0265336_10082297 | 3300028666 | Bacteria | 960 |
| 266 | Ga0307515_10048747 | 3300028794 | Bacteria | 6397 |
| 267 | Ga0307515_10591461 | 3300028794 | Bacteria | 720 |
| 268 | Ga0265338_10018504 | 3300028800 | Bacteria | 7456 |
| 269 | Ga0265338_10075675 | 3300028800 | Bacteria | 2855 |
| 270 | Ga0265330_10364716 | 3300031235 | Bacteria | 610 |
| 271 | Ga0265332_10171240 | 3300031238 | Bacteria | 906 |
| 272 | Ga0265328_10009339 | 3300031239 | Bacteria | 3997 |
| 273 | Ga0265320_10470912 | 3300031240 | Bacteria | 555 |
| 274 | Ga0265325_10186561 | 3300031241 | Bacteria | 963 |
| 275 | Ga0265325_10186921 | 3300031241 | Bacteria | 962 |
| 276 | Ga0265325_10196001 | 3300031241 | Bacteria | 934 |
| 277 | Ga0265329_10008887 | 3300031242 | Bacteria | 3784 |
| 278 | Ga0265340_10191773 | 3300031247 | Bacteria | 921 |
| 279 | Ga0265339_10002251 | 3300031249 | Bacteria | 13948 |
| 280 | Ga0265339_10012366 | 3300031249 | Bacteria | 5214 |
| 281 | Ga0265339_10050078 | 3300031249 | Bacteria | 2285 |
| 282 | Ga0265339_10126577 | 3300031249 | Bacteria | 1309 |
| 283 | Ga0265331_10001163 | 3300031250 | Bacteria | 20063 |
| 284 | Ga0265327_10303580 | 3300031251 | Bacteria | 702 |
| 285 | Ga0265316_10015583 | 3300031344 | Bacteria | 6637 |
| 286 | Ga0265316_10203112 | 3300031344 | Bacteria | 1468 |
| 287 | Ga0265313_10009740 | 3300031595 | Bacteria | 6193 |
| 288 | Ga0265313_10053628 | 3300031595 | Bacteria | 1918 |
| 289 | Ga0265314_10010467 | 3300031711 | Bacteria | 7732 |
| 290 | Ga0265314_10024861 | 3300031711 | Bacteria | 4532 |
| 291 | Ga0265314_10105927 | 3300031711 | Bacteria | 1797 |
| 292 | Ga0265342_10021504 | 3300031712 | Bacteria | 4117 |
| 293 | Ga0265342_10467673 | 3300031712 | Bacteria | 646 |
| 294 | Ga0265342_10568331 | 3300031712 | Bacteria | 574 |
| 295 | Ga0307409_100962040 | 3300031995 | Bacteria | 870 |
| 296 | Ga0307416_100218133 | 3300032002 | Bacteria | 1827 |
| 297 | Ga0307416_101037419 | 3300032002 | Bacteria | 924 |
| 298 | Ga0307416_103807609 | 3300032002 | Bacteria | 505 |
| 299 | Ga0307414_10164372 | 3300032004 | Bacteria | 1767 |
| 300 | Ga0307414_10398990 | 3300032004 | Bacteria | 1194 |
| 301 | Ga0307414_10650244 | 3300032004 | Bacteria | 950 |
| 302 | Ga0307415_102040736 | 3300032126 | Bacteria | 559 |
| 303 | Ga0307510_10446701 | 3300033180 | Bacteria | 734 |
| 304 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 305 | Ga0315911_1000026 | 3300033442 | Bacteria | 88844 |
| 306 | Ga0373936_0043642 | 3300035113 | Bacteria | 1803 |
| 307 | Ga0373936_0074239 | 3300035113 | Bacteria | 1407 |
| 308 | Ga0373936_0206679 | 3300035113 | Bacteria | 868 |
| 309 | Ga0373954_0031430 | 3300035118 | Bacteria | 2452 |
| 310 | Ga0373935_0182472 | 3300035692 | Bacteria | 1442 |
| 311 | Ga0373927_0074351 | 3300035695 | Bacteria | 2200 |
| 312 | Ga0373927_0093766 | 3300035695 | Bacteria | 1951 |
| 313 | Ga0373927_0097680 | 3300035695 | Bacteria | 1909 |
| 314 | Ga0373927_0550939 | 3300035695 | Bacteria | 762 |
| 315 | Ga0373927_1024575 | 3300035695 | Bacteria | 544 |
| 316 | Ga0373933_0248011 | 3300035724 | Bacteria | 1146 |
| 317 | Ga0373947_0653031 | 3300035725 | Bacteria | 717 |
| 318 | Ga0373947_0697673 | 3300035725 | Bacteria | 692 |
| 319 | Ga0373937_0062495 | 3300036401 | Bacteria | 3424 |
| 320 | Ga0373925_0565612 | 3300037068 | Bacteria | 935 |
| 321 | Ga0373925_1128605 | 3300037068 | Bacteria | 645 |
| 322 | Ga0395899_0370824 | 3300037312 | Bacteria | 953 |
| 323 | Ga0395899_0497615 | 3300037312 | Bacteria | 791 |
| 324 | Ga0395900_0002291 | 3300037418 | Bacteria | 21262 |
| 325 | Ga0395900_0184311 | 3300037418 | Bacteria | 2119 |
| 326 | Ga0395900_0506319 | 3300037418 | Bacteria | 1157 |
| 327 | Ga0395898_0019531 | 3300037466 | Bacteria | 6895 |
| 328 | Ga0395898_0292056 | 3300037466 | Bacteria | 1555 |
| 329 | Ga0395905_0003413 | 3300037471 | Bacteria | 16995 |
| 330 | Ga0395905_0535534 | 3300037471 | Bacteria | 1072 |
| 331 | Ga0395905_0772097 | 3300037471 | Bacteria | 864 |
| 332 | Ga0395905_0796729 | 3300037471 | Bacteria | 848 |
| 333 | Ga0436364_0117958 | 3300037853 | Unclassified | 814 |
| 334 | Ga0436364_0167314 | 3300037853 | Bacteria | 105007 |
| 335 | Ga0436364_0226891 | 3300037853 | Bacteria | 40228 |
| 336 | Ga0436364_0494866 | 3300037853 | Bacteria | 1106 |
| 337 | Ga0436364_0543304 | 3300037853 | Bacteria | 2326 |
| 338 | Ga0436364_0749918 | 3300037853 | Bacteria | 963 |
| 339 | Ga0436364_0793320 | 3300037853 | Bacteria | 621 |
| 340 | Ga0436364_1440006 | 3300037853 | Bacteria | 636 |
| 341 | Ga0395901_0065231 | 3300038443 | Bacteria | 3791 |
| 342 | Ga0395901_0160060 | 3300038443 | Bacteria | 2365 |
| 343 | Ga0395901_0173114 | 3300038443 | Bacteria | 2265 |
| 344 | Ga0395901_0186637 | 3300038443 | Bacteria | 2174 |
| 345 | Ga0395901_0619233 | 3300038443 | Bacteria | 1089 |
| 346 | Ga0395901_1110613 | 3300038443 | Bacteria | 761 |
| 347 | Ga0395901_1522481 | 3300038443 | Bacteria | 624 |
| 348 | Ga0436365_0623764 | 3300039437 | Bacteria | 1827 |
| 349 | Ga0436365_1174990 | 3300039437 | Bacteria | 1553 |
| 350 | Ga0436365_1331505 | 3300039437 | Bacteria | 622 |
| 351 | Ga0436365_1547453 | 3300039437 | Bacteria | 851 |
| 352 | Ga0436365_1665747 | 3300039437 | Bacteria | 1814 |
| 353 | Ga0436365_1860902 | 3300039437 | Bacteria | 507 |
| 354 | Ga0436365_1876159 | 3300039437 | Bacteria | 1032 |
| 355 | Ga0436360_0251747 | 3300039438 | Bacteria | 664 |
| 356 | Ga0436360_0575218 | 3300039438 | Bacteria | 859 |
| 357 | Ga0436360_0776894 | 3300039438 | Bacteria | 537 |
| 358 | Ga0436360_0797411 | 3300039438 | Bacteria | 920 |
| 359 | Ga0436360_0859224 | 3300039438 | Bacteria | 760 |
| 360 | Ga0436360_1077870 | 3300039438 | Unclassified | 715 |
| 361 | Ga0436360_1246931 | 3300039438 | Bacteria | 1193 |
| 362 | Ga0436360_1247036 | 3300039438 | Bacteria | 2658 |
| 363 | Ga0436361_0065056 | 3300039447 | Bacteria | 517 |
| 364 | Ga0436361_0115207 | 3300039447 | Bacteria | 727 |
| 365 | Ga0436361_0185942 | 3300039447 | Bacteria | 1162 |
| 366 | Ga0436361_0224260 | 3300039447 | Bacteria | 4624 |
| 367 | Ga0436361_0289583 | 3300039447 | Bacteria | 3382 |
| 368 | Ga0436361_0456415 | 3300039447 | Bacteria | 1668 |
| 369 | Ga0436361_0778911 | 3300039447 | Bacteria | 1080 |
| 370 | Ga0436361_0820693 | 3300039447 | Bacteria | 506 |
| 371 | Ga0436361_1081026 | 3300039447 | Bacteria | 565 |
| 372 | Ga0436363_0283155 | 3300039450 | Bacteria | 1931 |
| 373 | Ga0436363_0469747 | 3300039450 | Bacteria | 1128 |
| 374 | Ga0436363_0590522 | 3300039450 | Bacteria | 897 |
| 375 | Ga0436363_0832663 | 3300039450 | Bacteria | 539 |
| 376 | Ga0436363_0865732 | 3300039450 | Bacteria | 1864 |
| 377 | Ga0436363_0950379 | 3300039450 | Bacteria | 3933 |
| 378 | Ga0436363_0992069 | 3300039450 | Bacteria | 687 |
| 379 | Ga0436363_1098882 | 3300039450 | Bacteria | 1854 |
| 380 | Ga0439438_025844 | 3300041405 | Bacteria | 1596 |
| 381 | Ga0439447_028871 | 3300041407 | Bacteria | 1407 |
| 382 | Ga0451791_1597435 | 3300041451 | Bacteria | 867 |
| 383 | Ga0451802_0643512 | 3300041460 | Bacteria | 607 |
| 384 | Ga0451837_0898365 | 3300041494 | Bacteria | 2450 |
| 385 | Ga0451845_0978265 | 3300041501 | Bacteria | 650 |
| 386 | Ga0451847_0700671 | 3300041503 | Bacteria | 500 |
| 387 | Ga0451855_0984920 | 3300041511 | Bacteria | 70555 |
| 388 | Ga0451853_0961848 | 3300041512 | Bacteria | 693 |
| 389 | Ga0451853_3701895 | 3300041512 | Bacteria | 631 |
| 390 | Ga0439448_0289099 | 3300042005 | Bacteria | 581 |
| 391 | Ga0439434_0032895 | 3300042435 | Bacteria | 1579 |
| 392 | Ga0466969_0419942 | 3300044656 | Bacteria | 608 |
| 393 | Ga0466969_0462719 | 3300044656 | Bacteria | 577 |
| 394 | Ga0466966_0001036 | 3300044684 | Bacteria | 17796 |
| 395 | Ga0466966_0001850 | 3300044684 | Bacteria | 13717 |
| 396 | Ga0466961_0000004 | 3300044693 | Bacteria | 175855 |
| 397 | Ga0466961_0136286 | 3300044693 | Bacteria | 1538 |
| 398 | Ga0466961_0282653 | 3300044693 | Bacteria | 1015 |
| 399 | Ga0466963_0045911 | 3300044694 | Bacteria | 2879 |
| 400 | Ga0466960_0568302 | 3300044901 | Bacteria | 670 |
| 401 | Ga0451576_0002567 | 3300045051 | Bacteria | 26795 |
| 402 | Ga0451576_1151414 | 3300045051 | Bacteria | 811 |
| 403 | Ga0466958_1166610 | 3300045836 | Bacteria | 503 |
| 404 | Ga0466967_1145459 | 3300045976 | Bacteria | 775 |
| 405 | Ga0495603_0505824 | 3300046455 | Bacteria | 692 |
| 406 | Ga0495629_0500025 | 3300046459 | Bacteria | 820 |
| 407 | Ga0495638_0108565 | 3300046460 | Bacteria | 1651 |
| 408 | Ga0495651_0837574 | 3300046462 | Bacteria | 566 |
| 409 | Ga0495653_0923002 | 3300046463 | Bacteria | 519 |
| 410 | Ga0495664_0316564 | 3300046477 | Bacteria | 941 |
| 411 | Ga0495664_0431967 | 3300046477 | Bacteria | 789 |
| 412 | Ga0495584_0321807 | 3300046491 | Bacteria | 785 |
| 413 | Ga0495606_0305319 | 3300046507 | Bacteria | 861 |
| 414 | Ga0495606_0669266 | 3300046507 | Bacteria | 500 |
| 415 | Ga0495632_0000023 | 3300046519 | Bacteria | 180933 |
| 416 | Ga0495643_0238648 | 3300046522 | Bacteria | 854 |
| 417 | Ga0495648_0009994 | 3300046524 | Bacteria | 7278 |
| 418 | Ga0495648_0055254 | 3300046524 | Bacteria | 2394 |
| 419 | Ga0495663_0000059 | 3300046525 | Bacteria | 51157 |
| 420 | Ga0495652_0091821 | 3300046529 | Bacteria | 2481 |
| 421 | Ga0495654_0378927 | 3300046530 | Bacteria | 565 |
| 422 | Ga0495640_0108583 | 3300046533 | Bacteria | 1815 |
| 423 | Ga0495622_0139512 | 3300046557 | Bacteria | 1101 |
| 424 | Ga0495633_0003846 | 3300046558 | Bacteria | 9814 |
| 425 | Ga0495633_0007824 | 3300046558 | Bacteria | 6101 |
| 426 | Ga0495625_0458757 | 3300046660 | Bacteria | 786 |
| 427 | Ga0495669_0471668 | 3300046684 | Bacteria | 610 |
| 428 | Ga0495671_0015899 | 3300046692 | Bacteria | 4027 |
| 429 | Ga0495649_0351381 | 3300046694 | Bacteria | 745 |
| 430 | Ga0495604_0590913 | 3300047317 | Bacteria | 713 |
| 431 | Ga0495674_0570706 | 3300047319 | Bacteria | 899 |
| 432 | Ga0495674_0878913 | 3300047319 | Bacteria | 693 |
| 433 | Ga0495672_0000160 | 3300047320 | Bacteria | 98077 |
| 434 | Ga0495672_0095259 | 3300047320 | Bacteria | 1626 |
| 435 | Ga0495672_0162682 | 3300047320 | Bacteria | 1145 |
| 436 | Ga0495672_0314138 | 3300047320 | Bacteria | 738 |
| 437 | Ga0495676_0354450 | 3300047321 | Bacteria | 980 |
| 438 | Ga0495676_0368815 | 3300047321 | Bacteria | 957 |
| 439 | Ga0495673_0014778 | 3300047469 | Bacteria | 4049 |
| 440 | Ga0495673_0181500 | 3300047469 | Bacteria | 797 |
| 441 | Ga0495686_0330915 | 3300047472 | Bacteria | 832 |
| 442 | Ga0495686_0442986 | 3300047472 | Bacteria | 691 |
| 443 | Ga0495593_0209360 | 3300047673 | Bacteria | 979 |
| 444 | Ga0495602_0242960 | 3300048088 | Bacteria | 1346 |
| 445 | Ga0496100_0757863 | 3300048903 | Bacteria | 759 |
| 446 | Ga0496100_1414261 | 3300048903 | Bacteria | 549 |
| 447 | Ga0496101_0937427 | 3300048904 | Bacteria | 681 |
| 448 | Ga0496102_0262378 | 3300048905 | Bacteria | 1629 |
| 449 | Ga0496103_0889972 | 3300048906 | Bacteria | 558 |
| 450 | Ga0496104_0000255 | 3300048907 | Bacteria | 47426 |
| 451 | Ga0496104_0055706 | 3300048907 | Bacteria | 3739 |
| 452 | Ga0496104_0086120 | 3300048907 | Bacteria | 3000 |
| 453 | Ga0496104_0164093 | 3300048907 | Bacteria | 2130 |
| 454 | Ga0496104_0471618 | 3300048907 | Bacteria | 1167 |
| 455 | Ga0496105_0000078 | 3300048908 | Bacteria | 74087 |
| 456 | Ga0496105_0211950 | 3300048908 | Bacteria | 1579 |
