F485856
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 924 | 550 | 797 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300011119|Ga0105246_10053597|Ga0105246_100535972 |
| Length | 329 |
| Sequence | MALVRLIVVGLSAQTASPTPVAFRYAPAIDLRKSRGQLFLMDCREKAGIKPLSSRPEIEVESAPTRRPAGAMIEIDRVSQIFQTSGRQNHLALSQISLTIDDGAFVAILGPSGCGKSTLLYIVGGFVNPTEGIARMKGKPIAGPGPDRGPVFQEFALFPWKTVLGNVMYGPRQLRVKSAEAEAQSRQLIEMVGLKGFEDFYPKELSGGMKQRVALARTLAYHPAVLLMDEPFGALDAHTRTRLQNDLLNIWERDRKTVLFVTHSVDEAVFLSDKVVVMTRAPGRIKEIVDINLPRPRRRADLLLDPRYQKYVVEIERMIDDTSEDGLRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 11 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 12 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 15 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 16 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 17 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 18 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 19 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 20 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 21 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 22 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 23 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 24 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 25 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 26 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 27 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 28 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 29 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 30 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 31 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 32 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 33 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 34 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 35 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 36 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 37 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 38 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 39 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 40 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 41 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 42 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 43 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 44 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 45 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 46 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 47 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 48 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 49 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 50 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 51 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 52 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 53 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 54 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 55 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 56 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 57 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 58 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 59 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 60 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 61 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 62 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 63 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 64 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 65 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 66 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 67 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 68 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 69 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 70 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 71 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 72 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 73 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 74 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 75 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 76 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 77 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 78 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 79 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 80 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 81 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 82 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 83 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 84 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 85 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 86 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 87 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 88 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 89 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 90 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 91 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 92 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 93 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 94 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 95 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 96 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 97 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 98 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 99 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 100 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 101 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 102 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 103 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 104 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 105 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 106 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 107 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 108 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 109 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 110 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 111 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 112 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 113 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 117 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 121 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 141 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 142 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 143 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 144 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 145 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 146 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 149 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 150 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 151 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 152 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 153 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 154 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 155 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 156 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 157 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 158 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 159 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 160 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 161 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 162 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 163 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 165 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 166 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 167 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 168 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 169 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 170 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 171 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 172 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 173 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 174 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 175 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 176 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 177 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 178 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 179 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 181 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 182 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 210 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 211 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 212 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 213 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 214 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 219 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 222 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 277 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 278 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 279 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 280 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 282 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 286 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 287 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 288 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 289 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 290 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 291 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 292 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 293 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 294 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 295 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 296 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 297 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 298 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 299 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 300 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 302 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 303 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 305 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 307 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 308 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 309 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 310 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 311 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 312 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 313 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 314 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 315 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 318 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 319 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 320 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 321 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 322 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 323 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 324 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 325 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 326 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 328 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 329 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 330 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 331 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 332 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 333 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 334 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 335 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 336 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 337 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 338 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 339 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 414 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 415 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 416 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 417 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 418 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 419 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 422 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 423 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 424 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 425 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 426 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 427 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 428 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 429 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 430 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 431 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 432 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 433 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 434 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 435 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 466 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 467 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 468 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 469 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 470 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 471 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 478 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 484 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 486 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 487 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 488 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 489 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 490 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 491 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 492 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 493 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 494 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 495 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 496 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 497 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 498 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 499 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 500 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 501 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 502 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 504 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 505 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 506 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 507 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 508 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 509 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 510 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 511 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 512 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 513 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 514 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 515 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 516 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 517 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 518 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 519 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 521 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 523 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 524 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 525 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 526 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 527 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 528 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 529 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 530 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 531 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 532 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 533 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 534 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 535 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 536 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 537 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 538 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 539 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 540 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 541 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 542 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 543 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 544 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 545 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 546 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 547 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 548 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 549 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 550 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.26 |
| Metatranscriptomes | 0 |
| Isolates | 13.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.39 |
| Nodule | 12.88 |
| Rhizoplane | 6.93 |
| Rhizosphere | 58.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10047256 | 3300001990 | Bacteria | 1312 |
| 2 | JGI24750J21931_1002919 | 3300002070 | Bacteria | 2046 |
| 3 | JGI25165J46597_1006259 | 3300003214 | Bacteria | 2134 |
| 4 | JGI25153J46596_10000110 | 3300003215 | Bacteria | 93591 |
| 5 | JGI25153J46596_10000161 | 3300003215 | Bacteria | 67388 |
| 6 | JGI25153J46596_10000354 | 3300003215 | Bacteria | 31788 |
| 7 | JGI25153J46596_10006394 | 3300003215 | Bacteria | 5971 |
| 8 | JGI25153J46596_10015820 | 3300003215 | Bacteria | 3052 |
| 9 | rootH1_10033771 | 3300003323 | Bacteria | 3812 |
| 10 | JGI25160J50197_1000217 | 3300003354 | Bacteria | 46375 |
| 11 | JGI25160J50197_1001256 | 3300003354 | Bacteria | 12850 |
| 12 | JGI25160J50197_1008322 | 3300003354 | Bacteria | 3960 |
| 13 | Ga0055539_1004673 | 3300003752 | Bacteria | 1818 |
| 14 | Ga0055542_1006033 | 3300003762 | Bacteria | 2641 |
| 15 | Ga0055529_1007904 | 3300003763 | Bacteria | 1428 |
| 16 | Ga0055526_1036322 | 3300003771 | Bacteria | 1309 |
| 17 | Ga0055531_10030177 | 3300003794 | Bacteria | 1828 |
| 18 | Ga0055543_1003554 | 3300004625 | Bacteria | 4523 |
| 19 | Ga0065165_1000244 | 3300005262 | Bacteria | 93411 |
| 20 | Ga0065165_1000368 | 3300005262 | Bacteria | 73904 |
| 21 | Ga0065165_1009863 | 3300005262 | Bacteria | 4213 |
| 22 | Ga0065165_1013890 | 3300005262 | Bacteria | 3164 |
| 23 | Ga0070676_10291743 | 3300005328 | Bacteria | 1102 |
| 24 | Ga0070670_100021295 | 3300005331 | Bacteria | 5577 |
| 25 | Ga0070670_100033635 | 3300005331 | Bacteria | 4415 |
| 26 | Ga0070670_100595403 | 3300005331 | Bacteria | 989 |
| 27 | Ga0070666_10138301 | 3300005335 | Bacteria | 1696 |
| 28 | Ga0070680_100074670 | 3300005336 | Bacteria | 2790 |
| 29 | Ga0070682_100089046 | 3300005337 | Bacteria | 2015 |
| 30 | Ga0070660_100413953 | 3300005339 | Bacteria | 1116 |
| 31 | Ga0070691_10022142 | 3300005341 | Bacteria | 2946 |
| 32 | Ga0070687_100117744 | 3300005343 | Bacteria | 1514 |
| 33 | Ga0070668_100019603 | 3300005347 | Bacteria | 5091 |
| 34 | Ga0070668_100037603 | 3300005347 | Bacteria | 3697 |
| 35 | Ga0070675_100437456 | 3300005354 | Bacteria | 1171 |
| 36 | Ga0070671_100014431 | 3300005355 | Bacteria | 6384 |
| 37 | Ga0070673_100025677 | 3300005364 | Bacteria | 4340 |
| 38 | Ga0070673_100185913 | 3300005364 | Bacteria | 1781 |
| 39 | Ga0070659_100011570 | 3300005366 | Bacteria | 6531 |
| 40 | Ga0070667_100042934 | 3300005367 | Bacteria | 3794 |
| 41 | Ga0070667_100088818 | 3300005367 | Bacteria | 2654 |
| 42 | Ga0070667_100359941 | 3300005367 | Bacteria | 1318 |
| 43 | Ga0070709_10003713 | 3300005434 | Bacteria | 8204 |
| 44 | Ga0070714_100035097 | 3300005435 | Bacteria | 4201 |
| 45 | Ga0070714_100304490 | 3300005435 | Bacteria | 1486 |
| 46 | Ga0070714_100451105 | 3300005435 | Bacteria | 1222 |
| 47 | Ga0070713_100040305 | 3300005436 | Bacteria | 3797 |
| 48 | Ga0070713_100052143 | 3300005436 | Bacteria | 3386 |
| 49 | Ga0070710_10000965 | 3300005437 | Bacteria | 13640 |
| 50 | Ga0070701_10005491 | 3300005438 | Bacteria | 5246 |
| 51 | Ga0070701_10038307 | 3300005438 | Bacteria | 2426 |
| 52 | Ga0070711_100002283 | 3300005439 | Bacteria | 10871 |
| 53 | Ga0070711_100042604 | 3300005439 | Bacteria | 3070 |
| 54 | Ga0070705_100022760 | 3300005440 | Bacteria | 3353 |
| 55 | Ga0070700_100042261 | 3300005441 | Bacteria | 2798 |
| 56 | Ga0070694_100357761 | 3300005444 | Bacteria | 1133 |
| 57 | Ga0070708_100065204 | 3300005445 | Bacteria | 3266 |
| 58 | Ga0070663_100161614 | 3300005455 | Bacteria | 1724 |
| 59 | Ga0070678_100012356 | 3300005456 | Bacteria | 5304 |
| 60 | Ga0070678_100054699 | 3300005456 | Bacteria | 2910 |
| 61 | Ga0070662_100005484 | 3300005457 | Bacteria | 8109 |
| 62 | Ga0070662_100017092 | 3300005457 | Bacteria | 4883 |
| 63 | Ga0070662_100084801 | 3300005457 | Bacteria | 2367 |
| 64 | Ga0070685_10207574 | 3300005466 | Bacteria | 1277 |
| 65 | Ga0070707_100021225 | 3300005468 | Bacteria | 6138 |
| 66 | Ga0070684_100028265 | 3300005535 | Bacteria | 4743 |
| 67 | Ga0070684_100047141 | 3300005535 | Bacteria | 3734 |
| 68 | Ga0068853_100071694 | 3300005539 | Bacteria | 3017 |
| 69 | Ga0068853_100145328 | 3300005539 | Bacteria | 2131 |
| 70 | Ga0070686_100087062 | 3300005544 | Bacteria | 2081 |
| 71 | Ga0070695_100199566 | 3300005545 | Bacteria | 1429 |
| 72 | Ga0070693_100083478 | 3300005547 | Bacteria | 1910 |
| 73 | Ga0070665_100020007 | 3300005548 | Bacteria | 6721 |
| 74 | Ga0068855_100038765 | 3300005563 | Bacteria | 5660 |
| 75 | Ga0068857_100096707 | 3300005577 | Bacteria | 2646 |
| 76 | Ga0068857_100248922 | 3300005577 | Bacteria | 1629 |
| 77 | Ga0068854_100009906 | 3300005578 | Bacteria | 6166 |
| 78 | Ga0068854_100161236 | 3300005578 | Bacteria | 1737 |
| 79 | Ga0068854_100394563 | 3300005578 | Bacteria | 1143 |
| 80 | Ga0068856_100121348 | 3300005614 | Bacteria | 2615 |
| 81 | Ga0068852_100001503 | 3300005616 | Bacteria | 15782 |
| 82 | Ga0068852_100257446 | 3300005616 | Bacteria | 1674 |
| 83 | Ga0068859_100123399 | 3300005617 | Bacteria | 2657 |
| 84 | Ga0068859_100358526 | 3300005617 | Bacteria | 1553 |
| 85 | Ga0068864_100396089 | 3300005618 | Bacteria | 1311 |
| 86 | Ga0068861_100040555 | 3300005719 | Bacteria | 3483 |
| 87 | Ga0068851_10037324 | 3300005834 | Bacteria | 2435 |
| 88 | Ga0068863_100044648 | 3300005841 | Bacteria | 4205 |
| 89 | Ga0068858_100069140 | 3300005842 | Bacteria | 3273 |
| 90 | Ga0068858_100343107 | 3300005842 | Bacteria | 1430 |
| 91 | Ga0068860_100082874 | 3300005843 | Bacteria | 3050 |
| 92 | Ga0068860_100143777 | 3300005843 | Bacteria | 2294 |
| 93 | Ga0068862_100017342 | 3300005844 | Bacteria | 5995 |
| 94 | Ga0068862_100070936 | 3300005844 | Bacteria | 3008 |
| 95 | Ga0081540_1031125 | 3300005983 | Bacteria | 2941 |
| 96 | Ga0081540_1063983 | 3300005983 | Bacteria | 1738 |
| 97 | Ga0081539_10000172 | 3300005985 | Bacteria | 151505 |
| 98 | Ga0070717_10070422 | 3300006028 | Bacteria | 2915 |
| 99 | Ga0070717_10070996 | 3300006028 | Bacteria | 2903 |
| 100 | Ga0075365_10007549 | 3300006038 | Bacteria | 6104 |
| 101 | Ga0075365_10105746 | 3300006038 | Bacteria | 1931 |
| 102 | Ga0075365_10129215 | 3300006038 | Bacteria | 1747 |
| 103 | Ga0075368_10000322 | 3300006042 | Bacteria | 14006 |
| 104 | Ga0075368_10039184 | 3300006042 | Bacteria | 1857 |
| 105 | Ga0075363_100001208 | 3300006048 | Bacteria | 9534 |
| 106 | Ga0075364_10015940 | 3300006051 | Bacteria | 4666 |
| 107 | Ga0075364_10037918 | 3300006051 | Bacteria | 3122 |
| 108 | Ga0075364_10269687 | 3300006051 | Bacteria | 1158 |
| 109 | Ga0075362_10052520 | 3300006177 | Bacteria | 1827 |
| 110 | Ga0075362_10080859 | 3300006177 | Bacteria | 1498 |
| 111 | Ga0075367_10004226 | 3300006178 | Bacteria | 6973 |
| 112 | Ga0075367_10085174 | 3300006178 | Bacteria | 1918 |
| 113 | Ga0075369_10005952 | 3300006186 | Bacteria | 4589 |
| 114 | Ga0075369_10014616 | 3300006186 | Bacteria | 3140 |
| 115 | Ga0075369_10021350 | 3300006186 | Bacteria | 2660 |
| 116 | Ga0075366_10002088 | 3300006195 | Bacteria | 10148 |
| 117 | Ga0075366_10008073 | 3300006195 | Bacteria | 5834 |
| 118 | Ga0075366_10067769 | 3300006195 | Bacteria | 2124 |
| 119 | Ga0075370_10003222 | 3300006353 | Bacteria | 7724 |
| 120 | Ga0075370_10026189 | 3300006353 | Bacteria | 3230 |
| 121 | Ga0075370_10073793 | 3300006353 | Bacteria | 1955 |
| 122 | Ga0075428_100000390 | 3300006844 | Bacteria | 43360 |
| 123 | Ga0075428_100141581 | 3300006844 | Bacteria | 2615 |
| 124 | Ga0075430_100037274 | 3300006846 | Bacteria | 4122 |
| 125 | Ga0075431_100000003 | 3300006847 | Bacteria | 112884 |
| 126 | Ga0075431_100128497 | 3300006847 | Bacteria | 2615 |
| 127 | Ga0075434_100072569 | 3300006871 | Bacteria | 3434 |
| 128 | Ga0075429_100000288 | 3300006880 | Bacteria | 35542 |
| 129 | Ga0068865_100015129 | 3300006881 | Bacteria | 4916 |
| 130 | Ga0068865_100072834 | 3300006881 | Bacteria | 2441 |
| 131 | Ga0097620_100123397 | 3300006931 | Bacteria | 2657 |
| 132 | Ga0097620_100358551 | 3300006931 | Bacteria | 1553 |
| 133 | Ga0099825_1036759 | 3300006941 | Bacteria | 1663 |
| 134 | Ga0099795_10003727 | 3300007788 | Bacteria | 3821 |
| 135 | Ga0105240_10008478 | 3300009093 | Bacteria | 14699 |
| 136 | Ga0105240_10043555 | 3300009093 | Bacteria | 5710 |
| 137 | Ga0105240_10331132 | 3300009093 | Bacteria | 1733 |
| 138 | Ga0111539_10000753 | 3300009094 | Bacteria | 42119 |
| 139 | Ga0105245_10129742 | 3300009098 | Bacteria | 2364 |
| 140 | Ga0105245_10240730 | 3300009098 | Bacteria | 1754 |
| 141 | Ga0105247_10100100 | 3300009101 | Bacteria | 1852 |
| 142 | Ga0114129_10000104 | 3300009147 | Bacteria | 83195 |
| 143 | Ga0114129_10370903 | 3300009147 | Bacteria | 1892 |
| 144 | Ga0105243_10052979 | 3300009148 | Bacteria | 3217 |
| 145 | Ga0105243_10148988 | 3300009148 | Bacteria | 2005 |
| 146 | Ga0105241_10057857 | 3300009174 | Bacteria | 2975 |
| 147 | Ga0105241_10061812 | 3300009174 | Bacteria | 2885 |
| 148 | Ga0105241_10397027 | 3300009174 | Bacteria | 1209 |
| 149 | Ga0105241_10418924 | 3300009174 | Bacteria | 1178 |
| 150 | Ga0105242_10398197 | 3300009176 | Bacteria | 1284 |
| 151 | Ga0105248_10831608 | 3300009177 | Bacteria | 1042 |
| 152 | Ga0105237_10000892 | 3300009545 | Bacteria | 40254 |
| 153 | Ga0105237_10186583 | 3300009545 | Bacteria | 2074 |
| 154 | Ga0105238_10085834 | 3300009551 | Bacteria | 3135 |
| 155 | Ga0105238_10279083 | 3300009551 | Bacteria | 1652 |
| 156 | Ga0105238_10719310 | 3300009551 | Bacteria | 1011 |
| 157 | Ga0105249_10033690 | 3300009553 | Bacteria | 4638 |
| 158 | Ga0105239_10007059 | 3300010375 | Bacteria | 12929 |
| 159 | Ga0105239_10072876 | 3300010375 | Bacteria | 3776 |
| 160 | Ga0105239_10202107 | 3300010375 | Bacteria | 2226 |
| 161 | Ga0105239_10317568 | 3300010375 | Bacteria | 1756 |
| 162 | Ga0105239_10347262 | 3300010375 | Bacteria | 1675 |
| 163 | Ga0105239_10506852 | 3300010375 | Bacteria | 1372 |
| 164 | Ga0105239_10631346 | 3300010375 | Bacteria | 1223 |
| 165 | Ga0105246_10003773 | 3300011119 | Bacteria | 9185 |
| 166 | Ga0105246_10053597 | 3300011119 | Bacteria | 2776 |
| 167 | Ga0157373_10115006 | 3300013100 | Bacteria | 1891 |
| 168 | Ga0157371_10000045 | 3300013102 | Bacteria | 189065 |
| 169 | Ga0157370_10070803 | 3300013104 | Bacteria | 3291 |
| 170 | Ga0157370_10167330 | 3300013104 | Bacteria | 2044 |
| 171 | Ga0157369_10020698 | 3300013105 | Bacteria | 7355 |
| 172 | Ga0157369_10272403 | 3300013105 | Bacteria | 1764 |
| 173 | Ga0157374_10013038 | 3300013296 | Bacteria | 7248 |
| 174 | Ga0157374_10391529 | 3300013296 | Bacteria | 1385 |
| 175 | Ga0157378_10027386 | 3300013297 | Bacteria | 5030 |
| 176 | Ga0157378_10077940 | 3300013297 | Bacteria | 2988 |
| 177 | Ga0157378_10694039 | 3300013297 | Bacteria | 1037 |
| 178 | Ga0157378_10845598 | 3300013297 | Bacteria | 943 |
| 179 | Ga0163162_10027385 | 3300013306 | Bacteria | 5636 |
| 180 | Ga0163162_10068700 | 3300013306 | Bacteria | 3595 |
| 181 | Ga0157375_10142753 | 3300013308 | Bacteria | 2523 |
| 182 | Ga0163163_10007495 | 3300014325 | Bacteria | 9632 |
| 183 | Ga0163163_10148931 | 3300014325 | Bacteria | 2385 |
| 184 | Ga0157380_10036188 | 3300014326 | Bacteria | 3818 |
| 185 | Ga0157379_10341503 | 3300014968 | Bacteria | 1370 |
| 186 | Ga0157376_10024205 | 3300014969 | Bacteria | 4764 |
| 187 | Ga0157376_10250098 | 3300014969 | Bacteria | 1655 |
| 188 | Ga0163161_10015068 | 3300017792 | Bacteria | 5389 |
| 189 | Ga0163161_10102631 | 3300017792 | Bacteria | 2130 |
| 190 | Ga0214542_1003337 | 3300021321 | Bacteria | 32859 |
| 191 | Ga0214545_1000028 | 3300021324 | Bacteria | 127957 |
| 192 | Ga0214543_1000044 | 3300021327 | Bacteria | 158132 |
| 193 | Ga0213876_10000471 | 3300021384 | Bacteria | 32066 |
| 194 | Ga0213876_10225062 | 3300021384 | Bacteria | 997 |
| 195 | Ga0213875_10052511 | 3300021388 | Bacteria | 1909 |
| 196 | Ga0209677_101161 | 3300025253 | Bacteria | 12191 |
| 197 | Ga0209148_1000224 | 3300025254 | Bacteria | 92967 |
| 198 | Ga0209233_1003000 | 3300025261 | Bacteria | 6013 |
| 199 | Ga0209233_1006852 | 3300025261 | Bacteria | 3644 |
| 200 | Ga0209455_1000635 | 3300025272 | Bacteria | 21604 |
| 201 | Ga0209673_1031815 | 3300025273 | Bacteria | 1635 |
| 202 | Ga0209564_1002670 | 3300025295 | Bacteria | 13535 |
| 203 | Ga0209564_1007718 | 3300025295 | Bacteria | 5478 |
| 204 | Ga0209564_1012359 | 3300025295 | Bacteria | 3729 |
| 205 | Ga0209758_1000075 | 3300025297 | Bacteria | 271585 |
| 206 | Ga0209758_1000087 | 3300025297 | Bacteria | 254384 |
| 207 | Ga0209758_1001472 | 3300025297 | Bacteria | 27590 |
| 208 | Ga0209758_1003696 | 3300025297 | Bacteria | 13586 |
| 209 | Ga0209758_1006857 | 3300025297 | Bacteria | 7967 |
| 210 | Ga0209758_1027008 | 3300025297 | Bacteria | 2466 |
| 211 | Ga0209256_1022668 | 3300025299 | Bacteria | 1894 |
| 212 | Ga0209256_1039435 | 3300025299 | Bacteria | 1214 |
| 213 | Ga0207426_1000289 | 3300025302 | Bacteria | 99963 |
| 214 | Ga0207426_1000312 | 3300025302 | Bacteria | 95006 |
| 215 | Ga0207426_1006711 | 3300025302 | Bacteria | 4937 |
| 216 | Ga0209257_1000382 | 3300025304 | Bacteria | 88368 |
| 217 | Ga0207697_10054827 | 3300025315 | Bacteria | 1652 |
| 218 | Ga0207656_10103697 | 3300025321 | Bacteria | 1306 |
| 219 | Ga0207642_10001994 | 3300025899 | Bacteria | 6295 |
| 220 | Ga0207710_10010271 | 3300025900 | Bacteria | 3940 |
| 221 | Ga0207710_10020294 | 3300025900 | Bacteria | 2840 |
| 222 | Ga0207688_10003242 | 3300025901 | Bacteria | 8884 |
| 223 | Ga0207680_10138245 | 3300025903 | Bacteria | 1613 |
| 224 | Ga0207680_10332396 | 3300025903 | Bacteria | 1064 |
| 225 | Ga0207647_10006477 | 3300025904 | Bacteria | 8509 |
| 226 | Ga0207699_10018815 | 3300025906 | Bacteria | 3668 |
| 227 | Ga0207645_10075123 | 3300025907 | Bacteria | 2163 |
| 228 | Ga0207705_10075667 | 3300025909 | Bacteria | 2446 |
| 229 | Ga0207705_10136706 | 3300025909 | Bacteria | 1828 |
| 230 | Ga0207654_10030151 | 3300025911 | Bacteria | 2975 |
| 231 | Ga0207654_10032141 | 3300025911 | Bacteria | 2896 |
| 232 | Ga0207654_10049902 | 3300025911 | Bacteria | 2403 |
| 233 | Ga0207654_10166276 | 3300025911 | Bacteria | 1429 |
| 234 | Ga0207707_10003822 | 3300025912 | Bacteria | 13339 |
| 235 | Ga0207707_10164933 | 3300025912 | Bacteria | 1936 |
| 236 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 237 | Ga0207671_10005341 | 3300025914 | Bacteria | 11889 |
| 238 | Ga0207671_10145289 | 3300025914 | Bacteria | 1829 |
| 239 | Ga0207671_10263917 | 3300025914 | Bacteria | 1356 |
| 240 | Ga0207660_10010800 | 3300025917 | Bacteria | 5934 |
| 241 | Ga0207660_10065273 | 3300025917 | Bacteria | 2630 |
| 242 | Ga0207660_10108606 | 3300025917 | Bacteria | 2084 |
| 243 | Ga0207662_10112221 | 3300025918 | Bacteria | 1701 |
| 244 | Ga0207657_10026833 | 3300025919 | Bacteria | 5285 |
| 245 | Ga0207657_10069651 | 3300025919 | Bacteria | 2984 |
| 246 | Ga0207649_10192398 | 3300025920 | Bacteria | 1436 |
| 247 | Ga0207646_10066283 | 3300025922 | Bacteria | 3223 |
| 248 | Ga0207694_10232787 | 3300025924 | Bacteria | 1505 |
| 249 | Ga0207650_10013164 | 3300025925 | Bacteria | 5726 |
| 250 | Ga0207650_10051907 | 3300025925 | Bacteria | 3036 |
| 251 | Ga0207659_10306089 | 3300025926 | Bacteria | 1307 |
| 252 | Ga0207687_10112481 | 3300025927 | Bacteria | 2024 |
| 253 | Ga0207700_10014312 | 3300025928 | Bacteria | 5195 |
| 254 | Ga0207664_10153066 | 3300025929 | Bacteria | 1961 |
| 255 | Ga0207644_10068376 | 3300025931 | Bacteria | 2591 |
| 256 | Ga0207644_10147179 | 3300025931 | Bacteria | 1819 |
| 257 | Ga0207690_10083625 | 3300025932 | Bacteria | 2235 |
| 258 | Ga0207706_10002137 | 3300025933 | Bacteria | 19347 |
| 259 | Ga0207706_10019725 | 3300025933 | Bacteria | 6065 |
| 260 | Ga0207706_10021973 | 3300025933 | Bacteria | 5727 |
| 261 | Ga0207709_10051024 | 3300025935 | Bacteria | 2533 |
| 262 | Ga0207709_10059697 | 3300025935 | Bacteria | 2375 |
| 263 | Ga0207704_10059412 | 3300025938 | Bacteria | 2360 |
| 264 | Ga0207691_10025691 | 3300025940 | Bacteria | 5527 |
| 265 | Ga0207711_10084395 | 3300025941 | Bacteria | 2780 |
| 266 | Ga0207689_10017173 | 3300025942 | Bacteria | 6125 |
| 267 | Ga0207661_10024749 | 3300025944 | Bacteria | 4554 |
| 268 | Ga0207661_10123932 | 3300025944 | Bacteria | 2204 |
| 269 | Ga0207667_10135137 | 3300025949 | Bacteria | 2539 |
| 270 | Ga0207667_10194874 | 3300025949 | Bacteria | 2079 |
| 271 | Ga0207667_10307621 | 3300025949 | Bacteria | 1619 |
| 272 | Ga0207651_10031260 | 3300025960 | Bacteria | 3401 |
| 273 | Ga0207712_10035474 | 3300025961 | Bacteria | 3389 |
| 274 | Ga0207668_10096171 | 3300025972 | Bacteria | 2188 |
| 275 | Ga0207668_10208796 | 3300025972 | Bacteria | 1560 |
| 276 | Ga0207668_10351573 | 3300025972 | Bacteria | 1232 |
| 277 | Ga0207640_10006486 | 3300025981 | Bacteria | 6425 |
| 278 | Ga0207640_10122726 | 3300025981 | Bacteria | 1864 |
| 279 | Ga0207640_10342175 | 3300025981 | Bacteria | 1198 |
| 280 | Ga0207658_10108791 | 3300025986 | Bacteria | 2187 |
| 281 | Ga0207677_10080977 | 3300026023 | Bacteria | 2328 |
| 282 | Ga0207639_10092498 | 3300026041 | Bacteria | 2424 |
| 283 | Ga0207639_10248368 | 3300026041 | Bacteria | 1550 |
| 284 | Ga0207639_10269424 | 3300026041 | Bacteria | 1493 |
| 285 | Ga0207639_10446571 | 3300026041 | Bacteria | 1173 |
| 286 | Ga0207678_10008862 | 3300026067 | Bacteria | 8859 |
| 287 | Ga0207678_10011915 | 3300026067 | Bacteria | 7636 |
| 288 | Ga0207678_10036408 | 3300026067 | Bacteria | 4283 |
| 289 | Ga0207708_10011033 | 3300026075 | Bacteria | 6718 |
| 290 | Ga0207708_10049107 | 3300026075 | Bacteria | 3212 |
| 291 | Ga0207702_10001454 | 3300026078 | Bacteria | 23549 |
| 292 | Ga0207702_10065504 | 3300026078 | Bacteria | 3112 |
| 293 | Ga0207702_10102151 | 3300026078 | Bacteria | 2533 |
| 294 | Ga0207641_10403403 | 3300026088 | Bacteria | 1313 |
| 295 | Ga0207641_10562760 | 3300026088 | Bacteria | 1113 |
| 296 | Ga0207648_10006963 | 3300026089 | Bacteria | 11191 |
| 297 | Ga0207648_10037025 | 3300026089 | Bacteria | 4297 |
| 298 | Ga0207676_10053568 | 3300026095 | Bacteria | 3158 |
| 299 | Ga0207674_10053974 | 3300026116 | Bacteria | 4094 |
| 300 | Ga0207674_10079178 | 3300026116 | Bacteria | 3291 |
| 301 | Ga0207674_10162957 | 3300026116 | Bacteria | 2184 |
| 302 | Ga0207675_100061684 | 3300026118 | Bacteria | 3500 |
| 303 | Ga0207683_10017919 | 3300026121 | Bacteria | 6039 |
| 304 | Ga0207698_10018315 | 3300026142 | Bacteria | 4769 |
| 305 | Ga0207698_10199788 | 3300026142 | Bacteria | 1789 |
| 306 | Ga0209389_1000137 | 3300027296 | Bacteria | 63287 |
| 307 | Ga0209389_1000353 | 3300027296 | Bacteria | 27634 |
| 308 | Ga0209589_1003439 | 3300027357 | Bacteria | 27634 |
| 309 | Ga0209489_100192 | 3300027361 | Bacteria | 98028 |
| 310 | Ga0209489_107326 | 3300027361 | Bacteria | 16591 |
| 311 | Ga0209489_107331 | 3300027361 | Bacteria | 16585 |
| 312 | Ga0209700_100046 | 3300027363 | Bacteria | 159296 |
| 313 | Ga0209813_10003308 | 3300027866 | Bacteria | 3766 |
| 314 | Ga0207428_10000831 | 3300027907 | Bacteria | 34817 |
| 315 | Ga0268266_10003426 | 3300028379 | Bacteria | 15859 |
| 316 | Ga0268266_10396811 | 3300028379 | Bacteria | 1304 |
| 317 | Ga0268265_10023655 | 3300028380 | Bacteria | 4334 |
| 318 | Ga0268265_10433197 | 3300028380 | Bacteria | 1224 |
| 319 | Ga0268264_10108091 | 3300028381 | Bacteria | 2431 |
| 320 | Ga0268264_10114295 | 3300028381 | Bacteria | 2369 |
| 321 | Ga0265319_1002640 | 3300028563 | Bacteria | 9640 |
| 322 | Ga0265334_10000410 | 3300028573 | Bacteria | 22501 |
| 323 | Ga0265334_10018447 | 3300028573 | Bacteria | 2877 |
| 324 | Ga0265323_10000658 | 3300028653 | Bacteria | 18872 |
| 325 | Ga0265336_10000063 | 3300028666 | Bacteria | 98413 |
| 326 | Ga0265338_10000154 | 3300028800 | Bacteria | 125708 |
| 327 | Ga0265324_10008680 | 3300029957 | Bacteria | 4019 |
| 328 | Ga0265330_10050451 | 3300031235 | Bacteria | 1825 |
| 329 | Ga0265330_10058176 | 3300031235 | Bacteria | 1685 |
| 330 | Ga0265330_10088551 | 3300031235 | Bacteria | 1330 |
| 331 | Ga0265328_10093835 | 3300031239 | Bacteria | 1109 |
| 332 | Ga0265325_10039166 | 3300031241 | Bacteria | 2497 |
| 333 | Ga0265340_10017726 | 3300031247 | Bacteria | 3683 |
| 334 | Ga0265316_10081073 | 3300031344 | Bacteria | 2488 |
| 335 | Ga0307508_10073310 | 3300031616 | Bacteria | 2999 |
| 336 | Ga0307508_10183016 | 3300031616 | Bacteria | 1698 |
| 337 | Ga0307508_10243060 | 3300031616 | Bacteria | 1397 |
| 338 | Ga0307516_10056982 | 3300031730 | Bacteria | 3808 |
| 339 | Ga0307412_10016383 | 3300031911 | Bacteria | 4415 |
| 340 | Ga0307510_10024769 | 3300033180 | Bacteria | 6930 |
| 341 | Ga0373934_0043616 | 3300035086 | Bacteria | 1772 |
| 342 | Ga0373951_0038484 | 3300035091 | Bacteria | 1147 |
| 343 | Ga0373936_0001079 | 3300035113 | Bacteria | 9758 |
| 344 | Ga0373945_0008170 | 3300035116 | Bacteria | 3403 |
| 345 | Ga0373945_0014499 | 3300035116 | Bacteria | 2642 |
| 346 | Ga0373954_0029065 | 3300035118 | Bacteria | 2544 |
| 347 | Ga0373956_0064226 | 3300035119 | Bacteria | 1666 |
| 348 | Ga0373943_0003024 | 3300035170 | Bacteria | 7636 |
| 349 | Ga0373943_0005006 | 3300035170 | Bacteria | 5977 |
| 350 | Ga0373943_0112598 | 3300035170 | Bacteria | 1437 |
| 351 | Ga0373946_0001257 | 3300035171 | Bacteria | 8767 |
| 352 | Ga0373946_0006955 | 3300035171 | Bacteria | 4121 |
| 353 | Ga0373955_0062635 | 3300035172 | Bacteria | 2057 |
| 354 | Ga0373962_0009749 | 3300035242 | Bacteria | 2385 |
| 355 | Ga0373924_0059079 | 3300035410 | Bacteria | 1601 |
| 356 | Ga0373935_0000494 | 3300035692 | Bacteria | 20439 |
| 357 | Ga0373935_0015948 | 3300035692 | Bacteria | 4547 |
| 358 | Ga0373935_0026690 | 3300035692 | Bacteria | 3567 |
| 359 | Ga0373927_0002352 | 3300035695 | Bacteria | 13783 |
| 360 | Ga0373927_0003247 | 3300035695 | Bacteria | 11701 |
| 361 | Ga0373927_0010188 | 3300035695 | Bacteria | 6282 |
| 362 | Ga0373927_0025356 | 3300035695 | Bacteria | 3876 |
| 363 | Ga0373927_0074932 | 3300035695 | Bacteria | 2191 |
| 364 | Ga0373933_0046219 | 3300035724 | Bacteria | 2584 |
| 365 | Ga0373933_0091492 | 3300035724 | Bacteria | 1877 |
| 366 | Ga0373947_0002117 | 3300035725 | Bacteria | 12102 |
| 367 | Ga0373947_0002364 | 3300035725 | Bacteria | 11398 |
| 368 | Ga0373947_0018954 | 3300035725 | Bacteria | 3964 |
| 369 | Ga0373947_0019786 | 3300035725 | Bacteria | 3884 |
| 370 | Ga0373947_0287589 | 3300035725 | Bacteria | 1094 |
| 371 | Ga0373937_0037849 | 3300036401 | Bacteria | 4397 |
| 372 | Ga0373925_0007070 | 3300037068 | Bacteria | 8203 |
| 373 | Ga0373925_0010310 | 3300037068 | Bacteria | 6779 |
| 374 | Ga0373925_0073183 | 3300037068 | Bacteria | 2593 |
| 375 | Ga0373925_0123949 | 3300037068 | Bacteria | 2008 |
| 376 | Ga0373925_0380911 | 3300037068 | Bacteria | 1149 |
| 377 | Ga0395899_0039215 | 3300037312 | Bacteria | 3547 |
| 378 | Ga0395900_0000943 | 3300037418 | Bacteria | 37925 |
| 379 | Ga0395900_0515441 | 3300037418 | Bacteria | 1144 |
| 380 | Ga0395898_0002974 | 3300037466 | Bacteria | 19263 |
| 381 | Ga0395898_0022540 | 3300037466 | Bacteria | 6377 |
| 382 | Ga0395905_0021852 | 3300037471 | Bacteria | 6052 |
| 383 | Ga0436364_1135391 | 3300037853 | Bacteria | 2481 |
| 384 | Ga0395901_0001973 | 3300038443 | Bacteria | 21111 |
| 385 | Ga0395901_0376376 | 3300038443 | Bacteria | 1462 |
| 386 | Ga0436365_0858635 | 3300039437 | Bacteria | 1054 |
| 387 | Ga0436361_0394385 | 3300039447 | Bacteria | 2403 |
| 388 | Ga0436362_0891589 | 3300039453 | Bacteria | 1323 |
| 389 | Ga0451800_0227374 | 3300041459 | Bacteria | 1628 |
| 390 | Ga0451843_0945699 | 3300041509 | Bacteria | 1479 |
| 391 | Ga0451855_1012932 | 3300041511 | Bacteria | 1545 |
| 392 | Ga0466969_0023413 | 3300044656 | Bacteria | 3183 |
| 393 | Ga0466969_0121896 | 3300044656 | Bacteria | 1213 |
| 394 | Ga0466972_0001101 | 3300044658 | Bacteria | 12925 |
| 395 | Ga0466972_0036902 | 3300044658 | Bacteria | 2389 |
| 396 | Ga0466966_0000707 | 3300044684 | Bacteria | 21128 |
| 397 | Ga0466961_0000029 | 3300044693 | Bacteria | 86710 |
| 398 | Ga0466961_0036986 | 3300044693 | Bacteria | 3133 |
| 399 | Ga0466963_0056092 | 3300044694 | Bacteria | 2621 |
| 400 | Ga0466968_0019728 | 3300044735 | Bacteria | 2716 |
| 401 | Ga0466968_0099649 | 3300044735 | Bacteria | 1296 |
| 402 | Ga0466970_0221241 | 3300044765 | Bacteria | 1057 |
| 403 | Ga0466960_0071300 | 3300044901 | Bacteria | 1730 |
| 404 | Ga0466959_0018100 | 3300045049 | Bacteria | 5170 |
| 405 | Ga0466959_0044416 | 3300045049 | Bacteria | 3274 |
| 406 | Ga0466967_0002064 | 3300045976 | Bacteria | 12276 |
| 407 | Ga0466967_0140178 | 3300045976 | Bacteria | 2251 |
| 408 | Ga0495592_0006647 | 3300046454 | Bacteria | 8621 |
| 409 | Ga0495592_0096806 | 3300046454 | Bacteria | 2109 |
| 410 | Ga0495603_0000237 | 3300046455 | Bacteria | 28782 |
| 411 | Ga0495603_0003340 | 3300046455 | Bacteria | 9561 |
| 412 | Ga0495603_0007156 | 3300046455 | Bacteria | 6700 |
| 413 | Ga0495603_0015322 | 3300046455 | Bacteria | 4639 |
| 414 | Ga0495590_0089336 | 3300046457 | Bacteria | 1089 |
| 415 | Ga0495629_0000772 | 3300046459 | Bacteria | 25859 |
| 416 | Ga0495629_0048422 | 3300046459 | Bacteria | 2979 |
| 417 | Ga0495629_0158850 | 3300046459 | Bacteria | 1570 |
| 418 | Ga0495638_0006370 | 3300046460 | Bacteria | 8597 |
| 419 | Ga0495638_0230158 | 3300046460 | Bacteria | 1031 |
| 420 | Ga0495641_0004443 | 3300046461 | Bacteria | 9917 |
| 421 | Ga0495641_0007549 | 3300046461 | Bacteria | 6772 |
| 422 | Ga0495651_0066159 | 3300046462 | Bacteria | 2759 |
| 423 | Ga0495651_0196308 | 3300046462 | Bacteria | 1416 |
| 424 | Ga0495651_0256636 | 3300046462 | Bacteria | 1191 |
| 425 | Ga0495580_0001324 | 3300046472 | Bacteria | 21841 |
| 426 | Ga0495580_0029759 | 3300046472 | Bacteria | 3961 |
| 427 | Ga0495580_0063318 | 3300046472 | Bacteria | 2594 |
| 428 | Ga0495582_0000209 | 3300046473 | Bacteria | 32511 |
| 429 | Ga0495582_0059605 | 3300046473 | Bacteria | 2105 |
| 430 | Ga0495639_0000387 | 3300046475 | Bacteria | 20931 |
| 431 | Ga0495662_0000761 | 3300046476 | Bacteria | 15509 |
| 432 | Ga0495662_0031327 | 3300046476 | Bacteria | 2569 |
| 433 | Ga0495664_0012587 | 3300046477 | Bacteria | 4795 |
| 434 | Ga0495664_0093177 | 3300046477 | Bacteria | 1812 |
| 435 | Ga0495664_0208401 | 3300046477 | Bacteria | 1184 |
| 436 | Ga0495585_0072766 | 3300046492 | Bacteria | 1872 |
| 437 | Ga0495594_0000342 | 3300046499 | Bacteria | 23227 |
| 438 | Ga0495594_0011612 | 3300046499 | Bacteria | 4581 |
| 439 | Ga0495607_0159390 | 3300046501 | Bacteria | 1148 |
| 440 | Ga0495583_0059082 | 3300046506 | Bacteria | 1720 |
| 441 | Ga0495606_0008906 | 3300046507 | Bacteria | 8596 |
| 442 | Ga0495606_0014740 | 3300046507 | Bacteria | 6074 |
| 443 | Ga0495606_0113595 | 3300046507 | Bacteria | 1630 |
| 444 | Ga0495608_0019186 | 3300046511 | Bacteria | 4709 |
| 445 | Ga0495616_0031901 | 3300046513 | Bacteria | 2756 |
| 446 | Ga0495616_0047449 | 3300046513 | Bacteria | 2163 |
| 447 | Ga0495618_0008116 | 3300046514 | Bacteria | 6358 |
| 448 | Ga0495618_0036244 | 3300046514 | Bacteria | 3095 |
| 449 | Ga0495628_0009216 | 3300046516 | Bacteria | 8436 |
| 450 | Ga0495628_0201524 | 3300046516 | Bacteria | 1499 |
| 451 | Ga0495628_0202193 | 3300046516 | Bacteria | 1496 |
| 452 | Ga0495630_0003363 | 3300046517 | Bacteria | 11134 |
| 453 | Ga0495630_0022815 | 3300046517 | Bacteria | 4623 |
| 454 | Ga0495630_0091537 | 3300046517 | Bacteria | 2298 |
| 455 | Ga0495631_0095918 | 3300046518 | Bacteria | 1277 |
| 456 | Ga0495631_0097113 | 3300046518 | Bacteria | 1268 |
| 457 | Ga0495643_0010018 | 3300046522 | Bacteria | 5850 |
| 458 | Ga0495644_0016750 | 3300046523 | Bacteria | 2805 |
| 459 | Ga0495644_0026225 | 3300046523 | Bacteria | 2212 |
| 460 | Ga0495648_0011360 | 3300046524 | Bacteria | 6710 |
| 461 | Ga0495648_0040010 | 3300046524 | Bacteria | 2977 |
| 462 | Ga0495663_0054520 | 3300046525 | Bacteria | 1245 |
| 463 | Ga0495666_0029720 | 3300046526 | Bacteria | 2688 |
| 464 | Ga0495652_0033432 | 3300046529 | Bacteria | 4490 |
| 465 | Ga0495652_0044830 | 3300046529 | Bacteria | 3806 |
| 466 | Ga0495652_0085364 | 3300046529 | Bacteria | 2594 |
| 467 | Ga0495665_0000280 | 3300046531 | Bacteria | 25894 |
| 468 | Ga0495665_0211823 | 3300046531 | Bacteria | 1003 |
| 469 | Ga0495640_0001578 | 3300046533 | Bacteria | 17975 |
| 470 | Ga0495640_0123125 | 3300046533 | Bacteria | 1684 |
| 471 | Ga0495640_0216550 | 3300046533 | Bacteria | 1209 |
| 472 | Ga0495587_0142531 | 3300046536 | Bacteria | 1367 |
| 473 | Ga0495587_0178134 | 3300046536 | Bacteria | 1206 |
| 474 | Ga0495598_0018203 | 3300046537 | Bacteria | 1822 |
| 475 | Ga0495598_0018384 | 3300046537 | Bacteria | 1817 |
| 476 | Ga0495645_0010457 | 3300046543 | Bacteria | 6505 |
| 477 | Ga0495645_0075217 | 3300046543 | Bacteria | 2431 |
| 478 | Ga0495645_0113729 | 3300046543 | Bacteria | 1913 |
| 479 | Ga0495622_0011893 | 3300046557 | Bacteria | 4025 |
| 480 | Ga0495622_0023222 | 3300046557 | Bacteria | 2891 |
| 481 | Ga0495667_0014422 | 3300046559 | Bacteria | 5339 |
| 482 | Ga0495667_0064231 | 3300046559 | Bacteria | 2401 |
| 483 | Ga0495667_0345794 | 3300046559 | Bacteria | 940 |
| 484 | Ga0495656_0082383 | 3300046615 | Bacteria | 1454 |
| 485 | Ga0495656_0244906 | 3300046615 | Bacteria | 904 |
| 486 | Ga0495668_0115329 | 3300046616 | Bacteria | 1469 |
| 487 | Ga0495668_0243383 | 3300046616 | Bacteria | 985 |
| 488 | Ga0495634_0000865 | 3300046642 | Bacteria | 29129 |
| 489 | Ga0495634_0013143 | 3300046642 | Bacteria | 5981 |
| 490 | Ga0495634_0059031 | 3300046642 | Bacteria | 2556 |
| 491 | Ga0495634_0241365 | 3300046642 | Bacteria | 1108 |
| 492 | Ga0495625_0164363 | 3300046660 | Bacteria | 1485 |
| 493 | Ga0495635_0003213 | 3300046663 | Bacteria | 11263 |
| 494 | Ga0495635_0004387 | 3300046663 | Bacteria | 9772 |
| 495 | Ga0495635_0085602 | 3300046663 | Bacteria | 2157 |
| 496 | Ga0495659_0055866 | 3300046664 | Bacteria | 1448 |
| 497 | Ga0495661_0221850 | 3300046665 | Bacteria | 979 |
| 498 | Ga0495588_0036213 | 3300046674 | Bacteria | 2503 |
| 499 | Ga0495588_0068193 | 3300046674 | Bacteria | 1847 |
| 500 | Ga0495588_0083379 | 3300046674 | Bacteria | 1670 |
| 501 | Ga0495657_0011035 | 3300046675 | Bacteria | 6774 |
| 502 | Ga0495657_0064940 | 3300046675 | Bacteria | 2401 |
| 503 | Ga0495657_0113788 | 3300046675 | Bacteria | 1711 |
| 504 | Ga0495599_0006315 | 3300046678 | Bacteria | 7144 |
| 505 | Ga0495599_0110554 | 3300046678 | Bacteria | 1712 |
| 506 | Ga0495599_0112341 | 3300046678 | Bacteria | 1696 |
| 507 | Ga0495599_0178968 | 3300046678 | Bacteria | 1307 |
| 508 | Ga0495623_0076303 | 3300046679 | Bacteria | 2079 |
| 509 | Ga0495623_0150420 | 3300046679 | Bacteria | 1376 |
| 510 | Ga0495646_0020456 | 3300046680 | Bacteria | 4188 |
| 511 | Ga0495646_0166663 | 3300046680 | Bacteria | 1216 |
| 512 | Ga0495647_0004026 | 3300046681 | Bacteria | 4742 |
| 513 | Ga0495658_0004391 | 3300046683 | Bacteria | 6944 |
| 514 | Ga0495658_0008880 | 3300046683 | Bacteria | 4997 |
| 515 | Ga0495658_0060313 | 3300046683 | Bacteria | 2175 |
| 516 | Ga0495669_0005176 | 3300046684 | Bacteria | 5426 |
| 517 | Ga0495613_0003086 | 3300046689 | Bacteria | 12448 |
| 518 | Ga0495613_0027959 | 3300046689 | Bacteria | 4198 |
| 519 | Ga0495613_0111362 | 3300046689 | Bacteria | 1972 |
| 520 | Ga0495613_0167372 | 3300046689 | Bacteria | 1561 |
| 521 | Ga0495613_0323434 | 3300046689 | Bacteria | 1064 |
| 522 | Ga0495624_0001082 | 3300046690 | Bacteria | 21523 |
| 523 | Ga0495624_0002738 | 3300046690 | Bacteria | 13256 |
| 524 | Ga0495624_0096431 | 3300046690 | Bacteria | 1822 |
| 525 | Ga0495670_0009149 | 3300046691 | Bacteria | 4871 |
| 526 | Ga0495649_0043342 | 3300046694 | Bacteria | 2456 |
| 527 | Ga0495589_0107261 | 3300046794 | Bacteria | 1349 |
| 528 | Ga0495600_0038148 | 3300046809 | Bacteria | 3125 |
| 529 | Ga0495660_0046852 | 3300046810 | Bacteria | 2370 |
| 530 | Ga0495581_0010372 | 3300047315 | Bacteria | 5390 |
| 531 | Ga0495581_0058487 | 3300047315 | Bacteria | 2226 |
| 532 | Ga0495604_0016851 | 3300047317 | Bacteria | 5844 |
| 533 | Ga0495674_0004372 | 3300047319 | Bacteria | 13583 |
| 534 | Ga0495674_0021149 | 3300047319 | Bacteria | 6018 |
| 535 | Ga0495674_0024884 | 3300047319 | Bacteria | 5496 |
| 536 | Ga0495674_0100461 | 3300047319 | Bacteria | 2462 |
| 537 | Ga0495676_0025949 | 3300047321 | Bacteria | 5050 |
| 538 | Ga0495676_0071413 | 3300047321 | Bacteria | 2669 |
| 539 | Ga0495676_0121617 | 3300047321 | Bacteria | 1898 |
| 540 | Ga0495680_0027137 | 3300047322 | Bacteria | 4709 |
| 541 | Ga0495680_0151947 | 3300047322 | Bacteria | 1687 |
| 542 | Ga0495683_0007012 | 3300047323 | Bacteria | 6119 |
| 543 | Ga0495687_048756 | 3300047443 | Bacteria | 1814 |
| 544 | Ga0495675_0020242 | 3300047444 | Bacteria | 4230 |
| 545 | Ga0495675_0077940 | 3300047444 | Bacteria | 2087 |
| 546 | Ga0495684_0005777 | 3300047471 | Bacteria | 9626 |
| 547 | Ga0495686_0023315 | 3300047472 | Bacteria | 4084 |
| 548 | Ga0495686_0045614 | 3300047472 | Bacteria | 2772 |
| 549 | Ga0495593_0000238 | 3300047673 | Bacteria | 29664 |
| 550 | Ga0495593_0007681 | 3300047673 | Bacteria | 6293 |
| 551 | Ga0495593_0144829 | 3300047673 | Bacteria | 1203 |
| 552 | Ga0495602_0116214 | 3300048088 | Bacteria | 2162 |
| 553 | Ga0495602_0143393 | 3300048088 | Bacteria | 1888 |
| 554 | Ga0495614_0028011 | 3300048089 | Bacteria | 2429 |
| 555 | Ga0495626_0144468 | 3300048091 | Bacteria | 1007 |
| 556 | Ga0496100_0026555 | 3300048903 | Bacteria | 3551 |
| 557 | Ga0496100_0071299 | 3300048903 | Bacteria | 2319 |
| 558 | Ga0496100_0231627 | 3300048903 | Bacteria | 1359 |
| 559 | Ga0496100_0400542 | 3300048903 | Bacteria | 1045 |
| 560 | Ga0496101_0009142 | 3300048904 | Bacteria | 6504 |
| 561 | Ga0496101_0023004 | 3300048904 | Bacteria | 4299 |
| 562 | Ga0496101_0339633 | 3300048904 | Bacteria | 1179 |
| 563 | Ga0496102_0001874 | 3300048905 | Bacteria | 18120 |
| 564 | Ga0496102_0055964 | 3300048905 | Bacteria | 3597 |
| 565 | Ga0496102_0077241 | 3300048905 | Bacteria | 3064 |
| 566 | Ga0496102_0372991 | 3300048905 | Bacteria | 1343 |
| 567 | Ga0496103_0002168 | 3300048906 | Bacteria | 12474 |
| 568 | Ga0496103_0004621 | 3300048906 | Bacteria | 8335 |
| 569 | Ga0496103_0050949 | 3300048906 | Bacteria | 2562 |
| 570 | Ga0496103_0083548 | 3300048906 | Bacteria | 2010 |
| 571 | Ga0496104_0019755 | 3300048907 | Bacteria | 6168 |
| 572 | Ga0496104_0092498 | 3300048907 | Bacteria | 2892 |
| 573 | Ga0496104_0194120 | 3300048907 | Bacteria | 1942 |
| 574 | Ga0496104_0211558 | 3300048907 | Bacteria | 1851 |
| 575 | Ga0496105_0005120 | 3300048908 | Bacteria | 9938 |
| 576 | Ga0496105_0005229 | 3300048908 | Bacteria | 9837 |
| 577 | Ga0496105_0006240 | 3300048908 | Bacteria | 9152 |
| 578 | Ga0496105_0091652 | 3300048908 | Bacteria | 2510 |
| 579 | Ga0496105_0139551 | 3300048908 | Bacteria | 1995 |
| 580 | Ga0496106_0080265 | 3300048909 | Bacteria | 2505 |
| 581 | Ga0496106_0304870 | 3300048909 | Bacteria | 1277 |
| 582 | Ga0496106_0361973 | 3300048909 | Bacteria | 1165 |
| 583 | Ga0496107_0114243 | 3300048910 | Bacteria | 1986 |
| 584 | Ga0496107_0346540 | 3300048910 | Bacteria | 1105 |
| 585 | Ga0496108_0000244 | 3300048911 | Bacteria | 48432 |
| 586 | Ga0496108_0013227 | 3300048911 | Bacteria | 6726 |
| 587 | Ga0496108_0023662 | 3300048911 | Bacteria | 5055 |
| 588 | Ga0496108_0035682 | 3300048911 | Bacteria | 4134 |
| 589 | Ga0496108_0197019 | 3300048911 | Bacteria | 1747 |
| 590 | Ga0496109_0002677 | 3300048912 | Bacteria | 14952 |
| 591 | Ga0496109_0044910 | 3300048912 | Bacteria | 4009 |
| 592 | Ga0496109_0160326 | 3300048912 | Bacteria | 2107 |
| 593 | Ga0496110_0015570 | 3300048913 | Bacteria | 6333 |
| 594 | Ga0496110_0044847 | 3300048913 | Bacteria | 3862 |
| 595 | Ga0496110_0079371 | 3300048913 | Bacteria | 2922 |
| 596 | Ga0496111_0000320 | 3300048914 | Bacteria | 23827 |
| 597 | Ga0496111_0033662 | 3300048914 | Bacteria | 3656 |
| 598 | Ga0496111_0087254 | 3300048914 | Bacteria | 2283 |
| 599 | Ga0496112_0006808 | 3300048915 | Bacteria | 10073 |
| 600 | Ga0496112_0040401 | 3300048915 | Bacteria | 4561 |
| 601 | Ga0496112_0055817 | 3300048915 | Bacteria | 3885 |
| 602 | Ga0496112_0119384 | 3300048915 | Bacteria | 2607 |
| 603 | Ga0496112_0127715 | 3300048915 | Bacteria | 2513 |
| 604 | Ga0496112_0234401 | 3300048915 | Bacteria | 1789 |
| 605 | Ga0496112_0334699 | 3300048915 | Bacteria | 1457 |
| 606 | Ga0496112_0341661 | 3300048915 | Bacteria | 1440 |
| 607 | Ga0496112_0459600 | 3300048915 | Bacteria | 1210 |
| 608 | Ga0496113_0003916 | 3300048916 | Bacteria | 9027 |
| 609 | Ga0496113_0039682 | 3300048916 | Bacteria | 3466 |
| 610 | Ga0496113_0197939 | 3300048916 | Bacteria | 1596 |
| 611 | Ga0496114_0049745 | 3300048917 | Bacteria | 3488 |
| 612 | Ga0496114_0150162 | 3300048917 | Bacteria | 2021 |
| 613 | Ga0496115_0005249 | 3300048918 | Bacteria | 9415 |
| 614 | Ga0496115_0019367 | 3300048918 | Bacteria | 5235 |
| 615 | Ga0496115_0049447 | 3300048918 | Bacteria | 3366 |
| 616 | Ga0496115_0076782 | 3300048918 | Bacteria | 2715 |
| 617 | Ga0496115_0131634 | 3300048918 | Bacteria | 2062 |
| 618 | Ga0496116_0003489 | 3300048919 | Bacteria | 15474 |
| 619 | Ga0496116_0032500 | 3300048919 | Bacteria | 3718 |
| 620 | Ga0496116_0109690 | 3300048919 | Bacteria | 1626 |
| 621 | Ga0496116_0120688 | 3300048919 | Bacteria | 1518 |
| 622 | Ga0496118_0019343 | 3300048921 | Bacteria | 6089 |
| 623 | Ga0496118_0043899 | 3300048921 | Bacteria | 3507 |
| 624 | Ga0496118_0072961 | 3300048921 | Bacteria | 2462 |
| 625 | Ga0496118_0251909 | 3300048921 | Bacteria | 1003 |
| 626 | Ga0496119_0014153 | 3300048922 | Bacteria | 6267 |
| 627 | Ga0496119_0031299 | 3300048922 | Bacteria | 3572 |
| 628 | Ga0496119_0057292 | 3300048922 | Bacteria | 2355 |
| 629 | Ga0496119_0171818 | 3300048922 | Bacteria | 1144 |
| 630 | Ga0496121_0001361 | 3300048924 | Bacteria | 41683 |
| 631 | Ga0496121_0006808 | 3300048924 | Bacteria | 14001 |
| 632 | Ga0496121_0038006 | 3300048924 | Bacteria | 4270 |
| 633 | Ga0496121_0040996 | 3300048924 | Bacteria | 4053 |
| 634 | Ga0496121_0067199 | 3300048924 | Bacteria | 2906 |
| 635 | Ga0496121_0089499 | 3300048924 | Bacteria | 2409 |
| 636 | Ga0496121_0102845 | 3300048924 | Bacteria | 2199 |
| 637 | Ga0496122_0031025 | 3300048925 | Bacteria | 4460 |
| 638 | Ga0496122_0168680 | 3300048925 | Bacteria | 1323 |
| 639 | Ga0496124_0020591 | 3300048927 | Bacteria | 6089 |
| 640 | Ga0496124_0193994 | 3300048927 | Bacteria | 1551 |
| 641 | Ga0496124_0262792 | 3300048927 | Bacteria | 1269 |
| 642 | Ga0496125_0000202 | 3300048928 | Bacteria | 125963 |
| 643 | Ga0496125_0010389 | 3300048928 | Bacteria | 9418 |
| 644 | Ga0496125_0014914 | 3300048928 | Bacteria | 7547 |
| 645 | Ga0496125_0037272 | 3300048928 | Bacteria | 4229 |
| 646 | Ga0496125_0048526 | 3300048928 | Bacteria | 3539 |
| 647 | Ga0496125_0066386 | 3300048928 | Bacteria | 2851 |
| 648 | Ga0496126_0025578 | 3300048929 | Bacteria | 5675 |
| 649 | Ga0496126_0038168 | 3300048929 | Bacteria | 4471 |
| 650 | Ga0496126_0055894 | 3300048929 | Bacteria | 3569 |
| 651 | Ga0496126_0118315 | 3300048929 | Bacteria | 2300 |
| 652 | Ga0496126_0151787 | 3300048929 | Bacteria | 1985 |
| 653 | Ga0496126_0200459 | 3300048929 | Bacteria | 1686 |
| 654 | Ga0496126_0297655 | 3300048929 | Bacteria | 1332 |
| 655 | Ga0495682_0023060 | 3300049460 | Bacteria | 2326 |
| 656 | Ga0495682_0047740 | 3300049460 | Bacteria | 1562 |
| 657 | Ga0501031_0053141 | 3300049568 | Bacteria | 2639 |
| 658 | Ga0501032_0000257 | 3300049569 | Bacteria | 44325 |
| 659 | Ga0501032_0002240 | 3300049569 | Bacteria | 15223 |
| 660 | Ga0501033_0000244 | 3300049570 | Bacteria | 52231 |
| 661 | Ga0501033_0000803 | 3300049570 | Bacteria | 28734 |
| 662 | Ga0501034_0000159 | 3300049571 | Bacteria | 127397 |
| 663 | Ga0501034_0019040 | 3300049571 | Bacteria | 7033 |
| 664 | Ga0501036_0000039 | 3300049572 | Bacteria | 83065 |
| 665 | Ga0501036_0000104 | 3300049572 | Bacteria | 52974 |
| 666 | Ga0501037_0001025 | 3300049573 | Bacteria | 20644 |
| 667 | Ga0501037_0001386 | 3300049573 | Bacteria | 17773 |
| 668 | Ga0501038_0000041 | 3300049574 | Bacteria | 120557 |
| 669 | Ga0501038_0000207 | 3300049574 | Bacteria | 50307 |
| 670 | Ga0501039_0000064 | 3300049575 | Bacteria | 83415 |
| 671 | Ga0501039_0000148 | 3300049575 | Bacteria | 47789 |
| 672 | Ga0501042_0071901 | 3300049578 | Bacteria | 2475 |
| 673 | Ga0501042_0242095 | 3300049578 | Bacteria | 1302 |
| 674 | Ga0501043_0000202 | 3300049579 | Bacteria | 54441 |
| 675 | Ga0501043_0012725 | 3300049579 | Bacteria | 6576 |
| 676 | Ga0501043_0188339 | 3300049579 | Bacteria | 1605 |
| 677 | Ga0501046_0000185 | 3300049580 | Bacteria | 63459 |
| 678 | Ga0501047_0000385 | 3300049581 | Bacteria | 49635 |
| 679 | Ga0501047_0000392 | 3300049581 | Bacteria | 49114 |
| 680 | Ga0501048_0000536 | 3300049582 | Bacteria | 26743 |
| 681 | Ga0501048_0051316 | 3300049582 | Bacteria | 2936 |
| 682 | Ga0501067_0005941 | 3300049583 | Bacteria | 6765 |
| 683 | Ga0501068_0004880 | 3300049584 | Bacteria | 7303 |
| 684 | Ga0501068_0012217 | 3300049584 | Bacteria | 4857 |
| 685 | Ga0501069_0002806 | 3300049585 | Bacteria | 8910 |
| 686 | Ga0501069_0024732 | 3300049585 | Bacteria | 3277 |
| 687 | Ga0501070_0000209 | 3300049586 | Bacteria | 55271 |
| 688 | Ga0501070_0000557 | 3300049586 | Bacteria | 34014 |
| 689 | Ga0501070_0033362 | 3300049586 | Bacteria | 4308 |
| 690 | Ga0501071_0096410 | 3300049587 | Bacteria | 2177 |
| 691 | Ga0501072_0029712 | 3300049588 | Bacteria | 4270 |
| 692 | Ga0501073_0000034 | 3300049589 | Bacteria | 95224 |
| 693 | Ga0501073_0008907 | 3300049589 | Bacteria | 7417 |
| 694 | Ga0501074_0000271 | 3300049590 | Bacteria | 29628 |
| 695 | Ga0501079_0000773 | 3300049741 | Bacteria | 21906 |
| 696 | Ga0501079_0442365 | 3300049741 | Bacteria | 1021 |
| 697 | Ga0501080_0001103 | 3300049742 | Bacteria | 22242 |
| 698 | Ga0501080_0005894 | 3300049742 | Bacteria | 10975 |
| 699 | Ga0501080_0010052 | 3300049742 | Bacteria | 8649 |
| 700 | Ga0501080_0184326 | 3300049742 | Bacteria | 1920 |
| 701 | Ga0501083_0000118 | 3300049744 | Bacteria | 54096 |
| 702 | Ga0501035_0000137 | 3300049822 | Bacteria | 89273 |
| 703 | Ga0501035_0000155 | 3300049822 | Bacteria | 84012 |
| 704 | Ga0501044_0000548 | 3300049823 | Bacteria | 45787 |
| 705 | Ga0501044_0001941 | 3300049823 | Bacteria | 23927 |
| 706 | Ga0501044_0011998 | 3300049823 | Bacteria | 9387 |
| 707 | Ga0501045_0010495 | 3300049824 | Bacteria | 6489 |
| 708 | Ga0501045_0065935 | 3300049824 | Bacteria | 2659 |
| 709 | nmdc:mga03683_103928_c1 | 3300050489 | Bacteria | 1251 |
| 710 | nmdc:mga03683_149728_c1 | 3300050489 | Bacteria | 1052 |
| 711 | nmdc:mga03683_7443_c1 | 3300050489 | Bacteria | 3801 |
| 712 | nmdc:mga03n38_117865_c1 | 3300050490 | Bacteria | 1301 |
| 713 | nmdc:mga03n38_22639_c1 | 3300050490 | Bacteria | 2546 |
| 714 | nmdc:mga00v17_114956_c1 | 3300050491 | Bacteria | 1710 |
| 715 | nmdc:mga00v17_20781_c1 | 3300050491 | Bacteria | 3765 |
| 716 | nmdc:mga00v17_249572_c1 | 3300050491 | Bacteria | 1151 |
| 717 | nmdc:mga0yw44_12005_c1 | 3300050492 | Bacteria | 4497 |
| 718 | nmdc:mga0yw44_17277_c1 | 3300050492 | Bacteria | 3923 |
| 719 | nmdc:mga0yw44_723_c1 | 3300050492 | Bacteria | 12145 |
| 720 | nmdc:mga0k408_10760_c1 | 3300050493 | Bacteria | 4958 |
| 721 | nmdc:mga0k408_15187_c1 | 3300050493 | Bacteria | 4255 |
| 722 | nmdc:mga06z11_101504_c1 | 3300050494 | Bacteria | 1579 |
| 723 | nmdc:mga06z11_97387_c1 | 3300050494 | Bacteria | 1608 |
| 724 | nmdc:mga04h51_2017_c1 | 3300050495 | Bacteria | 4755 |
| 725 | nmdc:mga07m45_12998_c1 | 3300050496 | Bacteria | 4405 |
| 726 | nmdc:mga07m45_24695_c1 | 3300050496 | Bacteria | 3294 |
| 727 | nmdc:mga05p37_215_c1 | 3300050507 | Bacteria | 57982 |
| 728 | nmdc:mga05p37_331717_c1 | 3300050507 | Bacteria | 1797 |
| 729 | nmdc:mga09592_1263_c1 | 3300050508 | Bacteria | 20295 |
| 730 | nmdc:mga0qj67_5759_c1 | 3300050509 | Bacteria | 9069 |
| 731 | nmdc:mga06r32_133694_c1 | 3300050510 | Bacteria | 2454 |
| 732 | nmdc:mga06r32_1551_c1 | 3300050510 | Bacteria | 20713 |
| 733 | nmdc:mga08y16_176_c1 | 3300050511 | Bacteria | 56313 |
| 734 | nmdc:mga0n895_166279_c1 | 3300050512 | Bacteria | 2237 |
| 735 | nmdc:mga0sz30_10704_c1 | 3300050516 | Bacteria | 3520 |
| 736 | nmdc:mga0sz30_98716_c1 | 3300050516 | Bacteria | 1275 |
| 737 | Ga0495601_0060441 | 3300053077 | Bacteria | 2404 |
| 738 | Ga0495601_0149370 | 3300053077 | Bacteria | 1525 |
| 739 | Ga0495601_0222194 | 3300053077 | Bacteria | 1234 |
| 740 | Ga0495612_0008556 | 3300053078 | Bacteria | 4150 |
| 741 | Ga0495655_0036324 | 3300053083 | Bacteria | 1231 |
| 742 | Ga0495595_0160098 | 3300053084 | Bacteria | 1110 |
| 743 | Ga0495619_0083357 | 3300053085 | Bacteria | 2156 |
| 744 | Ga0495619_0142416 | 3300053085 | Bacteria | 1652 |
| 745 | Ga0500643_000037 | 3300053087 | Bacteria | 180821 |
| 746 | Ga0500643_033261 | 3300053087 | Bacteria | 1560 |
| 747 | Ga0500644_0112559 | 3300053088 | Bacteria | 1050 |
| 748 | Ga0500581_026824 | 3300053089 | Bacteria | 2933 |
| 749 | Ga0500646_0011610 | 3300053090 | Bacteria | 2267 |
| 750 | Ga0500583_0015846 | 3300053092 | Bacteria | 2994 |
| 751 | Ga0500651_0012304 | 3300053093 | Bacteria | 5187 |
| 752 | Ga0500651_0075684 | 3300053093 | Bacteria | 2091 |
| 753 | Ga0500566_0000166 | 3300053094 | Bacteria | 33843 |
| 754 | Ga0500566_0254409 | 3300053094 | Bacteria | 852 |
| 755 | Ga0500641_0023680 | 3300053096 | Bacteria | 2364 |
| 756 | Ga0500554_001732 | 3300053102 | Bacteria | 4201 |
| 757 | Ga0500555_000550 | 3300053103 | Bacteria | 14953 |
| 758 | Ga0500556_0000089 | 3300053104 | Bacteria | 84468 |
| 759 | Ga0500557_000047 | 3300053105 | Bacteria | 59226 |
| 760 | Ga0500569_003630 | 3300053109 | Bacteria | 3175 |
| 761 | Ga0500595_002385 | 3300053119 | Bacteria | 9386 |
| 762 | Ga0500595_027503 | 3300053119 | Bacteria | 1947 |
| 763 | Ga0500607_088391 | 3300053121 | Bacteria | 1564 |
| 764 | Ga0500614_049953 | 3300053123 | Bacteria | 1094 |
| 765 | Ga0500642_0000030 | 3300053130 | Bacteria | 115114 |
| 766 | Ga0500642_0000071 | 3300053130 | Bacteria | 55663 |
| 767 | Ga0500642_0012757 | 3300053130 | Bacteria | 3061 |
| 768 | Ga0500658_0008212 | 3300053134 | Bacteria | 3857 |
| 769 | Ga0500658_0016210 | 3300053134 | Bacteria | 2775 |
| 770 | Ga0500559_0002659 | 3300053136 | Bacteria | 9097 |
| 771 | Ga0500559_0057068 | 3300053136 | Bacteria | 1734 |
| 772 | Ga0500564_162190 | 3300053138 | Bacteria | 945 |
| 773 | Ga0500577_0001653 | 3300053142 | Bacteria | 5708 |
| 774 | Ga0500577_0013663 | 3300053142 | Bacteria | 2487 |
| 775 | Ga0500577_0014053 | 3300053142 | Bacteria | 2464 |
| 776 | Ga0500588_0018546 | 3300053146 | Bacteria | 1835 |
| 777 | Ga0500603_000324 | 3300053150 | Bacteria | 12495 |
| 778 | Ga0500604_0002842 | 3300053151 | Bacteria | 4699 |
| 779 | Ga0500616_0000026 | 3300053153 | Bacteria | 454314 |
| 780 | Ga0500619_043197 | 3300053154 | Bacteria | 1432 |
| 781 | Ga0500622_0001149 | 3300053156 | Bacteria | 22026 |
| 782 | Ga0500622_0001752 | 3300053156 | Bacteria | 16718 |
| 783 | Ga0500627_0010696 | 3300053158 | Bacteria | 3355 |
| 784 | Ga0500634_0022780 | 3300053161 | Bacteria | 3402 |
| 785 | Ga0500636_0004341 | 3300053177 | Bacteria | 8020 |
| 786 | Ga0500636_0045565 | 3300053177 | Bacteria | 2586 |
| 787 | Ga0500636_0162117 | 3300053177 | Bacteria | 1218 |
| 788 | Ga0500637_0000582 | 3300053178 | Bacteria | 14362 |
| 789 | Ga0500576_005569 | 3300053725 | Bacteria | 5228 |
| 790 | Ga0500625_002984 | 3300053729 | Bacteria | 6534 |
| 791 | Ga0500645_007814 | 3300053730 | Bacteria | 3697 |
| 792 | Ga0500609_002144 | 3300053731 | Bacteria | 2829 |
| 793 | Ga0500601_000014 | 3300053737 | Bacteria | 41972 |
| 794 | Ga0501084_0003978 | 3300054114 | Bacteria | 12040 |
| 795 | Ga0500661_001823 | 3300055283 | Bacteria | 4021 |
| 796 | Ga0501082_0078362 | 3300060353 | Bacteria | 2850 |
| 797 | Ga0530510_0139373 | 3300061734 | Bacteria | 1786 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005328 | Ga0070676_10291743 | Ga0070676_102917432 | 261 |
| 2 | 3300005364 | Ga0070673_100025677 | Ga0070673_1000256773 | 261 |
| 3 | 3300005367 | Ga0070667_100088818 | Ga0070667_1000888182 | 261 |
| 4 | 3300005440 | Ga0070705_100022760 | Ga0070705_1000227603 | 261 |
| 5 | 3300005444 | Ga0070694_100357761 | Ga0070694_1003577612 | 261 |
| 6 | 3300005544 | Ga0070686_100087062 | Ga0070686_1000870622 | 261 |
| 7 | 3300005545 | Ga0070695_100199566 | Ga0070695_1001995662 | 261 |
| 8 | 3300006038 | Ga0075365_10105746 | Ga0075365_101057462 | 261 |
| 9 | 3300006178 | Ga0075367_10085174 | Ga0075367_100851742 | 261 |
| 10 | 3300006844 | Ga0075428_100141581 | Ga0075428_1001415812 | 261 |
| 11 | 3300009147 | Ga0114129_10370903 | Ga0114129_103709032 | 261 |
| 12 | 3300009148 | Ga0105243_10148988 | Ga0105243_101489882 | 261 |
| 13 | 3300009174 | Ga0105241_10397027 | Ga0105241_103970272 | 261 |
| 14 | 3300009176 | Ga0105242_10398197 | Ga0105242_103981972 | 261 |
| 15 | 3300010375 | Ga0105239_10506852 | Ga0105239_105068522 | 261 |
| 16 | 3300014326 | Ga0157380_10036188 | Ga0157380_100361884 | 261 |
| 17 | 3300025907 | Ga0207645_10075123 | Ga0207645_100751232 | 261 |
| 18 | 3300035242 | Ga0373962_0009749 | Ga0373962_0009749_1296_2096 | 261 |
| 19 | 3300046476 | Ga0495662_0031327 | Ga0495662_0031327_1732_2532 | 261 |
| 20 | 3300046513 | Ga0495616_0031901 | Ga0495616_0031901_1911_2711 | 261 |
| 21 | 3300046523 | Ga0495644_0016750 | Ga0495644_0016750_1363_2163 | 261 |
| 22 | 3300046537 | Ga0495598_0018203 | Ga0495598_0018203_931_1731 | 261 |
| 23 | 3300046537 | Ga0495598_0018384 | Ga0495598_0018384_53_853 | 261 |
| 24 | 3300046664 | Ga0495659_0055866 | Ga0495659_0055866_597_1397 | 261 |
| 25 | 3300048091 | Ga0495626_0144468 | Ga0495626_0144468_182_982 | 261 |
| 26 | 3300048904 | Ga0496101_0339633 | Ga0496101_0339633_93_893 | 261 |
| 27 | 3300048910 | Ga0496107_0346540 | Ga0496107_0346540_223_1023 | 261 |
| 28 | 3300050492 | nmdc:mga0yw44_17277_c1 | nmdc:mga0yw44_17277_c1_2715_3515 | 261 |
| 29 | 3300050494 | nmdc:mga06z11_97387_c1 | nmdc:mga06z11_97387_c1_757_1557 | 261 |
| 30 | 3300002070 | JGI24750J21931_1002919 | JGI24750J21931_10029192 | 262 |
| 31 | 3300005331 | Ga0070670_100021295 | Ga0070670_1000212952 | 262 |
| 32 | 3300005339 | Ga0070660_100413953 | Ga0070660_1004139532 | 262 |
| 33 | 3300005347 | Ga0070668_100019603 | Ga0070668_1000196032 | 262 |
| 34 | 3300005438 | Ga0070701_10005491 | Ga0070701_100054917 | 262 |
| 35 | 3300005618 | Ga0068864_100396089 | Ga0068864_1003960892 | 262 |
| 36 | 3300017792 | Ga0163161_10102631 | Ga0163161_101026312 | 262 |
| 37 | 3300025900 | Ga0207710_10020294 | Ga0207710_100202942 | 262 |
| 38 | 3300025918 | Ga0207662_10112221 | Ga0207662_101122212 | 262 |
| 39 | 3300025926 | Ga0207659_10306089 | Ga0207659_103060892 | 262 |
| 40 | 3300025935 | Ga0207709_10059697 | Ga0207709_100596972 | 262 |
| 41 | 3300025942 | Ga0207689_10017173 | Ga0207689_100171734 | 262 |
| 42 | 3300026041 | Ga0207639_10269424 | Ga0207639_102694242 | 262 |
| 43 | 3300026067 | Ga0207678_10011915 | Ga0207678_100119153 | 262 |
| 44 | 3300026075 | Ga0207708_10011033 | Ga0207708_100110336 | 262 |
| 45 | 3300026088 | Ga0207641_10403403 | Ga0207641_104034032 | 262 |
| 46 | 3300028381 | Ga0268264_10114295 | Ga0268264_101142952 | 262 |
| 47 | 3300005335 | Ga0070666_10138301 | Ga0070666_101383012 | 263 |
| 48 | 3300005364 | Ga0070673_100185913 | Ga0070673_1001859132 | 263 |
| 49 | 3300005367 | Ga0070667_100359941 | Ga0070667_1003599412 | 263 |
| 50 | 3300014969 | Ga0157376_10250098 | Ga0157376_102500982 | 263 |
| 51 | 3300046615 | Ga0495656_0244906 | Ga0495656_0244906_40_879 | 263 |
| 52 | 3300046531 | Ga0495665_0211823 | Ga0495665_0211823_119_925 | 264 |
| 53 | 3300009093 | Ga0105240_10331132 | Ga0105240_103311322 | 265 |
| 54 | 3300010375 | Ga0105239_10317568 | Ga0105239_103175682 | 265 |
| 55 | 3300013296 | Ga0157374_10391529 | Ga0157374_103915292 | 265 |
| 56 | 3300013297 | Ga0157378_10694039 | Ga0157378_106940391 | 265 |
| 57 | 3300025924 | Ga0207694_10232787 | Ga0207694_102327871 | 265 |
| 58 | 3300026116 | Ga0207674_10162957 | Ga0207674_101629572 | 265 |
| 59 | 3300028380 | Ga0268265_10433197 | Ga0268265_104331972 | 265 |
| 60 | 3300035725 | Ga0373947_0287589 | Ga0373947_0287589_48_845 | 265 |
| 61 | 3300046462 | Ga0495651_0196308 | Ga0495651_0196308_439_1242 | 266 |
| 62 | 3300053085 | Ga0495619_0142416 | Ga0495619_0142416_309_1112 | 266 |
| 63 | 3300053730 | Ga0500645_007814 | Ga0500645_007814_2620_3420 | 266 |
| 64 | iso_pu_bacteria | 2935975950 | 2935979678 | 266 |
| 65 | 3300009098 | Ga0105245_10240730 | Ga0105245_102407302 | 267 |
| 66 | 3300013297 | Ga0157378_10077940 | Ga0157378_100779403 | 267 |
| 67 | 3300014325 | Ga0163163_10148931 | Ga0163163_101489312 | 267 |
| 68 | 3300014968 | Ga0157379_10341503 | Ga0157379_103415032 | 267 |
| 69 | 3300021384 | Ga0213876_10000471 | Ga0213876_100004713 | 267 |
| 70 | 3300035170 | Ga0373943_0112598 | Ga0373943_0112598_39_842 | 267 |
| 71 | 3300041459 | Ga0451800_0227374 | Ga0451800_0227374_311_1114 | 267 |
| 72 | 3300041509 | Ga0451843_0945699 | Ga0451843_0945699_663_1466 | 267 |
| 73 | 3300041511 | Ga0451855_1012932 | Ga0451855_1012932_541_1344 | 267 |
| 74 | 3300044656 | Ga0466969_0023413 | Ga0466969_0023413_564_1367 | 267 |
| 75 | 3300044684 | Ga0466966_0000707 | Ga0466966_0000707_5410_6213 | 267 |
| 76 | 3300044693 | Ga0466961_0000029 | Ga0466961_0000029_65806_66609 | 267 |
| 77 | 3300045049 | Ga0466959_0044416 | Ga0466959_0044416_1723_2526 | 267 |
| 78 | 3300046454 | Ga0495592_0096806 | Ga0495592_0096806_1257_2060 | 267 |
| 79 | 3300046459 | Ga0495629_0048422 | Ga0495629_0048422_1150_1953 | 267 |
| 80 | 3300046462 | Ga0495651_0066159 | Ga0495651_0066159_1404_2207 | 267 |
| 81 | 3300046462 | Ga0495651_0256636 | Ga0495651_0256636_264_1067 | 267 |
| 82 | 3300046477 | Ga0495664_0208401 | Ga0495664_0208401_86_889 | 267 |
| 83 | 3300046501 | Ga0495607_0159390 | Ga0495607_0159390_24_827 | 267 |
| 84 | 3300046507 | Ga0495606_0113595 | Ga0495606_0113595_22_825 | 267 |
| 85 | 3300046513 | Ga0495616_0047449 | Ga0495616_0047449_868_1671 | 267 |
| 86 | 3300046518 | Ga0495631_0095918 | Ga0495631_0095918_176_979 | 267 |
| 87 | 3300046522 | Ga0495643_0010018 | Ga0495643_0010018_4638_5441 | 267 |
| 88 | 3300046529 | Ga0495652_0044830 | Ga0495652_0044830_1852_2655 | 267 |
| 89 | 3300046536 | Ga0495587_0142531 | Ga0495587_0142531_114_917 | 267 |
| 90 | 3300046557 | Ga0495622_0023222 | Ga0495622_0023222_834_1637 | 267 |
| 91 | 3300046559 | Ga0495667_0345794 | Ga0495667_0345794_52_855 | 267 |
| 92 | 3300046616 | Ga0495668_0115329 | Ga0495668_0115329_12_815 | 267 |
| 93 | 3300046660 | Ga0495625_0164363 | Ga0495625_0164363_654_1457 | 267 |
| 94 | 3300046663 | Ga0495635_0003213 | Ga0495635_0003213_6978_7781 | 267 |
| 95 | 3300046675 | Ga0495657_0011035 | Ga0495657_0011035_5841_6644 | 267 |
| 96 | 3300046675 | Ga0495657_0113788 | Ga0495657_0113788_96_899 | 267 |
| 97 | 3300046689 | Ga0495613_0111362 | Ga0495613_0111362_218_1021 | 267 |
| 98 | 3300046810 | Ga0495660_0046852 | Ga0495660_0046852_1542_2345 | 267 |
| 99 | 3300047317 | Ga0495604_0016851 | Ga0495604_0016851_3790_4593 | 267 |
| 100 | 3300047322 | Ga0495680_0027137 | Ga0495680_0027137_3064_3867 | 267 |
| 101 | 3300047323 | Ga0495683_0007012 | Ga0495683_0007012_679_1482 | 267 |
| 102 | 3300047443 | Ga0495687_048756 | Ga0495687_048756_868_1671 | 267 |
| 103 | 3300047444 | Ga0495675_0020242 | Ga0495675_0020242_482_1285 | 267 |
| 104 | 3300047472 | Ga0495686_0045614 | Ga0495686_0045614_325_1128 | 267 |
| 105 | 3300048088 | Ga0495602_0116214 | Ga0495602_0116214_344_1147 | 267 |
| 106 | 3300048088 | Ga0495602_0143393 | Ga0495602_0143393_808_1611 | 267 |
| 107 | 3300048903 | Ga0496100_0400542 | Ga0496100_0400542_193_996 | 267 |
| 108 | 3300048905 | Ga0496102_0001874 | Ga0496102_0001874_16187_16990 | 267 |
| 109 | 3300048906 | Ga0496103_0002168 | Ga0496103_0002168_5227_6030 | 267 |
| 110 | 3300048907 | Ga0496104_0092498 | Ga0496104_0092498_1550_2353 | 267 |
| 111 | 3300048908 | Ga0496105_0005120 | Ga0496105_0005120_8172_8975 | 267 |
| 112 | 3300048908 | Ga0496105_0006240 | Ga0496105_0006240_3903_4706 | 267 |
| 113 | 3300048911 | Ga0496108_0035682 | Ga0496108_0035682_2886_3689 | 267 |
| 114 | 3300048912 | Ga0496109_0160326 | Ga0496109_0160326_941_1744 | 267 |
| 115 | 3300048913 | Ga0496110_0079371 | Ga0496110_0079371_862_1665 | 267 |
| 116 | 3300048914 | Ga0496111_0033662 | Ga0496111_0033662_2326_3129 | 267 |
| 117 | 3300048915 | Ga0496112_0006808 | Ga0496112_0006808_4492_5295 | 267 |
| 118 | 3300048918 | Ga0496115_0019367 | Ga0496115_0019367_1182_1985 | 267 |
| 119 | 3300048919 | Ga0496116_0032500 | Ga0496116_0032500_494_1297 | 267 |
| 120 | 3300048919 | Ga0496116_0109690 | Ga0496116_0109690_516_1319 | 267 |
| 121 | 3300048921 | Ga0496118_0019343 | Ga0496118_0019343_1754_2557 | 267 |
| 122 | 3300048921 | Ga0496118_0043899 | Ga0496118_0043899_389_1192 | 267 |
| 123 | 3300048921 | Ga0496118_0251909 | Ga0496118_0251909_85_888 | 267 |
| 124 | 3300048922 | Ga0496119_0014153 | Ga0496119_0014153_3741_4544 | 267 |
| 125 | 3300048924 | Ga0496121_0067199 | Ga0496121_0067199_1421_2224 | 267 |
| 126 | 3300048925 | Ga0496122_0031025 | Ga0496122_0031025_2365_3168 | 267 |
| 127 | 3300048927 | Ga0496124_0020591 | Ga0496124_0020591_19_822 | 267 |
| 128 | 3300048927 | Ga0496124_0193994 | Ga0496124_0193994_13_816 | 267 |
| 129 | 3300048928 | Ga0496125_0010389 | Ga0496125_0010389_2261_3064 | 267 |
| 130 | 3300048928 | Ga0496125_0037272 | Ga0496125_0037272_3036_3839 | 267 |
| 131 | 3300048928 | Ga0496125_0048526 | Ga0496125_0048526_2632_3435 | 267 |
| 132 | 3300048929 | Ga0496126_0038168 | Ga0496126_0038168_1120_1923 | 267 |
| 133 | 3300049460 | Ga0495682_0023060 | Ga0495682_0023060_150_953 | 267 |
| 134 | 3300050489 | nmdc:mga03683_149728_c1 | nmdc:mga03683_149728_c1_39_842 | 267 |
| 135 | 3300050489 | nmdc:mga03683_7443_c1 | nmdc:mga03683_7443_c1_2292_3095 | 267 |
| 136 | 3300050490 | nmdc:mga03n38_22639_c1 | nmdc:mga03n38_22639_c1_246_1049 | 267 |
| 137 | 3300050491 | nmdc:mga00v17_114956_c1 | nmdc:mga00v17_114956_c1_69_872 | 267 |
| 138 | 3300050491 | nmdc:mga00v17_20781_c1 | nmdc:mga00v17_20781_c1_2880_3683 | 267 |
| 139 | 3300050492 | nmdc:mga0yw44_723_c1 | nmdc:mga0yw44_723_c1_4880_5683 | 267 |
| 140 | 3300050493 | nmdc:mga0k408_10760_c1 | nmdc:mga0k408_10760_c1_3288_4091 | 267 |
| 141 | 3300050495 | nmdc:mga04h51_2017_c1 | nmdc:mga04h51_2017_c1_3478_4281 | 267 |
| 142 | 3300050496 | nmdc:mga07m45_12998_c1 | nmdc:mga07m45_12998_c1_3331_4134 | 267 |
| 143 | 3300050496 | nmdc:mga07m45_24695_c1 | nmdc:mga07m45_24695_c1_630_1433 | 267 |
| 144 | 3300050516 | nmdc:mga0sz30_98716_c1 | nmdc:mga0sz30_98716_c1_328_1131 | 267 |
| 145 | 3300053084 | Ga0495595_0160098 | Ga0495595_0160098_20_823 | 267 |
| 146 | 3300053087 | Ga0500643_000037 | Ga0500643_000037_115516_116319 | 267 |
| 147 | 3300053092 | Ga0500583_0015846 | Ga0500583_0015846_1694_2497 | 267 |
| 148 | 3300053094 | Ga0500566_0000166 | Ga0500566_0000166_8300_9103 | 267 |
| 149 | 3300053094 | Ga0500566_0254409 | Ga0500566_0254409_11_814 | 267 |
| 150 | 3300053096 | Ga0500641_0023680 | Ga0500641_0023680_246_1049 | 267 |
| 151 | 3300053103 | Ga0500555_000550 | Ga0500555_000550_153_956 | 267 |
| 152 | 3300053121 | Ga0500607_088391 | Ga0500607_088391_317_1120 | 267 |
| 153 | 3300053130 | Ga0500642_0000071 | Ga0500642_0000071_9363_10166 | 267 |
| 154 | 3300053130 | Ga0500642_0012757 | Ga0500642_0012757_982_1785 | 267 |
| 155 | 3300053134 | Ga0500658_0016210 | Ga0500658_0016210_917_1720 | 267 |
| 156 | 3300053138 | Ga0500564_162190 | Ga0500564_162190_51_854 | 267 |
| 157 | 3300053142 | Ga0500577_0013663 | Ga0500577_0013663_12_815 | 267 |
| 158 | 3300053154 | Ga0500619_043197 | Ga0500619_043197_434_1237 | 267 |
| 159 | 3300053156 | Ga0500622_0001752 | Ga0500622_0001752_10899_11702 | 267 |
| 160 | 3300053158 | Ga0500627_0010696 | Ga0500627_0010696_34_837 | 267 |
| 161 | 3300053161 | Ga0500634_0022780 | Ga0500634_0022780_1011_1814 | 267 |
| 162 | 3300053177 | Ga0500636_0004341 | Ga0500636_0004341_2290_3093 | 267 |
| 163 | 3300053729 | Ga0500625_002984 | Ga0500625_002984_3972_4775 | 267 |
| 164 | iso_pu_bacteria | 2744054633 | 2745076157 | 267 |
| 165 | 3300013102 | Ga0157371_10000045 | Ga0157371_1000004547 | 268 |
| 166 | 3300003354 | JGI25160J50197_1008322 | JGI25160J50197_10083225 | 269 |
| 167 | 3300005262 | Ga0065165_1000368 | Ga0065165_100036812 | 269 |
| 168 | 3300006844 | Ga0075428_100000390 | Ga0075428_10000039010 | 269 |
| 169 | 3300006846 | Ga0075430_100037274 | Ga0075430_1000372745 | 269 |
| 170 | 3300006847 | Ga0075431_100000003 | Ga0075431_10000000335 | 269 |
| 171 | 3300006880 | Ga0075429_100000288 | Ga0075429_10000028819 | 269 |
| 172 | 3300009094 | Ga0111539_10000753 | Ga0111539_1000075324 | 269 |
| 173 | 3300009147 | Ga0114129_10000104 | Ga0114129_1000010431 | 269 |
| 174 | 3300025302 | Ga0207426_1000289 | Ga0207426_1000289103 | 269 |
| 175 | 3300027907 | Ga0207428_10000831 | Ga0207428_1000083111 | 269 |
| 176 | 3300048929 | Ga0496126_0200459 | Ga0496126_0200459_396_1268 | 269 |
| 177 | 3300050507 | nmdc:mga05p37_215_c1 | nmdc:mga05p37_215_c1_14579_15391 | 269 |
| 178 | 3300050508 | nmdc:mga09592_1263_c1 | nmdc:mga09592_1263_c1_14546_15358 | 269 |
| 179 | 3300050509 | nmdc:mga0qj67_5759_c1 | nmdc:mga0qj67_5759_c1_3090_3902 | 269 |
| 180 | 3300050510 | nmdc:mga06r32_1551_c1 | nmdc:mga06r32_1551_c1_15091_15903 | 269 |
| 181 | 3300050511 | nmdc:mga08y16_176_c1 | nmdc:mga08y16_176_c1_15935_16747 | 269 |
| 182 | 3300005983 | Ga0081540_1031125 | Ga0081540_10311252 | 270 |
| 183 | 3300005983 | Ga0081540_1063983 | Ga0081540_10639832 | 270 |
| 184 | 3300006177 | Ga0075362_10080859 | Ga0075362_100808592 | 270 |
| 185 | 3300006195 | Ga0075366_10008073 | Ga0075366_100080732 | 270 |
| 186 | 3300009101 | Ga0105247_10100100 | Ga0105247_101001002 | 270 |
| 187 | 3300010375 | Ga0105239_10347262 | Ga0105239_103472622 | 270 |
| 188 | 3300013297 | Ga0157378_10845598 | Ga0157378_108455981 | 270 |
| 189 | 3300044658 | Ga0466972_0001101 | Ga0466972_0001101_10572_11384 | 270 |
| 190 | 3300044658 | Ga0466972_0036902 | Ga0466972_0036902_293_1105 | 270 |
| 191 | 3300044694 | Ga0466963_0056092 | Ga0466963_0056092_201_1013 | 270 |
| 192 | 3300044735 | Ga0466968_0019728 | Ga0466968_0019728_321_1133 | 270 |
| 193 | 3300044735 | Ga0466968_0099649 | Ga0466968_0099649_323_1135 | 270 |
| 194 | 3300044901 | Ga0466960_0071300 | Ga0466960_0071300_177_989 | 270 |
| 195 | 3300045976 | Ga0466967_0002064 | Ga0466967_0002064_9668_10480 | 270 |
| 196 | 3300046457 | Ga0495590_0089336 | Ga0495590_0089336_227_1039 | 270 |
| 197 | 3300046524 | Ga0495648_0011360 | Ga0495648_0011360_2523_3395 | 270 |
| 198 | 3300046616 | Ga0495668_0243383 | Ga0495668_0243383_152_964 | 270 |
| 199 | 3300046665 | Ga0495661_0221850 | Ga0495661_0221850_88_900 | 270 |
| 200 | 3300046674 | Ga0495588_0036213 | Ga0495588_0036213_1148_1960 | 270 |
| 201 | 3300048903 | Ga0496100_0231627 | Ga0496100_0231627_331_1143 | 270 |
| 202 | 3300048906 | Ga0496103_0050949 | Ga0496103_0050949_1539_2351 | 270 |
| 203 | 3300048909 | Ga0496106_0361973 | Ga0496106_0361973_28_840 | 270 |
| 204 | 3300048915 | Ga0496112_0341661 | Ga0496112_0341661_299_1111 | 270 |
| 205 | 3300048924 | Ga0496121_0040996 | Ga0496121_0040996_2719_3531 | 270 |
| 206 | 3300048925 | Ga0496122_0168680 | Ga0496122_0168680_172_1044 | 270 |
| 207 | 3300048927 | Ga0496124_0262792 | Ga0496124_0262792_161_973 | 270 |
| 208 | 3300048928 | Ga0496125_0000202 | Ga0496125_0000202_19215_20087 | 270 |
| 209 | 3300048928 | Ga0496125_0014914 | Ga0496125_0014914_2935_3807 | 270 |
| 210 | 3300048929 | Ga0496126_0151787 | Ga0496126_0151787_1088_1900 | 270 |
| 211 | 3300048929 | Ga0496126_0297655 | Ga0496126_0297655_160_972 | 270 |
| 212 | 3300049460 | Ga0495682_0047740 | Ga0495682_0047740_46_858 | 270 |
| 213 | 3300050489 | nmdc:mga03683_103928_c1 | nmdc:mga03683_103928_c1_349_1182 | 270 |
| 214 | 3300050491 | nmdc:mga00v17_249572_c1 | nmdc:mga00v17_249572_c1_111_944 | 270 |
| 215 | 3300050493 | nmdc:mga0k408_15187_c1 | nmdc:mga0k408_15187_c1_2767_3600 | 270 |
| 216 | 3300048924 | Ga0496121_0102845 | Ga0496121_0102845_213_1028 | 271 |
| 217 | 3300048929 | Ga0496126_0118315 | Ga0496126_0118315_670_1485 | 271 |
| 218 | 3300053142 | Ga0500577_0001653 | Ga0500577_0001653_1578_2450 | 271 |
| 219 | 3300005354 | Ga0070675_100437456 | Ga0070675_1004374562 | 272 |
| 220 | 3300005578 | Ga0068854_100394563 | Ga0068854_1003945632 | 272 |
| 221 | 3300005614 | Ga0068856_100121348 | Ga0068856_1001213482 | 272 |
| 222 | 3300005616 | Ga0068852_100257446 | Ga0068852_1002574462 | 272 |
| 223 | 3300005617 | Ga0068859_100123399 | Ga0068859_1001233992 | 272 |
| 224 | 3300005841 | Ga0068863_100044648 | Ga0068863_1000446482 | 272 |
| 225 | 3300005842 | Ga0068858_100069140 | Ga0068858_1000691402 | 272 |
| 226 | 3300005844 | Ga0068862_100070936 | Ga0068862_1000709363 | 272 |
| 227 | 3300006028 | Ga0070717_10070422 | Ga0070717_100704223 | 272 |
| 228 | 3300006038 | Ga0075365_10129215 | Ga0075365_101292152 | 272 |
| 229 | 3300006847 | Ga0075431_100128497 | Ga0075431_1001284973 | 272 |
| 230 | 3300006871 | Ga0075434_100072569 | Ga0075434_1000725692 | 272 |
| 231 | 3300006881 | Ga0068865_100072834 | Ga0068865_1000728342 | 272 |
| 232 | 3300006931 | Ga0097620_100123397 | Ga0097620_1001233972 | 272 |
| 233 | 3300025900 | Ga0207710_10010271 | Ga0207710_100102715 | 272 |
| 234 | 3300025901 | Ga0207688_10003242 | Ga0207688_100032427 | 272 |
| 235 | 3300025903 | Ga0207680_10332396 | Ga0207680_103323961 | 272 |
| 236 | 3300025911 | Ga0207654_10166276 | Ga0207654_101662762 | 272 |
| 237 | 3300025914 | Ga0207671_10145289 | Ga0207671_101452892 | 272 |
| 238 | 3300025919 | Ga0207657_10026833 | Ga0207657_100268333 | 272 |
| 239 | 3300025925 | Ga0207650_10051907 | Ga0207650_100519072 | 272 |
| 240 | 3300025927 | Ga0207687_10112481 | Ga0207687_101124812 | 272 |
| 241 | 3300025931 | Ga0207644_10147179 | Ga0207644_101471792 | 272 |
| 242 | 3300025933 | Ga0207706_10002137 | Ga0207706_1000213714 | 272 |
| 243 | 3300025940 | Ga0207691_10025691 | Ga0207691_100256915 | 272 |
| 244 | 3300025949 | Ga0207667_10194874 | Ga0207667_101948742 | 272 |
| 245 | 3300025972 | Ga0207668_10208796 | Ga0207668_102087962 | 272 |
| 246 | 3300026023 | Ga0207677_10080977 | Ga0207677_100809772 | 272 |
| 247 | 3300026089 | Ga0207648_10006963 | Ga0207648_100069636 | 272 |
| 248 | 3300026095 | Ga0207676_10053568 | Ga0207676_100535682 | 272 |
| 249 | 3300026116 | Ga0207674_10053974 | Ga0207674_100539744 | 272 |
| 250 | 3300026118 | Ga0207675_100061684 | Ga0207675_1000616845 | 272 |
| 251 | 3300026121 | Ga0207683_10017919 | Ga0207683_100179192 | 272 |
| 252 | 3300026142 | Ga0207698_10199788 | Ga0207698_101997882 | 272 |
| 253 | 3300035116 | Ga0373945_0014499 | Ga0373945_0014499_1452_2285 | 272 |
| 254 | 3300035170 | Ga0373943_0005006 | Ga0373943_0005006_1835_2668 | 272 |
| 255 | 3300035171 | Ga0373946_0006955 | Ga0373946_0006955_1917_2750 | 272 |
| 256 | 3300035692 | Ga0373935_0015948 | Ga0373935_0015948_1367_2200 | 272 |
| 257 | 3300035695 | Ga0373927_0010188 | Ga0373927_0010188_2063_2896 | 272 |
| 258 | 3300035725 | Ga0373947_0002364 | Ga0373947_0002364_3396_4229 | 272 |
| 259 | 3300037068 | Ga0373925_0073183 | Ga0373925_0073183_341_1174 | 272 |
| 260 | 3300037068 | Ga0373925_0380911 | Ga0373925_0380911_12_845 | 272 |
| 261 | 3300046455 | Ga0495603_0007156 | Ga0495603_0007156_1615_2448 | 272 |
| 262 | 3300046459 | Ga0495629_0158850 | Ga0495629_0158850_126_959 | 272 |
| 263 | 3300046461 | Ga0495641_0007549 | Ga0495641_0007549_2627_3460 | 272 |
| 264 | 3300046492 | Ga0495585_0072766 | Ga0495585_0072766_856_1689 | 272 |
| 265 | 3300046499 | Ga0495594_0011612 | Ga0495594_0011612_1874_2707 | 272 |
| 266 | 3300046517 | Ga0495630_0091537 | Ga0495630_0091537_321_1154 | 272 |
| 267 | 3300046518 | Ga0495631_0097113 | Ga0495631_0097113_68_901 | 272 |
| 268 | 3300046525 | Ga0495663_0054520 | Ga0495663_0054520_51_884 | 272 |
| 269 | 3300046533 | Ga0495640_0123125 | Ga0495640_0123125_255_1088 | 272 |
| 270 | 3300046642 | Ga0495634_0241365 | Ga0495634_0241365_79_912 | 272 |
| 271 | 3300046663 | Ga0495635_0085602 | Ga0495635_0085602_867_1700 | 272 |
| 272 | 3300046681 | Ga0495647_0004026 | Ga0495647_0004026_2026_2859 | 272 |
| 273 | 3300046683 | Ga0495658_0060313 | Ga0495658_0060313_617_1450 | 272 |
| 274 | 3300046689 | Ga0495613_0027959 | Ga0495613_0027959_1273_2106 | 272 |
| 275 | 3300046690 | Ga0495624_0002738 | Ga0495624_0002738_9464_10297 | 272 |
| 276 | 3300047321 | Ga0495676_0025949 | Ga0495676_0025949_1338_2171 | 272 |
| 277 | 3300047673 | Ga0495593_0144829 | Ga0495593_0144829_65_898 | 272 |
| 278 | 3300048903 | Ga0496100_0026555 | Ga0496100_0026555_2306_3139 | 272 |
| 279 | 3300048904 | Ga0496101_0009142 | Ga0496101_0009142_5347_6180 | 272 |
| 280 | 3300048905 | Ga0496102_0077241 | Ga0496102_0077241_1371_2204 | 272 |
| 281 | 3300048906 | Ga0496103_0004621 | Ga0496103_0004621_7407_8240 | 272 |
| 282 | 3300048906 | Ga0496103_0083548 | Ga0496103_0083548_924_1757 | 272 |
| 283 | 3300048907 | Ga0496104_0211558 | Ga0496104_0211558_622_1455 | 272 |
| 284 | 3300048908 | Ga0496105_0005229 | Ga0496105_0005229_616_1449 | 272 |
| 285 | 3300048908 | Ga0496105_0139551 | Ga0496105_0139551_433_1266 | 272 |
| 286 | 3300048909 | Ga0496106_0304870 | Ga0496106_0304870_174_1007 | 272 |
| 287 | 3300048910 | Ga0496107_0114243 | Ga0496107_0114243_433_1266 | 272 |
| 288 | 3300048911 | Ga0496108_0000244 | Ga0496108_0000244_36952_37785 | 272 |
| 289 | 3300048911 | Ga0496108_0197019 | Ga0496108_0197019_501_1337 | 272 |
| 290 | 3300048912 | Ga0496109_0002677 | Ga0496109_0002677_722_1555 | 272 |
| 291 | 3300048913 | Ga0496110_0015570 | Ga0496110_0015570_861_1694 | 272 |
| 292 | 3300048914 | Ga0496111_0000320 | Ga0496111_0000320_18862_19695 | 272 |
| 293 | 3300048914 | Ga0496111_0087254 | Ga0496111_0087254_721_1554 | 272 |
| 294 | 3300048915 | Ga0496112_0127715 | Ga0496112_0127715_958_1794 | 272 |
| 295 | 3300048915 | Ga0496112_0234401 | Ga0496112_0234401_597_1430 | 272 |
| 296 | 3300048915 | Ga0496112_0334699 | Ga0496112_0334699_228_1061 | 272 |
| 297 | 3300048916 | Ga0496113_0003916 | Ga0496113_0003916_810_1643 | 272 |
| 298 | 3300048916 | Ga0496113_0039682 | Ga0496113_0039682_1832_2665 | 272 |
| 299 | 3300048918 | Ga0496115_0076782 | Ga0496115_0076782_61_894 | 272 |
| 300 | 3300049742 | Ga0501080_0184326 | Ga0501080_0184326_857_1678 | 272 |
| 301 | 3300050490 | nmdc:mga03n38_117865_c1 | nmdc:mga03n38_117865_c1_414_1247 | 272 |
| 302 | 3300050494 | nmdc:mga06z11_101504_c1 | nmdc:mga06z11_101504_c1_501_1334 | 272 |
| 303 | 3300050507 | nmdc:mga05p37_331717_c1 | nmdc:mga05p37_331717_c1_221_1054 | 272 |
| 304 | 3300050510 | nmdc:mga06r32_133694_c1 | nmdc:mga06r32_133694_c1_814_1647 | 272 |
| 305 | 3300050512 | nmdc:mga0n895_166279_c1 | nmdc:mga0n895_166279_c1_744_1577 | 272 |
| 306 | 3300053077 | Ga0495601_0149370 | Ga0495601_0149370_99_932 | 272 |
| 307 | 3300053083 | Ga0495655_0036324 | Ga0495655_0036324_96_929 | 272 |
| 308 | 3300061734 | Ga0530510_0139373 | Ga0530510_0139373_939_1760 | 272 |
| 309 | 3300046674 | Ga0495588_0083379 | Ga0495588_0083379_707_1540 | 274 |
| 310 | iso_pu_bacteria | 2602042107 | 2603862505 | 274 |
| 311 | iso_pu_bacteria | 2888388044 | 2888388647 | 274 |
| 312 | 3300005438 | Ga0070701_10038307 | Ga0070701_100383072 | 276 |
| 313 | iso_pu_bacteria | 2508501128 | 2509148673 | 276 |
| 314 | 3300005331 | Ga0070670_100595403 | Ga0070670_1005954031 | 277 |
| 315 | 3300005456 | Ga0070678_100054699 | Ga0070678_1000546992 | 277 |
| 316 | 3300031616 | Ga0307508_10073310 | Ga0307508_100733102 | 277 |
| 317 | 3300045976 | Ga0466967_0140178 | Ga0466967_0140178_241_1074 | 277 |
| 318 | 3300046507 | Ga0495606_0008906 | Ga0495606_0008906_4160_4999 | 277 |
| 319 | iso_pu_bacteria | 2507262055 | 2507510610 | 277 |
| 320 | iso_pu_bacteria | 2508501009 | 2508544412 | 277 |
| 321 | iso_pu_bacteria | 2508501042 | 2508697447 | 277 |
| 322 | iso_pu_bacteria | 2511231028 | 2511396338 | 277 |
| 323 | iso_pu_bacteria | 2513237094 | 2513640196 | 277 |
| 324 | iso_pu_bacteria | 2513237095 | 2513650747 | 277 |
| 325 | iso_pu_bacteria | 2513237104 | 2513715856 | 277 |
| 326 | iso_pu_bacteria | 2513237139 | 2513877766 | 277 |
| 327 | iso_pu_bacteria | 2513237161 | 2514015043 | 277 |
| 328 | iso_pu_bacteria | 2515154112 | 2515628662 | 277 |
| 329 | iso_pu_bacteria | 2517093001 | 2517105514 | 277 |
| 330 | iso_pu_bacteria | 2524023205 | 2524437013 | 277 |
| 331 | iso_pu_bacteria | 2528768022 | 2528852284 | 277 |
| 332 | iso_pu_bacteria | 2617270735 | 2617350027 | 277 |
| 333 | iso_pu_bacteria | 2791355196 | 2793063375 | 277 |
| 334 | iso_pu_bacteria | 2802429603 | 2805917106 | 277 |
| 335 | iso_pu_bacteria | 2816332527 | 2818243551 | 277 |
| 336 | iso_pu_bacteria | 2824661429 | 2824662442 | 277 |
| 337 | iso_pu_bacteria | 2824704595 | 2824705690 | 277 |
| 338 | iso_pu_bacteria | 2824753945 | 2824756372 | 277 |
| 339 | iso_pu_bacteria | 2824763712 | 2824764057 | 277 |
| 340 | iso_pu_bacteria | 2857509624 | 2857516135 | 277 |
| 341 | iso_pu_bacteria | 2874590934 | 2874594750 | 277 |
| 342 | iso_pu_bacteria | 2874628541 | 2874634729 | 277 |
| 343 | iso_pu_bacteria | 2876771140 | 2876774408 | 277 |
| 344 | iso_pu_bacteria | 2876818435 | 2876822802 | 277 |
| 345 | iso_pu_bacteria | 2879074833 | 2879078562 | 277 |
| 346 | iso_pu_bacteria | 2888378607 | 2888382002 | 277 |
| 347 | iso_pu_bacteria | 2904711408 | 2904720360 | 277 |
| 348 | iso_pu_bacteria | 2906626472 | 2906634101 | 277 |
| 349 | iso_pu_bacteria | 2932784394 | 2932793103 | 277 |
| 350 | iso_pu_bacteria | 2932809354 | 2932814591 | 277 |
| 351 | iso_pu_bacteria | 2932818245 | 2932824656 | 277 |
| 352 | iso_pu_bacteria | 2932828146 | 2932836563 | 277 |
| 353 | iso_pu_bacteria | 2933577622 | 2933578014 | 277 |
| 354 | iso_pu_bacteria | 2935608549 | 2935610657 | 277 |
| 355 | iso_pu_bacteria | 2935616580 | 2935623296 | 277 |
| 356 | iso_pu_bacteria | 2935638405 | 2935646706 | 277 |
| 357 | iso_pu_bacteria | 2935648319 | 2935652428 | 277 |
| 358 | iso_pu_bacteria | 2935656913 | 2935661010 | 277 |
| 359 | iso_pu_bacteria | 2935665750 | 2935672624 | 277 |
| 360 | iso_pu_bacteria | 2935675223 | 2935682497 | 277 |
| 361 | iso_pu_bacteria | 2935684952 | 2935691701 | 277 |
| 362 | iso_pu_bacteria | 2935694250 | 2935699570 | 277 |
| 363 | iso_pu_bacteria | 2935703347 | 2935707807 | 277 |
| 364 | iso_pu_bacteria | 2935713505 | 2935719535 | 277 |
| 365 | iso_pu_bacteria | 2935722832 | 2935728863 | 277 |
| 366 | iso_pu_bacteria | 2935732158 | 2935737895 | 277 |
| 367 | iso_pu_bacteria | 2935741537 | 2935747270 | 277 |
| 368 | iso_pu_bacteria | 2935750917 | 2935757929 | 277 |
| 369 | iso_pu_bacteria | 2935760218 | 2935761722 | 277 |
| 370 | iso_pu_bacteria | 2935777560 | 2935782796 | 277 |
| 371 | iso_pu_bacteria | 2935785616 | 2935787152 | 277 |
| 372 | iso_pu_bacteria | 2935793552 | 2935795200 | 277 |
| 373 | iso_pu_bacteria | 2935801545 | 2935810082 | 277 |
| 374 | iso_pu_bacteria | 2935810662 | 2935819034 | 277 |
| 375 | iso_pu_bacteria | 2935819856 | 2935820154 | 277 |
| 376 | iso_pu_bacteria | 2935827899 | 2935835973 | 277 |
| 377 | iso_pu_bacteria | 2935837841 | 2935844903 | 277 |
| 378 | iso_pu_bacteria | 2935847175 | 2935849835 | 277 |
| 379 | iso_pu_bacteria | 2935855204 | 2935861704 | 277 |
| 380 | iso_pu_bacteria | 2935864058 | 2935870743 | 277 |
| 381 | iso_pu_bacteria | 2935873716 | 2935881384 | 277 |
| 382 | iso_pu_bacteria | 2935908558 | 2935914475 | 277 |
| 383 | iso_pu_bacteria | 2935916978 | 2935919025 | 277 |
| 384 | iso_pu_bacteria | 2935926038 | 2935932144 | 277 |
| 385 | iso_pu_bacteria | 2935934488 | 2935940742 | 277 |
| 386 | iso_pu_bacteria | 2935942939 | 2935948671 | 277 |
| 387 | iso_pu_bacteria | 2935951376 | 2935957222 | 277 |
| 388 | iso_pu_bacteria | 2935959822 | 2935963652 | 277 |
| 389 | iso_pu_bacteria | 2935967501 | 2935973806 | 277 |
| 390 | iso_pu_bacteria | 2935984226 | 2935988953 | 277 |
| 391 | iso_pu_bacteria | 2935992306 | 2936000435 | 277 |
| 392 | iso_pu_bacteria | 2936002035 | 2936005451 | 277 |
| 393 | iso_pu_bacteria | 2936011229 | 2936015067 | 277 |
| 394 | iso_pu_bacteria | 2936019824 | 2936023212 | 277 |
| 395 | iso_pu_bacteria | 2936028420 | 2936032335 | 277 |
| 396 | iso_pu_bacteria | 2936037263 | 2936041990 | 277 |
| 397 | iso_pu_bacteria | 2936046547 | 2936050196 | 277 |
| 398 | iso_pu_bacteria | 2936055302 | 2936061096 | 277 |
| 399 | iso_pu_bacteria | 2940556831 | 2940564159 | 277 |
| 400 | iso_pu_bacteria | 2941531003 | 2941535140 | 277 |
| 401 | iso_pu_bacteria | 2941538514 | 2941546710 | 277 |
| 402 | iso_pu_bacteria | 3005506211 | 3005512141 | 277 |
| 403 | iso_pu_bacteria | 3005594810 | 3005597014 | 277 |
| 404 | iso_pu_bacteria | 3005710791 | 3005713086 | 277 |
| 405 | iso_pu_bacteria | 3005718088 | 3005720446 | 277 |
| 406 | iso_pu_bacteria | 8016511872 | 8016515719 | 277 |
| 407 | iso_pu_bacteria | 8016522445 | 8016523284 | 277 |
| 408 | iso_pu_bacteria | 8016530956 | 8016536776 | 277 |
| 409 | iso_pu_bacteria | 8016539877 | 8016541049 | 277 |
| 410 | iso_pu_bacteria | 8016548790 | 8016552204 | 277 |
| 411 | iso_pu_bacteria | 8016557553 | 8016560584 | 277 |
| 412 | iso_pu_bacteria | 8016566248 | 8016566438 | 277 |
| 413 | iso_pu_bacteria | 8016575299 | 8016579188 | 277 |
| 414 | iso_pu_bacteria | 8016583857 | 8016590058 | 277 |
| 415 | iso_pu_bacteria | 8016595262 | 8016598478 | 277 |
| 416 | iso_pu_bacteria | 8016603502 | 8016612659 | 277 |
| 417 | iso_pu_bacteria | 8016622563 | 8016628857 | 277 |
| 418 | iso_pu_bacteria | 8016630954 | 8016633384 | 277 |
| 419 | iso_pu_bacteria | 8017057580 | 8017060780 | 277 |
| 420 | iso_pu_bacteria | 8019538911 | 8019542972 | 277 |
| 421 | iso_pu_bacteria | 8019547302 | 8019547781 | 277 |
| 422 | iso_pu_bacteria | 8019576017 | 8019580303 | 277 |
| 423 | iso_pu_bacteria | 8019586578 | 8019588021 | 277 |
| 424 | iso_pu_bacteria | 8019597564 | 8019603319 | 277 |
| 425 | iso_pu_bacteria | 8019608314 | 8019615215 | 277 |
| 426 | iso_pu_bacteria | 8019619141 | 8019626013 | 277 |
| 427 | iso_pu_bacteria | 8019629233 | 8019636469 | 277 |
| 428 | iso_pu_bacteria | 8019648815 | 8019655997 | 277 |
| 429 | iso_pu_bacteria | 8019659431 | 8019664250 | 277 |
| 430 | iso_pu_bacteria | 8019668869 | 8019673834 | 277 |
| 431 | iso_pu_bacteria | 8019687851 | 8019687973 | 277 |
| 432 | iso_pu_bacteria | 8055742211 | 8055748349 | 277 |
| 433 | iso_pu_bacteria | 8056967851 | 8056971971 | 277 |
| 434 | 3300003215 | JGI25153J46596_10006394 | JGI25153J46596_100063942 | 278 |
| 435 | 3300005455 | Ga0070663_100161614 | Ga0070663_1001616141 | 278 |
| 436 | 3300006051 | Ga0075364_10269687 | Ga0075364_102696872 | 278 |
| 437 | 3300006186 | Ga0075369_10005952 | Ga0075369_100059524 | 278 |
| 438 | 3300006353 | Ga0075370_10073793 | Ga0075370_100737932 | 278 |
| 439 | 3300013104 | Ga0157370_10167330 | Ga0157370_101673302 | 278 |
| 440 | 3300025295 | Ga0209564_1007718 | Ga0209564_10077185 | 278 |
| 441 | 3300025297 | Ga0209758_1006857 | Ga0209758_10068573 | 278 |
| 442 | 3300031730 | Ga0307516_10056982 | Ga0307516_100569823 | 278 |
| 443 | 3300031911 | Ga0307412_10016383 | Ga0307412_100163831 | 278 |
| 444 | 3300037312 | Ga0395899_0039215 | Ga0395899_0039215_2228_3064 | 278 |
| 445 | 3300037418 | Ga0395900_0000943 | Ga0395900_0000943_25273_26109 | 278 |
| 446 | 3300037466 | Ga0395898_0002974 | Ga0395898_0002974_13049_13885 | 278 |
| 447 | 3300038443 | Ga0395901_0001973 | Ga0395901_0001973_6083_6919 | 278 |
| 448 | 3300046460 | Ga0495638_0230158 | Ga0495638_0230158_113_976 | 278 |
| 449 | 3300046506 | Ga0495583_0059082 | Ga0495583_0059082_675_1517 | 278 |
| 450 | 3300046691 | Ga0495670_0009149 | Ga0495670_0009149_1650_2492 | 278 |
| 451 | 3300048915 | Ga0496112_0040401 | Ga0496112_0040401_2479_3315 | 278 |
| 452 | 3300048919 | Ga0496116_0003489 | Ga0496116_0003489_13625_14467 | 278 |
| 453 | 3300048921 | Ga0496118_0072961 | Ga0496118_0072961_53_916 | 278 |
| 454 | 3300048924 | Ga0496121_0006808 | Ga0496121_0006808_5507_6370 | 278 |
| 455 | 3300048928 | Ga0496125_0066386 | Ga0496125_0066386_397_1239 | 278 |
| 456 | 3300049568 | Ga0501031_0053141 | Ga0501031_0053141_1387_2229 | 278 |
| 457 | 3300049569 | Ga0501032_0000257 | Ga0501032_0000257_30891_31733 | 278 |
| 458 | 3300049570 | Ga0501033_0000244 | Ga0501033_0000244_15127_15969 | 278 |
| 459 | 3300049571 | Ga0501034_0000159 | Ga0501034_0000159_36263_37105 | 278 |
| 460 | 3300049572 | Ga0501036_0000039 | Ga0501036_0000039_37296_38138 | 278 |
| 461 | 3300049573 | Ga0501037_0001386 | Ga0501037_0001386_2046_2888 | 278 |
| 462 | 3300049574 | Ga0501038_0000207 | Ga0501038_0000207_26029_26871 | 278 |
| 463 | 3300049575 | Ga0501039_0000148 | Ga0501039_0000148_29307_30149 | 278 |
| 464 | 3300049578 | Ga0501042_0071901 | Ga0501042_0071901_725_1567 | 278 |
| 465 | 3300049579 | Ga0501043_0000202 | Ga0501043_0000202_49667_50509 | 278 |
| 466 | 3300049580 | Ga0501046_0000185 | Ga0501046_0000185_24169_25011 | 278 |
| 467 | 3300049581 | Ga0501047_0000385 | Ga0501047_0000385_12531_13373 | 278 |
| 468 | 3300049582 | Ga0501048_0000536 | Ga0501048_0000536_3629_4471 | 278 |
| 469 | 3300049583 | Ga0501067_0005941 | Ga0501067_0005941_4159_5001 | 278 |
| 470 | 3300049584 | Ga0501068_0012217 | Ga0501068_0012217_3811_4653 | 278 |
| 471 | 3300049585 | Ga0501069_0002806 | Ga0501069_0002806_3873_4715 | 278 |
| 472 | 3300049586 | Ga0501070_0000557 | Ga0501070_0000557_29114_29956 | 278 |
| 473 | 3300049587 | Ga0501071_0096410 | Ga0501071_0096410_654_1496 | 278 |
| 474 | 3300049588 | Ga0501072_0029712 | Ga0501072_0029712_1853_2695 | 278 |
| 475 | 3300049589 | Ga0501073_0000034 | Ga0501073_0000034_90082_90924 | 278 |
| 476 | 3300049590 | Ga0501074_0000271 | Ga0501074_0000271_15559_16401 | 278 |
| 477 | 3300049741 | Ga0501079_0000773 | Ga0501079_0000773_52_894 | 278 |
| 478 | 3300049742 | Ga0501080_0001103 | Ga0501080_0001103_1417_2259 | 278 |
| 479 | 3300049744 | Ga0501083_0000118 | Ga0501083_0000118_20539_21381 | 278 |
| 480 | 3300049822 | Ga0501035_0000137 | Ga0501035_0000137_3929_4771 | 278 |
| 481 | 3300049823 | Ga0501044_0000548 | Ga0501044_0000548_32288_33130 | 278 |
| 482 | 3300049824 | Ga0501045_0010495 | Ga0501045_0010495_1008_1850 | 278 |
| 483 | 3300050492 | nmdc:mga0yw44_12005_c1 | nmdc:mga0yw44_12005_c1_42_905 | 278 |
| 484 | 3300050516 | nmdc:mga0sz30_10704_c1 | nmdc:mga0sz30_10704_c1_1123_1965 | 278 |
| 485 | 3300053087 | Ga0500643_033261 | Ga0500643_033261_240_1082 | 278 |
| 486 | 3300053089 | Ga0500581_026824 | Ga0500581_026824_1934_2776 | 278 |
| 487 | 3300053090 | Ga0500646_0011610 | Ga0500646_0011610_1266_2129 | 278 |
| 488 | 3300053093 | Ga0500651_0075684 | Ga0500651_0075684_63_926 | 278 |
| 489 | 3300053104 | Ga0500556_0000089 | Ga0500556_0000089_3054_3917 | 278 |
| 490 | 3300053109 | Ga0500569_003630 | Ga0500569_003630_672_1535 | 278 |
| 491 | 3300053130 | Ga0500642_0000030 | Ga0500642_0000030_108025_108867 | 278 |
| 492 | 3300053136 | Ga0500559_0057068 | Ga0500559_0057068_70_933 | 278 |
| 493 | 3300053151 | Ga0500604_0002842 | Ga0500604_0002842_3801_4664 | 278 |
| 494 | 3300053153 | Ga0500616_0000026 | Ga0500616_0000026_85173_86015 | 278 |
| 495 | 3300053156 | Ga0500622_0001149 | Ga0500622_0001149_18583_19446 | 278 |
| 496 | 3300054114 | Ga0501084_0003978 | Ga0501084_0003978_3639_4481 | 278 |
| 497 | 3300060353 | Ga0501082_0078362 | Ga0501082_0078362_1933_2775 | 278 |
| 498 | iso_pu_bacteria | 2857524615 | 2857529845 | 278 |
| 499 | iso_pu_bacteria | 2919073203 | 2919077299 | 278 |
| 500 | 3300005985 | Ga0081539_10000172 | Ga0081539_1000017290 | 279 |
| 501 | 3300009177 | Ga0105248_10831608 | Ga0105248_108316082 | 279 |
| 502 | 3300013105 | Ga0157369_10020698 | Ga0157369_100206986 | 279 |
| 503 | 3300031616 | Ga0307508_10183016 | Ga0307508_101830161 | 279 |
| 504 | 3300037418 | Ga0395900_0515441 | Ga0395900_0515441_126_971 | 279 |
| 505 | 3300048905 | Ga0496102_0372991 | Ga0496102_0372991_69_908 | 279 |
| 506 | 3300048929 | Ga0496126_0025578 | Ga0496126_0025578_3087_3947 | 279 |
| 507 | 3300049579 | Ga0501043_0188339 | Ga0501043_0188339_130_975 | 279 |
| 508 | 3300003323 | rootH1_10033771 | rootH1_100337713 | 280 |
| 509 | 3300003752 | Ga0055539_1004673 | Ga0055539_10046731 | 280 |
| 510 | 3300005435 | Ga0070714_100451105 | Ga0070714_1004511052 | 280 |
| 511 | 3300005436 | Ga0070713_100052143 | Ga0070713_1000521433 | 280 |
| 512 | 3300006028 | Ga0070717_10070996 | Ga0070717_100709963 | 280 |
| 513 | 3300021384 | Ga0213876_10225062 | Ga0213876_102250621 | 280 |
| 514 | 3300025253 | Ga0209677_101161 | Ga0209677_1011619 | 280 |
| 515 | 3300025261 | Ga0209233_1003000 | Ga0209233_10030006 | 280 |
| 516 | 3300025928 | Ga0207700_10014312 | Ga0207700_100143122 | 280 |
| 517 | 3300025929 | Ga0207664_10153066 | Ga0207664_101530663 | 280 |
| 518 | 3300031616 | Ga0307508_10243060 | Ga0307508_102430602 | 280 |
| 519 | 3300037466 | Ga0395898_0022540 | Ga0395898_0022540_1175_2017 | 280 |
| 520 | 3300038443 | Ga0395901_0376376 | Ga0395901_0376376_119_982 | 280 |
| 521 | 3300039437 | Ga0436365_0858635 | Ga0436365_0858635_24_866 | 280 |
| 522 | 3300048919 | Ga0496116_0120688 | Ga0496116_0120688_88_930 | 280 |
| 523 | 3300048922 | Ga0496119_0171818 | Ga0496119_0171818_110_952 | 280 |
| 524 | 3300048924 | Ga0496121_0038006 | Ga0496121_0038006_1340_2182 | 280 |
| 525 | 3300048924 | Ga0496121_0089499 | Ga0496121_0089499_719_1561 | 280 |
| 526 | 3300049569 | Ga0501032_0002240 | Ga0501032_0002240_3486_4334 | 280 |
| 527 | 3300049570 | Ga0501033_0000803 | Ga0501033_0000803_3413_4261 | 280 |
| 528 | 3300049571 | Ga0501034_0019040 | Ga0501034_0019040_1633_2481 | 280 |
| 529 | 3300049572 | Ga0501036_0000104 | Ga0501036_0000104_38136_38984 | 280 |
| 530 | 3300049573 | Ga0501037_0001025 | Ga0501037_0001025_18168_19016 | 280 |
| 531 | 3300049574 | Ga0501038_0000041 | Ga0501038_0000041_77353_78201 | 280 |
| 532 | 3300049575 | Ga0501039_0000064 | Ga0501039_0000064_21427_22275 | 280 |
| 533 | 3300049578 | Ga0501042_0242095 | Ga0501042_0242095_99_947 | 280 |
| 534 | 3300049579 | Ga0501043_0012725 | Ga0501043_0012725_4046_4894 | 280 |
| 535 | 3300049581 | Ga0501047_0000392 | Ga0501047_0000392_44720_45568 | 280 |
| 536 | 3300049582 | Ga0501048_0051316 | Ga0501048_0051316_1463_2311 | 280 |
| 537 | 3300049584 | Ga0501068_0004880 | Ga0501068_0004880_4869_5717 | 280 |
| 538 | 3300049585 | Ga0501069_0024732 | Ga0501069_0024732_764_1612 | 280 |
| 539 | 3300049586 | Ga0501070_0000209 | Ga0501070_0000209_1620_2468 | 280 |
| 540 | 3300049589 | Ga0501073_0008907 | Ga0501073_0008907_3450_4298 | 280 |
| 541 | 3300049742 | Ga0501080_0010052 | Ga0501080_0010052_5051_5899 | 280 |
| 542 | 3300049822 | Ga0501035_0000155 | Ga0501035_0000155_58563_59411 | 280 |
| 543 | 3300049823 | Ga0501044_0001941 | Ga0501044_0001941_4990_5838 | 280 |
| 544 | 3300049824 | Ga0501045_0065935 | Ga0501045_0065935_1174_2022 | 280 |
| 545 | 3300001990 | JGI24737J22298_10047256 | JGI24737J22298_100472561 | 281 |
| 546 | 3300003214 | JGI25165J46597_1006259 | JGI25165J46597_10062592 | 281 |
| 547 | 3300003215 | JGI25153J46596_10000110 | JGI25153J46596_1000011049 | 281 |
| 548 | 3300003215 | JGI25153J46596_10000161 | JGI25153J46596_1000016167 | 281 |
| 549 | 3300003215 | JGI25153J46596_10000354 | JGI25153J46596_1000035419 | 281 |
| 550 | 3300003215 | JGI25153J46596_10015820 | JGI25153J46596_100158202 | 281 |
| 551 | 3300003354 | JGI25160J50197_1000217 | JGI25160J50197_10002174 | 281 |
| 552 | 3300003354 | JGI25160J50197_1001256 | JGI25160J50197_10012567 | 281 |
| 553 | 3300003762 | Ga0055542_1006033 | Ga0055542_10060332 | 281 |
| 554 | 3300003763 | Ga0055529_1007904 | Ga0055529_10079041 | 281 |
| 555 | 3300003771 | Ga0055526_1036322 | Ga0055526_10363222 | 281 |
| 556 | 3300003794 | Ga0055531_10030177 | Ga0055531_100301772 | 281 |
| 557 | 3300004625 | Ga0055543_1003554 | Ga0055543_10035542 | 281 |
| 558 | 3300005262 | Ga0065165_1000244 | Ga0065165_100024484 | 281 |
| 559 | 3300005262 | Ga0065165_1009863 | Ga0065165_10098634 | 281 |
| 560 | 3300005262 | Ga0065165_1013890 | Ga0065165_10138903 | 281 |
| 561 | 3300005331 | Ga0070670_100033635 | Ga0070670_1000336354 | 281 |
| 562 | 3300005336 | Ga0070680_100074670 | Ga0070680_1000746702 | 281 |
| 563 | 3300005337 | Ga0070682_100089046 | Ga0070682_1000890463 | 281 |
| 564 | 3300005341 | Ga0070691_10022142 | Ga0070691_100221424 | 281 |
| 565 | 3300005343 | Ga0070687_100117744 | Ga0070687_1001177441 | 281 |
| 566 | 3300005347 | Ga0070668_100037603 | Ga0070668_1000376033 | 281 |
| 567 | 3300005355 | Ga0070671_100014431 | Ga0070671_1000144316 | 281 |
| 568 | 3300005366 | Ga0070659_100011570 | Ga0070659_1000115706 | 281 |
| 569 | 3300005367 | Ga0070667_100042934 | Ga0070667_1000429343 | 281 |
| 570 | 3300005434 | Ga0070709_10003713 | Ga0070709_100037137 | 281 |
| 571 | 3300005435 | Ga0070714_100035097 | Ga0070714_1000350972 | 281 |
| 572 | 3300005435 | Ga0070714_100304490 | Ga0070714_1003044902 | 281 |
| 573 | 3300005436 | Ga0070713_100040305 | Ga0070713_1000403054 | 281 |
| 574 | 3300005437 | Ga0070710_10000965 | Ga0070710_100009652 | 281 |
| 575 | 3300005439 | Ga0070711_100002283 | Ga0070711_1000022835 | 281 |
| 576 | 3300005439 | Ga0070711_100042604 | Ga0070711_1000426042 | 281 |
| 577 | 3300005441 | Ga0070700_100042261 | Ga0070700_1000422614 | 281 |
| 578 | 3300005445 | Ga0070708_100065204 | Ga0070708_1000652043 | 281 |
| 579 | 3300005456 | Ga0070678_100012356 | Ga0070678_1000123563 | 281 |
| 580 | 3300005457 | Ga0070662_100005484 | Ga0070662_1000054846 | 281 |
| 581 | 3300005457 | Ga0070662_100017092 | Ga0070662_1000170923 | 281 |
| 582 | 3300005457 | Ga0070662_100084801 | Ga0070662_1000848013 | 281 |
| 583 | 3300005466 | Ga0070685_10207574 | Ga0070685_102075742 | 281 |
| 584 | 3300005468 | Ga0070707_100021225 | Ga0070707_1000212252 | 281 |
| 585 | 3300005535 | Ga0070684_100028265 | Ga0070684_1000282653 | 281 |
| 586 | 3300005535 | Ga0070684_100047141 | Ga0070684_1000471414 | 281 |
| 587 | 3300005539 | Ga0068853_100071694 | Ga0068853_1000716943 | 281 |
| 588 | 3300005539 | Ga0068853_100145328 | Ga0068853_1001453282 | 281 |
| 589 | 3300005547 | Ga0070693_100083478 | Ga0070693_1000834782 | 281 |
| 590 | 3300005548 | Ga0070665_100020007 | Ga0070665_1000200072 | 281 |
| 591 | 3300005563 | Ga0068855_100038765 | Ga0068855_1000387653 | 281 |
| 592 | 3300005577 | Ga0068857_100096707 | Ga0068857_1000967072 | 281 |
| 593 | 3300005577 | Ga0068857_100248922 | Ga0068857_1002489222 | 281 |
| 594 | 3300005578 | Ga0068854_100009906 | Ga0068854_1000099063 | 281 |
| 595 | 3300005578 | Ga0068854_100161236 | Ga0068854_1001612362 | 281 |
| 596 | 3300005616 | Ga0068852_100001503 | Ga0068852_10000150310 | 281 |
| 597 | 3300005617 | Ga0068859_100358526 | Ga0068859_1003585263 | 281 |
| 598 | 3300005719 | Ga0068861_100040555 | Ga0068861_1000405554 | 281 |
| 599 | 3300005834 | Ga0068851_10037324 | Ga0068851_100373243 | 281 |
| 600 | 3300005842 | Ga0068858_100343107 | Ga0068858_1003431071 | 281 |
| 601 | 3300005843 | Ga0068860_100082874 | Ga0068860_1000828742 | 281 |
| 602 | 3300005843 | Ga0068860_100143777 | Ga0068860_1001437772 | 281 |
| 603 | 3300005844 | Ga0068862_100017342 | Ga0068862_1000173422 | 281 |
| 604 | 3300006038 | Ga0075365_10007549 | Ga0075365_100075493 | 281 |
| 605 | 3300006042 | Ga0075368_10000322 | Ga0075368_100003226 | 281 |
| 606 | 3300006042 | Ga0075368_10039184 | Ga0075368_100391842 | 281 |
| 607 | 3300006048 | Ga0075363_100001208 | Ga0075363_1000012085 | 281 |
| 608 | 3300006051 | Ga0075364_10015940 | Ga0075364_100159405 | 281 |
| 609 | 3300006051 | Ga0075364_10037918 | Ga0075364_100379183 | 281 |
| 610 | 3300006177 | Ga0075362_10052520 | Ga0075362_100525202 | 281 |
| 611 | 3300006178 | Ga0075367_10004226 | Ga0075367_100042266 | 281 |
| 612 | 3300006186 | Ga0075369_10014616 | Ga0075369_100146164 | 281 |
| 613 | 3300006186 | Ga0075369_10021350 | Ga0075369_100213504 | 281 |
| 614 | 3300006195 | Ga0075366_10002088 | Ga0075366_100020885 | 281 |
| 615 | 3300006195 | Ga0075366_10067769 | Ga0075366_100677692 | 281 |
| 616 | 3300006353 | Ga0075370_10003222 | Ga0075370_100032223 | 281 |
| 617 | 3300006353 | Ga0075370_10026189 | Ga0075370_100261892 | 281 |
| 618 | 3300006881 | Ga0068865_100015129 | Ga0068865_1000151292 | 281 |
| 619 | 3300006931 | Ga0097620_100358551 | Ga0097620_1003585513 | 281 |
| 620 | 3300006941 | Ga0099825_1036759 | Ga0099825_10367592 | 281 |
| 621 | 3300007788 | Ga0099795_10003727 | Ga0099795_100037272 | 281 |
| 622 | 3300009093 | Ga0105240_10008478 | Ga0105240_100084789 | 281 |
| 623 | 3300009093 | Ga0105240_10043555 | Ga0105240_100435553 | 281 |
| 624 | 3300009098 | Ga0105245_10129742 | Ga0105245_101297422 | 281 |
| 625 | 3300009148 | Ga0105243_10052979 | Ga0105243_100529792 | 281 |
| 626 | 3300009174 | Ga0105241_10057857 | Ga0105241_100578572 | 281 |
| 627 | 3300009174 | Ga0105241_10061812 | Ga0105241_100618122 | 281 |
| 628 | 3300009174 | Ga0105241_10418924 | Ga0105241_104189242 | 281 |
| 629 | 3300009545 | Ga0105237_10000892 | Ga0105237_1000089213 | 281 |
| 630 | 3300009545 | Ga0105237_10186583 | Ga0105237_101865832 | 281 |
| 631 | 3300009551 | Ga0105238_10085834 | Ga0105238_100858343 | 281 |
| 632 | 3300009551 | Ga0105238_10279083 | Ga0105238_102790831 | 281 |
| 633 | 3300009551 | Ga0105238_10719310 | Ga0105238_107193101 | 281 |
| 634 | 3300009553 | Ga0105249_10033690 | Ga0105249_100336904 | 281 |
| 635 | 3300010375 | Ga0105239_10007059 | Ga0105239_100070598 | 281 |
| 636 | 3300010375 | Ga0105239_10072876 | Ga0105239_100728762 | 281 |
| 637 | 3300010375 | Ga0105239_10202107 | Ga0105239_102021072 | 281 |
| 638 | 3300010375 | Ga0105239_10631346 | Ga0105239_106313462 | 281 |
| 639 | 3300011119 | Ga0105246_10003773 | Ga0105246_100037733 | 281 |
| 640 | 3300011119 | Ga0105246_10053597 | Ga0105246_100535972 | 281 |
| 641 | 3300013100 | Ga0157373_10115006 | Ga0157373_101150062 | 281 |
| 642 | 3300013104 | Ga0157370_10070803 | Ga0157370_100708032 | 281 |
| 643 | 3300013105 | Ga0157369_10272403 | Ga0157369_102724032 | 281 |
| 644 | 3300013296 | Ga0157374_10013038 | Ga0157374_100130382 | 281 |
| 645 | 3300013297 | Ga0157378_10027386 | Ga0157378_100273862 | 281 |
| 646 | 3300013306 | Ga0163162_10027385 | Ga0163162_100273855 | 281 |
| 647 | 3300013306 | Ga0163162_10068700 | Ga0163162_100687003 | 281 |
| 648 | 3300013308 | Ga0157375_10142753 | Ga0157375_101427532 | 281 |
| 649 | 3300014325 | Ga0163163_10007495 | Ga0163163_100074956 | 281 |
| 650 | 3300014969 | Ga0157376_10024205 | Ga0157376_100242051 | 281 |
| 651 | 3300017792 | Ga0163161_10015068 | Ga0163161_100150682 | 281 |
| 652 | 3300021321 | Ga0214542_1003337 | Ga0214542_10033379 | 281 |
| 653 | 3300021324 | Ga0214545_1000028 | Ga0214545_1000028114 | 281 |
| 654 | 3300021327 | Ga0214543_1000044 | Ga0214543_100004450 | 281 |
| 655 | 3300021388 | Ga0213875_10052511 | Ga0213875_100525112 | 281 |
| 656 | 3300025254 | Ga0209148_1000224 | Ga0209148_100022432 | 281 |
| 657 | 3300025261 | Ga0209233_1006852 | Ga0209233_10068522 | 281 |
| 658 | 3300025272 | Ga0209455_1000635 | Ga0209455_10006352 | 281 |
| 659 | 3300025273 | Ga0209673_1031815 | Ga0209673_10318151 | 281 |
| 660 | 3300025295 | Ga0209564_1002670 | Ga0209564_10026704 | 281 |
| 661 | 3300025295 | Ga0209564_1012359 | Ga0209564_10123592 | 281 |
| 662 | 3300025297 | Ga0209758_1000075 | Ga0209758_100007575 | 281 |
| 663 | 3300025297 | Ga0209758_1000087 | Ga0209758_1000087147 | 281 |
| 664 | 3300025297 | Ga0209758_1001472 | Ga0209758_10014724 | 281 |
| 665 | 3300025297 | Ga0209758_1003696 | Ga0209758_10036966 | 281 |
| 666 | 3300025297 | Ga0209758_1027008 | Ga0209758_10270083 | 281 |
| 667 | 3300025299 | Ga0209256_1022668 | Ga0209256_10226682 | 281 |
| 668 | 3300025299 | Ga0209256_1039435 | Ga0209256_10394351 | 281 |
| 669 | 3300025302 | Ga0207426_1000312 | Ga0207426_10003124 | 281 |
| 670 | 3300025302 | Ga0207426_1006711 | Ga0207426_10067111 | 281 |
| 671 | 3300025304 | Ga0209257_1000382 | Ga0209257_100038272 | 281 |
| 672 | 3300025315 | Ga0207697_10054827 | Ga0207697_100548272 | 281 |
| 673 | 3300025321 | Ga0207656_10103697 | Ga0207656_101036972 | 281 |
| 674 | 3300025899 | Ga0207642_10001994 | Ga0207642_100019944 | 281 |
| 675 | 3300025903 | Ga0207680_10138245 | Ga0207680_101382451 | 281 |
| 676 | 3300025904 | Ga0207647_10006477 | Ga0207647_100064773 | 281 |
| 677 | 3300025906 | Ga0207699_10018815 | Ga0207699_100188152 | 281 |
| 678 | 3300025909 | Ga0207705_10075667 | Ga0207705_100756673 | 281 |
| 679 | 3300025909 | Ga0207705_10136706 | Ga0207705_101367062 | 281 |
| 680 | 3300025911 | Ga0207654_10030151 | Ga0207654_100301512 | 281 |
| 681 | 3300025911 | Ga0207654_10032141 | Ga0207654_100321413 | 281 |
| 682 | 3300025911 | Ga0207654_10049902 | Ga0207654_100499023 | 281 |
| 683 | 3300025912 | Ga0207707_10003822 | Ga0207707_100038226 | 281 |
| 684 | 3300025912 | Ga0207707_10164933 | Ga0207707_101649332 | 281 |
| 685 | 3300025913 | Ga0207695_10000029 | Ga0207695_10000029507 | 281 |
| 686 | 3300025914 | Ga0207671_10005341 | Ga0207671_100053414 | 281 |
| 687 | 3300025914 | Ga0207671_10263917 | Ga0207671_102639171 | 281 |
| 688 | 3300025917 | Ga0207660_10010800 | Ga0207660_100108002 | 281 |
| 689 | 3300025917 | Ga0207660_10065273 | Ga0207660_100652732 | 281 |
| 690 | 3300025917 | Ga0207660_10108606 | Ga0207660_101086062 | 281 |
| 691 | 3300025919 | Ga0207657_10069651 | Ga0207657_100696511 | 281 |
| 692 | 3300025920 | Ga0207649_10192398 | Ga0207649_101923982 | 281 |
| 693 | 3300025922 | Ga0207646_10066283 | Ga0207646_100662834 | 281 |
| 694 | 3300025925 | Ga0207650_10013164 | Ga0207650_100131643 | 281 |
| 695 | 3300025931 | Ga0207644_10068376 | Ga0207644_100683763 | 281 |
| 696 | 3300025932 | Ga0207690_10083625 | Ga0207690_100836252 | 281 |
| 697 | 3300025933 | Ga0207706_10019725 | Ga0207706_100197253 | 281 |
| 698 | 3300025933 | Ga0207706_10021973 | Ga0207706_100219734 | 281 |
| 699 | 3300025935 | Ga0207709_10051024 | Ga0207709_100510242 | 281 |
| 700 | 3300025938 | Ga0207704_10059412 | Ga0207704_100594123 | 281 |
| 701 | 3300025941 | Ga0207711_10084395 | Ga0207711_100843952 | 281 |
| 702 | 3300025944 | Ga0207661_10024749 | Ga0207661_100247495 | 281 |
| 703 | 3300025944 | Ga0207661_10123932 | Ga0207661_101239322 | 281 |
| 704 | 3300025949 | Ga0207667_10135137 | Ga0207667_101351372 | 281 |
| 705 | 3300025949 | Ga0207667_10307621 | Ga0207667_103076212 | 281 |
| 706 | 3300025960 | Ga0207651_10031260 | Ga0207651_100312602 | 281 |
| 707 | 3300025961 | Ga0207712_10035474 | Ga0207712_100354743 | 281 |
| 708 | 3300025972 | Ga0207668_10096171 | Ga0207668_100961713 | 281 |
| 709 | 3300025972 | Ga0207668_10351573 | Ga0207668_103515731 | 281 |
| 710 | 3300025981 | Ga0207640_10006486 | Ga0207640_100064863 | 281 |
| 711 | 3300025981 | Ga0207640_10122726 | Ga0207640_101227262 | 281 |
| 712 | 3300025981 | Ga0207640_10342175 | Ga0207640_103421752 | 281 |
| 713 | 3300025986 | Ga0207658_10108791 | Ga0207658_101087912 | 281 |
| 714 | 3300026041 | Ga0207639_10092498 | Ga0207639_100924982 | 281 |
| 715 | 3300026041 | Ga0207639_10248368 | Ga0207639_102483682 | 281 |
| 716 | 3300026041 | Ga0207639_10446571 | Ga0207639_104465711 | 281 |
| 717 | 3300026067 | Ga0207678_10008862 | Ga0207678_100088624 | 281 |
| 718 | 3300026067 | Ga0207678_10036408 | Ga0207678_100364083 | 281 |
| 719 | 3300026075 | Ga0207708_10049107 | Ga0207708_100491074 | 281 |
| 720 | 3300026078 | Ga0207702_10001454 | Ga0207702_1000145418 | 281 |
| 721 | 3300026078 | Ga0207702_10065504 | Ga0207702_100655042 | 281 |
| 722 | 3300026078 | Ga0207702_10102151 | Ga0207702_101021512 | 281 |
| 723 | 3300026088 | Ga0207641_10562760 | Ga0207641_105627602 | 281 |
| 724 | 3300026089 | Ga0207648_10037025 | Ga0207648_100370252 | 281 |
| 725 | 3300026116 | Ga0207674_10079178 | Ga0207674_100791782 | 281 |
| 726 | 3300026142 | Ga0207698_10018315 | Ga0207698_100183153 | 281 |
| 727 | 3300027296 | Ga0209389_1000137 | Ga0209389_100013757 | 281 |
| 728 | 3300027296 | Ga0209389_1000353 | Ga0209389_10003538 | 281 |
| 729 | 3300027357 | Ga0209589_1003439 | Ga0209589_10034398 | 281 |
| 730 | 3300027361 | Ga0209489_100192 | Ga0209489_10019243 | 281 |
| 731 | 3300027361 | Ga0209489_107326 | Ga0209489_10732612 | 281 |
| 732 | 3300027361 | Ga0209489_107331 | Ga0209489_10733112 | 281 |
| 733 | 3300027363 | Ga0209700_100046 | Ga0209700_10004665 | 281 |
| 734 | 3300027866 | Ga0209813_10003308 | Ga0209813_100033082 | 281 |
| 735 | 3300028379 | Ga0268266_10003426 | Ga0268266_1000342617 | 281 |
| 736 | 3300028379 | Ga0268266_10396811 | Ga0268266_103968111 | 281 |
| 737 | 3300028380 | Ga0268265_10023655 | Ga0268265_100236555 | 281 |
| 738 | 3300028381 | Ga0268264_10108091 | Ga0268264_101080913 | 281 |
| 739 | 3300028563 | Ga0265319_1002640 | Ga0265319_10026407 | 281 |
| 740 | 3300028573 | Ga0265334_10000410 | Ga0265334_1000041015 | 281 |
| 741 | 3300028573 | Ga0265334_10018447 | Ga0265334_100184473 | 281 |
| 742 | 3300028653 | Ga0265323_10000658 | Ga0265323_100006585 | 281 |
| 743 | 3300028666 | Ga0265336_10000063 | Ga0265336_1000006357 | 281 |
| 744 | 3300028800 | Ga0265338_10000154 | Ga0265338_1000015437 | 281 |
| 745 | 3300029957 | Ga0265324_10008680 | Ga0265324_100086802 | 281 |
| 746 | 3300031235 | Ga0265330_10050451 | Ga0265330_100504511 | 281 |
| 747 | 3300031235 | Ga0265330_10058176 | Ga0265330_100581762 | 281 |
| 748 | 3300031235 | Ga0265330_10088551 | Ga0265330_100885511 | 281 |
| 749 | 3300031239 | Ga0265328_10093835 | Ga0265328_100938351 | 281 |
| 750 | 3300031241 | Ga0265325_10039166 | Ga0265325_100391662 | 281 |
| 751 | 3300031247 | Ga0265340_10017726 | Ga0265340_100177264 | 281 |
| 752 | 3300031344 | Ga0265316_10081073 | Ga0265316_100810732 | 281 |
| 753 | 3300033180 | Ga0307510_10024769 | Ga0307510_100247691 | 281 |
| 754 | 3300035086 | Ga0373934_0043616 | Ga0373934_0043616_12_857 | 281 |
| 755 | 3300035091 | Ga0373951_0038484 | Ga0373951_0038484_70_915 | 281 |
| 756 | 3300035113 | Ga0373936_0001079 | Ga0373936_0001079_5636_6481 | 281 |
| 757 | 3300035116 | Ga0373945_0008170 | Ga0373945_0008170_1396_2241 | 281 |
| 758 | 3300035118 | Ga0373954_0029065 | Ga0373954_0029065_1591_2436 | 281 |
| 759 | 3300035119 | Ga0373956_0064226 | Ga0373956_0064226_770_1636 | 281 |
| 760 | 3300035170 | