F485856

General Info

Members Datasets Scaffolds Average Seq Length
924 550 797 279

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10053597|Ga0105246_100535972
Length 329
Sequence MALVRLIVVGLSAQTASPTPVAFRYAPAIDLRKSRGQLFLMDCREKAGIKPLSSRPEIEVESAPTRRPAGAMIEIDRVSQIFQTSGRQNHLALSQISLTIDDGAFVAILGPSGCGKSTLLYIVGGFVNPTEGIARMKGKPIAGPGPDRGPVFQEFALFPWKTVLGNVMYGPRQLRVKSAEAEAQSRQLIEMVGLKGFEDFYPKELSGGMKQRVALARTLAYHPAVLLMDEPFGALDAHTRTRLQNDLLNIWERDRKTVLFVTHSVDEAVFLSDKVVVMTRAPGRIKEIVDINLPRPRRRADLLLDPRYQKYVVEIERMIDDTSEDGLRP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
17 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
18 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
19 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
20 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
21 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
22 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
23 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
24 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
25 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
26 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
27 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
28 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
29 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
30 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
31 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
32 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
33 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
34 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
35 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
36 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
37 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
38 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
39 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
40 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
41 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
42 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
43 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
44 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
45 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
46 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
47 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
48 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
49 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
50 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
51 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
52 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
53 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
54 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
55 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
56 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
57 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
58 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
59 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
60 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
61 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
62 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
63 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
64 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
65 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
66 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
67 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
68 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
69 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
70 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
71 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
72 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
73 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
74 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
75 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
76 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
77 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
78 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
79 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
80 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
81 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
82 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
83 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
84 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
85 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
86 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
87 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
88 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
89 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
90 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
91 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
92 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
93 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
94 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
95 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
96 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
97 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
98 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
99 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
100 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
101 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
102 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
103 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
104 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
105 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
106 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
107 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
108 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
109 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
110 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
111 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
112 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
113 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
114 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
115 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
116 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
117 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
118 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
119 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
120 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
121 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
122 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
123 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
124 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
125 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
126 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
127 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
128 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
129 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
130 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
131 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
132 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
133 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
134 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
135 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
136 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
137 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
138 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
139 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
140 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
141 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
142 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
143 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
144 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
145 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
146 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
147 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
148 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
149 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
150 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
151 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
152 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
153 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
154 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
155 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
156 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
157 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
158 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
159 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
160 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
161 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
162 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
163 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
164 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
165 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
166 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
167 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
168 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
169 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
170 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
171 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
172 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
173 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
174 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
175 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
176 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
177 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
178 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
179 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
180 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
181 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
182 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
183 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
184 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
185 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
186 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
187 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
188 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
189 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
190 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
191 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
192 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
193 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
194 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
195 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
196 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
197 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
198 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
199 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
200 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
201 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
202 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
203 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
204 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
205 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
206 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
207 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
208 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
209 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
210 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
211 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
212 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
213 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
214 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
217 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
221 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
223 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
277 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
278 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
279 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
280 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
281 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
282 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
286 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
287 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
288 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
289 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
290 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
291 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
292 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
293 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
294 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
295 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
296 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
297 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
298 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
299 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
300 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
301 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
302 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
303 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
304 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
305 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
306 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
307 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
308 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
309 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
310 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
311 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
312 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
313 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
314 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
315 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
316 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
318 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
319 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
320 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
321 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
322 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
323 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
324 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
325 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
326 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
327 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
328 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
329 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
330 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
331 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
332 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
333 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
334 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
335 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
336 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
337 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
338 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
339 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
340 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
341 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
342 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
343 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
344 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
345 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
346 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
347 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
348 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
349 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
350 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
351 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
352 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
353 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
354 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
355 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
356 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
357 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
358 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
359 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
360 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
361 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
362 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
363 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
364 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
365 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
366 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
367 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
368 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
369 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
370 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
371 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
372 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
373 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
376 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
377 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
381 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
382 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
383 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
384 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
385 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
386 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
387 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
388 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
389 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
390 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
391 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
392 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
393 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
394 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
395 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
396 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
397 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
398 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
399 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
400 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
401 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
402 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
403 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
404 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
405 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
406 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
410 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
411 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
412 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
413 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
414 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
415 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
416 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
417 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
418 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
419 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
420 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
421 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
422 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
423 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
424 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
425 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
426 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
427 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
428 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
429 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
430 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
431 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
432 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
433 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
434 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
435 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
436 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
450 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
451 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
452 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
453 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
454 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
455 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
456 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
457 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
458 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
459 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
460 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
463 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
464 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
465 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
466 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
467 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
468 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
469 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
470 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
471 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
472 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
473 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
474 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
475 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
476 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
477 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
478 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
479 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
480 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
481 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
482 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
483 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
484 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
485 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
486 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
487 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
488 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
489 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
490 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
491 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
492 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
493 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
494 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
495 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
496 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
497 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
498 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
499 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
500 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
501 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
502 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
503 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
504 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
505 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
506 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
507 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
508 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
509 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
510 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
511 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
512 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
513 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
514 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
515 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
516 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
517 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
518 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
519 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
520 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
521 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
522 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
523 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
524 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
525 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
526 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
527 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
528 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
529 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
530 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
531 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
532 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
533 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
534 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
535 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
536 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
537 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
538 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
539 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
540 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
541 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
542 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
543 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
544 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
545 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
546 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
547 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
548 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
549 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
550 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.26
Metatranscriptomes 0
Isolates 13.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.39
Nodule 12.88
Rhizoplane 6.93
Rhizosphere 58.55
Stem 0
Stem Tuber 0
Unclassified 7.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10047256 3300001990 Bacteria 1312
2 JGI24750J21931_1002919 3300002070 Bacteria 2046
3 JGI25165J46597_1006259 3300003214 Bacteria 2134
4 JGI25153J46596_10000110 3300003215 Bacteria 93591
5 JGI25153J46596_10000161 3300003215 Bacteria 67388
6 JGI25153J46596_10000354 3300003215 Bacteria 31788
7 JGI25153J46596_10006394 3300003215 Bacteria 5971
8 JGI25153J46596_10015820 3300003215 Bacteria 3052
9 rootH1_10033771 3300003323 Bacteria 3812
10 JGI25160J50197_1000217 3300003354 Bacteria 46375
11 JGI25160J50197_1001256 3300003354 Bacteria 12850
12 JGI25160J50197_1008322 3300003354 Bacteria 3960
13 Ga0055539_1004673 3300003752 Bacteria 1818
14 Ga0055542_1006033 3300003762 Bacteria 2641
15 Ga0055529_1007904 3300003763 Bacteria 1428
16 Ga0055526_1036322 3300003771 Bacteria 1309
17 Ga0055531_10030177 3300003794 Bacteria 1828
18 Ga0055543_1003554 3300004625 Bacteria 4523
19 Ga0065165_1000244 3300005262 Bacteria 93411
20 Ga0065165_1000368 3300005262 Bacteria 73904
21 Ga0065165_1009863 3300005262 Bacteria 4213
22 Ga0065165_1013890 3300005262 Bacteria 3164
23 Ga0070676_10291743 3300005328 Bacteria 1102
24 Ga0070670_100021295 3300005331 Bacteria 5577
25 Ga0070670_100033635 3300005331 Bacteria 4415
26 Ga0070670_100595403 3300005331 Bacteria 989
27 Ga0070666_10138301 3300005335 Bacteria 1696
28 Ga0070680_100074670 3300005336 Bacteria 2790
29 Ga0070682_100089046 3300005337 Bacteria 2015
30 Ga0070660_100413953 3300005339 Bacteria 1116
31 Ga0070691_10022142 3300005341 Bacteria 2946
32 Ga0070687_100117744 3300005343 Bacteria 1514
33 Ga0070668_100019603 3300005347 Bacteria 5091
34 Ga0070668_100037603 3300005347 Bacteria 3697
35 Ga0070675_100437456 3300005354 Bacteria 1171
36 Ga0070671_100014431 3300005355 Bacteria 6384
37 Ga0070673_100025677 3300005364 Bacteria 4340
38 Ga0070673_100185913 3300005364 Bacteria 1781
39 Ga0070659_100011570 3300005366 Bacteria 6531
40 Ga0070667_100042934 3300005367 Bacteria 3794
41 Ga0070667_100088818 3300005367 Bacteria 2654
42 Ga0070667_100359941 3300005367 Bacteria 1318
43 Ga0070709_10003713 3300005434 Bacteria 8204
44 Ga0070714_100035097 3300005435 Bacteria 4201
45 Ga0070714_100304490 3300005435 Bacteria 1486
46 Ga0070714_100451105 3300005435 Bacteria 1222
47 Ga0070713_100040305 3300005436 Bacteria 3797
48 Ga0070713_100052143 3300005436 Bacteria 3386
49 Ga0070710_10000965 3300005437 Bacteria 13640
50 Ga0070701_10005491 3300005438 Bacteria 5246
51 Ga0070701_10038307 3300005438 Bacteria 2426
52 Ga0070711_100002283 3300005439 Bacteria 10871
53 Ga0070711_100042604 3300005439 Bacteria 3070
54 Ga0070705_100022760 3300005440 Bacteria 3353
55 Ga0070700_100042261 3300005441 Bacteria 2798
56 Ga0070694_100357761 3300005444 Bacteria 1133
57 Ga0070708_100065204 3300005445 Bacteria 3266
58 Ga0070663_100161614 3300005455 Bacteria 1724
59 Ga0070678_100012356 3300005456 Bacteria 5304
60 Ga0070678_100054699 3300005456 Bacteria 2910
61 Ga0070662_100005484 3300005457 Bacteria 8109
62 Ga0070662_100017092 3300005457 Bacteria 4883
63 Ga0070662_100084801 3300005457 Bacteria 2367
64 Ga0070685_10207574 3300005466 Bacteria 1277
65 Ga0070707_100021225 3300005468 Bacteria 6138
66 Ga0070684_100028265 3300005535 Bacteria 4743
67 Ga0070684_100047141 3300005535 Bacteria 3734
68 Ga0068853_100071694 3300005539 Bacteria 3017
69 Ga0068853_100145328 3300005539 Bacteria 2131
70 Ga0070686_100087062 3300005544 Bacteria 2081
71 Ga0070695_100199566 3300005545 Bacteria 1429
72 Ga0070693_100083478 3300005547 Bacteria 1910
73 Ga0070665_100020007 3300005548 Bacteria 6721
74 Ga0068855_100038765 3300005563 Bacteria 5660
75 Ga0068857_100096707 3300005577 Bacteria 2646
76 Ga0068857_100248922 3300005577 Bacteria 1629
77 Ga0068854_100009906 3300005578 Bacteria 6166
78 Ga0068854_100161236 3300005578 Bacteria 1737
79 Ga0068854_100394563 3300005578 Bacteria 1143
80 Ga0068856_100121348 3300005614 Bacteria 2615
81 Ga0068852_100001503 3300005616 Bacteria 15782
82 Ga0068852_100257446 3300005616 Bacteria 1674
83 Ga0068859_100123399 3300005617 Bacteria 2657
84 Ga0068859_100358526 3300005617 Bacteria 1553
85 Ga0068864_100396089 3300005618 Bacteria 1311
86 Ga0068861_100040555 3300005719 Bacteria 3483
87 Ga0068851_10037324 3300005834 Bacteria 2435
88 Ga0068863_100044648 3300005841 Bacteria 4205
89 Ga0068858_100069140 3300005842 Bacteria 3273
90 Ga0068858_100343107 3300005842 Bacteria 1430
91 Ga0068860_100082874 3300005843 Bacteria 3050
92 Ga0068860_100143777 3300005843 Bacteria 2294
93 Ga0068862_100017342 3300005844 Bacteria 5995
94 Ga0068862_100070936 3300005844 Bacteria 3008
95 Ga0081540_1031125 3300005983 Bacteria 2941
96 Ga0081540_1063983 3300005983 Bacteria 1738
97 Ga0081539_10000172 3300005985 Bacteria 151505
98 Ga0070717_10070422 3300006028 Bacteria 2915
99 Ga0070717_10070996 3300006028 Bacteria 2903
100 Ga0075365_10007549 3300006038 Bacteria 6104
101 Ga0075365_10105746 3300006038 Bacteria 1931
102 Ga0075365_10129215 3300006038 Bacteria 1747
103 Ga0075368_10000322 3300006042 Bacteria 14006
104 Ga0075368_10039184 3300006042 Bacteria 1857
105 Ga0075363_100001208 3300006048 Bacteria 9534
106 Ga0075364_10015940 3300006051 Bacteria 4666
107 Ga0075364_10037918 3300006051 Bacteria 3122
108 Ga0075364_10269687 3300006051 Bacteria 1158
109 Ga0075362_10052520 3300006177 Bacteria 1827
110 Ga0075362_10080859 3300006177 Bacteria 1498
111 Ga0075367_10004226 3300006178 Bacteria 6973
112 Ga0075367_10085174 3300006178 Bacteria 1918
113 Ga0075369_10005952 3300006186 Bacteria 4589
114 Ga0075369_10014616 3300006186 Bacteria 3140
115 Ga0075369_10021350 3300006186 Bacteria 2660
116 Ga0075366_10002088 3300006195 Bacteria 10148
117 Ga0075366_10008073 3300006195 Bacteria 5834
118 Ga0075366_10067769 3300006195 Bacteria 2124
119 Ga0075370_10003222 3300006353 Bacteria 7724
120 Ga0075370_10026189 3300006353 Bacteria 3230
121 Ga0075370_10073793 3300006353 Bacteria 1955
122 Ga0075428_100000390 3300006844 Bacteria 43360
123 Ga0075428_100141581 3300006844 Bacteria 2615
124 Ga0075430_100037274 3300006846 Bacteria 4122
125 Ga0075431_100000003 3300006847 Bacteria 112884
126 Ga0075431_100128497 3300006847 Bacteria 2615
127 Ga0075434_100072569 3300006871 Bacteria 3434
128 Ga0075429_100000288 3300006880 Bacteria 35542
129 Ga0068865_100015129 3300006881 Bacteria 4916
130 Ga0068865_100072834 3300006881 Bacteria 2441
131 Ga0097620_100123397 3300006931 Bacteria 2657
132 Ga0097620_100358551 3300006931 Bacteria 1553
133 Ga0099825_1036759 3300006941 Bacteria 1663
134 Ga0099795_10003727 3300007788 Bacteria 3821
135 Ga0105240_10008478 3300009093 Bacteria 14699
136 Ga0105240_10043555 3300009093 Bacteria 5710
137 Ga0105240_10331132 3300009093 Bacteria 1733
138 Ga0111539_10000753 3300009094 Bacteria 42119
139 Ga0105245_10129742 3300009098 Bacteria 2364
140 Ga0105245_10240730 3300009098 Bacteria 1754
141 Ga0105247_10100100 3300009101 Bacteria 1852
142 Ga0114129_10000104 3300009147 Bacteria 83195
143 Ga0114129_10370903 3300009147 Bacteria 1892
144 Ga0105243_10052979 3300009148 Bacteria 3217
145 Ga0105243_10148988 3300009148 Bacteria 2005
146 Ga0105241_10057857 3300009174 Bacteria 2975
147 Ga0105241_10061812 3300009174 Bacteria 2885
148 Ga0105241_10397027 3300009174 Bacteria 1209
149 Ga0105241_10418924 3300009174 Bacteria 1178
150 Ga0105242_10398197 3300009176 Bacteria 1284
151 Ga0105248_10831608 3300009177 Bacteria 1042
152 Ga0105237_10000892 3300009545 Bacteria 40254
153 Ga0105237_10186583 3300009545 Bacteria 2074
154 Ga0105238_10085834 3300009551 Bacteria 3135
155 Ga0105238_10279083 3300009551 Bacteria 1652
156 Ga0105238_10719310 3300009551 Bacteria 1011
157 Ga0105249_10033690 3300009553 Bacteria 4638
158 Ga0105239_10007059 3300010375 Bacteria 12929
159 Ga0105239_10072876 3300010375 Bacteria 3776
160 Ga0105239_10202107 3300010375 Bacteria 2226
161 Ga0105239_10317568 3300010375 Bacteria 1756
162 Ga0105239_10347262 3300010375 Bacteria 1675
163 Ga0105239_10506852 3300010375 Bacteria 1372
164 Ga0105239_10631346 3300010375 Bacteria 1223
165 Ga0105246_10003773 3300011119 Bacteria 9185
166 Ga0105246_10053597 3300011119 Bacteria 2776
167 Ga0157373_10115006 3300013100 Bacteria 1891
168 Ga0157371_10000045 3300013102 Bacteria 189065
169 Ga0157370_10070803 3300013104 Bacteria 3291
170 Ga0157370_10167330 3300013104 Bacteria 2044
171 Ga0157369_10020698 3300013105 Bacteria 7355
172 Ga0157369_10272403 3300013105 Bacteria 1764
173 Ga0157374_10013038 3300013296 Bacteria 7248
174 Ga0157374_10391529 3300013296 Bacteria 1385
175 Ga0157378_10027386 3300013297 Bacteria 5030
176 Ga0157378_10077940 3300013297 Bacteria 2988
177 Ga0157378_10694039 3300013297 Bacteria 1037
178 Ga0157378_10845598 3300013297 Bacteria 943
179 Ga0163162_10027385 3300013306 Bacteria 5636
180 Ga0163162_10068700 3300013306 Bacteria 3595
181 Ga0157375_10142753 3300013308 Bacteria 2523
182 Ga0163163_10007495 3300014325 Bacteria 9632
183 Ga0163163_10148931 3300014325 Bacteria 2385
184 Ga0157380_10036188 3300014326 Bacteria 3818
185 Ga0157379_10341503 3300014968 Bacteria 1370
186 Ga0157376_10024205 3300014969 Bacteria 4764
187 Ga0157376_10250098 3300014969 Bacteria 1655
188 Ga0163161_10015068 3300017792 Bacteria 5389
189 Ga0163161_10102631 3300017792 Bacteria 2130
190 Ga0214542_1003337 3300021321 Bacteria 32859
191 Ga0214545_1000028 3300021324 Bacteria 127957
192 Ga0214543_1000044 3300021327 Bacteria 158132
193 Ga0213876_10000471 3300021384 Bacteria 32066
194 Ga0213876_10225062 3300021384 Bacteria 997
195 Ga0213875_10052511 3300021388 Bacteria 1909
196 Ga0209677_101161 3300025253 Bacteria 12191
197 Ga0209148_1000224 3300025254 Bacteria 92967
198 Ga0209233_1003000 3300025261 Bacteria 6013
199 Ga0209233_1006852 3300025261 Bacteria 3644
200 Ga0209455_1000635 3300025272 Bacteria 21604
201 Ga0209673_1031815 3300025273 Bacteria 1635
202 Ga0209564_1002670 3300025295 Bacteria 13535
203 Ga0209564_1007718 3300025295 Bacteria 5478
204 Ga0209564_1012359 3300025295 Bacteria 3729
205 Ga0209758_1000075 3300025297 Bacteria 271585
206 Ga0209758_1000087 3300025297 Bacteria 254384
207 Ga0209758_1001472 3300025297 Bacteria 27590
208 Ga0209758_1003696 3300025297 Bacteria 13586
209 Ga0209758_1006857 3300025297 Bacteria 7967
210 Ga0209758_1027008 3300025297 Bacteria 2466
211 Ga0209256_1022668 3300025299 Bacteria 1894
212 Ga0209256_1039435 3300025299 Bacteria 1214
213 Ga0207426_1000289 3300025302 Bacteria 99963
214 Ga0207426_1000312 3300025302 Bacteria 95006
215 Ga0207426_1006711 3300025302 Bacteria 4937
216 Ga0209257_1000382 3300025304 Bacteria 88368
217 Ga0207697_10054827 3300025315 Bacteria 1652
218 Ga0207656_10103697 3300025321 Bacteria 1306
219 Ga0207642_10001994 3300025899 Bacteria 6295
220 Ga0207710_10010271 3300025900 Bacteria 3940
221 Ga0207710_10020294 3300025900 Bacteria 2840
222 Ga0207688_10003242 3300025901 Bacteria 8884
223 Ga0207680_10138245 3300025903 Bacteria 1613
224 Ga0207680_10332396 3300025903 Bacteria 1064
225 Ga0207647_10006477 3300025904 Bacteria 8509
226 Ga0207699_10018815 3300025906 Bacteria 3668
227 Ga0207645_10075123 3300025907 Bacteria 2163
228 Ga0207705_10075667 3300025909 Bacteria 2446
229 Ga0207705_10136706 3300025909 Bacteria 1828
230 Ga0207654_10030151 3300025911 Bacteria 2975
231 Ga0207654_10032141 3300025911 Bacteria 2896
232 Ga0207654_10049902 3300025911 Bacteria 2403
233 Ga0207654_10166276 3300025911 Bacteria 1429
234 Ga0207707_10003822 3300025912 Bacteria 13339
235 Ga0207707_10164933 3300025912 Bacteria 1936
236 Ga0207695_10000029 3300025913 Bacteria 548364
237 Ga0207671_10005341 3300025914 Bacteria 11889
238 Ga0207671_10145289 3300025914 Bacteria 1829
239 Ga0207671_10263917 3300025914 Bacteria 1356
240 Ga0207660_10010800 3300025917 Bacteria 5934
241 Ga0207660_10065273 3300025917 Bacteria 2630
242 Ga0207660_10108606 3300025917 Bacteria 2084
243 Ga0207662_10112221 3300025918 Bacteria 1701
244 Ga0207657_10026833 3300025919 Bacteria 5285
245 Ga0207657_10069651 3300025919 Bacteria 2984
246 Ga0207649_10192398 3300025920 Bacteria 1436
247 Ga0207646_10066283 3300025922 Bacteria 3223
248 Ga0207694_10232787 3300025924 Bacteria 1505
249 Ga0207650_10013164 3300025925 Bacteria 5726
250 Ga0207650_10051907 3300025925 Bacteria 3036
251 Ga0207659_10306089 3300025926 Bacteria 1307
252 Ga0207687_10112481 3300025927 Bacteria 2024
253 Ga0207700_10014312 3300025928 Bacteria 5195
254 Ga0207664_10153066 3300025929 Bacteria 1961
255 Ga0207644_10068376 3300025931 Bacteria 2591
256 Ga0207644_10147179 3300025931 Bacteria 1819
257 Ga0207690_10083625 3300025932 Bacteria 2235
258 Ga0207706_10002137 3300025933 Bacteria 19347
259 Ga0207706_10019725 3300025933 Bacteria 6065
260 Ga0207706_10021973 3300025933 Bacteria 5727
261 Ga0207709_10051024 3300025935 Bacteria 2533
262 Ga0207709_10059697 3300025935 Bacteria 2375
263 Ga0207704_10059412 3300025938 Bacteria 2360
264 Ga0207691_10025691 3300025940 Bacteria 5527
265 Ga0207711_10084395 3300025941 Bacteria 2780
266 Ga0207689_10017173 3300025942 Bacteria 6125
267 Ga0207661_10024749 3300025944 Bacteria 4554
268 Ga0207661_10123932 3300025944 Bacteria 2204
269 Ga0207667_10135137 3300025949 Bacteria 2539
270 Ga0207667_10194874 3300025949 Bacteria 2079
271 Ga0207667_10307621 3300025949 Bacteria 1619
272 Ga0207651_10031260 3300025960 Bacteria 3401
273 Ga0207712_10035474 3300025961 Bacteria 3389
274 Ga0207668_10096171 3300025972 Bacteria 2188
275 Ga0207668_10208796 3300025972 Bacteria 1560
276 Ga0207668_10351573 3300025972 Bacteria 1232
277 Ga0207640_10006486 3300025981 Bacteria 6425
278 Ga0207640_10122726 3300025981 Bacteria 1864
279 Ga0207640_10342175 3300025981 Bacteria 1198
280 Ga0207658_10108791 3300025986 Bacteria 2187
281 Ga0207677_10080977 3300026023 Bacteria 2328
282 Ga0207639_10092498 3300026041 Bacteria 2424
283 Ga0207639_10248368 3300026041 Bacteria 1550
284 Ga0207639_10269424 3300026041 Bacteria 1493
285 Ga0207639_10446571 3300026041 Bacteria 1173
286 Ga0207678_10008862 3300026067 Bacteria 8859
287 Ga0207678_10011915 3300026067 Bacteria 7636
288 Ga0207678_10036408 3300026067 Bacteria 4283
289 Ga0207708_10011033 3300026075 Bacteria 6718
290 Ga0207708_10049107 3300026075 Bacteria 3212
291 Ga0207702_10001454 3300026078 Bacteria 23549
292 Ga0207702_10065504 3300026078 Bacteria 3112
293 Ga0207702_10102151 3300026078 Bacteria 2533
294 Ga0207641_10403403 3300026088 Bacteria 1313
295 Ga0207641_10562760 3300026088 Bacteria 1113
296 Ga0207648_10006963 3300026089 Bacteria 11191
297 Ga0207648_10037025 3300026089 Bacteria 4297
298 Ga0207676_10053568 3300026095 Bacteria 3158
299 Ga0207674_10053974 3300026116 Bacteria 4094
300 Ga0207674_10079178 3300026116 Bacteria 3291
301 Ga0207674_10162957 3300026116 Bacteria 2184
302 Ga0207675_100061684 3300026118 Bacteria 3500
303 Ga0207683_10017919 3300026121 Bacteria 6039
304 Ga0207698_10018315 3300026142 Bacteria 4769
305 Ga0207698_10199788 3300026142 Bacteria 1789
306 Ga0209389_1000137 3300027296 Bacteria 63287
307 Ga0209389_1000353 3300027296 Bacteria 27634
308 Ga0209589_1003439 3300027357 Bacteria 27634
309 Ga0209489_100192 3300027361 Bacteria 98028
310 Ga0209489_107326 3300027361 Bacteria 16591
311 Ga0209489_107331 3300027361 Bacteria 16585
312 Ga0209700_100046 3300027363 Bacteria 159296
313 Ga0209813_10003308 3300027866 Bacteria 3766
314 Ga0207428_10000831 3300027907 Bacteria 34817
315 Ga0268266_10003426 3300028379 Bacteria 15859
316 Ga0268266_10396811 3300028379 Bacteria 1304
317 Ga0268265_10023655 3300028380 Bacteria 4334
318 Ga0268265_10433197 3300028380 Bacteria 1224
319 Ga0268264_10108091 3300028381 Bacteria 2431
320 Ga0268264_10114295 3300028381 Bacteria 2369
321 Ga0265319_1002640 3300028563 Bacteria 9640
322 Ga0265334_10000410 3300028573 Bacteria 22501
323 Ga0265334_10018447 3300028573 Bacteria 2877
324 Ga0265323_10000658 3300028653 Bacteria 18872
325 Ga0265336_10000063 3300028666 Bacteria 98413
326 Ga0265338_10000154 3300028800 Bacteria 125708
327 Ga0265324_10008680 3300029957 Bacteria 4019
328 Ga0265330_10050451 3300031235 Bacteria 1825
329 Ga0265330_10058176 3300031235 Bacteria 1685
330 Ga0265330_10088551 3300031235 Bacteria 1330
331 Ga0265328_10093835 3300031239 Bacteria 1109
332 Ga0265325_10039166 3300031241 Bacteria 2497
333 Ga0265340_10017726 3300031247 Bacteria 3683
334 Ga0265316_10081073 3300031344 Bacteria 2488
335 Ga0307508_10073310 3300031616 Bacteria 2999
336 Ga0307508_10183016 3300031616 Bacteria 1698
337 Ga0307508_10243060 3300031616 Bacteria 1397
338 Ga0307516_10056982 3300031730 Bacteria 3808
339 Ga0307412_10016383 3300031911 Bacteria 4415
340 Ga0307510_10024769 3300033180 Bacteria 6930
341 Ga0373934_0043616 3300035086 Bacteria 1772
342 Ga0373951_0038484 3300035091 Bacteria 1147
343 Ga0373936_0001079 3300035113 Bacteria 9758
344 Ga0373945_0008170 3300035116 Bacteria 3403
345 Ga0373945_0014499 3300035116 Bacteria 2642
346 Ga0373954_0029065 3300035118 Bacteria 2544
347 Ga0373956_0064226 3300035119 Bacteria 1666
348 Ga0373943_0003024 3300035170 Bacteria 7636
349 Ga0373943_0005006 3300035170 Bacteria 5977
350 Ga0373943_0112598 3300035170 Bacteria 1437
351 Ga0373946_0001257 3300035171 Bacteria 8767
352 Ga0373946_0006955 3300035171 Bacteria 4121
353 Ga0373955_0062635 3300035172 Bacteria 2057
354 Ga0373962_0009749 3300035242 Bacteria 2385
355 Ga0373924_0059079 3300035410 Bacteria 1601
356 Ga0373935_0000494 3300035692 Bacteria 20439
357 Ga0373935_0015948 3300035692 Bacteria 4547
358 Ga0373935_0026690 3300035692 Bacteria 3567
359 Ga0373927_0002352 3300035695 Bacteria 13783
360 Ga0373927_0003247 3300035695 Bacteria 11701
361 Ga0373927_0010188 3300035695 Bacteria 6282
362 Ga0373927_0025356 3300035695 Bacteria 3876
363 Ga0373927_0074932 3300035695 Bacteria 2191
364 Ga0373933_0046219 3300035724 Bacteria 2584
365 Ga0373933_0091492 3300035724 Bacteria 1877
366 Ga0373947_0002117 3300035725 Bacteria 12102
367 Ga0373947_0002364 3300035725 Bacteria 11398
368 Ga0373947_0018954 3300035725 Bacteria 3964
369 Ga0373947_0019786 3300035725 Bacteria 3884
370 Ga0373947_0287589 3300035725 Bacteria 1094
371 Ga0373937_0037849 3300036401 Bacteria 4397
372 Ga0373925_0007070 3300037068 Bacteria 8203
373 Ga0373925_0010310 3300037068 Bacteria 6779
374 Ga0373925_0073183 3300037068 Bacteria 2593
375 Ga0373925_0123949 3300037068 Bacteria 2008
376 Ga0373925_0380911 3300037068 Bacteria 1149
377 Ga0395899_0039215 3300037312 Bacteria 3547
378 Ga0395900_0000943 3300037418 Bacteria 37925
379 Ga0395900_0515441 3300037418 Bacteria 1144
380 Ga0395898_0002974 3300037466 Bacteria 19263
381 Ga0395898_0022540 3300037466 Bacteria 6377
382 Ga0395905_0021852 3300037471 Bacteria 6052
383 Ga0436364_1135391 3300037853 Bacteria 2481
384 Ga0395901_0001973 3300038443 Bacteria 21111
385 Ga0395901_0376376 3300038443 Bacteria 1462
386 Ga0436365_0858635 3300039437 Bacteria 1054
387 Ga0436361_0394385 3300039447 Bacteria 2403
388 Ga0436362_0891589 3300039453 Bacteria 1323
389 Ga0451800_0227374 3300041459 Bacteria 1628
390 Ga0451843_0945699 3300041509 Bacteria 1479
391 Ga0451855_1012932 3300041511 Bacteria 1545
392 Ga0466969_0023413 3300044656 Bacteria 3183
393 Ga0466969_0121896 3300044656 Bacteria 1213
394 Ga0466972_0001101 3300044658 Bacteria 12925
395 Ga0466972_0036902 3300044658 Bacteria 2389
396 Ga0466966_0000707 3300044684 Bacteria 21128
397 Ga0466961_0000029 3300044693 Bacteria 86710
398 Ga0466961_0036986 3300044693 Bacteria 3133
399 Ga0466963_0056092 3300044694 Bacteria 2621
400 Ga0466968_0019728 3300044735 Bacteria 2716
401 Ga0466968_0099649 3300044735 Bacteria 1296
402 Ga0466970_0221241 3300044765 Bacteria 1057
403 Ga0466960_0071300 3300044901 Bacteria 1730
404 Ga0466959_0018100 3300045049 Bacteria 5170
405 Ga0466959_0044416 3300045049 Bacteria 3274
406 Ga0466967_0002064 3300045976 Bacteria 12276
407 Ga0466967_0140178 3300045976 Bacteria 2251
408 Ga0495592_0006647 3300046454 Bacteria 8621
409 Ga0495592_0096806 3300046454 Bacteria 2109
410 Ga0495603_0000237 3300046455 Bacteria 28782
411 Ga0495603_0003340 3300046455 Bacteria 9561
412 Ga0495603_0007156 3300046455 Bacteria 6700
413 Ga0495603_0015322 3300046455 Bacteria 4639
414 Ga0495590_0089336 3300046457 Bacteria 1089
415 Ga0495629_0000772 3300046459 Bacteria 25859
416 Ga0495629_0048422 3300046459 Bacteria 2979
417 Ga0495629_0158850 3300046459 Bacteria 1570
418 Ga0495638_0006370 3300046460 Bacteria 8597
419 Ga0495638_0230158 3300046460 Bacteria 1031
420 Ga0495641_0004443 3300046461 Bacteria 9917
421 Ga0495641_0007549 3300046461 Bacteria 6772
422 Ga0495651_0066159 3300046462 Bacteria 2759
423 Ga0495651_0196308 3300046462 Bacteria 1416
424 Ga0495651_0256636 3300046462 Bacteria 1191
425 Ga0495580_0001324 3300046472 Bacteria 21841
426 Ga0495580_0029759 3300046472 Bacteria 3961
427 Ga0495580_0063318 3300046472 Bacteria 2594
428 Ga0495582_0000209 3300046473 Bacteria 32511
429 Ga0495582_0059605 3300046473 Bacteria 2105
430 Ga0495639_0000387 3300046475 Bacteria 20931
431 Ga0495662_0000761 3300046476 Bacteria 15509
432 Ga0495662_0031327 3300046476 Bacteria 2569
433 Ga0495664_0012587 3300046477 Bacteria 4795
434 Ga0495664_0093177 3300046477 Bacteria 1812
435 Ga0495664_0208401 3300046477 Bacteria 1184
436 Ga0495585_0072766 3300046492 Bacteria 1872
437 Ga0495594_0000342 3300046499 Bacteria 23227
438 Ga0495594_0011612 3300046499 Bacteria 4581
439 Ga0495607_0159390 3300046501 Bacteria 1148
440 Ga0495583_0059082 3300046506 Bacteria 1720
441 Ga0495606_0008906 3300046507 Bacteria 8596
442 Ga0495606_0014740 3300046507 Bacteria 6074
443 Ga0495606_0113595 3300046507 Bacteria 1630
444 Ga0495608_0019186 3300046511 Bacteria 4709
445 Ga0495616_0031901 3300046513 Bacteria 2756
446 Ga0495616_0047449 3300046513 Bacteria 2163
447 Ga0495618_0008116 3300046514 Bacteria 6358
448 Ga0495618_0036244 3300046514 Bacteria 3095
449 Ga0495628_0009216 3300046516 Bacteria 8436
450 Ga0495628_0201524 3300046516 Bacteria 1499
451 Ga0495628_0202193 3300046516 Bacteria 1496
452 Ga0495630_0003363 3300046517 Bacteria 11134
453 Ga0495630_0022815 3300046517 Bacteria 4623
454 Ga0495630_0091537 3300046517 Bacteria 2298
455 Ga0495631_0095918 3300046518 Bacteria 1277
456 Ga0495631_0097113 3300046518 Bacteria 1268
457 Ga0495643_0010018 3300046522 Bacteria 5850
458 Ga0495644_0016750 3300046523 Bacteria 2805
459 Ga0495644_0026225 3300046523 Bacteria 2212
460 Ga0495648_0011360 3300046524 Bacteria 6710
461 Ga0495648_0040010 3300046524 Bacteria 2977
462 Ga0495663_0054520 3300046525 Bacteria 1245
463 Ga0495666_0029720 3300046526 Bacteria 2688
464 Ga0495652_0033432 3300046529 Bacteria 4490
465 Ga0495652_0044830 3300046529 Bacteria 3806
466 Ga0495652_0085364 3300046529 Bacteria 2594
467 Ga0495665_0000280 3300046531 Bacteria 25894
468 Ga0495665_0211823 3300046531 Bacteria 1003
469 Ga0495640_0001578 3300046533 Bacteria 17975
470 Ga0495640_0123125 3300046533 Bacteria 1684
471 Ga0495640_0216550 3300046533 Bacteria 1209
472 Ga0495587_0142531 3300046536 Bacteria 1367
473 Ga0495587_0178134 3300046536 Bacteria 1206
474 Ga0495598_0018203 3300046537 Bacteria 1822
475 Ga0495598_0018384 3300046537 Bacteria 1817
476 Ga0495645_0010457 3300046543 Bacteria 6505
477 Ga0495645_0075217 3300046543 Bacteria 2431
478 Ga0495645_0113729 3300046543 Bacteria 1913
479 Ga0495622_0011893 3300046557 Bacteria 4025
480 Ga0495622_0023222 3300046557 Bacteria 2891
481 Ga0495667_0014422 3300046559 Bacteria 5339
482 Ga0495667_0064231 3300046559 Bacteria 2401
483 Ga0495667_0345794 3300046559 Bacteria 940
484 Ga0495656_0082383 3300046615 Bacteria 1454
485 Ga0495656_0244906 3300046615 Bacteria 904
486 Ga0495668_0115329 3300046616 Bacteria 1469
487 Ga0495668_0243383 3300046616 Bacteria 985
488 Ga0495634_0000865 3300046642 Bacteria 29129
489 Ga0495634_0013143 3300046642 Bacteria 5981
490 Ga0495634_0059031 3300046642 Bacteria 2556
491 Ga0495634_0241365 3300046642 Bacteria 1108
492 Ga0495625_0164363 3300046660 Bacteria 1485
493 Ga0495635_0003213 3300046663 Bacteria 11263
494 Ga0495635_0004387 3300046663 Bacteria 9772
495 Ga0495635_0085602 3300046663 Bacteria 2157
496 Ga0495659_0055866 3300046664 Bacteria 1448
497 Ga0495661_0221850 3300046665 Bacteria 979
498 Ga0495588_0036213 3300046674 Bacteria 2503
499 Ga0495588_0068193 3300046674 Bacteria 1847
500 Ga0495588_0083379 3300046674 Bacteria 1670
501 Ga0495657_0011035 3300046675 Bacteria 6774
502 Ga0495657_0064940 3300046675 Bacteria 2401
503 Ga0495657_0113788 3300046675 Bacteria 1711
504 Ga0495599_0006315 3300046678 Bacteria 7144
505 Ga0495599_0110554 3300046678 Bacteria 1712
506 Ga0495599_0112341 3300046678 Bacteria 1696
507 Ga0495599_0178968 3300046678 Bacteria 1307
508 Ga0495623_0076303 3300046679 Bacteria 2079
509 Ga0495623_0150420 3300046679 Bacteria 1376
510 Ga0495646_0020456 3300046680 Bacteria 4188
511 Ga0495646_0166663 3300046680 Bacteria 1216
512 Ga0495647_0004026 3300046681 Bacteria 4742
513 Ga0495658_0004391 3300046683 Bacteria 6944
514 Ga0495658_0008880 3300046683 Bacteria 4997
515 Ga0495658_0060313 3300046683 Bacteria 2175
516 Ga0495669_0005176 3300046684 Bacteria 5426
517 Ga0495613_0003086 3300046689 Bacteria 12448
518 Ga0495613_0027959 3300046689 Bacteria 4198
519 Ga0495613_0111362 3300046689 Bacteria 1972
520 Ga0495613_0167372 3300046689 Bacteria 1561
521 Ga0495613_0323434 3300046689 Bacteria 1064
522 Ga0495624_0001082 3300046690 Bacteria 21523
523 Ga0495624_0002738 3300046690 Bacteria 13256
524 Ga0495624_0096431 3300046690 Bacteria 1822
525 Ga0495670_0009149 3300046691 Bacteria 4871
526 Ga0495649_0043342 3300046694 Bacteria 2456
527 Ga0495589_0107261 3300046794 Bacteria 1349
528 Ga0495600_0038148 3300046809 Bacteria 3125
529 Ga0495660_0046852 3300046810 Bacteria 2370
530 Ga0495581_0010372 3300047315 Bacteria 5390
531 Ga0495581_0058487 3300047315 Bacteria 2226
532 Ga0495604_0016851 3300047317 Bacteria 5844
533 Ga0495674_0004372 3300047319 Bacteria 13583
534 Ga0495674_0021149 3300047319 Bacteria 6018
535 Ga0495674_0024884 3300047319 Bacteria 5496
536 Ga0495674_0100461 3300047319 Bacteria 2462
537 Ga0495676_0025949 3300047321 Bacteria 5050
538 Ga0495676_0071413 3300047321 Bacteria 2669
539 Ga0495676_0121617 3300047321 Bacteria 1898
540 Ga0495680_0027137 3300047322 Bacteria 4709
541 Ga0495680_0151947 3300047322 Bacteria 1687
542 Ga0495683_0007012 3300047323 Bacteria 6119
543 Ga0495687_048756 3300047443 Bacteria 1814
544 Ga0495675_0020242 3300047444 Bacteria 4230
545 Ga0495675_0077940 3300047444 Bacteria 2087
546 Ga0495684_0005777 3300047471 Bacteria 9626
547 Ga0495686_0023315 3300047472 Bacteria 4084
548 Ga0495686_0045614 3300047472 Bacteria 2772
549 Ga0495593_0000238 3300047673 Bacteria 29664
550 Ga0495593_0007681 3300047673 Bacteria 6293
551 Ga0495593_0144829 3300047673 Bacteria 1203
552 Ga0495602_0116214 3300048088 Bacteria 2162
553 Ga0495602_0143393 3300048088 Bacteria 1888
554 Ga0495614_0028011 3300048089 Bacteria 2429
555 Ga0495626_0144468 3300048091 Bacteria 1007
556 Ga0496100_0026555 3300048903 Bacteria 3551
557 Ga0496100_0071299 3300048903 Bacteria 2319
558 Ga0496100_0231627 3300048903 Bacteria 1359
559 Ga0496100_0400542 3300048903 Bacteria 1045
560 Ga0496101_0009142 3300048904 Bacteria 6504
561 Ga0496101_0023004 3300048904 Bacteria 4299
562 Ga0496101_0339633 3300048904 Bacteria 1179
563 Ga0496102_0001874 3300048905 Bacteria 18120
564 Ga0496102_0055964 3300048905 Bacteria 3597
565 Ga0496102_0077241 3300048905 Bacteria 3064
566 Ga0496102_0372991 3300048905 Bacteria 1343
567 Ga0496103_0002168 3300048906 Bacteria 12474
568 Ga0496103_0004621 3300048906 Bacteria 8335
569 Ga0496103_0050949 3300048906 Bacteria 2562
570 Ga0496103_0083548 3300048906 Bacteria 2010
571 Ga0496104_0019755 3300048907 Bacteria 6168
572 Ga0496104_0092498 3300048907 Bacteria 2892
573 Ga0496104_0194120 3300048907 Bacteria 1942
574 Ga0496104_0211558 3300048907 Bacteria 1851
575 Ga0496105_0005120 3300048908 Bacteria 9938
576 Ga0496105_0005229 3300048908 Bacteria 9837
577 Ga0496105_0006240 3300048908 Bacteria 9152
578 Ga0496105_0091652 3300048908 Bacteria 2510
579 Ga0496105_0139551 3300048908 Bacteria 1995
580 Ga0496106_0080265 3300048909 Bacteria 2505
581 Ga0496106_0304870 3300048909 Bacteria 1277
582 Ga0496106_0361973 3300048909 Bacteria 1165
583 Ga0496107_0114243 3300048910 Bacteria 1986
584 Ga0496107_0346540 3300048910 Bacteria 1105
585 Ga0496108_0000244 3300048911 Bacteria 48432
586 Ga0496108_0013227 3300048911 Bacteria 6726
587 Ga0496108_0023662 3300048911 Bacteria 5055
588 Ga0496108_0035682 3300048911 Bacteria 4134
589 Ga0496108_0197019 3300048911 Bacteria 1747
590 Ga0496109_0002677 3300048912 Bacteria 14952
591 Ga0496109_0044910 3300048912 Bacteria 4009
592 Ga0496109_0160326 3300048912 Bacteria 2107
593 Ga0496110_0015570 3300048913 Bacteria 6333
594 Ga0496110_0044847 3300048913 Bacteria 3862
595 Ga0496110_0079371 3300048913 Bacteria 2922
596 Ga0496111_0000320 3300048914 Bacteria 23827
597 Ga0496111_0033662 3300048914 Bacteria 3656
598 Ga0496111_0087254 3300048914 Bacteria 2283
599 Ga0496112_0006808 3300048915 Bacteria 10073
600 Ga0496112_0040401 3300048915 Bacteria 4561
601 Ga0496112_0055817 3300048915 Bacteria 3885
602 Ga0496112_0119384 3300048915 Bacteria 2607
603 Ga0496112_0127715 3300048915 Bacteria 2513
604 Ga0496112_0234401 3300048915 Bacteria 1789
605 Ga0496112_0334699 3300048915 Bacteria 1457
606 Ga0496112_0341661 3300048915 Bacteria 1440
607 Ga0496112_0459600 3300048915 Bacteria 1210
608 Ga0496113_0003916 3300048916 Bacteria 9027
609 Ga0496113_0039682 3300048916 Bacteria 3466
610 Ga0496113_0197939 3300048916 Bacteria 1596
611 Ga0496114_0049745 3300048917 Bacteria 3488
612 Ga0496114_0150162 3300048917 Bacteria 2021
613 Ga0496115_0005249 3300048918 Bacteria 9415
614 Ga0496115_0019367 3300048918 Bacteria 5235
615 Ga0496115_0049447 3300048918 Bacteria 3366
616 Ga0496115_0076782 3300048918 Bacteria 2715
617 Ga0496115_0131634 3300048918 Bacteria 2062
618 Ga0496116_0003489 3300048919 Bacteria 15474
619 Ga0496116_0032500 3300048919 Bacteria 3718
620 Ga0496116_0109690 3300048919 Bacteria 1626
621 Ga0496116_0120688 3300048919 Bacteria 1518
622 Ga0496118_0019343 3300048921 Bacteria 6089
623 Ga0496118_0043899 3300048921 Bacteria 3507
624 Ga0496118_0072961 3300048921 Bacteria 2462
625 Ga0496118_0251909 3300048921 Bacteria 1003
626 Ga0496119_0014153 3300048922 Bacteria 6267
627 Ga0496119_0031299 3300048922 Bacteria 3572
628 Ga0496119_0057292 3300048922 Bacteria 2355
629 Ga0496119_0171818 3300048922 Bacteria 1144
630 Ga0496121_0001361 3300048924 Bacteria 41683
631 Ga0496121_0006808 3300048924 Bacteria 14001
632 Ga0496121_0038006 3300048924 Bacteria 4270
633 Ga0496121_0040996 3300048924 Bacteria 4053
634 Ga0496121_0067199 3300048924 Bacteria 2906
635 Ga0496121_0089499 3300048924 Bacteria 2409
636 Ga0496121_0102845 3300048924 Bacteria 2199
637 Ga0496122_0031025 3300048925 Bacteria 4460
638 Ga0496122_0168680 3300048925 Bacteria 1323
639 Ga0496124_0020591 3300048927 Bacteria 6089
640 Ga0496124_0193994 3300048927 Bacteria 1551
641 Ga0496124_0262792 3300048927 Bacteria 1269
642 Ga0496125_0000202 3300048928 Bacteria 125963
643 Ga0496125_0010389 3300048928 Bacteria 9418
644 Ga0496125_0014914 3300048928 Bacteria 7547
645 Ga0496125_0037272 3300048928 Bacteria 4229
646 Ga0496125_0048526 3300048928 Bacteria 3539
647 Ga0496125_0066386 3300048928 Bacteria 2851
648 Ga0496126_0025578 3300048929 Bacteria 5675
649 Ga0496126_0038168 3300048929 Bacteria 4471
650 Ga0496126_0055894 3300048929 Bacteria 3569
651 Ga0496126_0118315 3300048929 Bacteria 2300
652 Ga0496126_0151787 3300048929 Bacteria 1985
653 Ga0496126_0200459 3300048929 Bacteria 1686
654 Ga0496126_0297655 3300048929 Bacteria 1332
655 Ga0495682_0023060 3300049460 Bacteria 2326
656 Ga0495682_0047740 3300049460 Bacteria 1562
657 Ga0501031_0053141 3300049568 Bacteria 2639
658 Ga0501032_0000257 3300049569 Bacteria 44325
659 Ga0501032_0002240 3300049569 Bacteria 15223
660 Ga0501033_0000244 3300049570 Bacteria 52231
661 Ga0501033_0000803 3300049570 Bacteria 28734
662 Ga0501034_0000159 3300049571 Bacteria 127397
663 Ga0501034_0019040 3300049571 Bacteria 7033
664 Ga0501036_0000039 3300049572 Bacteria 83065
665 Ga0501036_0000104 3300049572 Bacteria 52974
666 Ga0501037_0001025 3300049573 Bacteria 20644
667 Ga0501037_0001386 3300049573 Bacteria 17773
668 Ga0501038_0000041 3300049574 Bacteria 120557
669 Ga0501038_0000207 3300049574 Bacteria 50307
670 Ga0501039_0000064 3300049575 Bacteria 83415
671 Ga0501039_0000148 3300049575 Bacteria 47789
672 Ga0501042_0071901 3300049578 Bacteria 2475
673 Ga0501042_0242095 3300049578 Bacteria 1302
674 Ga0501043_0000202 3300049579 Bacteria 54441
675 Ga0501043_0012725 3300049579 Bacteria 6576
676 Ga0501043_0188339 3300049579 Bacteria 1605
677 Ga0501046_0000185 3300049580 Bacteria 63459
678 Ga0501047_0000385 3300049581 Bacteria 49635
679 Ga0501047_0000392 3300049581 Bacteria 49114
680 Ga0501048_0000536 3300049582 Bacteria 26743
681 Ga0501048_0051316 3300049582 Bacteria 2936
682 Ga0501067_0005941 3300049583 Bacteria 6765
683 Ga0501068_0004880 3300049584 Bacteria 7303
684 Ga0501068_0012217 3300049584 Bacteria 4857
685 Ga0501069_0002806 3300049585 Bacteria 8910
686 Ga0501069_0024732 3300049585 Bacteria 3277
687 Ga0501070_0000209 3300049586 Bacteria 55271
688 Ga0501070_0000557 3300049586 Bacteria 34014
689 Ga0501070_0033362 3300049586 Bacteria 4308
690 Ga0501071_0096410 3300049587 Bacteria 2177
691 Ga0501072_0029712 3300049588 Bacteria 4270
692 Ga0501073_0000034 3300049589 Bacteria 95224
693 Ga0501073_0008907 3300049589 Bacteria 7417
694 Ga0501074_0000271 3300049590 Bacteria 29628
695 Ga0501079_0000773 3300049741 Bacteria 21906
696 Ga0501079_0442365 3300049741 Bacteria 1021
697 Ga0501080_0001103 3300049742 Bacteria 22242
698 Ga0501080_0005894 3300049742 Bacteria 10975
699 Ga0501080_0010052 3300049742 Bacteria 8649
700 Ga0501080_0184326 3300049742 Bacteria 1920
701 Ga0501083_0000118 3300049744 Bacteria 54096
702 Ga0501035_0000137 3300049822 Bacteria 89273
703 Ga0501035_0000155 3300049822 Bacteria 84012
704 Ga0501044_0000548 3300049823 Bacteria 45787
705 Ga0501044_0001941 3300049823 Bacteria 23927
706 Ga0501044_0011998 3300049823 Bacteria 9387
707 Ga0501045_0010495 3300049824 Bacteria 6489
708 Ga0501045_0065935 3300049824 Bacteria 2659
709 nmdc:mga03683_103928_c1 3300050489 Bacteria 1251
710 nmdc:mga03683_149728_c1 3300050489 Bacteria 1052
711 nmdc:mga03683_7443_c1 3300050489 Bacteria 3801
712 nmdc:mga03n38_117865_c1 3300050490 Bacteria 1301
713 nmdc:mga03n38_22639_c1 3300050490 Bacteria 2546
714 nmdc:mga00v17_114956_c1 3300050491 Bacteria 1710
715 nmdc:mga00v17_20781_c1 3300050491 Bacteria 3765
716 nmdc:mga00v17_249572_c1 3300050491 Bacteria 1151
717 nmdc:mga0yw44_12005_c1 3300050492 Bacteria 4497
718 nmdc:mga0yw44_17277_c1 3300050492 Bacteria 3923
719 nmdc:mga0yw44_723_c1 3300050492 Bacteria 12145
720 nmdc:mga0k408_10760_c1 3300050493 Bacteria 4958
721 nmdc:mga0k408_15187_c1 3300050493 Bacteria 4255
722 nmdc:mga06z11_101504_c1 3300050494 Bacteria 1579
723 nmdc:mga06z11_97387_c1 3300050494 Bacteria 1608
724 nmdc:mga04h51_2017_c1 3300050495 Bacteria 4755
725 nmdc:mga07m45_12998_c1 3300050496 Bacteria 4405
726 nmdc:mga07m45_24695_c1 3300050496 Bacteria 3294
727 nmdc:mga05p37_215_c1 3300050507 Bacteria 57982
728 nmdc:mga05p37_331717_c1 3300050507 Bacteria 1797
729 nmdc:mga09592_1263_c1 3300050508 Bacteria 20295
730 nmdc:mga0qj67_5759_c1 3300050509 Bacteria 9069
731 nmdc:mga06r32_133694_c1 3300050510 Bacteria 2454
732 nmdc:mga06r32_1551_c1 3300050510 Bacteria 20713
733 nmdc:mga08y16_176_c1 3300050511 Bacteria 56313
734 nmdc:mga0n895_166279_c1 3300050512 Bacteria 2237
735 nmdc:mga0sz30_10704_c1 3300050516 Bacteria 3520
736 nmdc:mga0sz30_98716_c1 3300050516 Bacteria 1275
737 Ga0495601_0060441 3300053077 Bacteria 2404
738 Ga0495601_0149370 3300053077 Bacteria 1525
739 Ga0495601_0222194 3300053077 Bacteria 1234
740 Ga0495612_0008556 3300053078 Bacteria 4150
741 Ga0495655_0036324 3300053083 Bacteria 1231
742 Ga0495595_0160098 3300053084 Bacteria 1110
743 Ga0495619_0083357 3300053085 Bacteria 2156
744 Ga0495619_0142416 3300053085 Bacteria 1652
745 Ga0500643_000037 3300053087 Bacteria 180821
746 Ga0500643_033261 3300053087 Bacteria 1560
747 Ga0500644_0112559 3300053088 Bacteria 1050
748 Ga0500581_026824 3300053089 Bacteria 2933
749 Ga0500646_0011610 3300053090 Bacteria 2267
750 Ga0500583_0015846 3300053092 Bacteria 2994
751 Ga0500651_0012304 3300053093 Bacteria 5187
752 Ga0500651_0075684 3300053093 Bacteria 2091
753 Ga0500566_0000166 3300053094 Bacteria 33843
754 Ga0500566_0254409 3300053094 Bacteria 852
755 Ga0500641_0023680 3300053096 Bacteria 2364
756 Ga0500554_001732 3300053102 Bacteria 4201
757 Ga0500555_000550 3300053103 Bacteria 14953
758 Ga0500556_0000089 3300053104 Bacteria 84468
759 Ga0500557_000047 3300053105 Bacteria 59226
760 Ga0500569_003630 3300053109 Bacteria 3175
761 Ga0500595_002385 3300053119 Bacteria 9386
762 Ga0500595_027503 3300053119 Bacteria 1947
763 Ga0500607_088391 3300053121 Bacteria 1564
764 Ga0500614_049953 3300053123 Bacteria 1094
765 Ga0500642_0000030 3300053130 Bacteria 115114
766 Ga0500642_0000071 3300053130 Bacteria 55663
767 Ga0500642_0012757 3300053130 Bacteria 3061
768 Ga0500658_0008212 3300053134 Bacteria 3857
769 Ga0500658_0016210 3300053134 Bacteria 2775
770 Ga0500559_0002659 3300053136 Bacteria 9097
771 Ga0500559_0057068 3300053136 Bacteria 1734
772 Ga0500564_162190 3300053138 Bacteria 945
773 Ga0500577_0001653 3300053142 Bacteria 5708
774 Ga0500577_0013663 3300053142 Bacteria 2487
775 Ga0500577_0014053 3300053142 Bacteria 2464
776 Ga0500588_0018546 3300053146 Bacteria 1835
777 Ga0500603_000324 3300053150 Bacteria 12495
778 Ga0500604_0002842 3300053151 Bacteria 4699
779 Ga0500616_0000026 3300053153 Bacteria 454314
780 Ga0500619_043197 3300053154 Bacteria 1432
781 Ga0500622_0001149 3300053156 Bacteria 22026
782 Ga0500622_0001752 3300053156 Bacteria 16718
783 Ga0500627_0010696 3300053158 Bacteria 3355
784 Ga0500634_0022780 3300053161 Bacteria 3402
785 Ga0500636_0004341 3300053177 Bacteria 8020
786 Ga0500636_0045565 3300053177 Bacteria 2586
787 Ga0500636_0162117 3300053177 Bacteria 1218
788 Ga0500637_0000582 3300053178 Bacteria 14362
789 Ga0500576_005569 3300053725 Bacteria 5228
790 Ga0500625_002984 3300053729 Bacteria 6534
791 Ga0500645_007814 3300053730 Bacteria 3697
792 Ga0500609_002144 3300053731 Bacteria 2829
793 Ga0500601_000014 3300053737 Bacteria 41972
794 Ga0501084_0003978 3300054114 Bacteria 12040
795 Ga0500661_001823 3300055283 Bacteria 4021
796 Ga0501082_0078362 3300060353 Bacteria 2850
797 Ga0530510_0139373 3300061734 Bacteria 1786

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10291743 Ga0070676_102917432 261
2 3300005364 Ga0070673_100025677 Ga0070673_1000256773 261
3 3300005367 Ga0070667_100088818 Ga0070667_1000888182 261
4 3300005440 Ga0070705_100022760 Ga0070705_1000227603 261
5 3300005444 Ga0070694_100357761 Ga0070694_1003577612 261
6 3300005544 Ga0070686_100087062 Ga0070686_1000870622 261
7 3300005545 Ga0070695_100199566 Ga0070695_1001995662 261
8 3300006038 Ga0075365_10105746 Ga0075365_101057462 261
9 3300006178 Ga0075367_10085174 Ga0075367_100851742 261
10 3300006844 Ga0075428_100141581 Ga0075428_1001415812 261
11 3300009147 Ga0114129_10370903 Ga0114129_103709032 261
12 3300009148 Ga0105243_10148988 Ga0105243_101489882 261
13 3300009174 Ga0105241_10397027 Ga0105241_103970272 261
14 3300009176 Ga0105242_10398197 Ga0105242_103981972 261
15 3300010375 Ga0105239_10506852 Ga0105239_105068522 261
16 3300014326 Ga0157380_10036188 Ga0157380_100361884 261
17 3300025907 Ga0207645_10075123 Ga0207645_100751232 261
18 3300035242 Ga0373962_0009749 Ga0373962_0009749_1296_2096 261
19 3300046476 Ga0495662_0031327 Ga0495662_0031327_1732_2532 261
20 3300046513 Ga0495616_0031901 Ga0495616_0031901_1911_2711 261
21 3300046523 Ga0495644_0016750 Ga0495644_0016750_1363_2163 261
22 3300046537 Ga0495598_0018203 Ga0495598_0018203_931_1731 261
23 3300046537 Ga0495598_0018384 Ga0495598_0018384_53_853 261
24 3300046664 Ga0495659_0055866 Ga0495659_0055866_597_1397 261
25 3300048091 Ga0495626_0144468 Ga0495626_0144468_182_982 261
26 3300048904 Ga0496101_0339633 Ga0496101_0339633_93_893 261
27 3300048910 Ga0496107_0346540 Ga0496107_0346540_223_1023 261
28 3300050492 nmdc:mga0yw44_17277_c1 nmdc:mga0yw44_17277_c1_2715_3515 261
29 3300050494 nmdc:mga06z11_97387_c1 nmdc:mga06z11_97387_c1_757_1557 261
30 3300002070 JGI24750J21931_1002919 JGI24750J21931_10029192 262
31 3300005331 Ga0070670_100021295 Ga0070670_1000212952 262
32 3300005339 Ga0070660_100413953 Ga0070660_1004139532 262
33 3300005347 Ga0070668_100019603 Ga0070668_1000196032 262
34 3300005438 Ga0070701_10005491 Ga0070701_100054917 262
35 3300005618 Ga0068864_100396089 Ga0068864_1003960892 262
36 3300017792 Ga0163161_10102631 Ga0163161_101026312 262
37 3300025900 Ga0207710_10020294 Ga0207710_100202942 262
38 3300025918 Ga0207662_10112221 Ga0207662_101122212 262
39 3300025926 Ga0207659_10306089 Ga0207659_103060892 262
40 3300025935 Ga0207709_10059697 Ga0207709_100596972 262
41 3300025942 Ga0207689_10017173 Ga0207689_100171734 262
42 3300026041 Ga0207639_10269424 Ga0207639_102694242 262
43 3300026067 Ga0207678_10011915 Ga0207678_100119153 262
44 3300026075 Ga0207708_10011033 Ga0207708_100110336 262
45 3300026088 Ga0207641_10403403 Ga0207641_104034032 262
46 3300028381 Ga0268264_10114295 Ga0268264_101142952 262
47 3300005335 Ga0070666_10138301 Ga0070666_101383012 263
48 3300005364 Ga0070673_100185913 Ga0070673_1001859132 263
49 3300005367 Ga0070667_100359941 Ga0070667_1003599412 263
50 3300014969 Ga0157376_10250098 Ga0157376_102500982 263
51 3300046615 Ga0495656_0244906 Ga0495656_0244906_40_879 263
52 3300046531 Ga0495665_0211823 Ga0495665_0211823_119_925 264
53 3300009093 Ga0105240_10331132 Ga0105240_103311322 265
54 3300010375 Ga0105239_10317568 Ga0105239_103175682 265
55 3300013296 Ga0157374_10391529 Ga0157374_103915292 265
56 3300013297 Ga0157378_10694039 Ga0157378_106940391 265
57 3300025924 Ga0207694_10232787 Ga0207694_102327871 265
58 3300026116 Ga0207674_10162957 Ga0207674_101629572 265
59 3300028380 Ga0268265_10433197 Ga0268265_104331972 265
60 3300035725 Ga0373947_0287589 Ga0373947_0287589_48_845 265
61 3300046462 Ga0495651_0196308 Ga0495651_0196308_439_1242 266
62 3300053085 Ga0495619_0142416 Ga0495619_0142416_309_1112 266
63 3300053730 Ga0500645_007814 Ga0500645_007814_2620_3420 266
64 iso_pu_bacteria 2935975950 2935979678 266
65 3300009098 Ga0105245_10240730 Ga0105245_102407302 267
66 3300013297 Ga0157378_10077940 Ga0157378_100779403 267
67 3300014325 Ga0163163_10148931 Ga0163163_101489312 267
68 3300014968 Ga0157379_10341503 Ga0157379_103415032 267
69 3300021384 Ga0213876_10000471 Ga0213876_100004713 267
70 3300035170 Ga0373943_0112598 Ga0373943_0112598_39_842 267
71 3300041459 Ga0451800_0227374 Ga0451800_0227374_311_1114 267
72 3300041509 Ga0451843_0945699 Ga0451843_0945699_663_1466 267
73 3300041511 Ga0451855_1012932 Ga0451855_1012932_541_1344 267
74 3300044656 Ga0466969_0023413 Ga0466969_0023413_564_1367 267
75 3300044684 Ga0466966_0000707 Ga0466966_0000707_5410_6213 267
76 3300044693 Ga0466961_0000029 Ga0466961_0000029_65806_66609 267
77 3300045049 Ga0466959_0044416 Ga0466959_0044416_1723_2526 267
78 3300046454 Ga0495592_0096806 Ga0495592_0096806_1257_2060 267
79 3300046459 Ga0495629_0048422 Ga0495629_0048422_1150_1953 267
80 3300046462 Ga0495651_0066159 Ga0495651_0066159_1404_2207 267
81 3300046462 Ga0495651_0256636 Ga0495651_0256636_264_1067 267
82 3300046477 Ga0495664_0208401 Ga0495664_0208401_86_889 267
83 3300046501 Ga0495607_0159390 Ga0495607_0159390_24_827 267
84 3300046507 Ga0495606_0113595 Ga0495606_0113595_22_825 267
85 3300046513 Ga0495616_0047449 Ga0495616_0047449_868_1671 267
86 3300046518 Ga0495631_0095918 Ga0495631_0095918_176_979 267
87 3300046522 Ga0495643_0010018 Ga0495643_0010018_4638_5441 267
88 3300046529 Ga0495652_0044830 Ga0495652_0044830_1852_2655 267
89 3300046536 Ga0495587_0142531 Ga0495587_0142531_114_917 267
90 3300046557 Ga0495622_0023222 Ga0495622_0023222_834_1637 267
91 3300046559 Ga0495667_0345794 Ga0495667_0345794_52_855 267
92 3300046616 Ga0495668_0115329 Ga0495668_0115329_12_815 267
93 3300046660 Ga0495625_0164363 Ga0495625_0164363_654_1457 267
94 3300046663 Ga0495635_0003213 Ga0495635_0003213_6978_7781 267
95 3300046675 Ga0495657_0011035 Ga0495657_0011035_5841_6644 267
96 3300046675 Ga0495657_0113788 Ga0495657_0113788_96_899 267
97 3300046689 Ga0495613_0111362 Ga0495613_0111362_218_1021 267
98 3300046810 Ga0495660_0046852 Ga0495660_0046852_1542_2345 267
99 3300047317 Ga0495604_0016851 Ga0495604_0016851_3790_4593 267
100 3300047322 Ga0495680_0027137 Ga0495680_0027137_3064_3867 267
101 3300047323 Ga0495683_0007012 Ga0495683_0007012_679_1482 267
102 3300047443 Ga0495687_048756 Ga0495687_048756_868_1671 267
103 3300047444 Ga0495675_0020242 Ga0495675_0020242_482_1285 267
104 3300047472 Ga0495686_0045614 Ga0495686_0045614_325_1128 267
105 3300048088 Ga0495602_0116214 Ga0495602_0116214_344_1147 267
106 3300048088 Ga0495602_0143393 Ga0495602_0143393_808_1611 267
107 3300048903 Ga0496100_0400542 Ga0496100_0400542_193_996 267
108 3300048905 Ga0496102_0001874 Ga0496102_0001874_16187_16990 267
109 3300048906 Ga0496103_0002168 Ga0496103_0002168_5227_6030 267
110 3300048907 Ga0496104_0092498 Ga0496104_0092498_1550_2353 267
111 3300048908 Ga0496105_0005120 Ga0496105_0005120_8172_8975 267
112 3300048908 Ga0496105_0006240 Ga0496105_0006240_3903_4706 267
113 3300048911 Ga0496108_0035682 Ga0496108_0035682_2886_3689 267
114 3300048912 Ga0496109_0160326 Ga0496109_0160326_941_1744 267
115 3300048913 Ga0496110_0079371 Ga0496110_0079371_862_1665 267
116 3300048914 Ga0496111_0033662 Ga0496111_0033662_2326_3129 267
117 3300048915 Ga0496112_0006808 Ga0496112_0006808_4492_5295 267
118 3300048918 Ga0496115_0019367 Ga0496115_0019367_1182_1985 267
119 3300048919 Ga0496116_0032500 Ga0496116_0032500_494_1297 267
120 3300048919 Ga0496116_0109690 Ga0496116_0109690_516_1319 267
121 3300048921 Ga0496118_0019343 Ga0496118_0019343_1754_2557 267
122 3300048921 Ga0496118_0043899 Ga0496118_0043899_389_1192 267
123 3300048921 Ga0496118_0251909 Ga0496118_0251909_85_888 267
124 3300048922 Ga0496119_0014153 Ga0496119_0014153_3741_4544 267
125 3300048924 Ga0496121_0067199 Ga0496121_0067199_1421_2224 267
126 3300048925 Ga0496122_0031025 Ga0496122_0031025_2365_3168 267
127 3300048927 Ga0496124_0020591 Ga0496124_0020591_19_822 267
128 3300048927 Ga0496124_0193994 Ga0496124_0193994_13_816 267
129 3300048928 Ga0496125_0010389 Ga0496125_0010389_2261_3064 267
130 3300048928 Ga0496125_0037272 Ga0496125_0037272_3036_3839 267
131 3300048928 Ga0496125_0048526 Ga0496125_0048526_2632_3435 267
132 3300048929 Ga0496126_0038168 Ga0496126_0038168_1120_1923 267
133 3300049460 Ga0495682_0023060 Ga0495682_0023060_150_953 267
134 3300050489 nmdc:mga03683_149728_c1 nmdc:mga03683_149728_c1_39_842 267
135 3300050489 nmdc:mga03683_7443_c1 nmdc:mga03683_7443_c1_2292_3095 267
136 3300050490 nmdc:mga03n38_22639_c1 nmdc:mga03n38_22639_c1_246_1049 267
137 3300050491 nmdc:mga00v17_114956_c1 nmdc:mga00v17_114956_c1_69_872 267
138 3300050491 nmdc:mga00v17_20781_c1 nmdc:mga00v17_20781_c1_2880_3683 267
139 3300050492 nmdc:mga0yw44_723_c1 nmdc:mga0yw44_723_c1_4880_5683 267
140 3300050493 nmdc:mga0k408_10760_c1 nmdc:mga0k408_10760_c1_3288_4091 267
141 3300050495 nmdc:mga04h51_2017_c1 nmdc:mga04h51_2017_c1_3478_4281 267
142 3300050496 nmdc:mga07m45_12998_c1 nmdc:mga07m45_12998_c1_3331_4134 267
143 3300050496 nmdc:mga07m45_24695_c1 nmdc:mga07m45_24695_c1_630_1433 267
144 3300050516 nmdc:mga0sz30_98716_c1 nmdc:mga0sz30_98716_c1_328_1131 267
145 3300053084 Ga0495595_0160098 Ga0495595_0160098_20_823 267
146 3300053087 Ga0500643_000037 Ga0500643_000037_115516_116319 267
147 3300053092 Ga0500583_0015846 Ga0500583_0015846_1694_2497 267
148 3300053094 Ga0500566_0000166 Ga0500566_0000166_8300_9103 267
149 3300053094 Ga0500566_0254409 Ga0500566_0254409_11_814 267
150 3300053096 Ga0500641_0023680 Ga0500641_0023680_246_1049 267
151 3300053103 Ga0500555_000550 Ga0500555_000550_153_956 267
152 3300053121 Ga0500607_088391 Ga0500607_088391_317_1120 267
153 3300053130 Ga0500642_0000071 Ga0500642_0000071_9363_10166 267
154 3300053130 Ga0500642_0012757 Ga0500642_0012757_982_1785 267
155 3300053134 Ga0500658_0016210 Ga0500658_0016210_917_1720 267
156 3300053138 Ga0500564_162190 Ga0500564_162190_51_854 267
157 3300053142 Ga0500577_0013663 Ga0500577_0013663_12_815 267
158 3300053154 Ga0500619_043197 Ga0500619_043197_434_1237 267
159 3300053156 Ga0500622_0001752 Ga0500622_0001752_10899_11702 267
160 3300053158 Ga0500627_0010696 Ga0500627_0010696_34_837 267
161 3300053161 Ga0500634_0022780 Ga0500634_0022780_1011_1814 267
162 3300053177 Ga0500636_0004341 Ga0500636_0004341_2290_3093 267
163 3300053729 Ga0500625_002984 Ga0500625_002984_3972_4775 267
164 iso_pu_bacteria 2744054633 2745076157 267
165 3300013102 Ga0157371_10000045 Ga0157371_1000004547 268
166 3300003354 JGI25160J50197_1008322 JGI25160J50197_10083225 269
167 3300005262 Ga0065165_1000368 Ga0065165_100036812 269
168 3300006844 Ga0075428_100000390 Ga0075428_10000039010 269
169 3300006846 Ga0075430_100037274 Ga0075430_1000372745 269
170 3300006847 Ga0075431_100000003 Ga0075431_10000000335 269
171 3300006880 Ga0075429_100000288 Ga0075429_10000028819 269
172 3300009094 Ga0111539_10000753 Ga0111539_1000075324 269
173 3300009147 Ga0114129_10000104 Ga0114129_1000010431 269
174 3300025302 Ga0207426_1000289 Ga0207426_1000289103 269
175 3300027907 Ga0207428_10000831 Ga0207428_1000083111 269
176 3300048929 Ga0496126_0200459 Ga0496126_0200459_396_1268 269
177 3300050507 nmdc:mga05p37_215_c1 nmdc:mga05p37_215_c1_14579_15391 269
178 3300050508 nmdc:mga09592_1263_c1 nmdc:mga09592_1263_c1_14546_15358 269
179 3300050509 nmdc:mga0qj67_5759_c1 nmdc:mga0qj67_5759_c1_3090_3902 269
180 3300050510 nmdc:mga06r32_1551_c1 nmdc:mga06r32_1551_c1_15091_15903 269
181 3300050511 nmdc:mga08y16_176_c1 nmdc:mga08y16_176_c1_15935_16747 269
182 3300005983 Ga0081540_1031125 Ga0081540_10311252 270
183 3300005983 Ga0081540_1063983 Ga0081540_10639832 270
184 3300006177 Ga0075362_10080859 Ga0075362_100808592 270
185 3300006195 Ga0075366_10008073 Ga0075366_100080732 270
186 3300009101 Ga0105247_10100100 Ga0105247_101001002 270
187 3300010375 Ga0105239_10347262 Ga0105239_103472622 270
188 3300013297 Ga0157378_10845598 Ga0157378_108455981 270
189 3300044658 Ga0466972_0001101 Ga0466972_0001101_10572_11384 270
190 3300044658 Ga0466972_0036902 Ga0466972_0036902_293_1105 270
191 3300044694 Ga0466963_0056092 Ga0466963_0056092_201_1013 270
192 3300044735 Ga0466968_0019728 Ga0466968_0019728_321_1133 270
193 3300044735 Ga0466968_0099649 Ga0466968_0099649_323_1135 270
194 3300044901 Ga0466960_0071300 Ga0466960_0071300_177_989 270
195 3300045976 Ga0466967_0002064 Ga0466967_0002064_9668_10480 270
196 3300046457 Ga0495590_0089336 Ga0495590_0089336_227_1039 270
197 3300046524 Ga0495648_0011360 Ga0495648_0011360_2523_3395 270
198 3300046616 Ga0495668_0243383 Ga0495668_0243383_152_964 270
199 3300046665 Ga0495661_0221850 Ga0495661_0221850_88_900 270
200 3300046674 Ga0495588_0036213 Ga0495588_0036213_1148_1960 270
201 3300048903 Ga0496100_0231627 Ga0496100_0231627_331_1143 270
202 3300048906 Ga0496103_0050949 Ga0496103_0050949_1539_2351 270
203 3300048909 Ga0496106_0361973 Ga0496106_0361973_28_840 270
204 3300048915 Ga0496112_0341661 Ga0496112_0341661_299_1111 270
205 3300048924 Ga0496121_0040996 Ga0496121_0040996_2719_3531 270
206 3300048925 Ga0496122_0168680 Ga0496122_0168680_172_1044 270
207 3300048927 Ga0496124_0262792 Ga0496124_0262792_161_973 270
208 3300048928 Ga0496125_0000202 Ga0496125_0000202_19215_20087 270
209 3300048928 Ga0496125_0014914 Ga0496125_0014914_2935_3807 270
210 3300048929 Ga0496126_0151787 Ga0496126_0151787_1088_1900 270
211 3300048929 Ga0496126_0297655 Ga0496126_0297655_160_972 270
212 3300049460 Ga0495682_0047740 Ga0495682_0047740_46_858 270
213 3300050489 nmdc:mga03683_103928_c1 nmdc:mga03683_103928_c1_349_1182 270
214 3300050491 nmdc:mga00v17_249572_c1 nmdc:mga00v17_249572_c1_111_944 270
215 3300050493 nmdc:mga0k408_15187_c1 nmdc:mga0k408_15187_c1_2767_3600 270
216 3300048924 Ga0496121_0102845 Ga0496121_0102845_213_1028 271
217 3300048929 Ga0496126_0118315 Ga0496126_0118315_670_1485 271
218 3300053142 Ga0500577_0001653 Ga0500577_0001653_1578_2450 271
219 3300005354 Ga0070675_100437456 Ga0070675_1004374562 272
220 3300005578 Ga0068854_100394563 Ga0068854_1003945632 272
221 3300005614 Ga0068856_100121348 Ga0068856_1001213482 272
222 3300005616 Ga0068852_100257446 Ga0068852_1002574462 272
223 3300005617 Ga0068859_100123399 Ga0068859_1001233992 272
224 3300005841 Ga0068863_100044648 Ga0068863_1000446482 272
225 3300005842 Ga0068858_100069140 Ga0068858_1000691402 272
226 3300005844 Ga0068862_100070936 Ga0068862_1000709363 272
227 3300006028 Ga0070717_10070422 Ga0070717_100704223 272
228 3300006038 Ga0075365_10129215 Ga0075365_101292152 272
229 3300006847 Ga0075431_100128497 Ga0075431_1001284973 272
230 3300006871 Ga0075434_100072569 Ga0075434_1000725692 272
231 3300006881 Ga0068865_100072834 Ga0068865_1000728342 272
232 3300006931 Ga0097620_100123397 Ga0097620_1001233972 272
233 3300025900 Ga0207710_10010271 Ga0207710_100102715 272
234 3300025901 Ga0207688_10003242 Ga0207688_100032427 272
235 3300025903 Ga0207680_10332396 Ga0207680_103323961 272
236 3300025911 Ga0207654_10166276 Ga0207654_101662762 272
237 3300025914 Ga0207671_10145289 Ga0207671_101452892 272
238 3300025919 Ga0207657_10026833 Ga0207657_100268333 272
239 3300025925 Ga0207650_10051907 Ga0207650_100519072 272
240 3300025927 Ga0207687_10112481 Ga0207687_101124812 272
241 3300025931 Ga0207644_10147179 Ga0207644_101471792 272
242 3300025933 Ga0207706_10002137 Ga0207706_1000213714 272
243 3300025940 Ga0207691_10025691 Ga0207691_100256915 272
244 3300025949 Ga0207667_10194874 Ga0207667_101948742 272
245 3300025972 Ga0207668_10208796 Ga0207668_102087962 272
246 3300026023 Ga0207677_10080977 Ga0207677_100809772 272
247 3300026089 Ga0207648_10006963 Ga0207648_100069636 272
248 3300026095 Ga0207676_10053568 Ga0207676_100535682 272
249 3300026116 Ga0207674_10053974 Ga0207674_100539744 272
250 3300026118 Ga0207675_100061684 Ga0207675_1000616845 272
251 3300026121 Ga0207683_10017919 Ga0207683_100179192 272
252 3300026142 Ga0207698_10199788 Ga0207698_101997882 272
253 3300035116 Ga0373945_0014499 Ga0373945_0014499_1452_2285 272
254 3300035170 Ga0373943_0005006 Ga0373943_0005006_1835_2668 272
255 3300035171 Ga0373946_0006955 Ga0373946_0006955_1917_2750 272
256 3300035692 Ga0373935_0015948 Ga0373935_0015948_1367_2200 272
257 3300035695 Ga0373927_0010188 Ga0373927_0010188_2063_2896 272
258 3300035725 Ga0373947_0002364 Ga0373947_0002364_3396_4229 272
259 3300037068 Ga0373925_0073183 Ga0373925_0073183_341_1174 272
260 3300037068 Ga0373925_0380911 Ga0373925_0380911_12_845 272
261 3300046455 Ga0495603_0007156 Ga0495603_0007156_1615_2448 272
262 3300046459 Ga0495629_0158850 Ga0495629_0158850_126_959 272
263 3300046461 Ga0495641_0007549 Ga0495641_0007549_2627_3460 272
264 3300046492 Ga0495585_0072766 Ga0495585_0072766_856_1689 272
265 3300046499 Ga0495594_0011612 Ga0495594_0011612_1874_2707 272
266 3300046517 Ga0495630_0091537 Ga0495630_0091537_321_1154 272
267 3300046518 Ga0495631_0097113 Ga0495631_0097113_68_901 272
268 3300046525 Ga0495663_0054520 Ga0495663_0054520_51_884 272
269 3300046533 Ga0495640_0123125 Ga0495640_0123125_255_1088 272
270 3300046642 Ga0495634_0241365 Ga0495634_0241365_79_912 272
271 3300046663 Ga0495635_0085602 Ga0495635_0085602_867_1700 272
272 3300046681 Ga0495647_0004026 Ga0495647_0004026_2026_2859 272
273 3300046683 Ga0495658_0060313 Ga0495658_0060313_617_1450 272
274 3300046689 Ga0495613_0027959 Ga0495613_0027959_1273_2106 272
275 3300046690 Ga0495624_0002738 Ga0495624_0002738_9464_10297 272
276 3300047321 Ga0495676_0025949 Ga0495676_0025949_1338_2171 272
277 3300047673 Ga0495593_0144829 Ga0495593_0144829_65_898 272
278 3300048903 Ga0496100_0026555 Ga0496100_0026555_2306_3139 272
279 3300048904 Ga0496101_0009142 Ga0496101_0009142_5347_6180 272
280 3300048905 Ga0496102_0077241 Ga0496102_0077241_1371_2204 272
281 3300048906 Ga0496103_0004621 Ga0496103_0004621_7407_8240 272
282 3300048906 Ga0496103_0083548 Ga0496103_0083548_924_1757 272
283 3300048907 Ga0496104_0211558 Ga0496104_0211558_622_1455 272
284 3300048908 Ga0496105_0005229 Ga0496105_0005229_616_1449 272
285 3300048908 Ga0496105_0139551 Ga0496105_0139551_433_1266 272
286 3300048909 Ga0496106_0304870 Ga0496106_0304870_174_1007 272
287 3300048910 Ga0496107_0114243 Ga0496107_0114243_433_1266 272
288 3300048911 Ga0496108_0000244 Ga0496108_0000244_36952_37785 272
289 3300048911 Ga0496108_0197019 Ga0496108_0197019_501_1337 272
290 3300048912 Ga0496109_0002677 Ga0496109_0002677_722_1555 272
291 3300048913 Ga0496110_0015570 Ga0496110_0015570_861_1694 272
292 3300048914 Ga0496111_0000320 Ga0496111_0000320_18862_19695 272
293 3300048914 Ga0496111_0087254 Ga0496111_0087254_721_1554 272
294 3300048915 Ga0496112_0127715 Ga0496112_0127715_958_1794 272
295 3300048915 Ga0496112_0234401 Ga0496112_0234401_597_1430 272
296 3300048915 Ga0496112_0334699 Ga0496112_0334699_228_1061 272
297 3300048916 Ga0496113_0003916 Ga0496113_0003916_810_1643 272
298 3300048916 Ga0496113_0039682 Ga0496113_0039682_1832_2665 272
299 3300048918 Ga0496115_0076782 Ga0496115_0076782_61_894 272
300 3300049742 Ga0501080_0184326 Ga0501080_0184326_857_1678 272
301 3300050490 nmdc:mga03n38_117865_c1 nmdc:mga03n38_117865_c1_414_1247 272
302 3300050494 nmdc:mga06z11_101504_c1 nmdc:mga06z11_101504_c1_501_1334 272
303 3300050507 nmdc:mga05p37_331717_c1 nmdc:mga05p37_331717_c1_221_1054 272
304 3300050510 nmdc:mga06r32_133694_c1 nmdc:mga06r32_133694_c1_814_1647 272
305 3300050512 nmdc:mga0n895_166279_c1 nmdc:mga0n895_166279_c1_744_1577 272
306 3300053077 Ga0495601_0149370 Ga0495601_0149370_99_932 272
307 3300053083 Ga0495655_0036324 Ga0495655_0036324_96_929 272
308 3300061734 Ga0530510_0139373 Ga0530510_0139373_939_1760 272
309 3300046674 Ga0495588_0083379 Ga0495588_0083379_707_1540 274
310 iso_pu_bacteria 2602042107 2603862505 274
311 iso_pu_bacteria 2888388044 2888388647 274
312 3300005438 Ga0070701_10038307 Ga0070701_100383072 276
313 iso_pu_bacteria 2508501128 2509148673 276
314 3300005331 Ga0070670_100595403 Ga0070670_1005954031 277
315 3300005456 Ga0070678_100054699 Ga0070678_1000546992 277
316 3300031616 Ga0307508_10073310 Ga0307508_100733102 277
317 3300045976 Ga0466967_0140178 Ga0466967_0140178_241_1074 277
318 3300046507 Ga0495606_0008906 Ga0495606_0008906_4160_4999 277
319 iso_pu_bacteria 2507262055 2507510610 277
320 iso_pu_bacteria 2508501009 2508544412 277
321 iso_pu_bacteria 2508501042 2508697447 277
322 iso_pu_bacteria 2511231028 2511396338 277
323 iso_pu_bacteria 2513237094 2513640196 277
324 iso_pu_bacteria 2513237095 2513650747 277
325 iso_pu_bacteria 2513237104 2513715856 277
326 iso_pu_bacteria 2513237139 2513877766 277
327 iso_pu_bacteria 2513237161 2514015043 277
328 iso_pu_bacteria 2515154112 2515628662 277
329 iso_pu_bacteria 2517093001 2517105514 277
330 iso_pu_bacteria 2524023205 2524437013 277
331 iso_pu_bacteria 2528768022 2528852284 277
332 iso_pu_bacteria 2617270735 2617350027 277
333 iso_pu_bacteria 2791355196 2793063375 277
334 iso_pu_bacteria 2802429603 2805917106 277
335 iso_pu_bacteria 2816332527 2818243551 277
336 iso_pu_bacteria 2824661429 2824662442 277
337 iso_pu_bacteria 2824704595 2824705690 277
338 iso_pu_bacteria 2824753945 2824756372 277
339 iso_pu_bacteria 2824763712 2824764057 277
340 iso_pu_bacteria 2857509624 2857516135 277
341 iso_pu_bacteria 2874590934 2874594750 277
342 iso_pu_bacteria 2874628541 2874634729 277
343 iso_pu_bacteria 2876771140 2876774408 277
344 iso_pu_bacteria 2876818435 2876822802 277
345 iso_pu_bacteria 2879074833 2879078562 277
346 iso_pu_bacteria 2888378607 2888382002 277
347 iso_pu_bacteria 2904711408 2904720360 277
348 iso_pu_bacteria 2906626472 2906634101 277
349 iso_pu_bacteria 2932784394 2932793103 277
350 iso_pu_bacteria 2932809354 2932814591 277
351 iso_pu_bacteria 2932818245 2932824656 277
352 iso_pu_bacteria 2932828146 2932836563 277
353 iso_pu_bacteria 2933577622 2933578014 277
354 iso_pu_bacteria 2935608549 2935610657 277
355 iso_pu_bacteria 2935616580 2935623296 277
356 iso_pu_bacteria 2935638405 2935646706 277
357 iso_pu_bacteria 2935648319 2935652428 277
358 iso_pu_bacteria 2935656913 2935661010 277
359 iso_pu_bacteria 2935665750 2935672624 277
360 iso_pu_bacteria 2935675223 2935682497 277
361 iso_pu_bacteria 2935684952 2935691701 277
362 iso_pu_bacteria 2935694250 2935699570 277
363 iso_pu_bacteria 2935703347 2935707807 277
364 iso_pu_bacteria 2935713505 2935719535 277
365 iso_pu_bacteria 2935722832 2935728863 277
366 iso_pu_bacteria 2935732158 2935737895 277
367 iso_pu_bacteria 2935741537 2935747270 277
368 iso_pu_bacteria 2935750917 2935757929 277
369 iso_pu_bacteria 2935760218 2935761722 277
370 iso_pu_bacteria 2935777560 2935782796 277
371 iso_pu_bacteria 2935785616 2935787152 277
372 iso_pu_bacteria 2935793552 2935795200 277
373 iso_pu_bacteria 2935801545 2935810082 277
374 iso_pu_bacteria 2935810662 2935819034 277
375 iso_pu_bacteria 2935819856 2935820154 277
376 iso_pu_bacteria 2935827899 2935835973 277
377 iso_pu_bacteria 2935837841 2935844903 277
378 iso_pu_bacteria 2935847175 2935849835 277
379 iso_pu_bacteria 2935855204 2935861704 277
380 iso_pu_bacteria 2935864058 2935870743 277
381 iso_pu_bacteria 2935873716 2935881384 277
382 iso_pu_bacteria 2935908558 2935914475 277
383 iso_pu_bacteria 2935916978 2935919025 277
384 iso_pu_bacteria 2935926038 2935932144 277
385 iso_pu_bacteria 2935934488 2935940742 277
386 iso_pu_bacteria 2935942939 2935948671 277
387 iso_pu_bacteria 2935951376 2935957222 277
388 iso_pu_bacteria 2935959822 2935963652 277
389 iso_pu_bacteria 2935967501 2935973806 277
390 iso_pu_bacteria 2935984226 2935988953 277
391 iso_pu_bacteria 2935992306 2936000435 277
392 iso_pu_bacteria 2936002035 2936005451 277
393 iso_pu_bacteria 2936011229 2936015067 277
394 iso_pu_bacteria 2936019824 2936023212 277
395 iso_pu_bacteria 2936028420 2936032335 277
396 iso_pu_bacteria 2936037263 2936041990 277
397 iso_pu_bacteria 2936046547 2936050196 277
398 iso_pu_bacteria 2936055302 2936061096 277
399 iso_pu_bacteria 2940556831 2940564159 277
400 iso_pu_bacteria 2941531003 2941535140 277
401 iso_pu_bacteria 2941538514 2941546710 277
402 iso_pu_bacteria 3005506211 3005512141 277
403 iso_pu_bacteria 3005594810 3005597014 277
404 iso_pu_bacteria 3005710791 3005713086 277
405 iso_pu_bacteria 3005718088 3005720446 277
406 iso_pu_bacteria 8016511872 8016515719 277
407 iso_pu_bacteria 8016522445 8016523284 277
408 iso_pu_bacteria 8016530956 8016536776 277
409 iso_pu_bacteria 8016539877 8016541049 277
410 iso_pu_bacteria 8016548790 8016552204 277
411 iso_pu_bacteria 8016557553 8016560584 277
412 iso_pu_bacteria 8016566248 8016566438 277
413 iso_pu_bacteria 8016575299 8016579188 277
414 iso_pu_bacteria 8016583857 8016590058 277
415 iso_pu_bacteria 8016595262 8016598478 277
416 iso_pu_bacteria 8016603502 8016612659 277
417 iso_pu_bacteria 8016622563 8016628857 277
418 iso_pu_bacteria 8016630954 8016633384 277
419 iso_pu_bacteria 8017057580 8017060780 277
420 iso_pu_bacteria 8019538911 8019542972 277
421 iso_pu_bacteria 8019547302 8019547781 277
422 iso_pu_bacteria 8019576017 8019580303 277
423 iso_pu_bacteria 8019586578 8019588021 277
424 iso_pu_bacteria 8019597564 8019603319 277
425 iso_pu_bacteria 8019608314 8019615215 277
426 iso_pu_bacteria 8019619141 8019626013 277
427 iso_pu_bacteria 8019629233 8019636469 277
428 iso_pu_bacteria 8019648815 8019655997 277
429 iso_pu_bacteria 8019659431 8019664250 277
430 iso_pu_bacteria 8019668869 8019673834 277
431 iso_pu_bacteria 8019687851 8019687973 277
432 iso_pu_bacteria 8055742211 8055748349 277
433 iso_pu_bacteria 8056967851 8056971971 277
434 3300003215 JGI25153J46596_10006394 JGI25153J46596_100063942 278
435 3300005455 Ga0070663_100161614 Ga0070663_1001616141 278
436 3300006051 Ga0075364_10269687 Ga0075364_102696872 278
437 3300006186 Ga0075369_10005952 Ga0075369_100059524 278
438 3300006353 Ga0075370_10073793 Ga0075370_100737932 278
439 3300013104 Ga0157370_10167330 Ga0157370_101673302 278
440 3300025295 Ga0209564_1007718 Ga0209564_10077185 278
441 3300025297 Ga0209758_1006857 Ga0209758_10068573 278
442 3300031730 Ga0307516_10056982 Ga0307516_100569823 278
443 3300031911 Ga0307412_10016383 Ga0307412_100163831 278
444 3300037312 Ga0395899_0039215 Ga0395899_0039215_2228_3064 278
445 3300037418 Ga0395900_0000943 Ga0395900_0000943_25273_26109 278
446 3300037466 Ga0395898_0002974 Ga0395898_0002974_13049_13885 278
447 3300038443 Ga0395901_0001973 Ga0395901_0001973_6083_6919 278
448 3300046460 Ga0495638_0230158 Ga0495638_0230158_113_976 278
449 3300046506 Ga0495583_0059082 Ga0495583_0059082_675_1517 278
450 3300046691 Ga0495670_0009149 Ga0495670_0009149_1650_2492 278
451 3300048915 Ga0496112_0040401 Ga0496112_0040401_2479_3315 278
452 3300048919 Ga0496116_0003489 Ga0496116_0003489_13625_14467 278
453 3300048921 Ga0496118_0072961 Ga0496118_0072961_53_916 278
454 3300048924 Ga0496121_0006808 Ga0496121_0006808_5507_6370 278
455 3300048928 Ga0496125_0066386 Ga0496125_0066386_397_1239 278
456 3300049568 Ga0501031_0053141 Ga0501031_0053141_1387_2229 278
457 3300049569 Ga0501032_0000257 Ga0501032_0000257_30891_31733 278
458 3300049570 Ga0501033_0000244 Ga0501033_0000244_15127_15969 278
459 3300049571 Ga0501034_0000159 Ga0501034_0000159_36263_37105 278
460 3300049572 Ga0501036_0000039 Ga0501036_0000039_37296_38138 278
461 3300049573 Ga0501037_0001386 Ga0501037_0001386_2046_2888 278
462 3300049574 Ga0501038_0000207 Ga0501038_0000207_26029_26871 278
463 3300049575 Ga0501039_0000148 Ga0501039_0000148_29307_30149 278
464 3300049578 Ga0501042_0071901 Ga0501042_0071901_725_1567 278
465 3300049579 Ga0501043_0000202 Ga0501043_0000202_49667_50509 278
466 3300049580 Ga0501046_0000185 Ga0501046_0000185_24169_25011 278
467 3300049581 Ga0501047_0000385 Ga0501047_0000385_12531_13373 278
468 3300049582 Ga0501048_0000536 Ga0501048_0000536_3629_4471 278
469 3300049583 Ga0501067_0005941 Ga0501067_0005941_4159_5001 278
470 3300049584 Ga0501068_0012217 Ga0501068_0012217_3811_4653 278
471 3300049585 Ga0501069_0002806 Ga0501069_0002806_3873_4715 278
472 3300049586 Ga0501070_0000557 Ga0501070_0000557_29114_29956 278
473 3300049587 Ga0501071_0096410 Ga0501071_0096410_654_1496 278
474 3300049588 Ga0501072_0029712 Ga0501072_0029712_1853_2695 278
475 3300049589 Ga0501073_0000034 Ga0501073_0000034_90082_90924 278
476 3300049590 Ga0501074_0000271 Ga0501074_0000271_15559_16401 278
477 3300049741 Ga0501079_0000773 Ga0501079_0000773_52_894 278
478 3300049742 Ga0501080_0001103 Ga0501080_0001103_1417_2259 278
479 3300049744 Ga0501083_0000118 Ga0501083_0000118_20539_21381 278
480 3300049822 Ga0501035_0000137 Ga0501035_0000137_3929_4771 278
481 3300049823 Ga0501044_0000548 Ga0501044_0000548_32288_33130 278
482 3300049824 Ga0501045_0010495 Ga0501045_0010495_1008_1850 278
483 3300050492 nmdc:mga0yw44_12005_c1 nmdc:mga0yw44_12005_c1_42_905 278
484 3300050516 nmdc:mga0sz30_10704_c1 nmdc:mga0sz30_10704_c1_1123_1965 278
485 3300053087 Ga0500643_033261 Ga0500643_033261_240_1082 278
486 3300053089 Ga0500581_026824 Ga0500581_026824_1934_2776 278
487 3300053090 Ga0500646_0011610 Ga0500646_0011610_1266_2129 278
488 3300053093 Ga0500651_0075684 Ga0500651_0075684_63_926 278
489 3300053104 Ga0500556_0000089 Ga0500556_0000089_3054_3917 278
490 3300053109 Ga0500569_003630 Ga0500569_003630_672_1535 278
491 3300053130 Ga0500642_0000030 Ga0500642_0000030_108025_108867 278
492 3300053136 Ga0500559_0057068 Ga0500559_0057068_70_933 278
493 3300053151 Ga0500604_0002842 Ga0500604_0002842_3801_4664 278
494 3300053153 Ga0500616_0000026 Ga0500616_0000026_85173_86015 278
495 3300053156 Ga0500622_0001149 Ga0500622_0001149_18583_19446 278
496 3300054114 Ga0501084_0003978 Ga0501084_0003978_3639_4481 278
497 3300060353 Ga0501082_0078362 Ga0501082_0078362_1933_2775 278
498 iso_pu_bacteria 2857524615 2857529845 278
499 iso_pu_bacteria 2919073203 2919077299 278
500 3300005985 Ga0081539_10000172 Ga0081539_1000017290 279
501 3300009177 Ga0105248_10831608 Ga0105248_108316082 279
502 3300013105 Ga0157369_10020698 Ga0157369_100206986 279
503 3300031616 Ga0307508_10183016 Ga0307508_101830161 279
504 3300037418 Ga0395900_0515441 Ga0395900_0515441_126_971 279
505 3300048905 Ga0496102_0372991 Ga0496102_0372991_69_908 279
506 3300048929 Ga0496126_0025578 Ga0496126_0025578_3087_3947 279
507 3300049579 Ga0501043_0188339 Ga0501043_0188339_130_975 279
508 3300003323 rootH1_10033771 rootH1_100337713 280
509 3300003752 Ga0055539_1004673 Ga0055539_10046731 280
510 3300005435 Ga0070714_100451105 Ga0070714_1004511052 280
511 3300005436 Ga0070713_100052143 Ga0070713_1000521433 280
512 3300006028 Ga0070717_10070996 Ga0070717_100709963 280
513 3300021384 Ga0213876_10225062 Ga0213876_102250621 280
514 3300025253 Ga0209677_101161 Ga0209677_1011619 280
515 3300025261 Ga0209233_1003000 Ga0209233_10030006 280
516 3300025928 Ga0207700_10014312 Ga0207700_100143122 280
517 3300025929 Ga0207664_10153066 Ga0207664_101530663 280
518 3300031616 Ga0307508_10243060 Ga0307508_102430602 280
519 3300037466 Ga0395898_0022540 Ga0395898_0022540_1175_2017 280
520 3300038443 Ga0395901_0376376 Ga0395901_0376376_119_982 280
521 3300039437 Ga0436365_0858635 Ga0436365_0858635_24_866 280
522 3300048919 Ga0496116_0120688 Ga0496116_0120688_88_930 280
523 3300048922 Ga0496119_0171818 Ga0496119_0171818_110_952 280
524 3300048924 Ga0496121_0038006 Ga0496121_0038006_1340_2182 280
525 3300048924 Ga0496121_0089499 Ga0496121_0089499_719_1561 280
526 3300049569 Ga0501032_0002240 Ga0501032_0002240_3486_4334 280
527 3300049570 Ga0501033_0000803 Ga0501033_0000803_3413_4261 280
528 3300049571 Ga0501034_0019040 Ga0501034_0019040_1633_2481 280
529 3300049572 Ga0501036_0000104 Ga0501036_0000104_38136_38984 280
530 3300049573 Ga0501037_0001025 Ga0501037_0001025_18168_19016 280
531 3300049574 Ga0501038_0000041 Ga0501038_0000041_77353_78201 280
532 3300049575 Ga0501039_0000064 Ga0501039_0000064_21427_22275 280
533 3300049578 Ga0501042_0242095 Ga0501042_0242095_99_947 280
534 3300049579 Ga0501043_0012725 Ga0501043_0012725_4046_4894 280
535 3300049581 Ga0501047_0000392 Ga0501047_0000392_44720_45568 280
536 3300049582 Ga0501048_0051316 Ga0501048_0051316_1463_2311 280
537 3300049584 Ga0501068_0004880 Ga0501068_0004880_4869_5717 280
538 3300049585 Ga0501069_0024732 Ga0501069_0024732_764_1612 280
539 3300049586 Ga0501070_0000209 Ga0501070_0000209_1620_2468 280
540 3300049589 Ga0501073_0008907 Ga0501073_0008907_3450_4298 280
541 3300049742 Ga0501080_0010052 Ga0501080_0010052_5051_5899 280
542 3300049822 Ga0501035_0000155 Ga0501035_0000155_58563_59411 280
543 3300049823 Ga0501044_0001941 Ga0501044_0001941_4990_5838 280
544 3300049824 Ga0501045_0065935 Ga0501045_0065935_1174_2022 280
545 3300001990 JGI24737J22298_10047256 JGI24737J22298_100472561 281
546 3300003214 JGI25165J46597_1006259 JGI25165J46597_10062592 281
547 3300003215 JGI25153J46596_10000110 JGI25153J46596_1000011049 281
548 3300003215 JGI25153J46596_10000161 JGI25153J46596_1000016167 281
549 3300003215 JGI25153J46596_10000354 JGI25153J46596_1000035419 281
550 3300003215 JGI25153J46596_10015820 JGI25153J46596_100158202 281
551 3300003354 JGI25160J50197_1000217 JGI25160J50197_10002174 281
552 3300003354 JGI25160J50197_1001256 JGI25160J50197_10012567 281
553 3300003762 Ga0055542_1006033 Ga0055542_10060332 281
554 3300003763 Ga0055529_1007904 Ga0055529_10079041 281
555 3300003771 Ga0055526_1036322 Ga0055526_10363222 281
556 3300003794 Ga0055531_10030177 Ga0055531_100301772 281
557 3300004625 Ga0055543_1003554 Ga0055543_10035542 281
558 3300005262 Ga0065165_1000244 Ga0065165_100024484 281
559 3300005262 Ga0065165_1009863 Ga0065165_10098634 281
560 3300005262 Ga0065165_1013890 Ga0065165_10138903 281
561 3300005331 Ga0070670_100033635 Ga0070670_1000336354 281
562 3300005336 Ga0070680_100074670 Ga0070680_1000746702 281
563 3300005337 Ga0070682_100089046 Ga0070682_1000890463 281
564 3300005341 Ga0070691_10022142 Ga0070691_100221424 281
565 3300005343 Ga0070687_100117744 Ga0070687_1001177441 281
566 3300005347 Ga0070668_100037603 Ga0070668_1000376033 281
567 3300005355 Ga0070671_100014431 Ga0070671_1000144316 281
568 3300005366 Ga0070659_100011570 Ga0070659_1000115706 281
569 3300005367 Ga0070667_100042934 Ga0070667_1000429343 281
570 3300005434 Ga0070709_10003713 Ga0070709_100037137 281
571 3300005435 Ga0070714_100035097 Ga0070714_1000350972 281
572 3300005435 Ga0070714_100304490 Ga0070714_1003044902 281
573 3300005436 Ga0070713_100040305 Ga0070713_1000403054 281
574 3300005437 Ga0070710_10000965 Ga0070710_100009652 281
575 3300005439 Ga0070711_100002283 Ga0070711_1000022835 281
576 3300005439 Ga0070711_100042604 Ga0070711_1000426042 281
577 3300005441 Ga0070700_100042261 Ga0070700_1000422614 281
578 3300005445 Ga0070708_100065204 Ga0070708_1000652043 281
579 3300005456 Ga0070678_100012356 Ga0070678_1000123563 281
580 3300005457 Ga0070662_100005484 Ga0070662_1000054846 281
581 3300005457 Ga0070662_100017092 Ga0070662_1000170923 281
582 3300005457 Ga0070662_100084801 Ga0070662_1000848013 281
583 3300005466 Ga0070685_10207574 Ga0070685_102075742 281
584 3300005468 Ga0070707_100021225 Ga0070707_1000212252 281
585 3300005535 Ga0070684_100028265 Ga0070684_1000282653 281
586 3300005535 Ga0070684_100047141 Ga0070684_1000471414 281
587 3300005539 Ga0068853_100071694 Ga0068853_1000716943 281
588 3300005539 Ga0068853_100145328 Ga0068853_1001453282 281
589 3300005547 Ga0070693_100083478 Ga0070693_1000834782 281
590 3300005548 Ga0070665_100020007 Ga0070665_1000200072 281
591 3300005563 Ga0068855_100038765 Ga0068855_1000387653 281
592 3300005577 Ga0068857_100096707 Ga0068857_1000967072 281
593 3300005577 Ga0068857_100248922 Ga0068857_1002489222 281
594 3300005578 Ga0068854_100009906 Ga0068854_1000099063 281
595 3300005578 Ga0068854_100161236 Ga0068854_1001612362 281
596 3300005616 Ga0068852_100001503 Ga0068852_10000150310 281
597 3300005617 Ga0068859_100358526 Ga0068859_1003585263 281
598 3300005719 Ga0068861_100040555 Ga0068861_1000405554 281
599 3300005834 Ga0068851_10037324 Ga0068851_100373243 281
600 3300005842 Ga0068858_100343107 Ga0068858_1003431071 281
601 3300005843 Ga0068860_100082874 Ga0068860_1000828742 281
602 3300005843 Ga0068860_100143777 Ga0068860_1001437772 281
603 3300005844 Ga0068862_100017342 Ga0068862_1000173422 281
604 3300006038 Ga0075365_10007549 Ga0075365_100075493 281
605 3300006042 Ga0075368_10000322 Ga0075368_100003226 281
606 3300006042 Ga0075368_10039184 Ga0075368_100391842 281
607 3300006048 Ga0075363_100001208 Ga0075363_1000012085 281
608 3300006051 Ga0075364_10015940 Ga0075364_100159405 281
609 3300006051 Ga0075364_10037918 Ga0075364_100379183 281
610 3300006177 Ga0075362_10052520 Ga0075362_100525202 281
611 3300006178 Ga0075367_10004226 Ga0075367_100042266 281
612 3300006186 Ga0075369_10014616 Ga0075369_100146164 281
613 3300006186 Ga0075369_10021350 Ga0075369_100213504 281
614 3300006195 Ga0075366_10002088 Ga0075366_100020885 281
615 3300006195 Ga0075366_10067769 Ga0075366_100677692 281
616 3300006353 Ga0075370_10003222 Ga0075370_100032223 281
617 3300006353 Ga0075370_10026189 Ga0075370_100261892 281
618 3300006881 Ga0068865_100015129 Ga0068865_1000151292 281
619 3300006931 Ga0097620_100358551 Ga0097620_1003585513 281
620 3300006941 Ga0099825_1036759 Ga0099825_10367592 281
621 3300007788 Ga0099795_10003727 Ga0099795_100037272 281
622 3300009093 Ga0105240_10008478 Ga0105240_100084789 281
623 3300009093 Ga0105240_10043555 Ga0105240_100435553 281
624 3300009098 Ga0105245_10129742 Ga0105245_101297422 281
625 3300009148 Ga0105243_10052979 Ga0105243_100529792 281
626 3300009174 Ga0105241_10057857 Ga0105241_100578572 281
627 3300009174 Ga0105241_10061812 Ga0105241_100618122 281
628 3300009174 Ga0105241_10418924 Ga0105241_104189242 281
629 3300009545 Ga0105237_10000892 Ga0105237_1000089213 281
630 3300009545 Ga0105237_10186583 Ga0105237_101865832 281
631 3300009551 Ga0105238_10085834 Ga0105238_100858343 281
632 3300009551 Ga0105238_10279083 Ga0105238_102790831 281
633 3300009551 Ga0105238_10719310 Ga0105238_107193101 281
634 3300009553 Ga0105249_10033690 Ga0105249_100336904 281
635 3300010375 Ga0105239_10007059 Ga0105239_100070598 281
636 3300010375 Ga0105239_10072876 Ga0105239_100728762 281
637 3300010375 Ga0105239_10202107 Ga0105239_102021072 281
638 3300010375 Ga0105239_10631346 Ga0105239_106313462 281
639 3300011119 Ga0105246_10003773 Ga0105246_100037733 281
640 3300011119 Ga0105246_10053597 Ga0105246_100535972 281
641 3300013100 Ga0157373_10115006 Ga0157373_101150062 281
642 3300013104 Ga0157370_10070803 Ga0157370_100708032 281
643 3300013105 Ga0157369_10272403 Ga0157369_102724032 281
644 3300013296 Ga0157374_10013038 Ga0157374_100130382 281
645 3300013297 Ga0157378_10027386 Ga0157378_100273862 281
646 3300013306 Ga0163162_10027385 Ga0163162_100273855 281
647 3300013306 Ga0163162_10068700 Ga0163162_100687003 281
648 3300013308 Ga0157375_10142753 Ga0157375_101427532 281
649 3300014325 Ga0163163_10007495 Ga0163163_100074956 281
650 3300014969 Ga0157376_10024205 Ga0157376_100242051 281
651 3300017792 Ga0163161_10015068 Ga0163161_100150682 281
652 3300021321 Ga0214542_1003337 Ga0214542_10033379 281
653 3300021324 Ga0214545_1000028 Ga0214545_1000028114 281
654 3300021327 Ga0214543_1000044 Ga0214543_100004450 281
655 3300021388 Ga0213875_10052511 Ga0213875_100525112 281
656 3300025254 Ga0209148_1000224 Ga0209148_100022432 281
657 3300025261 Ga0209233_1006852 Ga0209233_10068522 281
658 3300025272 Ga0209455_1000635 Ga0209455_10006352 281
659 3300025273 Ga0209673_1031815 Ga0209673_10318151 281
660 3300025295 Ga0209564_1002670 Ga0209564_10026704 281
661 3300025295 Ga0209564_1012359 Ga0209564_10123592 281
662 3300025297 Ga0209758_1000075 Ga0209758_100007575 281
663 3300025297 Ga0209758_1000087 Ga0209758_1000087147 281
664 3300025297 Ga0209758_1001472 Ga0209758_10014724 281
665 3300025297 Ga0209758_1003696 Ga0209758_10036966 281
666 3300025297 Ga0209758_1027008 Ga0209758_10270083 281
667 3300025299 Ga0209256_1022668 Ga0209256_10226682 281
668 3300025299 Ga0209256_1039435 Ga0209256_10394351 281
669 3300025302 Ga0207426_1000312 Ga0207426_10003124 281
670 3300025302 Ga0207426_1006711 Ga0207426_10067111 281
671 3300025304 Ga0209257_1000382 Ga0209257_100038272 281
672 3300025315 Ga0207697_10054827 Ga0207697_100548272 281
673 3300025321 Ga0207656_10103697 Ga0207656_101036972 281
674 3300025899 Ga0207642_10001994 Ga0207642_100019944 281
675 3300025903 Ga0207680_10138245 Ga0207680_101382451 281
676 3300025904 Ga0207647_10006477 Ga0207647_100064773 281
677 3300025906 Ga0207699_10018815 Ga0207699_100188152 281
678 3300025909 Ga0207705_10075667 Ga0207705_100756673 281
679 3300025909 Ga0207705_10136706 Ga0207705_101367062 281
680 3300025911 Ga0207654_10030151 Ga0207654_100301512 281
681 3300025911 Ga0207654_10032141 Ga0207654_100321413 281
682 3300025911 Ga0207654_10049902 Ga0207654_100499023 281
683 3300025912 Ga0207707_10003822 Ga0207707_100038226 281
684 3300025912 Ga0207707_10164933 Ga0207707_101649332 281
685 3300025913 Ga0207695_10000029 Ga0207695_10000029507 281
686 3300025914 Ga0207671_10005341 Ga0207671_100053414 281
687 3300025914 Ga0207671_10263917 Ga0207671_102639171 281
688 3300025917 Ga0207660_10010800 Ga0207660_100108002 281
689 3300025917 Ga0207660_10065273 Ga0207660_100652732 281
690 3300025917 Ga0207660_10108606 Ga0207660_101086062 281
691 3300025919 Ga0207657_10069651 Ga0207657_100696511 281
692 3300025920 Ga0207649_10192398 Ga0207649_101923982 281
693 3300025922 Ga0207646_10066283 Ga0207646_100662834 281
694 3300025925 Ga0207650_10013164 Ga0207650_100131643 281
695 3300025931 Ga0207644_10068376 Ga0207644_100683763 281
696 3300025932 Ga0207690_10083625 Ga0207690_100836252 281
697 3300025933 Ga0207706_10019725 Ga0207706_100197253 281
698 3300025933 Ga0207706_10021973 Ga0207706_100219734 281
699 3300025935 Ga0207709_10051024 Ga0207709_100510242 281
700 3300025938 Ga0207704_10059412 Ga0207704_100594123 281
701 3300025941 Ga0207711_10084395 Ga0207711_100843952 281
702 3300025944 Ga0207661_10024749 Ga0207661_100247495 281
703 3300025944 Ga0207661_10123932 Ga0207661_101239322 281
704 3300025949 Ga0207667_10135137 Ga0207667_101351372 281
705 3300025949 Ga0207667_10307621 Ga0207667_103076212 281
706 3300025960 Ga0207651_10031260 Ga0207651_100312602 281
707 3300025961 Ga0207712_10035474 Ga0207712_100354743 281
708 3300025972 Ga0207668_10096171 Ga0207668_100961713 281
709 3300025972 Ga0207668_10351573 Ga0207668_103515731 281
710 3300025981 Ga0207640_10006486 Ga0207640_100064863 281
711 3300025981 Ga0207640_10122726 Ga0207640_101227262 281
712 3300025981 Ga0207640_10342175 Ga0207640_103421752 281
713 3300025986 Ga0207658_10108791 Ga0207658_101087912 281
714 3300026041 Ga0207639_10092498 Ga0207639_100924982 281
715 3300026041 Ga0207639_10248368 Ga0207639_102483682 281
716 3300026041 Ga0207639_10446571 Ga0207639_104465711 281
717 3300026067 Ga0207678_10008862 Ga0207678_100088624 281
718 3300026067 Ga0207678_10036408 Ga0207678_100364083 281
719 3300026075 Ga0207708_10049107 Ga0207708_100491074 281
720 3300026078 Ga0207702_10001454 Ga0207702_1000145418 281
721 3300026078 Ga0207702_10065504 Ga0207702_100655042 281
722 3300026078 Ga0207702_10102151 Ga0207702_101021512 281
723 3300026088 Ga0207641_10562760 Ga0207641_105627602 281
724 3300026089 Ga0207648_10037025 Ga0207648_100370252 281
725 3300026116 Ga0207674_10079178 Ga0207674_100791782 281
726 3300026142 Ga0207698_10018315 Ga0207698_100183153 281
727 3300027296 Ga0209389_1000137 Ga0209389_100013757 281
728 3300027296 Ga0209389_1000353 Ga0209389_10003538 281
729 3300027357 Ga0209589_1003439 Ga0209589_10034398 281
730 3300027361 Ga0209489_100192 Ga0209489_10019243 281
731 3300027361 Ga0209489_107326 Ga0209489_10732612 281
732 3300027361 Ga0209489_107331 Ga0209489_10733112 281
733 3300027363 Ga0209700_100046 Ga0209700_10004665 281
734 3300027866 Ga0209813_10003308 Ga0209813_100033082 281
735 3300028379 Ga0268266_10003426 Ga0268266_1000342617 281
736 3300028379 Ga0268266_10396811 Ga0268266_103968111 281
737 3300028380 Ga0268265_10023655 Ga0268265_100236555 281
738 3300028381 Ga0268264_10108091 Ga0268264_101080913 281
739 3300028563 Ga0265319_1002640 Ga0265319_10026407 281
740 3300028573 Ga0265334_10000410 Ga0265334_1000041015 281
741 3300028573 Ga0265334_10018447 Ga0265334_100184473 281
742 3300028653 Ga0265323_10000658 Ga0265323_100006585 281
743 3300028666 Ga0265336_10000063 Ga0265336_1000006357 281
744 3300028800 Ga0265338_10000154 Ga0265338_1000015437 281
745 3300029957 Ga0265324_10008680 Ga0265324_100086802 281
746 3300031235 Ga0265330_10050451 Ga0265330_100504511 281
747 3300031235 Ga0265330_10058176 Ga0265330_100581762 281
748 3300031235 Ga0265330_10088551 Ga0265330_100885511 281
749 3300031239 Ga0265328_10093835 Ga0265328_100938351 281
750 3300031241 Ga0265325_10039166 Ga0265325_100391662 281
751 3300031247 Ga0265340_10017726 Ga0265340_100177264 281
752 3300031344 Ga0265316_10081073 Ga0265316_100810732 281
753 3300033180 Ga0307510_10024769 Ga0307510_100247691 281
754 3300035086 Ga0373934_0043616 Ga0373934_0043616_12_857 281
755 3300035091 Ga0373951_0038484 Ga0373951_0038484_70_915 281
756 3300035113 Ga0373936_0001079 Ga0373936_0001079_5636_6481 281
757 3300035116 Ga0373945_0008170 Ga0373945_0008170_1396_2241 281
758 3300035118 Ga0373954_0029065 Ga0373954_0029065_1591_2436 281
759 3300035119 Ga0373956_0064226 Ga0373956_0064226_770_1636 281
760 3300035170 Ga0373943_0003024 Ga0373943_0003024_3322_4167 281
761 3300035171 Ga0373946_0001257 Ga0373946_0001257_4676_5521 281
762 3300035172 Ga0373955_0062635 Ga0373955_0062635_1174_2019 281
763 3300035410 Ga0373924_0059079 Ga0373924_0059079_367_1233 281
764 3300035692 Ga0373935_0000494 Ga0373935_0000494_8571_9416 281
765 3300035692 Ga0373935_0026690 Ga0373935_0026690_1694_2539 281
766 3300035695 Ga0373927_0002352 Ga0373927_0002352_3970_4815 281
767 3300035695 Ga0373927_0003247 Ga0373927_0003247_10054_10899 281
768 3300035695 Ga0373927_0025356 Ga0373927_0025356_1927_2778 281
769 3300035695 Ga0373927_0074932 Ga0373927_0074932_741_1586 281
770 3300035724 Ga0373933_0046219 Ga0373933_0046219_1623_2468 281
771 3300035724 Ga0373933_0091492 Ga0373933_0091492_87_932 281
772 3300035725 Ga0373947_0002117 Ga0373947_0002117_6583_7449 281
773 3300035725 Ga0373947_0018954 Ga0373947_0018954_1720_2565 281
774 3300035725 Ga0373947_0019786 Ga0373947_0019786_2252_3097 281
775 3300036401 Ga0373937_0037849 Ga0373937_0037849_318_1163 281
776 3300037068 Ga0373925_0007070 Ga0373925_0007070_6596_7441 281
777 3300037068 Ga0373925_0010310 Ga0373925_0010310_5407_6252 281
778 3300037068 Ga0373925_0123949 Ga0373925_0123949_41_886 281
779 3300037471 Ga0395905_0021852 Ga0395905_0021852_81_944 281
780 3300037853 Ga0436364_1135391 Ga0436364_1135391_1165_2010 281
781 3300039447 Ga0436361_0394385 Ga0436361_0394385_1329_2174 281
782 3300039453 Ga0436362_0891589 Ga0436362_0891589_112_957 281
783 3300044656 Ga0466969_0121896 Ga0466969_0121896_173_1018 281
784 3300044693 Ga0466961_0036986 Ga0466961_0036986_2235_3080 281
785 3300044765 Ga0466970_0221241 Ga0466970_0221241_134_979 281
786 3300045049 Ga0466959_0018100 Ga0466959_0018100_1099_1944 281
787 3300046454 Ga0495592_0006647 Ga0495592_0006647_1114_1959 281
788 3300046455 Ga0495603_0000237 Ga0495603_0000237_24735_25580 281
789 3300046455 Ga0495603_0003340 Ga0495603_0003340_1153_2019 281
790 3300046455 Ga0495603_0015322 Ga0495603_0015322_505_1356 281
791 3300046459 Ga0495629_0000772 Ga0495629_0000772_8619_9464 281
792 3300046460 Ga0495638_0006370 Ga0495638_0006370_2204_3049 281
793 3300046461 Ga0495641_0004443 Ga0495641_0004443_7260_8105 281
794 3300046472 Ga0495580_0001324 Ga0495580_0001324_12429_13274 281
795 3300046472 Ga0495580_0029759 Ga0495580_0029759_715_1560 281
796 3300046472 Ga0495580_0063318 Ga0495580_0063318_885_1751 281
797 3300046473 Ga0495582_0000209 Ga0495582_0000209_21341_22186 281
798 3300046473 Ga0495582_0059605 Ga0495582_0059605_233_1078 281
799 3300046475 Ga0495639_0000387 Ga0495639_0000387_70_915 281
800 3300046476 Ga0495662_0000761 Ga0495662_0000761_3410_4255 281
801 3300046477 Ga0495664_0012587 Ga0495664_0012587_2482_3327 281
802 3300046477 Ga0495664_0093177 Ga0495664_0093177_134_979 281
803 3300046499 Ga0495594_0000342 Ga0495594_0000342_17517_18362 281
804 3300046507 Ga0495606_0014740 Ga0495606_0014740_3379_4224 281
805 3300046511 Ga0495608_0019186 Ga0495608_0019186_1094_1960 281
806 3300046514 Ga0495618_0008116 Ga0495618_0008116_3005_3850 281
807 3300046514 Ga0495618_0036244 Ga0495618_0036244_2186_3052 281
808 3300046516 Ga0495628_0009216 Ga0495628_0009216_2164_3009 281
809 3300046516 Ga0495628_0201524 Ga0495628_0201524_434_1300 281
810 3300046516 Ga0495628_0202193 Ga0495628_0202193_11_856 281
811 3300046517 Ga0495630_0003363 Ga0495630_0003363_8718_9563 281
812 3300046517 Ga0495630_0022815 Ga0495630_0022815_2247_3092 281
813 3300046523 Ga0495644_0026225 Ga0495644_0026225_95_940 281
814 3300046524 Ga0495648_0040010 Ga0495648_0040010_820_1665 281
815 3300046526 Ga0495666_0029720 Ga0495666_0029720_1734_2579 281
816 3300046529 Ga0495652_0033432 Ga0495652_0033432_2964_3809 281
817 3300046529 Ga0495652_0085364 Ga0495652_0085364_644_1489 281
818 3300046531 Ga0495665_0000280 Ga0495665_0000280_14460_15305 281
819 3300046533 Ga0495640_0001578 Ga0495640_0001578_2405_3250 281
820 3300046533 Ga0495640_0216550 Ga0495640_0216550_31_897 281
821 3300046536 Ga0495587_0178134 Ga0495587_0178134_347_1192 281
822 3300046543 Ga0495645_0010457 Ga0495645_0010457_225_1070 281
823 3300046543 Ga0495645_0075217 Ga0495645_0075217_920_1765 281
824 3300046543 Ga0495645_0113729 Ga0495645_0113729_594_1460 281
825 3300046557 Ga0495622_0011893 Ga0495622_0011893_1209_2054 281
826 3300046559 Ga0495667_0014422 Ga0495667_0014422_692_1558 281
827 3300046559 Ga0495667_0064231 Ga0495667_0064231_1546_2391 281
828 3300046615 Ga0495656_0082383 Ga0495656_0082383_432_1277 281
829 3300046642 Ga0495634_0000865 Ga0495634_0000865_19666_20511 281
830 3300046642 Ga0495634_0013143 Ga0495634_0013143_3893_4738 281
831 3300046642 Ga0495634_0059031 Ga0495634_0059031_244_1110 281
832 3300046663 Ga0495635_0004387 Ga0495635_0004387_3132_3977 281
833 3300046674 Ga0495588_0068193 Ga0495588_0068193_258_1103 281
834 3300046675 Ga0495657_0064940 Ga0495657_0064940_560_1426 281
835 3300046678 Ga0495599_0006315 Ga0495599_0006315_1256_2101 281
836 3300046678 Ga0495599_0110554 Ga0495599_0110554_144_989 281
837 3300046678 Ga0495599_0112341 Ga0495599_0112341_693_1538 281
838 3300046678 Ga0495599_0178968 Ga0495599_0178968_303_1169 281
839 3300046679 Ga0495623_0076303 Ga0495623_0076303_1172_2038 281
840 3300046679 Ga0495623_0150420 Ga0495623_0150420_18_863 281
841 3300046680 Ga0495646_0020456 Ga0495646_0020456_930_1775 281
842 3300046680 Ga0495646_0166663 Ga0495646_0166663_308_1153 281
843 3300046683 Ga0495658_0004391 Ga0495658_0004391_3586_4431 281
844 3300046683 Ga0495658_0008880 Ga0495658_0008880_182_1027 281
845 3300046684 Ga0495669_0005176 Ga0495669_0005176_943_1788 281
846 3300046689 Ga0495613_0003086 Ga0495613_0003086_3025_3870 281
847 3300046689 Ga0495613_0167372 Ga0495613_0167372_31_897 281
848 3300046689 Ga0495613_0323434 Ga0495613_0323434_40_885 281
849 3300046690 Ga0495624_0001082 Ga0495624_0001082_12662_13507 281
850 3300046690 Ga0495624_0096431 Ga0495624_0096431_836_1702 281
851 3300046694 Ga0495649_0043342 Ga0495649_0043342_1056_1901 281
852 3300046794 Ga0495589_0107261 Ga0495589_0107261_494_1339 281
853 3300046809 Ga0495600_0038148 Ga0495600_0038148_158_1024 281
854 3300047315 Ga0495581_0010372 Ga0495581_0010372_2528_3373 281
855 3300047315 Ga0495581_0058487 Ga0495581_0058487_988_1833 281
856 3300047319 Ga0495674_0004372 Ga0495674_0004372_11110_11955 281
857 3300047319 Ga0495674_0021149 Ga0495674_0021149_1229_2074 281
858 3300047319 Ga0495674_0024884 Ga0495674_0024884_263_1108 281
859 3300047319 Ga0495674_0100461 Ga0495674_0100461_1177_2043 281
860 3300047321 Ga0495676_0071413 Ga0495676_0071413_1746_2591 281
861 3300047321 Ga0495676_0121617 Ga0495676_0121617_934_1779 281
862 3300047322 Ga0495680_0151947 Ga0495680_0151947_130_996 281
863 3300047444 Ga0495675_0077940 Ga0495675_0077940_770_1636 281
864 3300047471 Ga0495684_0005777 Ga0495684_0005777_4734_5579 281
865 3300047472 Ga0495686_0023315 Ga0495686_0023315_852_1697 281
866 3300047673 Ga0495593_0000238 Ga0495593_0000238_8511_9356 281
867 3300047673 Ga0495593_0007681 Ga0495593_0007681_1709_2554 281
868 3300048089 Ga0495614_0028011 Ga0495614_0028011_680_1525 281
869 3300048903 Ga0496100_0071299 Ga0496100_0071299_104_1093 281
870 3300048904 Ga0496101_0023004 Ga0496101_0023004_160_1149 281
871 3300048905 Ga0496102_0055964 Ga0496102_0055964_1139_2128 281
872 3300048907 Ga0496104_0019755 Ga0496104_0019755_3719_4588 281
873 3300048907 Ga0496104_0194120 Ga0496104_0194120_252_1097 281
874 3300048908 Ga0496105_0091652 Ga0496105_0091652_1171_2016 281
875 3300048909 Ga0496106_0080265 Ga0496106_0080265_894_1763 281
876 3300048911 Ga0496108_0013227 Ga0496108_0013227_5559_6404 281
877 3300048911 Ga0496108_0023662 Ga0496108_0023662_3711_4580 281
878 3300048912 Ga0496109_0044910 Ga0496109_0044910_861_1706 281
879 3300048913 Ga0496110_0044847 Ga0496110_0044847_1411_2400 281
880 3300048915 Ga0496112_0055817 Ga0496112_0055817_468_1457 281
881 3300048915 Ga0496112_0119384 Ga0496112_0119384_920_1765 281
882 3300048915 Ga0496112_0459600 Ga0496112_0459600_51_896 281
883 3300048916 Ga0496113_0197939 Ga0496113_0197939_513_1358 281
884 3300048917 Ga0496114_0049745 Ga0496114_0049745_2298_3287 281
885 3300048917 Ga0496114_0150162 Ga0496114_0150162_622_1467 281
886 3300048918 Ga0496115_0005249 Ga0496115_0005249_6665_7654 281
887 3300048918 Ga0496115_0049447 Ga0496115_0049447_1108_1953 281
888 3300048918 Ga0496115_0131634 Ga0496115_0131634_237_1082 281
889 3300048922 Ga0496119_0031299 Ga0496119_0031299_2539_3411 281
890 3300048922 Ga0496119_0057292 Ga0496119_0057292_52_897 281
891 3300048924 Ga0496121_0001361 Ga0496121_0001361_3293_4165 281
892 3300048929 Ga0496126_0055894 Ga0496126_0055894_711_1556 281
893 3300049586 Ga0501070_0033362 Ga0501070_0033362_2987_3832 281
894 3300049741 Ga0501079_0442365 Ga0501079_0442365_13_858 281
895 3300049742 Ga0501080_0005894 Ga0501080_0005894_6640_7485 281
896 3300049823 Ga0501044_0011998 Ga0501044_0011998_576_1421 281
897 3300053077 Ga0495601_0060441 Ga0495601_0060441_762_1607 281
898 3300053077 Ga0495601_0222194 Ga0495601_0222194_342_1208 281
899 3300053078 Ga0495612_0008556 Ga0495612_0008556_587_1432 281
900 3300053085 Ga0495619_0083357 Ga0495619_0083357_324_1169 281
901 3300053088 Ga0500644_0112559 Ga0500644_0112559_132_977 281
902 3300053093 Ga0500651_0012304 Ga0500651_0012304_3594_4439 281
903 3300053102 Ga0500554_001732 Ga0500554_001732_2110_2961 281
904 3300053105 Ga0500557_000047 Ga0500557_000047_1422_2267 281
905 3300053119 Ga0500595_002385 Ga0500595_002385_8042_8914 281
906 3300053119 Ga0500595_027503 Ga0500595_027503_452_1297 281
907 3300053123 Ga0500614_049953 Ga0500614_049953_69_914 281
908 3300053134 Ga0500658_0008212 Ga0500658_0008212_1122_1967 281
909 3300053136 Ga0500559_0002659 Ga0500559_0002659_5741_6586 281
910 3300053142 Ga0500577_0014053 Ga0500577_0014053_1507_2352 281
911 3300053146 Ga0500588_0018546 Ga0500588_0018546_787_1632 281
912 3300053150 Ga0500603_000324 Ga0500603_000324_4336_5187 281
913 3300053177 Ga0500636_0045565 Ga0500636_0045565_46_891 281
914 3300053177 Ga0500636_0162117 Ga0500636_0162117_268_1113 281
915 3300053178 Ga0500637_0000582 Ga0500637_0000582_2153_3004 281
916 3300053725 Ga0500576_005569 Ga0500576_005569_3233_4078 281
917 3300053731 Ga0500609_002144 Ga0500609_002144_1075_1920 281
918 3300053737 Ga0500601_000014 Ga0500601_000014_34189_35034 281
919 3300055283 Ga0500661_001823 Ga0500661_001823_2439_3284 281
920 iso_pu_bacteria 2513237141 2513888386 281
921 iso_pu_bacteria 2885366525 2885367411 281
922 iso_pu_bacteria 2922393267 2922399304 281
923 iso_pu_bacteria 2932801729 2932803637 281
924 iso_pu_bacteria 3005483717 3005486314 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

93

233

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9177 22 241
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9162 22 241
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9146 23 241
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9058 23 241
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9034 25 241
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9648 25 267 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9493 25 267 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9309 24 259 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9234 24 259 3.40.50.300
af_Q2G1I6_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9232 24 271 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A534WP09-F1-model_v4 ABC transporter ATP-binding protein 0.96 21 272 GO:0005524
GO:0016887
AF-A0A536PA20-F1-model_v4 ABC transporter ATP-binding protein 0.9581 22 277 GO:0005524
GO:0016887
AF-A0A534UJK3-F1-model_v4 ABC transporter ATP-binding protein 0.957 24 271 GO:0005524
GO:0016887
AF-A0A1F4EWG6-F1-model_v4 ABC transporter 0.9568 21 272 GO:0005524
GO:0005886
GO:0016887
AF-A0A132MFY1-F1-model_v4 Mannosyltransferase 0.9568 24 272 GO:0005524
GO:0016757
GO:0016887

Feature Viewer

pLDDT pTM Quality
86.25 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map