| 457 | Ga0496105_0226167 | 3300048908 | Bacteria | 1522 |
| 458 | Ga0496105_0490527 | 3300048908 | Bacteria | 965 |
| 459 | Ga0496106_0246673 | 3300048909 | Bacteria | 1427 |
| 460 | Ga0496106_1370034 | 3300048909 | Bacteria | 547 |
| 461 | Ga0496107_0052424 | 3300048910 | Bacteria | 2943 |
| 462 | Ga0496107_0610407 | 3300048910 | Bacteria | 806 |
| 463 | Ga0496107_1106293 | 3300048910 | Bacteria | 572 |
| 464 | Ga0496110_0269347 | 3300048913 | Bacteria | 1551 |
| 465 | Ga0496111_1156004 | 3300048914 | Bacteria | 550 |
| 466 | Ga0496112_0603030 | 3300048915 | Bacteria | 1030 |
| 467 | Ga0496112_1663298 | 3300048915 | Bacteria | 551 |
| 468 | Ga0496113_0425242 | 3300048916 | Bacteria | 1067 |
| 469 | Ga0496113_0465982 | 3300048916 | Bacteria | 1015 |
| 470 | Ga0496113_1107659 | 3300048916 | Bacteria | 621 |
| 471 | Ga0496114_0433386 | 3300048917 | Bacteria | 1164 |
| 472 | Ga0496115_0253250 | 3300048918 | Bacteria | 1449 |
| 473 | Ga0496115_1106464 | 3300048918 | Bacteria | 600 |
| 474 | Ga0496116_0030535 | 3300048919 | Bacteria | 3869 |
| 475 | Ga0496116_0153683 | 3300048919 | Bacteria | 1274 |
| 476 | Ga0496117_0000405 | 3300048920 | Bacteria | 72837 |
| 477 | Ga0496117_0001136 | 3300048920 | Bacteria | 40156 |
| 478 | Ga0496117_0015195 | 3300048920 | Bacteria | 6584 |
| 479 | Ga0496117_0561311 | 3300048920 | Bacteria | 541 |
| 480 | Ga0496118_0000402 | 3300048921 | Bacteria | 73078 |
| 481 | Ga0496118_0002991 | 3300048921 | Bacteria | 21861 |
| 482 | Ga0496118_0003441 | 3300048921 | Bacteria | 19922 |
| 483 | Ga0496119_0022321 | 3300048922 | Bacteria | 4536 |
| 484 | Ga0496119_0038153 | 3300048922 | Bacteria | 3109 |
| 485 | Ga0496119_0049885 | 3300048922 | Bacteria | 2584 |
| 486 | Ga0496119_0145636 | 3300048922 | Bacteria | 1275 |
| 487 | Ga0496120_0051428 | 3300048923 | Bacteria | 2353 |
| 488 | Ga0496120_0091820 | 3300048923 | Bacteria | 1620 |
| 489 | Ga0496120_0245596 | 3300048923 | Bacteria | 843 |
| 490 | Ga0496121_0009861 | 3300048924 | Bacteria | 10897 |
| 491 | Ga0496121_0089649 | 3300048924 | Bacteria | 2407 |
| 492 | Ga0496121_0148849 | 3300048924 | Bacteria | 1726 |
| 493 | Ga0496121_0220649 | 3300048924 | Bacteria | 1335 |
| 494 | Ga0496121_0422852 | 3300048924 | Bacteria | 866 |
| 495 | Ga0496121_0560154 | 3300048924 | Bacteria | 713 |
| 496 | Ga0496121_0600945 | 3300048924 | Bacteria | 679 |
| 497 | Ga0496121_0702466 | 3300048924 | Bacteria | 608 |
| 498 | Ga0496122_0000921 | 3300048925 | Bacteria | 53852 |
| 499 | Ga0496122_0029876 | 3300048925 | Bacteria | 4583 |
| 500 | Ga0496123_0001350 | 3300048926 | Bacteria | 34582 |
| 501 | Ga0496123_0513572 | 3300048926 | Bacteria | 521 |
| 502 | Ga0496125_0066170 | 3300048928 | Bacteria | 2858 |
| 503 | Ga0496126_0000296 | 3300048929 | Bacteria | 106143 |
| 504 | Ga0496126_0043240 | 3300048929 | Bacteria | 4156 |
| 505 | Ga0496126_0117776 | 3300048929 | Bacteria | 2307 |
| 506 | Ga0496126_0326282 | 3300048929 | Bacteria | 1261 |
| 507 | Ga0496126_0537753 | 3300048929 | Bacteria | 929 |
| 508 | Ga0496126_1140000 | 3300048929 | Bacteria | 577 |
| 509 | Ga0495682_0368803 | 3300049460 | Bacteria | 506 |
| 510 | Ga0501031_0000005 | 3300049568 | Bacteria | 183960 |
| 511 | Ga0501031_0000157 | 3300049568 | Bacteria | 38675 |
| 512 | Ga0501031_0000803 | 3300049568 | Bacteria | 18908 |
| 513 | Ga0501031_0103161 | 3300049568 | Bacteria | 1861 |
| 514 | Ga0501032_0000069 | 3300049569 | Bacteria | 86501 |
| 515 | Ga0501032_0000337 | 3300049569 | Bacteria | 39238 |
| 516 | Ga0501032_0000772 | 3300049569 | Bacteria | 25963 |
| 517 | Ga0501032_0001324 | 3300049569 | Bacteria | 19785 |
| 518 | Ga0501032_0001526 | 3300049569 | Bacteria | 18457 |
| 519 | Ga0501032_0007316 | 3300049569 | Bacteria | 8075 |
| 520 | Ga0501032_0112590 | 3300049569 | Bacteria | 1800 |
| 521 | Ga0501032_0168350 | 3300049569 | Bacteria | 1437 |
| 522 | Ga0501032_0208243 | 3300049569 | Bacteria | 1275 |
| 523 | Ga0501032_0433984 | 3300049569 | Bacteria | 842 |
| 524 | Ga0501033_0000062 | 3300049570 | Bacteria | 102791 |
| 525 | Ga0501033_0000129 | 3300049570 | Bacteria | 73102 |
| 526 | Ga0501033_0000170 | 3300049570 | Bacteria | 62524 |
| 527 | Ga0501033_0000175 | 3300049570 | Bacteria | 60845 |
| 528 | Ga0501033_0000663 | 3300049570 | Bacteria | 31796 |
| 529 | Ga0501033_0020512 | 3300049570 | Bacteria | 4994 |
| 530 | Ga0501033_0155430 | 3300049570 | Bacteria | 1648 |
| 531 | Ga0501033_0288899 | 3300049570 | Bacteria | 1156 |
| 532 | Ga0501033_0308486 | 3300049570 | Bacteria | 1113 |
| 533 | Ga0501034_0000494 | 3300049571 | Bacteria | 64049 |
| 534 | Ga0501034_0000612 | 3300049571 | Bacteria | 56135 |
| 535 | Ga0501034_0001942 | 3300049571 | Bacteria | 26190 |
| 536 | Ga0501034_0002799 | 3300049571 | Bacteria | 20395 |
| 537 | Ga0501034_0005998 | 3300049571 | Bacteria | 13142 |
| 538 | Ga0501034_0039402 | 3300049571 | Bacteria | 4787 |
| 539 | Ga0501034_0041000 | 3300049571 | Bacteria | 4684 |
| 540 | Ga0501034_0404161 | 3300049571 | Bacteria | 1288 |
| 541 | Ga0501036_0000014 | 3300049572 | Bacteria | 148705 |
| 542 | Ga0501036_0000079 | 3300049572 | Bacteria | 60047 |
| 543 | Ga0501036_0000086 | 3300049572 | Bacteria | 58349 |
| 544 | Ga0501036_0000367 | 3300049572 | Bacteria | 31733 |
| 545 | Ga0501036_0855613 | 3300049572 | Bacteria | 747 |
| 546 | Ga0501037_0000042 | 3300049573 | Bacteria | 118407 |
| 547 | Ga0501037_0000087 | 3300049573 | Bacteria | 85372 |
| 548 | Ga0501037_0001088 | 3300049573 | Bacteria | 20159 |
| 549 | Ga0501037_0004449 | 3300049573 | Bacteria | 10179 |
| 550 | Ga0501037_0004889 | 3300049573 | Bacteria | 9746 |
| 551 | Ga0501037_0029061 | 3300049573 | Bacteria | 4083 |
| 552 | Ga0501038_0000024 | 3300049574 | Bacteria | 148705 |
| 553 | Ga0501038_0000067 | 3300049574 | Bacteria | 85978 |
| 554 | Ga0501038_0000095 | 3300049574 | Bacteria | 74178 |
| 555 | Ga0501038_0000157 | 3300049574 | Bacteria | 58169 |
| 556 | Ga0501038_0000284 | 3300049574 | Bacteria | 43096 |
| 557 | Ga0501038_0168268 | 3300049574 | Bacteria | 1776 |
| 558 | Ga0501038_0241953 | 3300049574 | Bacteria | 1432 |
| 559 | Ga0501038_0467044 | 3300049574 | Bacteria | 969 |
| 560 | Ga0501039_0000059 | 3300049575 | Bacteria | 85852 |
| 561 | Ga0501039_0000122 | 3300049575 | Bacteria | 53871 |
| 562 | Ga0501039_0002627 | 3300049575 | Bacteria | 13413 |
| 563 | Ga0501039_0005126 | 3300049575 | Bacteria | 9927 |
| 564 | Ga0501039_0145994 | 3300049575 | Bacteria | 1859 |
| 565 | Ga0501039_0343248 | 3300049575 | Bacteria | 1173 |
| 566 | Ga0501040_0004151 | 3300049576 | Bacteria | 9428 |
| 567 | Ga0501040_0144228 | 3300049576 | Bacteria | 1678 |
| 568 | Ga0501040_1168246 | 3300049576 | Bacteria | 558 |
| 569 | Ga0501041_0588314 | 3300049577 | Bacteria | 710 |
| 570 | Ga0501041_0695230 | 3300049577 | Bacteria | 651 |
| 571 | Ga0501042_0017225 | 3300049578 | Bacteria | 4980 |
| 572 | Ga0501042_0037725 | 3300049578 | Bacteria | 3430 |
| 573 | Ga0501043_0000178 | 3300049579 | Bacteria | 56959 |
| 574 | Ga0501043_0000289 | 3300049579 | Bacteria | 45306 |
| 575 | Ga0501043_0000925 | 3300049579 | Bacteria | 26012 |
| 576 | Ga0501043_0001213 | 3300049579 | Bacteria | 22701 |
| 577 | Ga0501043_0170211 | 3300049579 | Bacteria | 1699 |
| 578 | Ga0501043_0417172 | 3300049579 | Bacteria | 1012 |
| 579 | Ga0501046_0000260 | 3300049580 | Bacteria | 53763 |
| 580 | Ga0501046_0008310 | 3300049580 | Bacteria | 9057 |
| 581 | Ga0501046_0014331 | 3300049580 | Bacteria | 6694 |
| 582 | Ga0501046_0028877 | 3300049580 | Bacteria | 4513 |
| 583 | Ga0501046_0080485 | 3300049580 | Bacteria | 2517 |
| 584 | Ga0501046_0119988 | 3300049580 | Bacteria | 2001 |
| 585 | Ga0501046_1085899 | 3300049580 | Bacteria | 553 |
| 586 | Ga0501047_0000146 | 3300049581 | Bacteria | 85790 |
| 587 | Ga0501047_0001569 | 3300049581 | Bacteria | 22336 |
| 588 | Ga0501047_0002832 | 3300049581 | Bacteria | 16443 |
| 589 | Ga0501047_0006906 | 3300049581 | Bacteria | 10663 |
| 590 | Ga0501047_0037975 | 3300049581 | Bacteria | 4658 |
| 591 | Ga0501047_0084365 | 3300049581 | Bacteria | 3053 |
| 592 | Ga0501047_0285115 | 3300049581 | Bacteria | 1496 |
| 593 | Ga0501047_0301892 | 3300049581 | Bacteria | 1443 |
| 594 | Ga0501048_0000034 | 3300049582 | Bacteria | 64683 |
| 595 | Ga0501048_0000722 | 3300049582 | Bacteria | 24211 |
| 596 | Ga0501048_0068470 | 3300049582 | Bacteria | 2507 |
| 597 | Ga0501048_0565409 | 3300049582 | Bacteria | 816 |
| 598 | Ga0501067_0000594 | 3300049583 | Bacteria | 19485 |
| 599 | Ga0501067_0003934 | 3300049583 | Bacteria | 8202 |
| 600 | Ga0501068_0000552 | 3300049584 | Bacteria | 19000 |
| 601 | Ga0501068_0003289 | 3300049584 | Bacteria | 8662 |
| 602 | Ga0501068_0726980 | 3300049584 | Bacteria | 649 |
| 603 | Ga0501069_0000046 | 3300049585 | Bacteria | 74811 |
| 604 | Ga0501069_0000318 | 3300049585 | Bacteria | 21973 |
| 605 | Ga0501070_0000073 | 3300049586 | Bacteria | 85801 |
| 606 | Ga0501070_0002481 | 3300049586 | Bacteria | 16173 |
| 607 | Ga0501070_0003509 | 3300049586 | Bacteria | 13567 |
| 608 | Ga0501070_0034036 | 3300049586 | Bacteria | 4262 |
| 609 | Ga0501070_0050594 | 3300049586 | Bacteria | 3449 |
| 610 | Ga0501070_0148156 | 3300049586 | Bacteria | 1937 |
| 611 | Ga0501070_0160607 | 3300049586 | Bacteria | 1853 |
| 612 | Ga0501070_0656183 | 3300049586 | Bacteria | 833 |
| 613 | Ga0501070_1052303 | 3300049586 | Bacteria | 629 |
| 614 | Ga0501070_1116270 | 3300049586 | Bacteria | 608 |
| 615 | Ga0501070_1165427 | 3300049586 | Bacteria | 592 |
| 616 | Ga0501070_1452347 | 3300049586 | Bacteria | 520 |
| 617 | Ga0501070_1483054 | 3300049586 | Bacteria | 514 |
| 618 | Ga0501071_0000441 | 3300049587 | Bacteria | 20869 |
| 619 | Ga0501071_0018761 | 3300049587 | Bacteria | 4795 |
| 620 | Ga0501072_0000658 | 3300049588 | Bacteria | 24912 |
| 621 | Ga0501072_0004362 | 3300049588 | Bacteria | 10735 |
| 622 | Ga0501072_0944866 | 3300049588 | Bacteria | 673 |
| 623 | Ga0501073_0000239 | 3300049589 | Bacteria | 36296 |
| 624 | Ga0501073_0000323 | 3300049589 | Bacteria | 32000 |
| 625 | Ga0501073_0129600 | 3300049589 | Bacteria | 1748 |
| 626 | Ga0501073_1178992 | 3300049589 | Bacteria | 526 |
| 627 | Ga0501074_0000025 | 3300049590 | Bacteria | 68500 |
| 628 | Ga0501074_0000093 | 3300049590 | Bacteria | 42750 |
| 629 | Ga0501074_0212978 | 3300049590 | Bacteria | 1376 |
| 630 | Ga0501074_0934344 | 3300049590 | Bacteria | 610 |
| 631 | Ga0501075_0718076 | 3300049591 | Bacteria | 761 |
| 632 | Ga0501076_0156590 | 3300049592 | Bacteria | 1855 |
| 633 | Ga0501076_0494943 | 3300049592 | Bacteria | 1008 |
| 634 | Ga0501077_0051655 | 3300049593 | Bacteria | 2612 |
| 635 | Ga0501079_0000862 | 3300049741 | Bacteria | 20762 |
| 636 | Ga0501079_0001388 | 3300049741 | Bacteria | 17070 |
| 637 | Ga0501079_0542036 | 3300049741 | Bacteria | 915 |
| 638 | Ga0501080_0000037 | 3300049742 | Bacteria | 82435 |
| 639 | Ga0501080_0000635 | 3300049742 | Bacteria | 27889 |
| 640 | Ga0501080_0050016 | 3300049742 | Bacteria | 3891 |
| 641 | Ga0501080_0345173 | 3300049742 | Bacteria | 1345 |
| 642 | Ga0501080_0362973 | 3300049742 | Bacteria | 1307 |
| 643 | Ga0501080_0544921 | 3300049742 | Bacteria | 1034 |
| 644 | Ga0501080_1510352 | 3300049742 | Bacteria | 571 |
| 645 | Ga0501083_0000350 | 3300049744 | Bacteria | 29150 |
| 646 | Ga0501083_0004275 | 3300049744 | Bacteria | 10051 |
| 647 | Ga0501083_1075206 | 3300049744 | Bacteria | 524 |
| 648 | Ga0501035_0000045 | 3300049822 | Bacteria | 148705 |
| 649 | Ga0501035_0000141 | 3300049822 | Bacteria | 87831 |
| 650 | Ga0501035_0000172 | 3300049822 | Bacteria | 79203 |
| 651 | Ga0501035_0002255 | 3300049822 | Bacteria | 19067 |
| 652 | Ga0501035_0003323 | 3300049822 | Bacteria | 15404 |
| 653 | Ga0501035_0248701 | 3300049822 | Bacteria | 1510 |
| 654 | Ga0501035_0269648 | 3300049822 | Bacteria | 1441 |
| 655 | Ga0501035_0370745 | 3300049822 | Bacteria | 1195 |
| 656 | Ga0501035_1221369 | 3300049822 | Bacteria | 582 |
| 657 | Ga0501044_0000044 | 3300049823 | Bacteria | 148705 |
| 658 | Ga0501044_0000151 | 3300049823 | Bacteria | 85867 |
| 659 | Ga0501044_0001408 | 3300049823 | Bacteria | 28203 |
| 660 | Ga0501044_0006037 | 3300049823 | Bacteria | 13370 |
| 661 | Ga0501044_0016838 | 3300049823 | Bacteria | 7842 |
| 662 | Ga0501044_0046475 | 3300049823 | Bacteria | 4494 |
| 663 | Ga0501044_0133777 | 3300049823 | Bacteria | 2472 |
| 664 | Ga0501044_0162676 | 3300049823 | Bacteria | 2207 |
| 665 | Ga0501044_0319675 | 3300049823 | Bacteria | 1477 |
| 666 | Ga0501044_0385583 | 3300049823 | Bacteria | 1316 |
| 667 | Ga0501044_0800658 | 3300049823 | Bacteria | 822 |
| 668 | Ga0501045_0000540 | 3300049824 | Bacteria | 23669 |
| 669 | Ga0501045_0033573 | 3300049824 | Bacteria | 3721 |
| 670 | Ga0501045_0376772 | 3300049824 | Bacteria | 1056 |
| 671 | nmdc:mga03n38_13425_c1 | 3300050490 | Bacteria | 3111 |
| 672 | nmdc:mga00v17_36982_c1 | 3300050491 | Bacteria | 2912 |
| 673 | nmdc:mga0yw44_293469_c1 | 3300050492 | Bacteria | 1088 |
| 674 | nmdc:mga0yw44_364359_c1 | 3300050492 | Bacteria | 974 |
| 675 | nmdc:mga0yw44_405537_c1 | 3300050492 | Bacteria | 922 |
| 676 | nmdc:mga0yw44_446_c1 | 3300050492 | Bacteria | 14563 |
| 677 | nmdc:mga0yw44_59982_c1 | 3300050492 | Bacteria | 2329 |
| 678 | nmdc:mga06z11_5260_c2 | 3300050494 | Bacteria | 2482 |
| 679 | nmdc:mga07m45_278897_c1 | 3300050496 | Bacteria | 638 |
| 680 | nmdc:mga05p37_1942916_c1 | 3300050507 | Bacteria | 560 |
| 681 | nmdc:mga0n895_821034_c1 | 3300050512 | Bacteria | 919 |
| 682 | nmdc:mga0n895_838897_c1 | 3300050512 | Bacteria | 907 |
| 683 | nmdc:mga0rr50_474993_c1 | 3300050513 | Bacteria | 1061 |
| 684 | nmdc:mga0sz30_248264_c1 | 3300050516 | Bacteria | 792 |
| 685 | Ga0495612_0227018 | 3300053078 | Bacteria | 828 |
| 686 | Ga0500610_0272263 | 3300053079 | Bacteria | 765 |
| 687 | Ga0500572_087132 | 3300053111 | Bacteria | 985 |
| 688 | Ga0500607_206381 | 3300053121 | Bacteria | 837 |
| 689 | Ga0500608_369581 | 3300053122 | Bacteria | 500 |
| 690 | Ga0500559_0016276 | 3300053136 | Bacteria | 3140 |
| 691 | Ga0500559_0064957 | 3300053136 | Bacteria | 1634 |
| 692 | Ga0500590_098151 | 3300053148 | Bacteria | 1411 |
| 693 | Ga0500590_140551 | 3300053148 | Bacteria | 1104 |
| 694 | Ga0500627_0000048 | 3300053158 | Bacteria | 58964 |
| 695 | Ga0500627_0310374 | 3300053158 | Bacteria | 687 |
| 696 | Ga0500630_146903 | 3300053159 | Bacteria | 1005 |
| 697 | Ga0500639_000710 | 3300053163 | Bacteria | 16832 |
| 698 | Ga0500639_342776 | 3300053163 | Bacteria | 534 |
| 699 | Ga0500636_0017863 | 3300053177 | Bacteria | 4192 |
| 700 | Ga0501084_0002854 | 3300054114 | Bacteria | 13967 |
| 701 | Ga0501084_0024934 | 3300054114 | Bacteria | 4990 |
| 702 | Ga0501082_0000355 | 3300060353 | Bacteria | 40463 |
| 703 | Ga0501082_0004972 | 3300060353 | Bacteria | 11605 |
| 704 | Ga0501082_0574454 | 3300060353 | Bacteria | 986 |
| 705 | Ga0501082_0619322 | 3300060353 | Bacteria | 947 |
| 706 | Ga0530510_0471544 | 3300061734 | Bacteria | 950 |
| 707 | Ga0530510_1454721 | 3300061734 | Bacteria | 526 |
| 708 | Ga0530510_1493614 | 3300061734 | Bacteria | 519 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007788 | Ga0099795_10363680 | Ga0099795_103636801 | 77 |
| 2 | 3300010159 | Ga0099796_10316587 | Ga0099796_103165871 | 77 |
| 3 | 3300006051 | Ga0075364_10547243 | Ga0075364_105472432 | 78 |
| 4 | 3300006844 | Ga0075428_100103244 | Ga0075428_1001032442 | 79 |
| 5 | 3300006880 | Ga0075429_100430258 | Ga0075429_1004302583 | 79 |
| 6 | 3300027671 | Ga0209588_1055409 | Ga0209588_10554092 | 79 |
| 7 | 3300041405 | Ga0439438_025844 | Ga0439438_025844_558_830 | 79 |
| 8 | 3300041407 | Ga0439447_028871 | Ga0439447_028871_805_1077 | 79 |
| 9 | 3300042435 | Ga0439434_0032895 | Ga0439434_0032895_928_1200 | 79 |
| 10 | 3300049569 | Ga0501032_0007316 | Ga0501032_0007316_5240_5512 | 79 |
| 11 | 3300049573 | Ga0501037_0029061 | Ga0501037_0029061_3271_3543 | 79 |
| 12 | 3300046692 | Ga0495671_0015899 | Ga0495671_0015899_228_500 | 80 |
| 13 | 3300047469 | Ga0495673_0014778 | Ga0495673_0014778_3586_3858 | 80 |
| 14 | 3300031712 | Ga0265342_10568331 | Ga0265342_105683312 | 82 |
| 15 | 3300049570 | Ga0501033_0020512 | Ga0501033_0020512_2513_2782 | 82 |
| 16 | 3300049574 | Ga0501038_0467044 | Ga0501038_0467044_10_279 | 82 |
| 17 | 3300041503 | Ga0451847_0700671 | Ga0451847_0700671_66_377 | 83 |
| 18 | iso_pu_bacteria | 2507262055 | 2507510378 | 83 |
| 19 | iso_pu_bacteria | 2508501042 | 2508693131 | 83 |
| 20 | iso_pu_bacteria | 2513237090 | 2513613739 | 83 |
| 21 | iso_pu_bacteria | 2513237094 | 2513639883 | 83 |
| 22 | iso_pu_bacteria | 2513237094 | 2513641203 | 83 |
| 23 | iso_pu_bacteria | 2513237098 | 2513678672 | 83 |
| 24 | iso_pu_bacteria | 2513237137 | 2513863451 | 83 |
| 25 | iso_pu_bacteria | 2513237161 | 2514013784 | 83 |
| 26 | iso_pu_bacteria | 2513237161 | 2514014842 | 83 |
| 27 | iso_pu_bacteria | 2515154112 | 2515628599 | 83 |
| 28 | iso_pu_bacteria | 2517572143 | 2517890874 | 83 |
| 29 | iso_pu_bacteria | 2517572143 | 2517894309 | 83 |
| 30 | iso_pu_bacteria | 2528768022 | 2528855998 | 83 |
| 31 | iso_pu_bacteria | 2617270735 | 2617350391 | 83 |
| 32 | iso_pu_bacteria | 2617270741 | 2617379372 | 83 |
| 33 | iso_pu_bacteria | 2643221683 | 2644464671 | 83 |
| 34 | iso_pu_bacteria | 2728368998 | 2728753564 | 83 |
| 35 | iso_pu_bacteria | 2744054633 | 2745079409 | 83 |
| 36 | iso_pu_bacteria | 2791355197 | 2793066202 | 83 |
| 37 | iso_pu_bacteria | 2824600985 | 2824601460 | 83 |
| 38 | iso_pu_bacteria | 2824609381 | 2824613243 | 83 |
| 39 | iso_pu_bacteria | 2824617872 | 2824619954 | 83 |
| 40 | iso_pu_bacteria | 2824626560 | 2824628702 | 83 |
| 41 | iso_pu_bacteria | 2824635225 | 2824636512 | 83 |
| 42 | iso_pu_bacteria | 2824644064 | 2824645795 | 83 |
| 43 | iso_pu_bacteria | 2824653114 | 2824656520 | 83 |
| 44 | iso_pu_bacteria | 2824661429 | 2824664210 | 83 |
| 45 | iso_pu_bacteria | 2824671348 | 2824673116 | 83 |
| 46 | iso_pu_bacteria | 2824679649 | 2824680557 | 83 |
| 47 | iso_pu_bacteria | 2824687955 | 2824689836 | 83 |
| 48 | iso_pu_bacteria | 2824696289 | 2824698097 | 83 |
| 49 | iso_pu_bacteria | 2824704595 | 2824712282 | 83 |
| 50 | iso_pu_bacteria | 2824714736 | 2824716107 | 83 |
| 51 | iso_pu_bacteria | 2824723954 | 2824725833 | 83 |
| 52 | iso_pu_bacteria | 2824746037 | 2824746182 | 83 |
| 53 | iso_pu_bacteria | 2824773399 | 2824778752 | 83 |
| 54 | iso_pu_bacteria | 2838122688 | 2838128084 | 83 |
| 55 | iso_pu_bacteria | 2838122688 | 2838130575 | 83 |
| 56 | iso_pu_bacteria | 2841941048 | 2841947520 | 83 |
| 57 | iso_pu_bacteria | 2841949485 | 2841953749 | 83 |
| 58 | iso_pu_bacteria | 2841957949 | 2841959009 | 83 |
| 59 | iso_pu_bacteria | 2841957949 | 2841961757 | 83 |
| 60 | iso_pu_bacteria | 2841966195 | 2841971547 | 83 |
| 61 | iso_pu_bacteria | 2841974524 | 2841981073 | 83 |
| 62 | iso_pu_bacteria | 2841983080 | 2841986732 | 83 |
| 63 | iso_pu_bacteria | 2847939898 | 2847941003 | 83 |
| 64 | iso_pu_bacteria | 2856328259 | 2856330721 | 83 |
| 65 | iso_pu_bacteria | 2856334872 | 2856335373 | 83 |
| 66 | iso_pu_bacteria | 2869271264 | 2869275947 | 83 |
| 67 | iso_pu_bacteria | 2874123672 | 2874125402 | 83 |
| 68 | iso_pu_bacteria | 2874612657 | 2874619922 | 83 |
| 69 | iso_pu_bacteria | 2874620515 | 2874623660 | 83 |
| 70 | iso_pu_bacteria | 2874628541 | 2874635690 | 83 |
| 71 | iso_pu_bacteria | 2874645413 | 2874646464 | 83 |
| 72 | iso_pu_bacteria | 2876399893 | 2876400193 | 83 |
| 73 | iso_pu_bacteria | 2879083081 | 2879085088 | 83 |
| 74 | iso_pu_bacteria | 2879083081 | 2879090891 | 83 |
| 75 | iso_pu_bacteria | 2881665667 | 2881671424 | 83 |
| 76 | iso_pu_bacteria | 2885366525 | 2885374278 | 83 |
| 77 | iso_pu_bacteria | 2885409591 | 2885417903 | 83 |
| 78 | iso_pu_bacteria | 2889016732 | 2889020853 | 83 |
| 79 | iso_pu_bacteria | 2903748898 | 2903752418 | 83 |
| 80 | iso_pu_bacteria | 2903768456 | 2903771959 | 83 |
| 81 | iso_pu_bacteria | 2904666416 | 2904670471 | 83 |
| 82 | iso_pu_bacteria | 2904690495 | 2904694113 | 83 |
| 83 | iso_pu_bacteria | 2906626472 | 2906633863 | 83 |
| 84 | iso_pu_bacteria | 2906635258 | 2906638275 | 83 |
| 85 | iso_pu_bacteria | 2906635258 | 2906641297 | 83 |
| 86 | iso_pu_bacteria | 2906643746 | 2906644657 | 83 |
| 87 | iso_pu_bacteria | 2906643746 | 2906649567 | 83 |
| 88 | iso_pu_bacteria | 2908756301 | 2908764527 | 83 |
| 89 | iso_pu_bacteria | 2908775508 | 2908781909 | 83 |
| 90 | iso_pu_bacteria | 2922368715 | 2922377825 | 83 |
| 91 | iso_pu_bacteria | 2922393267 | 2922399056 | 83 |
| 92 | iso_pu_bacteria | 2924762789 | 2924766330 | 83 |
| 93 | iso_pu_bacteria | 2932784394 | 2932792111 | 83 |
| 94 | iso_pu_bacteria | 2932809354 | 2932814523 | 83 |
| 95 | iso_pu_bacteria | 2935616580 | 2935623363 | 83 |
| 96 | iso_pu_bacteria | 2935630451 | 2935637298 | 83 |
| 97 | iso_pu_bacteria | 2935638405 | 2935646634 | 83 |
| 98 | iso_pu_bacteria | 2935648319 | 2935652498 | 83 |
| 99 | iso_pu_bacteria | 2935656913 | 2935661080 | 83 |
| 100 | iso_pu_bacteria | 2935732158 | 2935733541 | 83 |
| 101 | iso_pu_bacteria | 2935741537 | 2935742920 | 83 |
| 102 | iso_pu_bacteria | 2935760218 | 2935764832 | 83 |
| 103 | iso_pu_bacteria | 2935827899 | 2935835900 | 83 |
| 104 | iso_pu_bacteria | 2935855204 | 2935861637 | 83 |
| 105 | iso_pu_bacteria | 2935883170 | 2935887849 | 83 |
| 106 | iso_pu_bacteria | 2935975950 | 2935979742 | 83 |
| 107 | iso_pu_bacteria | 2935984226 | 2935988885 | 83 |
| 108 | iso_pu_bacteria | 2936011229 | 2936015137 | 83 |
| 109 | iso_pu_bacteria | 2936019824 | 2936023282 | 83 |
| 110 | iso_pu_bacteria | 2936028420 | 2936032265 | 83 |
| 111 | iso_pu_bacteria | 2936046547 | 2936050126 | 83 |
| 112 | iso_pu_bacteria | 2936055302 | 2936061772 | 83 |
| 113 | iso_pu_bacteria | 2937836603 | 2937838650 | 83 |
| 114 | iso_pu_bacteria | 2941507105 | 2941513969 | 83 |
| 115 | iso_pu_bacteria | 2941515067 | 2941521930 | 83 |
| 116 | iso_pu_bacteria | 2941523033 | 2941529599 | 83 |
| 117 | iso_pu_bacteria | 2941531003 | 2941538359 | 83 |
| 118 | iso_pu_bacteria | 2958122699 | 2958124763 | 83 |
| 119 | iso_pu_bacteria | 2961064222 | 2961068359 | 83 |
| 120 | iso_pu_bacteria | 2961136820 | 2961140438 | 83 |
| 121 | iso_pu_bacteria | 2965025482 | 2965028474 | 83 |
| 122 | iso_pu_bacteria | 2965032056 | 2965038446 | 83 |
| 123 | iso_pu_bacteria | 2965102966 | 2965104971 | 83 |
| 124 | iso_pu_bacteria | 2965119406 | 2965121658 | 83 |
| 125 | iso_pu_bacteria | 2970547951 | 2970554903 | 83 |
| 126 | iso_pu_bacteria | 2977872689 | 2977879421 | 83 |
| 127 | iso_pu_bacteria | 2977957713 | 2977962267 | 83 |
| 128 | iso_pu_bacteria | 2987666974 | 2987672181 | 83 |
| 129 | iso_pu_bacteria | 3004239961 | 3004241399 | 83 |
| 130 | iso_pu_bacteria | 3005474847 | 3005477859 | 83 |
| 131 | iso_pu_bacteria | 3005474847 | 3005481914 | 83 |
| 132 | iso_pu_bacteria | 3005474847 | 3005483064 | 83 |
| 133 | iso_pu_bacteria | 3005587118 | 3005589152 | 83 |
| 134 | iso_pu_bacteria | 8016511872 | 8016515650 | 83 |
| 135 | iso_pu_bacteria | 8016583857 | 8016590369 | 83 |
| 136 | iso_pu_bacteria | 8016630954 | 8016633301 | 83 |
| 137 | iso_pu_bacteria | 8017057580 | 8017060845 | 83 |
| 138 | iso_pu_bacteria | 8019586578 | 8019594594 | 83 |
| 139 | iso_pu_bacteria | 8019619141 | 8019626095 | 83 |
| 140 | iso_pu_bacteria | 8019629233 | 8019636391 | 83 |
| 141 | iso_pu_bacteria | 8019648815 | 8019658704 | 83 |
| 142 | iso_pu_bacteria | 8019659431 | 8019664170 | 83 |
| 143 | iso_pu_bacteria | 8019668869 | 8019673765 | 83 |
| 144 | iso_pu_bacteria | 8019678201 | 8019682354 | 83 |
| 145 | iso_pu_bacteria | 8056967851 | 8056974230 | 83 |
| 146 | 3300005445 | Ga0070708_100000110 | Ga0070708_10000011017 | 84 |
| 147 | 3300013307 | Ga0157372_10765329 | Ga0157372_107653292 | 84 |
| 148 | 3300049580 | Ga0501046_0080485 | Ga0501046_0080485_288_542 | 84 |
| 149 | 3300049589 | Ga0501073_1178992 | Ga0501073_1178992_168_422 | 84 |
| 150 | 3300049742 | Ga0501080_0345173 | Ga0501080_0345173_326_580 | 84 |
| 151 | iso_pu_bacteria | 2880518877 | 2880521113 | 84 |
| 152 | iso_pu_bacteria | 2928115317 | 2928118117 | 84 |
| 153 | iso_pu_bacteria | 641228493 | 641334980 | 84 |
| 154 | iso_pu_bacteria | 643348555 | 643390533 | 84 |
| 155 | 3300049586 | Ga0501070_1483054 | Ga0501070_1483054_35_304 | 85 |
| 156 | iso_pu_bacteria | 2643221683 | 2644468644 | 85 |
| 157 | iso_pu_bacteria | 2643221713 | 2644619811 | 85 |
| 158 | iso_pu_bacteria | 2728369097 | 2729147703 | 85 |
| 159 | iso_pu_bacteria | 2818991435 | 2819536227 | 85 |
| 160 | iso_pu_bacteria | 2854601825 | 2854602876 | 85 |
| 161 | iso_pu_bacteria | 8011350971 | 8011352409 | 85 |
| 162 | 3300005718 | Ga0068866_10735332 | Ga0068866_107353322 | 86 |
| 163 | 3300009176 | Ga0105242_12156190 | Ga0105242_121561902 | 86 |
| 164 | 3300025934 | Ga0207686_11321418 | Ga0207686_113214181 | 86 |
| 165 | 3300025937 | Ga0207669_10860249 | Ga0207669_108602492 | 86 |
| 166 | 3300046529 | Ga0495652_0091821 | Ga0495652_0091821_1298_1567 | 86 |
| 167 | 3300048088 | Ga0495602_0242960 | Ga0495602_0242960_44_313 | 86 |
| 168 | 3300049581 | Ga0501047_0285115 | Ga0501047_0285115_870_1136 | 86 |
| 169 | 3300049592 | Ga0501076_0156590 | Ga0501076_0156590_1061_1333 | 86 |
| 170 | 3300049742 | Ga0501080_1510352 | Ga0501080_1510352_190_462 | 86 |
| 171 | 3300061734 | Ga0530510_1493614 | Ga0530510_1493614_182_454 | 86 |
| 172 | iso_pu_bacteria | 2503198000 | 2503200870 | 86 |
| 173 | iso_pu_bacteria | 2599185226 | 2599671616 | 86 |
| 174 | iso_pu_bacteria | 2599185227 | 2599681371 | 86 |
| 175 | iso_pu_bacteria | 2599185229 | 2599693226 | 86 |
| 176 | iso_pu_bacteria | 2600255389 | 2602010874 | 86 |
| 177 | iso_pu_bacteria | 2937843397 | 2937843861 | 86 |
| 178 | iso_pu_bacteria | 641228493 | 641334097 | 86 |
| 179 | iso_pu_bacteria | 651053060 | 651176321 | 86 |
| 180 | 3300002074 | JGI24748J21848_1033777 | JGI24748J21848_10337772 | 87 |
| 181 | 3300002774 | JGI25150J39212_1000241 | JGI25150J39212_10002418 | 87 |
| 182 | 3300003187 | JGI25151J46595_10048672 | JGI25151J46595_100486723 | 87 |
| 183 | 3300003214 | JGI25165J46597_1000078 | JGI25165J46597_100007849 | 87 |
| 184 | 3300003215 | JGI25153J46596_10000109 | JGI25153J46596_1000010963 | 87 |
| 185 | 3300003215 | JGI25153J46596_10080839 | JGI25153J46596_100808391 | 87 |
| 186 | 3300003320 | rootH2_10005575 | rootH2_1000557512 | 87 |
| 187 | 3300003354 | JGI25160J50197_1007209 | JGI25160J50197_10072092 | 87 |
| 188 | 3300003752 | Ga0055539_1007703 | Ga0055539_10077032 | 87 |
| 189 | 3300003911 | JGI25405J52794_10004874 | JGI25405J52794_100048741 | 87 |
| 190 | 3300003911 | JGI25405J52794_10049593 | JGI25405J52794_100495931 | 87 |
| 191 | 3300005262 | Ga0065165_1003688 | Ga0065165_10036887 | 87 |
| 192 | 3300005262 | Ga0065165_1100151 | Ga0065165_11001512 | 87 |
| 193 | 3300005329 | Ga0070683_100430387 | Ga0070683_1004303871 | 87 |
| 194 | 3300005331 | Ga0070670_100901191 | Ga0070670_1009011912 | 87 |
| 195 | 3300005334 | Ga0068869_100920507 | Ga0068869_1009205071 | 87 |
| 196 | 3300005335 | Ga0070666_10000070 | Ga0070666_1000007071 | 87 |
| 197 | 3300005335 | Ga0070666_10234077 | Ga0070666_102340772 | 87 |
| 198 | 3300005339 | Ga0070660_100597097 | Ga0070660_1005970973 | 87 |
| 199 | 3300005340 | Ga0070689_100553301 | Ga0070689_1005533012 | 87 |
| 200 | 3300005344 | Ga0070661_100315783 | Ga0070661_1003157832 | 87 |
| 201 | 3300005347 | Ga0070668_100000213 | Ga0070668_10000021327 | 87 |
| 202 | 3300005354 | Ga0070675_101168365 | Ga0070675_1011683652 | 87 |
| 203 | 3300005356 | Ga0070674_100301410 | Ga0070674_1003014101 | 87 |
| 204 | 3300005367 | Ga0070667_100000265 | Ga0070667_10000026547 | 87 |
| 205 | 3300005367 | Ga0070667_100004158 | Ga0070667_1000041586 | 87 |
| 206 | 3300005367 | Ga0070667_100341773 | Ga0070667_1003417732 | 87 |
| 207 | 3300005367 | Ga0070667_101022885 | Ga0070667_1010228852 | 87 |
| 208 | 3300005435 | Ga0070714_100123365 | Ga0070714_1001233652 | 87 |
| 209 | 3300005436 | Ga0070713_100904326 | Ga0070713_1009043262 | 87 |
| 210 | 3300005437 | Ga0070710_10437540 | Ga0070710_104375403 | 87 |
| 211 | 3300005439 | Ga0070711_100822773 | Ga0070711_1008227732 | 87 |
| 212 | 3300005445 | Ga0070708_100886377 | Ga0070708_1008863772 | 87 |
| 213 | 3300005455 | Ga0070663_100377712 | Ga0070663_1003777123 | 87 |
| 214 | 3300005458 | Ga0070681_11038737 | Ga0070681_110387371 | 87 |
| 215 | 3300005467 | Ga0070706_100119639 | Ga0070706_1001196391 | 87 |
| 216 | 3300005467 | Ga0070706_101973261 | Ga0070706_1019732611 | 87 |
| 217 | 3300005468 | Ga0070707_100089793 | Ga0070707_1000897931 | 87 |
| 218 | 3300005471 | Ga0070698_100114061 | Ga0070698_1001140612 | 87 |
| 219 | 3300005518 | Ga0070699_100002841 | Ga0070699_10000284112 | 87 |
| 220 | 3300005518 | Ga0070699_101053102 | Ga0070699_1010531022 | 87 |
| 221 | 3300005530 | Ga0070679_100328060 | Ga0070679_1003280602 | 87 |
| 222 | 3300005535 | Ga0070684_100014485 | Ga0070684_1000144857 | 87 |
| 223 | 3300005536 | Ga0070697_100412149 | Ga0070697_1004121492 | 87 |
| 224 | 3300005536 | Ga0070697_101253889 | Ga0070697_1012538892 | 87 |
| 225 | 3300005539 | Ga0068853_100486359 | Ga0068853_1004863593 | 87 |
| 226 | 3300005543 | Ga0070672_101261214 | Ga0070672_1012612142 | 87 |
| 227 | 3300005548 | Ga0070665_100010760 | Ga0070665_1000107608 | 87 |
| 228 | 3300005548 | Ga0070665_100075943 | Ga0070665_1000759433 | 87 |
| 229 | 3300005548 | Ga0070665_100132284 | Ga0070665_1001322843 | 87 |
| 230 | 3300005548 | Ga0070665_100603004 | Ga0070665_1006030041 | 87 |
| 231 | 3300005548 | Ga0070665_101784949 | Ga0070665_1017849492 | 87 |
| 232 | 3300005563 | Ga0068855_100842910 | Ga0068855_1008429102 | 87 |
| 233 | 3300005563 | Ga0068855_101341809 | Ga0068855_1013418092 | 87 |
| 234 | 3300005577 | Ga0068857_101509262 | Ga0068857_1015092621 | 87 |
| 235 | 3300005614 | Ga0068856_100757682 | Ga0068856_1007576822 | 87 |
| 236 | 3300005614 | Ga0068856_100945012 | Ga0068856_1009450122 | 87 |
| 237 | 3300005614 | Ga0068856_102255983 | Ga0068856_1022559832 | 87 |
| 238 | 3300005616 | Ga0068852_101643689 | Ga0068852_1016436892 | 87 |
| 239 | 3300005617 | Ga0068859_100259523 | Ga0068859_1002595233 | 87 |
| 240 | 3300005618 | Ga0068864_100431590 | Ga0068864_1004315903 | 87 |
| 241 | 3300005719 | Ga0068861_100701407 | Ga0068861_1007014073 | 87 |
| 242 | 3300005841 | Ga0068863_100000182 | Ga0068863_10000018217 | 87 |
| 243 | 3300005842 | Ga0068858_101023872 | Ga0068858_1010238722 | 87 |
| 244 | 3300005844 | Ga0068862_100459509 | Ga0068862_1004595091 | 87 |
| 245 | 3300005844 | Ga0068862_100584170 | Ga0068862_1005841702 | 87 |
| 246 | 3300005937 | Ga0081455_10000553 | Ga0081455_1000055333 | 87 |
| 247 | 3300005937 | Ga0081455_10021584 | Ga0081455_100215846 | 87 |
| 248 | 3300005937 | Ga0081455_10252359 | Ga0081455_102523593 | 87 |
| 249 | 3300005937 | Ga0081455_10984546 | Ga0081455_109845462 | 87 |
| 250 | 3300005983 | Ga0081540_1060731 | Ga0081540_10607313 | 87 |
| 251 | 3300005985 | Ga0081539_10000412 | Ga0081539_1000041281 | 87 |
| 252 | 3300005985 | Ga0081539_10002962 | Ga0081539_1000296212 | 87 |
| 253 | 3300006028 | Ga0070717_10249288 | Ga0070717_102492883 | 87 |
| 254 | 3300006038 | Ga0075365_10104210 | Ga0075365_101042102 | 87 |
| 255 | 3300006038 | Ga0075365_10930555 | Ga0075365_109305551 | 87 |
| 256 | 3300006042 | Ga0075368_10440705 | Ga0075368_104407052 | 87 |
| 257 | 3300006058 | Ga0075432_10474177 | Ga0075432_104741772 | 87 |
| 258 | 3300006175 | Ga0070712_100167703 | Ga0070712_1001677032 | 87 |
| 259 | 3300006175 | Ga0070712_100234107 | Ga0070712_1002341072 | 87 |
| 260 | 3300006177 | Ga0075362_10672043 | Ga0075362_106720432 | 87 |
| 261 | 3300006186 | Ga0075369_10066805 | Ga0075369_100668053 | 87 |
| 262 | 3300006847 | Ga0075431_100649301 | Ga0075431_1006493011 | 87 |
| 263 | 3300006880 | Ga0075429_100227466 | Ga0075429_1002274662 | 87 |
| 264 | 3300006881 | Ga0068865_101170254 | Ga0068865_1011702542 | 87 |
| 265 | 3300006931 | Ga0097620_100259504 | Ga0097620_1002595043 | 87 |
| 266 | 3300006942 | Ga0099824_1017053 | Ga0099824_10170531 | 87 |
| 267 | 3300006942 | Ga0099824_1026543 | Ga0099824_10265433 | 87 |
| 268 | 3300006943 | Ga0099822_1005508 | Ga0099822_100550818 | 87 |
| 269 | 3300006943 | Ga0099822_1040047 | Ga0099822_10400473 | 87 |
| 270 | 3300006944 | Ga0099823_1006666 | Ga0099823_100666616 | 87 |
| 271 | 3300006944 | Ga0099823_1008537 | Ga0099823_10085373 | 87 |
| 272 | 3300007265 | Ga0099794_10600897 | Ga0099794_106008972 | 87 |
| 273 | 3300007788 | Ga0099795_10002155 | Ga0099795_100021553 | 87 |
| 274 | 3300007788 | Ga0099795_10557850 | Ga0099795_105578502 | 87 |
| 275 | 3300009093 | Ga0105240_10441959 | Ga0105240_104419592 | 87 |
| 276 | 3300009093 | Ga0105240_10454237 | Ga0105240_104542371 | 87 |
| 277 | 3300009093 | Ga0105240_11082509 | Ga0105240_110825092 | 87 |
| 278 | 3300009093 | Ga0105240_11638491 | Ga0105240_116384912 | 87 |
| 279 | 3300009094 | Ga0111539_10636226 | Ga0111539_106362262 | 87 |
| 280 | 3300009101 | Ga0105247_10261431 | Ga0105247_102614313 | 87 |
| 281 | 3300009101 | Ga0105247_10490664 | Ga0105247_104906642 | 87 |
| 282 | 3300009147 | Ga0114129_10382564 | Ga0114129_103825643 | 87 |
| 283 | 3300009148 | Ga0105243_10616584 | Ga0105243_106165842 | 87 |
| 284 | 3300009174 | Ga0105241_11020926 | Ga0105241_110209261 | 87 |
| 285 | 3300009177 | Ga0105248_10514797 | Ga0105248_105147972 | 87 |
| 286 | 3300009545 | Ga0105237_10001960 | Ga0105237_1000196023 | 87 |
| 287 | 3300009545 | Ga0105237_11128908 | Ga0105237_111289081 | 87 |
| 288 | 3300009545 | Ga0105237_11215390 | Ga0105237_112153903 | 87 |
| 289 | 3300009545 | Ga0105237_11419272 | Ga0105237_114192721 | 87 |
| 290 | 3300009551 | Ga0105238_10007211 | Ga0105238_1000721110 | 87 |
| 291 | 3300009551 | Ga0105238_10009768 | Ga0105238_100097687 | 87 |
| 292 | 3300009553 | Ga0105249_12491139 | Ga0105249_124911392 | 87 |
| 293 | 3300010159 | Ga0099796_10031166 | Ga0099796_100311662 | 87 |
| 294 | 3300010159 | Ga0099796_10327338 | Ga0099796_103273382 | 87 |
| 295 | 3300010375 | Ga0105239_10000851 | Ga0105239_1000085126 | 87 |
| 296 | 3300010375 | Ga0105239_10216212 | Ga0105239_102162123 | 87 |
| 297 | 3300010375 | Ga0105239_10751148 | Ga0105239_107511483 | 87 |
| 298 | 3300010375 | Ga0105239_10911899 | Ga0105239_109118992 | 87 |
| 299 | 3300010375 | Ga0105239_11558967 | Ga0105239_115589672 | 87 |
| 300 | 3300011119 | Ga0105246_10129507 | Ga0105246_101295072 | 87 |
| 301 | 3300011119 | Ga0105246_10736472 | Ga0105246_107364722 | 87 |
| 302 | 3300011119 | Ga0105246_10738613 | Ga0105246_107386133 | 87 |
| 303 | 3300013100 | Ga0157373_10333726 | Ga0157373_103337262 | 87 |
| 304 | 3300013104 | Ga0157370_10357239 | Ga0157370_103572392 | 87 |
| 305 | 3300013104 | Ga0157370_11923943 | Ga0157370_119239432 | 87 |
| 306 | 3300013105 | Ga0157369_10244210 | Ga0157369_102442102 | 87 |
| 307 | 3300013297 | Ga0157378_11229318 | Ga0157378_112293182 | 87 |
| 308 | 3300013297 | Ga0157378_13191711 | Ga0157378_131917112 | 87 |
| 309 | 3300013306 | Ga0163162_10257491 | Ga0163162_102574912 | 87 |
| 310 | 3300013306 | Ga0163162_10305437 | Ga0163162_103054372 | 87 |
| 311 | 3300013306 | Ga0163162_11851734 | Ga0163162_118517342 | 87 |
| 312 | 3300013307 | Ga0157372_10953985 | Ga0157372_109539852 | 87 |
| 313 | 3300013308 | Ga0157375_10005116 | Ga0157375_100051162 | 87 |
| 314 | 3300013308 | Ga0157375_13333320 | Ga0157375_133333202 | 87 |
| 315 | 3300014325 | Ga0163163_10000007 | Ga0163163_10000007172 | 87 |
| 316 | 3300014497 | Ga0182008_10085263 | Ga0182008_100852632 | 87 |
| 317 | 3300014968 | Ga0157379_10477846 | Ga0157379_104778462 | 87 |
| 318 | 3300021320 | Ga0214544_1006236 | Ga0214544_100623617 | 87 |
| 319 | 3300021320 | Ga0214544_1010201 | Ga0214544_101020116 | 87 |
| 320 | 3300021320 | Ga0214544_1034719 | Ga0214544_10347192 | 87 |
| 321 | 3300021321 | Ga0214542_1006137 | Ga0214542_10061376 | 87 |
| 322 | 3300021321 | Ga0214542_1021169 | Ga0214542_10211693 | 87 |
| 323 | 3300021321 | Ga0214542_1029560 | Ga0214542_10295602 | 87 |
| 324 | 3300021321 | Ga0214542_1037224 | Ga0214542_10372242 | 87 |
| 325 | 3300021324 | Ga0214545_1005727 | Ga0214545_10057276 | 87 |
| 326 | 3300021327 | Ga0214543_1005902 | Ga0214543_100590217 | 87 |
| 327 | 3300021327 | Ga0214543_1015885 | Ga0214543_10158853 | 87 |
| 328 | 3300021327 | Ga0214543_1024724 | Ga0214543_10247242 | 87 |
| 329 | 3300021361 | Ga0213872_10111817 | Ga0213872_101118172 | 87 |
| 330 | 3300021377 | Ga0213874_10030608 | Ga0213874_100306083 | 87 |
| 331 | 3300021384 | Ga0213876_10013411 | Ga0213876_100134115 | 87 |
| 332 | 3300021388 | Ga0213875_10007585 | Ga0213875_100075852 | 87 |
| 333 | 3300021388 | Ga0213875_10016645 | Ga0213875_100166455 | 87 |
| 334 | 3300021388 | Ga0213875_10081267 | Ga0213875_100812671 | 87 |
| 335 | 3300025245 | Ga0207425_1000073 | Ga0207425_100007343 | 87 |
| 336 | 3300025253 | Ga0209677_101722 | Ga0209677_1017223 | 87 |
| 337 | 3300025253 | Ga0209677_125457 | Ga0209677_1254572 | 87 |
| 338 | 3300025254 | Ga0209148_1000126 | Ga0209148_1000126106 | 87 |
| 339 | 3300025254 | Ga0209148_1001202 | Ga0209148_10012025 | 87 |
| 340 | 3300025258 | Ga0209129_1000352 | Ga0209129_100035222 | 87 |
| 341 | 3300025261 | Ga0209233_1000150 | Ga0209233_1000150133 | 87 |
| 342 | 3300025261 | Ga0209233_1016987 | Ga0209233_10169873 | 87 |
| 343 | 3300025272 | Ga0209455_1000280 | Ga0209455_10002802 | 87 |
| 344 | 3300025272 | Ga0209455_1025699 | Ga0209455_10256993 | 87 |
| 345 | 3300025294 | Ga0209025_1000202 | Ga0209025_100020254 | 87 |
| 346 | 3300025297 | Ga0209758_1000138 | Ga0209758_100013852 | 87 |
| 347 | 3300025297 | Ga0209758_1000242 | Ga0209758_100024243 | 87 |
| 348 | 3300025297 | Ga0209758_1000825 | Ga0209758_100082532 | 87 |
| 349 | 3300025297 | Ga0209758_1002094 | Ga0209758_10020948 | 87 |
| 350 | 3300025302 | Ga0207426_1001196 | Ga0207426_100119618 | 87 |
| 351 | 3300025901 | Ga0207688_10011238 | Ga0207688_100112382 | 87 |
| 352 | 3300025901 | Ga0207688_10232773 | Ga0207688_102327732 | 87 |
| 353 | 3300025903 | Ga0207680_10000044 | Ga0207680_1000004448 | 87 |
| 354 | 3300025903 | Ga0207680_10056518 | Ga0207680_100565183 | 87 |
| 355 | 3300025904 | Ga0207647_10147677 | Ga0207647_101476772 | 87 |
| 356 | 3300025904 | Ga0207647_10255536 | Ga0207647_102555362 | 87 |
| 357 | 3300025904 | Ga0207647_10394698 | Ga0207647_103946982 | 87 |
| 358 | 3300025904 | Ga0207647_10410330 | Ga0207647_104103302 | 87 |
| 359 | 3300025907 | Ga0207645_10269951 | Ga0207645_102699513 | 87 |
| 360 | 3300025909 | Ga0207705_10119611 | Ga0207705_101196112 | 87 |
| 361 | 3300025910 | Ga0207684_10190504 | Ga0207684_101905043 | 87 |
| 362 | 3300025911 | Ga0207654_11082846 | Ga0207654_110828462 | 87 |
| 363 | 3300025913 | Ga0207695_10211799 | Ga0207695_102117993 | 87 |
| 364 | 3300025913 | Ga0207695_10283950 | Ga0207695_102839503 | 87 |
| 365 | 3300025913 | Ga0207695_10331732 | Ga0207695_103317321 | 87 |
| 366 | 3300025913 | Ga0207695_10335354 | Ga0207695_103353542 | 87 |
| 367 | 3300025914 | Ga0207671_10000106 | Ga0207671_10000106118 | 87 |
| 368 | 3300025915 | Ga0207693_10489409 | Ga0207693_104894092 | 87 |
| 369 | 3300025915 | Ga0207693_10810526 | Ga0207693_108105262 | 87 |
| 370 | 3300025917 | Ga0207660_11431873 | Ga0207660_114318731 | 87 |
| 371 | 3300025918 | Ga0207662_10220112 | Ga0207662_102201122 | 87 |
| 372 | 3300025919 | Ga0207657_10000052 | Ga0207657_1000005298 | 87 |
| 373 | 3300025919 | Ga0207657_10741033 | Ga0207657_107410332 | 87 |
| 374 | 3300025922 | Ga0207646_10043207 | Ga0207646_100432071 | 87 |
| 375 | 3300025923 | Ga0207681_10657165 | Ga0207681_106571652 | 87 |
| 376 | 3300025924 | Ga0207694_10005525 | Ga0207694_100055257 | 87 |
| 377 | 3300025924 | Ga0207694_10044212 | Ga0207694_100442125 | 87 |
| 378 | 3300025925 | Ga0207650_10693081 | Ga0207650_106930812 | 87 |
| 379 | 3300025926 | Ga0207659_10309274 | Ga0207659_103092742 | 87 |
| 380 | 3300025929 | Ga0207664_10473053 | Ga0207664_104730532 | 87 |
| 381 | 3300025932 | Ga0207690_11149789 | Ga0207690_111497891 | 87 |
| 382 | 3300025934 | Ga0207686_10545233 | Ga0207686_105452333 | 87 |
| 383 | 3300025936 | Ga0207670_10500582 | Ga0207670_105005822 | 87 |
| 384 | 3300025937 | Ga0207669_10492310 | Ga0207669_104923102 | 87 |
| 385 | 3300025941 | Ga0207711_10481755 | Ga0207711_104817553 | 87 |
| 386 | 3300025942 | Ga0207689_10049823 | Ga0207689_100498232 | 87 |
| 387 | 3300025944 | Ga0207661_10003110 | Ga0207661_100031105 | 87 |
| 388 | 3300025944 | Ga0207661_10433553 | Ga0207661_104335532 | 87 |
| 389 | 3300025949 | Ga0207667_10429990 | Ga0207667_104299902 | 87 |
| 390 | 3300025949 | Ga0207667_10685710 | Ga0207667_106857102 | 87 |
| 391 | 3300025949 | Ga0207667_10746048 | Ga0207667_107460482 | 87 |
| 392 | 3300025972 | Ga0207668_10000141 | Ga0207668_1000014122 | 87 |
| 393 | 3300025972 | Ga0207668_10509811 | Ga0207668_105098112 | 87 |
| 394 | 3300025981 | Ga0207640_10365282 | Ga0207640_103652822 | 87 |
| 395 | 3300025986 | Ga0207658_10000703 | Ga0207658_1000070324 | 87 |
| 396 | 3300025986 | Ga0207658_10002689 | Ga0207658_100026898 | 87 |
| 397 | 3300025986 | Ga0207658_11662465 | Ga0207658_116624652 | 87 |
| 398 | 3300026035 | Ga0207703_10208854 | Ga0207703_102088543 | 87 |
| 399 | 3300026041 | Ga0207639_10014746 | Ga0207639_100147463 | 87 |
| 400 | 3300026067 | Ga0207678_10157371 | Ga0207678_101573713 | 87 |
| 401 | 3300026078 | Ga0207702_10225493 | Ga0207702_102254932 | 87 |
| 402 | 3300026088 | Ga0207641_10000102 | Ga0207641_1000010254 | 87 |
| 403 | 3300026095 | Ga0207676_10402596 | Ga0207676_104025962 | 87 |
| 404 | 3300026116 | Ga0207674_11828357 | Ga0207674_118283571 | 87 |
| 405 | 3300026118 | Ga0207675_100010642 | Ga0207675_1000106422 | 87 |
| 406 | 3300026142 | Ga0207698_10416023 | Ga0207698_104160232 | 87 |
| 407 | 3300026142 | Ga0207698_10701812 | Ga0207698_107018122 | 87 |
| 408 | 3300027296 | Ga0209389_1000003 | Ga0209389_1000003222 | 87 |
| 409 | 3300027296 | Ga0209389_1000055 | Ga0209389_1000055116 | 87 |
| 410 | 3300027296 | Ga0209389_1000263 | Ga0209389_100026322 | 87 |
| 411 | 3300027296 | Ga0209389_1000404 | Ga0209389_10004046 | 87 |
| 412 | 3300027296 | Ga0209389_1005813 | Ga0209389_10058133 | 87 |
| 413 | 3300027357 | Ga0209589_1000008 | Ga0209589_100000822 | 87 |
| 414 | 3300027357 | Ga0209589_1000024 | Ga0209589_100002415 | 87 |
| 415 | 3300027357 | Ga0209589_1003752 | Ga0209589_10037526 | 87 |
| 416 | 3300027361 | Ga0209489_100123 | Ga0209489_1001238 | 87 |
| 417 | 3300027361 | Ga0209489_100474 | Ga0209489_10047439 | 87 |
| 418 | 3300027361 | Ga0209489_102905 | Ga0209489_10290530 | 87 |
| 419 | 3300027361 | Ga0209489_103245 | Ga0209489_10324522 | 87 |
| 420 | 3300027361 | Ga0209489_104558 | Ga0209489_10455815 | 87 |
| 421 | 3300027363 | Ga0209700_100029 | Ga0209700_100029208 | 87 |
| 422 | 3300027363 | Ga0209700_100046 | Ga0209700_100046137 | 87 |
| 423 | 3300027512 | Ga0209179_1002531 | Ga0209179_10025312 | 87 |
| 424 | 3300028379 | Ga0268266_10000989 | Ga0268266_1000098936 | 87 |
| 425 | 3300028379 | Ga0268266_10037067 | Ga0268266_100370674 | 87 |
| 426 | 3300028379 | Ga0268266_11017250 | Ga0268266_110172502 | 87 |
| 427 | 3300028380 | Ga0268265_10233430 | Ga0268265_102334302 | 87 |
| 428 | 3300028556 | Ga0265337_1003812 | Ga0265337_10038125 | 87 |
| 429 | 3300028573 | Ga0265334_10014683 | Ga0265334_100146833 | 87 |
| 430 | 3300028573 | Ga0265334_10086606 | Ga0265334_100866061 | 87 |
| 431 | 3300028573 | Ga0265334_10235687 | Ga0265334_102356872 | 87 |
| 432 | 3300028666 | Ga0265336_10082297 | Ga0265336_100822972 | 87 |
| 433 | 3300028794 | Ga0307515_10048747 | Ga0307515_100487473 | 87 |
| 434 | 3300028794 | Ga0307515_10591461 | Ga0307515_105914612 | 87 |
| 435 | 3300028800 | Ga0265338_10018504 | Ga0265338_100185046 | 87 |
| 436 | 3300028800 | Ga0265338_10075675 | Ga0265338_100756752 | 87 |
| 437 | 3300031235 | Ga0265330_10364716 | Ga0265330_103647162 | 87 |
| 438 | 3300031238 | Ga0265332_10171240 | Ga0265332_101712402 | 87 |
| 439 | 3300031239 | Ga0265328_10009339 | Ga0265328_100093393 | 87 |
| 440 | 3300031240 | Ga0265320_10470912 | Ga0265320_104709122 | 87 |
| 441 | 3300031241 | Ga0265325_10186561 | Ga0265325_101865612 | 87 |
| 442 | 3300031241 | Ga0265325_10186921 | Ga0265325_101869212 | 87 |
| 443 | 3300031241 | Ga0265325_10196001 | Ga0265325_101960012 | 87 |
| 444 | 3300031242 | Ga0265329_10008887 | Ga0265329_100088873 | 87 |
| 445 | 3300031247 | Ga0265340_10191773 | Ga0265340_101917733 | 87 |
| 446 | 3300031249 | Ga0265339_10002251 | Ga0265339_100022518 | 87 |
| 447 | 3300031249 | Ga0265339_10012366 | Ga0265339_100123663 | 87 |
| 448 | 3300031249 | Ga0265339_10050078 | Ga0265339_100500783 | 87 |
| 449 | 3300031249 | Ga0265339_10126577 | Ga0265339_101265773 | 87 |
| 450 | 3300031250 | Ga0265331_10001163 | Ga0265331_1000116315 | 87 |
| 451 | 3300031251 | Ga0265327_10303580 | Ga0265327_103035802 | 87 |
| 452 | 3300031344 | Ga0265316_10015583 | Ga0265316_100155834 | 87 |
| 453 | 3300031344 | Ga0265316_10203112 | Ga0265316_102031123 | 87 |
| 454 | 3300031595 | Ga0265313_10009740 | Ga0265313_100097403 | 87 |
| 455 | 3300031595 | Ga0265313_10053628 | Ga0265313_100536283 | 87 |
| 456 | 3300031711 | Ga0265314_10010467 | Ga0265314_100104675 | 87 |
| 457 | 3300031711 | Ga0265314_10024861 | Ga0265314_100248615 | 87 |
| 458 | 3300031711 | Ga0265314_10105927 | Ga0265314_101059273 | 87 |
| 459 | 3300031712 | Ga0265342_10021504 | Ga0265342_100215043 | 87 |
| 460 | 3300031712 | Ga0265342_10467673 | Ga0265342_104676731 | 87 |
| 461 | 3300031995 | Ga0307409_100962040 | Ga0307409_1009620402 | 87 |
| 462 | 3300032002 | Ga0307416_100218133 | Ga0307416_1002181333 | 87 |
| 463 | 3300032002 | Ga0307416_101037419 | Ga0307416_1010374192 | 87 |
| 464 | 3300032002 | Ga0307416_103807609 | Ga0307416_1038076091 | 87 |
| 465 | 3300032004 | Ga0307414_10164372 | Ga0307414_101643722 | 87 |
| 466 | 3300032004 | Ga0307414_10398990 | Ga0307414_103989903 | 87 |
| 467 | 3300032004 | Ga0307414_10650244 | Ga0307414_106502442 | 87 |
| 468 | 3300032126 | Ga0307415_102040736 | Ga0307415_1020407362 | 87 |
| 469 | 3300033180 | Ga0307510_10446701 | Ga0307510_104467012 | 87 |
| 470 | 3300033442 | Ga0315911_1000006 | Ga0315911_1000006201 | 87 |
| 471 | 3300033442 | Ga0315911_1000026 | Ga0315911_100002643 | 87 |
| 472 | 3300035113 | Ga0373936_0043642 | Ga0373936_0043642_790_1068 | 87 |
| 473 | 3300035113 | Ga0373936_0074239 | Ga0373936_0074239_168_437 | 87 |
| 474 | 3300035113 | Ga0373936_0206679 | Ga0373936_0206679_484_762 | 87 |
| 475 | 3300035118 | Ga0373954_0031430 | Ga0373954_0031430_1223_1492 | 87 |
| 476 | 3300035692 | Ga0373935_0182472 | Ga0373935_0182472_218_496 | 87 |
| 477 | 3300035695 | Ga0373927_0074351 | Ga0373927_0074351_645_923 | 87 |
| 478 | 3300035695 | Ga0373927_0093766 | Ga0373927_0093766_1653_1931 | 87 |
| 479 | 3300035695 | Ga0373927_0097680 | Ga0373927_0097680_951_1229 | 87 |
| 480 | 3300035695 | Ga0373927_0550939 | Ga0373927_0550939_314_592 | 87 |
| 481 | 3300035695 | Ga0373927_1024575 | Ga0373927_1024575_16_294 | 87 |
| 482 | 3300035724 | Ga0373933_0248011 | Ga0373933_0248011_79_348 | 87 |
| 483 | 3300035725 | Ga0373947_0653031 | Ga0373947_0653031_212_490 | 87 |
| 484 | 3300035725 | Ga0373947_0697673 | Ga0373947_0697673_85_363 | 87 |
| 485 | 3300036401 | Ga0373937_0062495 | Ga0373937_0062495_1631_1900 | 87 |
| 486 | 3300037068 | Ga0373925_0565612 | Ga0373925_0565612_215_493 | 87 |
| 487 | 3300037068 | Ga0373925_1128605 | Ga0373925_1128605_139_417 | 87 |
| 488 | 3300037312 | Ga0395899_0370824 | Ga0395899_0370824_560_838 | 87 |
| 489 | 3300037312 | Ga0395899_0497615 | Ga0395899_0497615_262_528 | 87 |
| 490 | 3300037418 | Ga0395900_0002291 | Ga0395900_0002291_6115_6378 | 87 |
| 491 | 3300037418 | Ga0395900_0184311 | Ga0395900_0184311_843_1121 | 87 |
| 492 | 3300037418 | Ga0395900_0506319 | Ga0395900_0506319_772_1047 | 87 |
| 493 | 3300037466 | Ga0395898_0019531 | Ga0395898_0019531_590_865 | 87 |
| 494 | 3300037466 | Ga0395898_0292056 | Ga0395898_0292056_47_310 | 87 |
| 495 | 3300037471 | Ga0395905_0003413 | Ga0395905_0003413_12117_12392 | 87 |
| 496 | 3300037471 | Ga0395905_0535534 | Ga0395905_0535534_468_734 | 87 |
| 497 | 3300037471 | Ga0395905_0772097 | Ga0395905_0772097_275_538 | 87 |
| 498 | 3300037471 | Ga0395905_0796729 | Ga0395905_0796729_56_319 | 87 |
| 499 | 3300037853 | Ga0436364_0117958 | Ga0436364_0117958_29_307 | 87 |
| 500 | 3300037853 | Ga0436364_0167314 | Ga0436364_0167314_11627_11902 | 87 |
| 501 | 3300037853 | Ga0436364_0226891 | Ga0436364_0226891_24132_24401 | 87 |
| 502 | 3300037853 | Ga0436364_0494866 | Ga0436364_0494866_53_316 | 87 |
| 503 | 3300037853 | Ga0436364_0543304 | Ga0436364_0543304_22_297 | 87 |
| 504 | 3300037853 | Ga0436364_0749918 | Ga0436364_0749918_81_356 | 87 |
| 505 | 3300037853 | Ga0436364_0793320 | Ga0436364_0793320_247_510 | 87 |
| 506 | 3300037853 | Ga0436364_1440006 | Ga0436364_1440006_91_369 | 87 |
| 507 | 3300038443 | Ga0395901_0065231 | Ga0395901_0065231_2516_2782 | 87 |
| 508 | 3300038443 | Ga0395901_0160060 | Ga0395901_0160060_318_593 | 87 |
| 509 | 3300038443 | Ga0395901_0173114 | Ga0395901_0173114_459_740 | 87 |
| 510 | 3300038443 | Ga0395901_0186637 | Ga0395901_0186637_613_876 | 87 |
| 511 | 3300038443 | Ga0395901_0619233 | Ga0395901_0619233_83_361 | 87 |
| 512 | 3300038443 | Ga0395901_1110613 | Ga0395901_1110613_112_390 | 87 |
| 513 | 3300038443 | Ga0395901_1522481 | Ga0395901_1522481_155_418 | 87 |
| 514 | 3300039437 | Ga0436365_0623764 | Ga0436365_0623764_1344_1613 | 87 |
| 515 | 3300039437 | Ga0436365_1174990 | Ga0436365_1174990_1071_1343 | 87 |
| 516 | 3300039437 | Ga0436365_1331505 | Ga0436365_1331505_168_446 | 87 |
| 517 | 3300039437 | Ga0436365_1547453 | Ga0436365_1547453_100_378 | 87 |
| 518 | 3300039437 | Ga0436365_1665747 | Ga0436365_1665747_93_365 | 87 |
| 519 | 3300039437 | Ga0436365_1860902 | Ga0436365_1860902_119_397 | 87 |
| 520 | 3300039437 | Ga0436365_1876159 | Ga0436365_1876159_32_304 | 87 |
| 521 | 3300039438 | Ga0436360_0251747 | Ga0436360_0251747_373_642 | 87 |
| 522 | 3300039438 | Ga0436360_0575218 | Ga0436360_0575218_563_835 | 87 |
| 523 | 3300039438 | Ga0436360_0776894 | Ga0436360_0776894_103_372 | 87 |
| 524 | 3300039438 | Ga0436360_0797411 | Ga0436360_0797411_502_771 | 87 |
| 525 | 3300039438 | Ga0436360_0859224 | Ga0436360_0859224_220_489 | 87 |
| 526 | 3300039438 | Ga0436360_1077870 | Ga0436360_1077870_81_353 | 87 |
| 527 | 3300039438 | Ga0436360_1246931 | Ga0436360_1246931_536_805 | 87 |
| 528 | 3300039438 | Ga0436360_1247036 | Ga0436360_1247036_679_948 | 87 |
| 529 | 3300039447 | Ga0436361_0065056 | Ga0436361_0065056_53_325 | 87 |
| 530 | 3300039447 | Ga0436361_0115207 | Ga0436361_0115207_405_674 | 87 |
| 531 | 3300039447 | Ga0436361_0185942 | Ga0436361_0185942_866_1135 | 87 |
| 532 | 3300039447 | Ga0436361_0224260 | Ga0436361_0224260_977_1255 | 87 |
| 533 | 3300039447 | Ga0436361_0289583 | Ga0436361_0289583_2691_2960 | 87 |
| 534 | 3300039447 | Ga0436361_0456415 | Ga0436361_0456415_1365_1634 | 87 |
| 535 | 3300039447 | Ga0436361_0778911 | Ga0436361_0778911_21_290 | 87 |
| 536 | 3300039447 | Ga0436361_0820693 | Ga0436361_0820693_37_309 | 87 |
| 537 | 3300039447 | Ga0436361_1081026 | Ga0436361_1081026_102_371 | 87 |
| 538 | 3300039450 | Ga0436363_0283155 | Ga0436363_0283155_929_1207 | 87 |
| 539 | 3300039450 | Ga0436363_0469747 | Ga0436363_0469747_472_744 | 87 |
| 540 | 3300039450 | Ga0436363_0590522 | Ga0436363_0590522_49_321 | 87 |
| 541 | 3300039450 | Ga0436363_0832663 | Ga0436363_0832663_239_514 | 87 |
| 542 | 3300039450 | Ga0436363_0865732 | Ga0436363_0865732_1473_1751 | 87 |
| 543 | 3300039450 | Ga0436363_0950379 | Ga0436363_0950379_2573_2848 | 87 |
| 544 | 3300039450 | Ga0436363_0992069 | Ga0436363_0992069_68_337 | 87 |
| 545 | 3300039450 | Ga0436363_1098882 | Ga0436363_1098882_161_439 | 87 |
| 546 | 3300041451 | Ga0451791_1597435 | Ga0451791_1597435_110_373 | 87 |
| 547 | 3300041460 | Ga0451802_0643512 | Ga0451802_0643512_241_510 | 87 |
| 548 | 3300041494 | Ga0451837_0898365 | Ga0451837_0898365_1973_2254 | 87 |
| 549 | 3300041501 | Ga0451845_0978265 | Ga0451845_0978265_358_621 | 87 |
| 550 | 3300041511 | Ga0451855_0984920 | Ga0451855_0984920_14910_15173 | 87 |
| 551 | 3300041512 | Ga0451853_0961848 | Ga0451853_0961848_374_637 | 87 |
| 552 | 3300041512 | Ga0451853_3701895 | Ga0451853_3701895_50_331 | 87 |
| 553 | 3300042005 | Ga0439448_0289099 | Ga0439448_0289099_254_529 | 87 |
| 554 | 3300044656 | Ga0466969_0419942 | Ga0466969_0419942_278_541 | 87 |
| 555 | 3300044656 | Ga0466969_0462719 | Ga0466969_0462719_22_285 | 87 |
| 556 | 3300044684 | Ga0466966_0001036 | Ga0466966_0001036_7228_7491 | 87 |
| 557 | 3300044684 | Ga0466966_0001850 | Ga0466966_0001850_4113_4376 | 87 |
| 558 | 3300044693 | Ga0466961_0000004 | Ga0466961_0000004_118718_118981 | 87 |
| 559 | 3300044693 | Ga0466961_0136286 | Ga0466961_0136286_247_510 | 87 |
| 560 | 3300044693 | Ga0466961_0282653 | Ga0466961_0282653_740_1003 | 87 |
| 561 | 3300044694 | Ga0466963_0045911 | Ga0466963_0045911_290_559 | 87 |
| 562 | 3300044901 | Ga0466960_0568302 | Ga0466960_0568302_218_481 | 87 |
| 563 | 3300045051 | Ga0451576_0002567 | Ga0451576_0002567_19328_19600 | 87 |
| 564 | 3300045051 | Ga0451576_1151414 | Ga0451576_1151414_65_337 | 87 |
| 565 | 3300045836 | Ga0466958_1166610 | Ga0466958_1166610_172_435 | 87 |
| 566 | 3300045976 | Ga0466967_1145459 | Ga0466967_1145459_103_372 | 87 |
| 567 | 3300046455 | Ga0495603_0505824 | Ga0495603_0505824_289_552 | 87 |
| 568 | 3300046459 | Ga0495629_0500025 | Ga0495629_0500025_131_409 | 87 |
| 569 | 3300046460 | Ga0495638_0108565 | Ga0495638_0108565_591_854 | 87 |
| 570 | 3300046462 | Ga0495651_0837574 | Ga0495651_0837574_155_424 | 87 |
| 571 | 3300046463 | Ga0495653_0923002 | Ga0495653_0923002_48_326 | 87 |
| 572 | 3300046477 | Ga0495664_0316564 | Ga0495664_0316564_392_670 | 87 |
| 573 | 3300046477 | Ga0495664_0431967 | Ga0495664_0431967_185_448 | 87 |
| 574 | 3300046491 | Ga0495584_0321807 | Ga0495584_0321807_413_676 | 87 |
| 575 | 3300046507 | Ga0495606_0305319 | Ga0495606_0305319_302_565 | 87 |
| 576 | 3300046507 | Ga0495606_0669266 | Ga0495606_0669266_154_417 | 87 |
| 577 | 3300046519 | Ga0495632_0000023 | Ga0495632_0000023_145301_145564 | 87 |
| 578 | 3300046522 | Ga0495643_0238648 | Ga0495643_0238648_236_499 | 87 |
| 579 | 3300046524 | Ga0495648_0009994 | Ga0495648_0009994_1811_2086 | 87 |
| 580 | 3300046524 | Ga0495648_0055254 | Ga0495648_0055254_305_586 | 87 |
| 581 | 3300046525 | Ga0495663_0000059 | Ga0495663_0000059_35370_35633 | 87 |
| 582 | 3300046530 | Ga0495654_0378927 | Ga0495654_0378927_288_551 | 87 |
| 583 | 3300046533 | Ga0495640_0108583 | Ga0495640_0108583_122_400 | 87 |
| 584 | 3300046557 | Ga0495622_0139512 | Ga0495622_0139512_494_757 | 87 |
| 585 | 3300046558 | Ga0495633_0003846 | Ga0495633_0003846_2099_2371 | 87 |
| 586 | 3300046558 | Ga0495633_0007824 | Ga0495633_0007824_4412_4675 | 87 |
| 587 | 3300046660 | Ga0495625_0458757 | Ga0495625_0458757_147_410 | 87 |
| 588 | 3300046684 | Ga0495669_0471668 | Ga0495669_0471668_309_572 | 87 |
| 589 | 3300046694 | Ga0495649_0351381 | Ga0495649_0351381_139_402 | 87 |
| 590 | 3300047317 | Ga0495604_0590913 | Ga0495604_0590913_117_386 | 87 |
| 591 | 3300047319 | Ga0495674_0570706 | Ga0495674_0570706_504_779 | 87 |
| 592 | 3300047319 | Ga0495674_0878913 | Ga0495674_0878913_89_358 | 87 |
| 593 | 3300047320 | Ga0495672_0000160 | Ga0495672_0000160_77319_77582 | 87 |
| 594 | 3300047320 | Ga0495672_0095259 | Ga0495672_0095259_1246_1524 | 87 |
| 595 | 3300047320 | Ga0495672_0162682 | Ga0495672_0162682_563_826 | 87 |
| 596 | 3300047320 | Ga0495672_0314138 | Ga0495672_0314138_124_387 | 87 |
| 597 | 3300047321 | Ga0495676_0354450 | Ga0495676_0354450_291_569 | 87 |
| 598 | 3300047321 | Ga0495676_0368815 | Ga0495676_0368815_123_401 | 87 |
| 599 | 3300047469 | Ga0495673_0181500 | Ga0495673_0181500_151_414 | 87 |
| 600 | 3300047472 | Ga0495686_0330915 | Ga0495686_0330915_498_761 | 87 |
| 601 | 3300047472 | Ga0495686_0442986 | Ga0495686_0442986_135_398 | 87 |
| 602 | 3300047673 | Ga0495593_0209360 | Ga0495593_0209360_195_473 | 87 |
| 603 | 3300048903 | Ga0496100_0757863 | Ga0496100_0757863_309_587 | 87 |
| 604 | 3300048903 | Ga0496100_1414261 | Ga0496100_1414261_274_537 | 87 |
| 605 | 3300048904 | Ga0496101_0937427 | Ga0496101_0937427_136_414 | 87 |
| 606 | 3300048905 | Ga0496102_0262378 | Ga0496102_0262378_1309_1572 | 87 |
| 607 | 3300048906 | Ga0496103_0889972 | Ga0496103_0889972_247_522 | 87 |
| 608 | 3300048907 | Ga0496104_0000255 | Ga0496104_0000255_36235_36510 | 87 |
| 609 | 3300048907 | Ga0496104_0055706 | Ga0496104_0055706_1577_1858 | 87 |
| 610 | 3300048907 | Ga0496104_0086120 | Ga0496104_0086120_1617_1880 | 87 |
| 611 | 3300048907 | Ga0496104_0164093 | Ga0496104_0164093_1673_1951 | 87 |
| 612 | 3300048907 | Ga0496104_0471618 | Ga0496104_0471618_858_1136 | 87 |
| 613 | 3300048908 | Ga0496105_0000078 | Ga0496105_0000078_62876_63151 | 87 |
| 614 | 3300048908 | Ga0496105_0211950 | Ga0496105_0211950_721_999 | 87 |
| 615 | 3300048908 | Ga0496105_0226167 | Ga0496105_0226167_10_273 | 87 |
| 616 | 3300048908 | Ga0496105_0490527 | Ga0496105_0490527_109_387 | 87 |
| 617 | 3300048909 | Ga0496106_0246673 | Ga0496106_0246673_923_1186 | 87 |
| 618 | 3300048909 | Ga0496106_1370034 | Ga0496106_1370034_139_420 | 87 |
| 619 | 3300048910 | Ga0496107_0052424 | Ga0496107_0052424_1164_1442 | 87 |
| 620 | 3300048910 | Ga0496107_0610407 | Ga0496107_0610407_64_327 | 87 |
| 621 | 3300048910 | Ga0496107_1106293 | Ga0496107_1106293_212_475 | 87 |
| 622 | 3300048913 | Ga0496110_0269347 | Ga0496110_0269347_181_444 | 87 |
| 623 | 3300048914 | Ga0496111_1156004 | Ga0496111_1156004_250_528 | 87 |
| 624 | 3300048915 | Ga0496112_0603030 | Ga0496112_0603030_283_561 | 87 |
| 625 | 3300048915 | Ga0496112_1663298 | Ga0496112_1663298_69_341 | 87 |
| 626 | 3300048916 | Ga0496113_0425242 | Ga0496113_0425242_732_995 | 87 |
| 627 | 3300048916 | Ga0496113_0465982 | Ga0496113_0465982_37_315 | 87 |
| 628 | 3300048916 | Ga0496113_1107659 | Ga0496113_1107659_162_428 | 87 |
| 629 | 3300048917 | Ga0496114_0433386 | Ga0496114_0433386_255_533 | 87 |
| 630 | 3300048918 | Ga0496115_0253250 | Ga0496115_0253250_1022_1300 | 87 |
| 631 | 3300048918 | Ga0496115_1106464 | Ga0496115_1106464_173_436 | 87 |
| 632 | 3300048919 | Ga0496116_0030535 | Ga0496116_0030535_2621_2902 | 87 |
| 633 | 3300048919 | Ga0496116_0153683 | Ga0496116_0153683_759_1040 | 87 |
| 634 | 3300048920 | Ga0496117_0000405 | Ga0496117_0000405_62701_62982 | 87 |
| 635 | 3300048920 | Ga0496117_0001136 | Ga0496117_0001136_25461_25742 | 87 |
| 636 | 3300048920 | Ga0496117_0015195 | Ga0496117_0015195_6277_6558 | 87 |
| 637 | 3300048920 | Ga0496117_0561311 | Ga0496117_0561311_220_489 | 87 |
| 638 | 3300048921 | Ga0496118_0000402 | Ga0496118_0000402_10059_10340 | 87 |
| 639 | 3300048921 | Ga0496118_0002991 | Ga0496118_0002991_4015_4296 | 87 |
| 640 | 3300048921 | Ga0496118_0003441 | Ga0496118_0003441_16695_16976 | 87 |
| 641 | 3300048922 | Ga0496119_0022321 | Ga0496119_0022321_3750_4031 | 87 |
| 642 | 3300048922 | Ga0496119_0038153 | Ga0496119_0038153_2564_2845 | 87 |
| 643 | 3300048922 | Ga0496119_0049885 | Ga0496119_0049885_1384_1665 | 87 |
| 644 | 3300048922 | Ga0496119_0145636 | Ga0496119_0145636_448_729 | 87 |
| 645 | 3300048923 | Ga0496120_0051428 | Ga0496120_0051428_1211_1492 | 87 |
| 646 | 3300048923 | Ga0496120_0091820 | Ga0496120_0091820_961_1242 | 87 |
| 647 | 3300048923 | Ga0496120_0245596 | Ga0496120_0245596_143_418 | 87 |
| 648 | 3300048924 | Ga0496121_0009861 | Ga0496121_0009861_9510_9791 | 87 |
| 649 | 3300048924 | Ga0496121_0089649 | Ga0496121_0089649_567_830 | 87 |
| 650 | 3300048924 | Ga0496121_0148849 | Ga0496121_0148849_435_716 | 87 |
| 651 | 3300048924 | Ga0496121_0220649 | Ga0496121_0220649_667_930 | 87 |
| 652 | 3300048924 | Ga0496121_0422852 | Ga0496121_0422852_109_384 | 87 |
| 653 | 3300048924 | Ga0496121_0560154 | Ga0496121_0560154_261_533 | 87 |
| 654 | 3300048924 | Ga0496121_0600945 | Ga0496121_0600945_193_462 | 87 |
| 655 | 3300048924 | Ga0496121_0702466 | Ga0496121_0702466_277_540 | 87 |
| 656 | 3300048925 | Ga0496122_0000921 | Ga0496122_0000921_40427_40708 | 87 |
| 657 | 3300048925 | Ga0496122_0029876 | Ga0496122_0029876_1551_1814 | 87 |
| 658 | 3300048926 | Ga0496123_0001350 | Ga0496123_0001350_22017_22298 | 87 |
| 659 | 3300048926 | Ga0496123_0513572 | Ga0496123_0513572_161_430 | 87 |
| 660 | 3300048928 | Ga0496125_0066170 | Ga0496125_0066170_1816_2097 | 87 |
| 661 | 3300048929 | Ga0496126_0000296 | Ga0496126_0000296_81590_81859 | 87 |
| 662 | 3300048929 | Ga0496126_0043240 | Ga0496126_0043240_721_1002 | 87 |
| 663 | 3300048929 | Ga0496126_0117776 | Ga0496126_0117776_208_471 | 87 |
| 664 | 3300048929 | Ga0496126_0326282 | Ga0496126_0326282_507_770 | 87 |
| 665 | 3300048929 | Ga0496126_0537753 | Ga0496126_0537753_64_327 | 87 |
| 666 | 3300048929 | Ga0496126_1140000 | Ga0496126_1140000_165_434 | 87 |
| 667 | 3300049460 | Ga0495682_0368803 | Ga0495682_0368803_182_445 | 87 |
| 668 | 3300049568 | Ga0501031_0000005 | Ga0501031_0000005_147448_147723 | 87 |
| 669 | 3300049568 | Ga0501031_0000157 | Ga0501031_0000157_9156_9419 | 87 |
| 670 | 3300049568 | Ga0501031_0000803 | Ga0501031_0000803_9027_9290 | 87 |
| 671 | 3300049568 | Ga0501031_0103161 | Ga0501031_0103161_1588_1851 | 87 |
| 672 | 3300049569 | Ga0501032_0000069 | Ga0501032_0000069_19214_19477 | 87 |
| 673 | 3300049569 | Ga0501032_0000337 | Ga0501032_0000337_3440_3715 | 87 |
| 674 | 3300049569 | Ga0501032_0000772 | Ga0501032_0000772_19765_20028 | 87 |
| 675 | 3300049569 | Ga0501032_0001324 | Ga0501032_0001324_8824_9087 | 87 |
| 676 | 3300049569 | Ga0501032_0001526 | Ga0501032_0001526_10675_10938 | 87 |
| 677 | 3300049569 | Ga0501032_0112590 | Ga0501032_0112590_1026_1289 | 87 |
| 678 | 3300049569 | Ga0501032_0168350 | Ga0501032_0168350_108_377 | 87 |
| 679 | 3300049569 | Ga0501032_0208243 | Ga0501032_0208243_954_1217 | 87 |
| 680 | 3300049569 | Ga0501032_0433984 | Ga0501032_0433984_486_749 | 87 |
| 681 | 3300049570 | Ga0501033_0000062 | Ga0501033_0000062_19214_19477 | 87 |
| 682 | 3300049570 | Ga0501033_0000129 | Ga0501033_0000129_69703_69978 | 87 |
| 683 | 3300049570 | Ga0501033_0000170 | Ga0501033_0000170_34095_34358 | 87 |
| 684 | 3300049570 | Ga0501033_0000175 | Ga0501033_0000175_6351_6614 | 87 |
| 685 | 3300049570 | Ga0501033_0000663 | Ga0501033_0000663_18264_18527 | 87 |
| 686 | 3300049570 | Ga0501033_0155430 | Ga0501033_0155430_885_1148 | 87 |
| 687 | 3300049570 | Ga0501033_0288899 | Ga0501033_0288899_700_963 | 87 |
| 688 | 3300049570 | Ga0501033_0308486 | Ga0501033_0308486_114_383 | 87 |
| 689 | 3300049571 | Ga0501034_0000494 | Ga0501034_0000494_19745_20008 | 87 |
| 690 | 3300049571 | Ga0501034_0000612 | Ga0501034_0000612_16745_17011 | 87 |
| 691 | 3300049571 | Ga0501034_0001942 | Ga0501034_0001942_6714_6977 | 87 |
| 692 | 3300049571 | Ga0501034_0002799 | Ga0501034_0002799_10579_10854 | 87 |
| 693 | 3300049571 | Ga0501034_0005998 | Ga0501034_0005998_6535_6798 | 87 |
| 694 | 3300049571 | Ga0501034_0039402 | Ga0501034_0039402_2894_3157 | 87 |
| 695 | 3300049571 | Ga0501034_0041000 | Ga0501034_0041000_3845_4108 | 87 |
| 696 | 3300049571 | Ga0501034_0404161 | Ga0501034_0404161_454_717 | 87 |
| 697 | 3300049572 | Ga0501036_0000014 | Ga0501036_0000014_35524_35799 | 87 |
| 698 | 3300049572 | Ga0501036_0000079 | Ga0501036_0000079_11422_11685 | 87 |
| 699 | 3300049572 | Ga0501036_0000086 | Ga0501036_0000086_19214_19477 | 87 |
| 700 | 3300049572 | Ga0501036_0000367 | Ga0501036_0000367_6400_6663 | 87 |
| 701 | 3300049572 | Ga0501036_0855613 | Ga0501036_0855613_377_640 | 87 |
| 702 | 3300049573 | Ga0501037_0000042 | Ga0501037_0000042_5226_5501 | 87 |
| 703 | 3300049573 | Ga0501037_0000087 | Ga0501037_0000087_62639_62902 | 87 |
| 704 | 3300049573 | Ga0501037_0001088 | Ga0501037_0001088_7585_7848 | 87 |
| 705 | 3300049573 | Ga0501037_0004449 | Ga0501037_0004449_2493_2756 | 87 |
| 706 | 3300049573 | Ga0501037_0004889 | Ga0501037_0004889_6226_6489 | 87 |
| 707 | 3300049574 | Ga0501038_0000024 | Ga0501038_0000024_35524_35799 | 87 |
| 708 | 3300049574 | Ga0501038_0000067 | Ga0501038_0000067_66325_66588 | 87 |
| 709 | 3300049574 | Ga0501038_0000095 | Ga0501038_0000095_66383_66646 | 87 |
| 710 | 3300049574 | Ga0501038_0000157 | Ga0501038_0000157_6336_6599 | 87 |
| 711 | 3300049574 | Ga0501038_0000284 | Ga0501038_0000284_28136_28399 | 87 |
| 712 | 3300049574 | Ga0501038_0168268 | Ga0501038_0168268_1034_1309 | 87 |
| 713 | 3300049574 | Ga0501038_0241953 | Ga0501038_0241953_996_1259 | 87 |
| 714 | 3300049575 | Ga0501039_0000059 | Ga0501039_0000059_19214_19477 | 87 |
| 715 | 3300049575 | Ga0501039_0000122 | Ga0501039_0000122_18073_18348 | 87 |
| 716 | 3300049575 | Ga0501039_0002627 | Ga0501039_0002627_6744_7007 | 87 |
| 717 | 3300049575 | Ga0501039_0005126 | Ga0501039_0005126_8087_8350 | 87 |
| 718 | 3300049575 | Ga0501039_0145994 | Ga0501039_0145994_1260_1523 | 87 |
| 719 | 3300049575 | Ga0501039_0343248 | Ga0501039_0343248_480_743 | 87 |
| 720 | 3300049576 | Ga0501040_0004151 | Ga0501040_0004151_8146_8421 | 87 |
| 721 | 3300049576 | Ga0501040_0144228 | Ga0501040_0144228_1109_1372 | 87 |
| 722 | 3300049576 | Ga0501040_1168246 | Ga0501040_1168246_210_473 | 87 |
| 723 | 3300049577 | Ga0501041_0588314 | Ga0501041_0588314_306_569 | 87 |
| 724 | 3300049577 | Ga0501041_0695230 | Ga0501041_0695230_265_543 | 87 |
| 725 | 3300049578 | Ga0501042_0017225 | Ga0501042_0017225_3976_4239 | 87 |
| 726 | 3300049578 | Ga0501042_0037725 | Ga0501042_0037725_3138_3401 | 87 |
| 727 | 3300049579 | Ga0501043_0000178 | Ga0501043_0000178_8352_8615 | 87 |
| 728 | 3300049579 | Ga0501043_0000289 | Ga0501043_0000289_28362_28625 | 87 |
| 729 | 3300049579 | Ga0501043_0000925 | Ga0501043_0000925_19399_19662 | 87 |
| 730 | 3300049579 | Ga0501043_0001213 | Ga0501043_0001213_11634_11897 | 87 |
| 731 | 3300049579 | Ga0501043_0170211 | Ga0501043_0170211_130_405 | 87 |
| 732 | 3300049579 | Ga0501043_0417172 | Ga0501043_0417172_369_632 | 87 |
| 733 | 3300049580 | Ga0501046_0000260 | Ga0501046_0000260_28294_28557 | 87 |
| 734 | 3300049580 | Ga0501046_0008310 | Ga0501046_0008310_6744_7007 | 87 |
| 735 | 3300049580 | Ga0501046_0014331 | Ga0501046_0014331_2458_2721 | 87 |
| 736 | 3300049580 | Ga0501046_0028877 | Ga0501046_0028877_1744_2019 | 87 |
| 737 | 3300049580 | Ga0501046_0119988 | Ga0501046_0119988_177_452 | 87 |
| 738 | 3300049580 | Ga0501046_1085899 | Ga0501046_1085899_195_473 | 87 |
| 739 | 3300049581 | Ga0501047_0000146 | Ga0501047_0000146_19214_19477 | 87 |
| 740 | 3300049581 | Ga0501047_0001569 | Ga0501047_0001569_7192_7470 | 87 |
| 741 | 3300049581 | Ga0501047_0002832 | Ga0501047_0002832_3760_4023 | 87 |
| 742 | 3300049581 | Ga0501047_0006906 | Ga0501047_0006906_1672_1947 | 87 |
| 743 | 3300049581 | Ga0501047_0037975 | Ga0501047_0037975_3258_3521 | 87 |
| 744 | 3300049581 | Ga0501047_0084365 | Ga0501047_0084365_1912_2187 | 87 |
| 745 | 3300049581 | Ga0501047_0301892 | Ga0501047_0301892_964_1227 | 87 |
| 746 | 3300049582 | Ga0501048_0000034 | Ga0501048_0000034_38609_38872 | 87 |
| 747 | 3300049582 | Ga0501048_0000722 | Ga0501048_0000722_6921_7184 | 87 |
| 748 | 3300049582 | Ga0501048_0068470 | Ga0501048_0068470_1361_1624 | 87 |
| 749 | 3300049582 | Ga0501048_0565409 | Ga0501048_0565409_31_306 | 87 |
| 750 | 3300049583 | Ga0501067_0000594 | Ga0501067_0000594_16250_16513 | 87 |
| 751 | 3300049583 | Ga0501067_0003934 | Ga0501067_0003934_4293_4556 | 87 |
| 752 | 3300049584 | Ga0501068_0000552 | Ga0501068_0000552_17039_17302 | 87 |
| 753 | 3300049584 | Ga0501068_0003289 | Ga0501068_0003289_7520_7783 | 87 |
| 754 | 3300049584 | Ga0501068_0726980 | Ga0501068_0726980_54_317 | 87 |
| 755 | 3300049585 | Ga0501069_0000046 | Ga0501069_0000046_22958_23221 | 87 |
| 756 | 3300049585 | Ga0501069_0000318 | Ga0501069_0000318_17273_17536 | 87 |
| 757 | 3300049586 | Ga0501070_0000073 | Ga0501070_0000073_66325_66588 | 87 |
| 758 | 3300049586 | Ga0501070_0002481 | Ga0501070_0002481_5590_5853 | 87 |
| 759 | 3300049586 | Ga0501070_0003509 | Ga0501070_0003509_5067_5330 | 87 |
| 760 | 3300049586 | Ga0501070_0034036 | Ga0501070_0034036_1221_1490 | 87 |
| 761 | 3300049586 | Ga0501070_0050594 | Ga0501070_0050594_176_451 | 87 |
| 762 | 3300049586 | Ga0501070_0148156 | Ga0501070_0148156_1145_1408 | 87 |
| 763 | 3300049586 | Ga0501070_0160607 | Ga0501070_0160607_190_453 | 87 |
| 764 | 3300049586 | Ga0501070_0656183 | Ga0501070_0656183_471_746 | 87 |
| 765 | 3300049586 | Ga0501070_1052303 | Ga0501070_1052303_223_492 | 87 |
| 766 | 3300049586 | Ga0501070_1116270 | Ga0501070_1116270_238_516 | 87 |
| 767 | 3300049586 | Ga0501070_1165427 | Ga0501070_1165427_178_456 | 87 |
| 768 | 3300049586 | Ga0501070_1452347 | Ga0501070_1452347_41_310 | 87 |
| 769 | 3300049587 | Ga0501071_0000441 | Ga0501071_0000441_17076_17339 | 87 |
| 770 | 3300049587 | Ga0501071_0018761 | Ga0501071_0018761_2606_2869 | 87 |
| 771 | 3300049588 | Ga0501072_0000658 | Ga0501072_0000658_21003_21266 | 87 |
| 772 | 3300049588 | Ga0501072_0004362 | Ga0501072_0004362_9417_9680 | 87 |
| 773 | 3300049588 | Ga0501072_0944866 | Ga0501072_0944866_111_374 | 87 |
| 774 | 3300049589 | Ga0501073_0000239 | Ga0501073_0000239_29290_29553 | 87 |
| 775 | 3300049589 | Ga0501073_0000323 | Ga0501073_0000323_13262_13525 | 87 |
| 776 | 3300049589 | Ga0501073_0129600 | Ga0501073_0129600_654_917 | 87 |
| 777 | 3300049590 | Ga0501074_0000025 | Ga0501074_0000025_19655_19918 | 87 |
| 778 | 3300049590 | Ga0501074_0000093 | Ga0501074_0000093_10219_10482 | 87 |
| 779 | 3300049590 | Ga0501074_0212978 | Ga0501074_0212978_203_466 | 87 |
| 780 | 3300049590 | Ga0501074_0934344 | Ga0501074_0934344_112_375 | 87 |
| 781 | 3300049591 | Ga0501075_0718076 | Ga0501075_0718076_260_523 | 87 |
| 782 | 3300049592 | Ga0501076_0494943 | Ga0501076_0494943_323_586 | 87 |
| 783 | 3300049593 | Ga0501077_0051655 | Ga0501077_0051655_795_1058 | 87 |
| 784 | 3300049741 | Ga0501079_0000862 | Ga0501079_0000862_2582_2845 | 87 |
| 785 | 3300049741 | Ga0501079_0001388 | Ga0501079_0001388_14610_14873 | 87 |
| 786 | 3300049741 | Ga0501079_0542036 | Ga0501079_0542036_584_847 | 87 |
| 787 | 3300049742 | Ga0501080_0000037 | Ga0501080_0000037_15779_16042 | 87 |
| 788 | 3300049742 | Ga0501080_0000635 | Ga0501080_0000635_6744_7007 | 87 |
| 789 | 3300049742 | Ga0501080_0050016 | Ga0501080_0050016_338_601 | 87 |
| 790 | 3300049742 | Ga0501080_0362973 | Ga0501080_0362973_133_402 | 87 |
| 791 | 3300049742 | Ga0501080_0544921 | Ga0501080_0544921_253_528 | 87 |
| 792 | 3300049744 | Ga0501083_0000350 | Ga0501083_0000350_27031_27294 | 87 |
| 793 | 3300049744 | Ga0501083_0004275 | Ga0501083_0004275_7596_7859 | 87 |
| 794 | 3300049744 | Ga0501083_1075206 | Ga0501083_1075206_236_502 | 87 |
| 795 | 3300049822 | Ga0501035_0000045 | Ga0501035_0000045_112907_113182 | 87 |
| 796 | 3300049822 | Ga0501035_0000141 | Ga0501035_0000141_66315_66578 | 87 |
| 797 | 3300049822 | Ga0501035_0000172 | Ga0501035_0000172_72433_72696 | 87 |
| 798 | 3300049822 | Ga0501035_0002255 | Ga0501035_0002255_559_822 | 87 |
| 799 | 3300049822 | Ga0501035_0003323 | Ga0501035_0003323_11311_11589 | 87 |
| 800 | 3300049822 | Ga0501035_0248701 | Ga0501035_0248701_461_730 | 87 |
| 801 | 3300049822 | Ga0501035_0269648 | Ga0501035_0269648_758_1027 | 87 |
| 802 | 3300049822 | Ga0501035_0370745 | Ga0501035_0370745_615_890 | 87 |
| 803 | 3300049822 | Ga0501035_1221369 | Ga0501035_1221369_171_434 | 87 |
| 804 | 3300049823 | Ga0501044_0000044 | Ga0501044_0000044_35524_35799 | 87 |
| 805 | 3300049823 | Ga0501044_0000151 | Ga0501044_0000151_66391_66654 | 87 |
| 806 | 3300049823 | Ga0501044_0001408 | Ga0501044_0001408_6508_6771 | 87 |
| 807 | 3300049823 | Ga0501044_0006037 | Ga0501044_0006037_559_822 | 87 |
| 808 | 3300049823 | Ga0501044_0016838 | Ga0501044_0016838_5622_5900 | 87 |
| 809 | 3300049823 | Ga0501044_0046475 | Ga0501044_0046475_3292_3567 | 87 |
| 810 | 3300049823 | Ga0501044_0133777 | Ga0501044_0133777_1756_2019 | 87 |
| 811 | 3300049823 | Ga0501044_0162676 | Ga0501044_0162676_299_562 | 87 |
| 812 | 3300049823 | Ga0501044_0319675 | Ga0501044_0319675_482_751 | 87 |
| 813 | 3300049823 | Ga0501044_0385583 | Ga0501044_0385583_432_710 | 87 |
| 814 | 3300049823 | Ga0501044_0800658 | Ga0501044_0800658_73_336 | 87 |
| 815 | 3300049824 | Ga0501045_0000540 | Ga0501045_0000540_6350_6613 | 87 |
| 816 | 3300049824 | Ga0501045_0033573 | Ga0501045_0033573_1525_1788 | 87 |
| 817 | 3300049824 | Ga0501045_0376772 | Ga0501045_0376772_533_808 | 87 |
| 818 | 3300050490 | nmdc:mga03n38_13425_c1 | nmdc:mga03n38_13425_c1_2250_2531 | 87 |
| 819 | 3300050491 | nmdc:mga00v17_36982_c1 | nmdc:mga00v17_36982_c1_1816_2097 | 87 |
| 820 | 3300050492 | nmdc:mga0yw44_293469_c1 | nmdc:mga0yw44_293469_c1_376_654 | 87 |
| 821 | 3300050492 | nmdc:mga0yw44_364359_c1 | nmdc:mga0yw44_364359_c1_364_627 | 87 |
| 822 | 3300050492 | nmdc:mga0yw44_405537_c1 | nmdc:mga0yw44_405537_c1_555_818 | 87 |
| 823 | 3300050492 | nmdc:mga0yw44_446_c1 | nmdc:mga0yw44_446_c1_11470_11751 | 87 |
| 824 | 3300050492 | nmdc:mga0yw44_59982_c1 | nmdc:mga0yw44_59982_c1_262_525 | 87 |
| 825 | 3300050494 | nmdc:mga06z11_5260_c2 | nmdc:mga06z11_5260_c2_1282_1563 | 87 |
| 826 | 3300050496 | nmdc:mga07m45_278897_c1 | nmdc:mga07m45_278897_c1_341_622 | 87 |
| 827 | 3300050507 | nmdc:mga05p37_1942916_c1 | nmdc:mga05p37_1942916_c1_168_446 | 87 |
| 828 | 3300050512 | nmdc:mga0n895_821034_c1 | nmdc:mga0n895_821034_c1_47_328 | 87 |
| 829 | 3300050512 | nmdc:mga0n895_838897_c1 | nmdc:mga0n895_838897_c1_564_842 | 87 |
| 830 | 3300050513 | nmdc:mga0rr50_474993_c1 | nmdc:mga0rr50_474993_c1_202_480 | 87 |
| 831 | 3300050516 | nmdc:mga0sz30_248264_c1 | nmdc:mga0sz30_248264_c1_380_655 | 87 |
| 832 | 3300053078 | Ga0495612_0227018 | Ga0495612_0227018_371_634 | 87 |
| 833 | 3300053079 | Ga0500610_0272263 | Ga0500610_0272263_175_459 | 87 |
| 834 | 3300053111 | Ga0500572_087132 | Ga0500572_087132_611_874 | 87 |
| 835 | 3300053121 | Ga0500607_206381 | Ga0500607_206381_200_463 | 87 |
| 836 | 3300053122 | Ga0500608_369581 | Ga0500608_369581_185_448 | 87 |
| 837 | 3300053136 | Ga0500559_0016276 | Ga0500559_0016276_1709_1972 | 87 |
| 838 | 3300053136 | Ga0500559_0064957 | Ga0500559_0064957_1218_1487 | 87 |
| 839 | 3300053148 | Ga0500590_098151 | Ga0500590_098151_818_1081 | 87 |
| 840 | 3300053148 | Ga0500590_140551 | Ga0500590_140551_498_767 | 87 |
| 841 | 3300053158 | Ga0500627_0000048 | Ga0500627_0000048_54269_54538 | 87 |
| 842 | 3300053158 | Ga0500627_0310374 | Ga0500627_0310374_266_529 | 87 |
| 843 | 3300053159 | Ga0500630_146903 | Ga0500630_146903_95_364 | 87 |
| 844 | 3300053163 | Ga0500639_000710 | Ga0500639_000710_1711_1980 | 87 |
| 845 | 3300053163 | Ga0500639_342776 | Ga0500639_342776_22_285 | 87 |
| 846 | 3300053177 | Ga0500636_0017863 | Ga0500636_0017863_3242_3517 | 87 |
| 847 | 3300054114 | Ga0501084_0002854 | Ga0501084_0002854_12091_12354 | 87 |
| 848 | 3300054114 | Ga0501084_0024934 | Ga0501084_0024934_2403_2666 | 87 |
| 849 | 3300060353 | Ga0501082_0000355 | Ga0501082_0000355_30823_31086 | 87 |
| 850 | 3300060353 | Ga0501082_0004972 | Ga0501082_0004972_2411_2674 | 87 |
| 851 | 3300060353 | Ga0501082_0574454 | Ga0501082_0574454_496_759 | 87 |
| 852 | 3300060353 | Ga0501082_0619322 | Ga0501082_0619322_628_903 | 87 |
| 853 | 3300061734 | Ga0530510_0471544 | Ga0530510_0471544_577_840 | 87 |
| 854 | 3300061734 | Ga0530510_1454721 | Ga0530510_1454721_34_297 | 87 |
| 855 | iso_pu_bacteria | 2510461069 | 2510840207 | 87 |
| 856 | iso_pu_bacteria | 2512564014 | 2512643129 | 87 |
| 857 | iso_pu_bacteria | 2513237086 | 2513587407 | 87 |
| 858 | iso_pu_bacteria | 2513237087 | 2513592869 | 87 |
| 859 | iso_pu_bacteria | 2513237137 | 2513863418 | 87 |
| 860 | iso_pu_bacteria | 2513237137 | 2513864015 | 87 |
| 861 | iso_pu_bacteria | 2513237137 | 2513864337 | 87 |
| 862 | iso_pu_bacteria | 2513237139 | 2513879740 | 87 |
| 863 | iso_pu_bacteria | 2515154112 | 2515630447 | 87 |
| 864 | iso_pu_bacteria | 2516143018 | 2516205842 | 87 |
| 865 | iso_pu_bacteria | 2517093001 | 2517108042 | 87 |
| 866 | iso_pu_bacteria | 2517572143 | 2517887621 | 87 |
| 867 | iso_pu_bacteria | 2524023210 | 2524471174 | 87 |
| 868 | iso_pu_bacteria | 2537561587 | 2537876283 | 87 |
| 869 | iso_pu_bacteria | 2558860100 | 2558860116 | 87 |
| 870 | iso_pu_bacteria | 2802429603 | 2805922871 | 87 |
| 871 | iso_pu_bacteria | 2824746037 | 2824749504 | 87 |
| 872 | iso_pu_bacteria | 2841734538 | 2841739822 | 87 |
| 873 | iso_pu_bacteria | 2841941048 | 2841949314 | 87 |
| 874 | iso_pu_bacteria | 2841949485 | 2841957603 | 87 |
| 875 | iso_pu_bacteria | 2841974524 | 2841981412 | 87 |
| 876 | iso_pu_bacteria | 2842348783 | 2842353381 | 87 |
| 877 | iso_pu_bacteria | 2842357229 | 2842362954 | 87 |
| 878 | iso_pu_bacteria | 2847930680 | 2847931650 | 87 |
| 879 | iso_pu_bacteria | 2847939898 | 2847942908 | 87 |
| 880 | iso_pu_bacteria | 2885366525 | 2885370898 | 87 |
| 881 | iso_pu_bacteria | 2888378607 | 2888378947 | 87 |
| 882 | iso_pu_bacteria | 2891088606 | 2891091104 | 87 |
| 883 | iso_pu_bacteria | 2891088606 | 2891093067 | 87 |
| 884 | iso_pu_bacteria | 2904456579 | 2904457263 | 87 |
| 885 | iso_pu_bacteria | 2908775508 | 2908775568 | 87 |
| 886 | iso_pu_bacteria | 2909399089 | 2909401321 | 87 |
| 887 | iso_pu_bacteria | 2921201388 | 2921204170 | 87 |
| 888 | iso_pu_bacteria | 2921201388 | 2921204181 | 87 |
| 889 | iso_pu_bacteria | 2924207177 | 2924213175 | 87 |
| 890 | iso_pu_bacteria | 2929624759 | 2929633516 | 87 |
| 891 | iso_pu_bacteria | 2935675223 | 2935684680 | 87 |
| 892 | iso_pu_bacteria | 2935703347 | 2935712846 | 87 |
| 893 | iso_pu_bacteria | 2935769743 | 2935775723 | 87 |
| 894 | iso_pu_bacteria | 2935785616 | 2935792640 | 87 |
| 895 | iso_pu_bacteria | 2935793552 | 2935800680 | 87 |
| 896 | iso_pu_bacteria | 2935975950 | 2935982902 | 87 |
| 897 | iso_pu_bacteria | 2935992306 | 2936001301 | 87 |
| 898 | iso_pu_bacteria | 2936055302 | 2936055758 | 87 |
| 899 | iso_pu_bacteria | 2937063883 | 2937070220 | 87 |
| 900 | iso_pu_bacteria | 2937106411 | 2937107067 | 87 |
| 901 | iso_pu_bacteria | 2937106411 | 2937108153 | 87 |
| 902 | iso_pu_bacteria | 2941531003 | 2941537586 | 87 |
| 903 | iso_pu_bacteria | 2945972063 | 2945976203 | 87 |
| 904 | iso_pu_bacteria | 2960637947 | 2960643157 | 87 |
| 905 | iso_pu_bacteria | 2964628898 | 2964629386 | 87 |
| 906 | iso_pu_bacteria | 2964663802 | 2964669044 | 87 |
| 907 | iso_pu_bacteria | 2964719344 | 2964724886 | 87 |
| 908 | iso_pu_bacteria | 2967664464 | 2967664770 | 87 |
| 909 | iso_pu_bacteria | 2967664464 | 2967666565 | 87 |
| 910 | iso_pu_bacteria | 2967996073 | 2968002693 | 87 |
| 911 | iso_pu_bacteria | 2970033650 | 2970039059 | 87 |
| 912 | iso_pu_bacteria | 2970068827 | 2970074217 | 87 |
| 913 | iso_pu_bacteria | 2970082768 | 2970087708 | 87 |
| 914 | iso_pu_bacteria | 2977986579 | 2977987225 | 87 |
| 915 | iso_pu_bacteria | 3005710791 | 3005717076 | 87 |
| 916 | iso_pu_bacteria | 643348555 | 643392334 | 87 |
| 917 | iso_pu_bacteria | 8016622563 | 8016630928 | 87 |
| 918 | iso_pu_bacteria | 8019538911 | 8019542106 | 87 |
| 919 | iso_pu_bacteria | 8019547302 | 8019547555 | 87 |
| 920 | iso_pu_bacteria | 8019586578 | 8019592614 | 87 |
| 921 | iso_pu_bacteria | 8019619141 | 8019622325 | 87 |
| 922 | iso_pu_bacteria | 8019629233 | 8019630986 | 87 |
| 923 | iso_pu_bacteria | 8019638758 | 8019639636 | 87 |
| 924 | iso_pu_bacteria | 8019678201 | 8019687771 | 87 |
| 925 | iso_pu_bacteria | 8023680758 | 8023688463 | 87 |
| 926 | iso_pu_bacteria | 8055742211 | 8055743068 | 87 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar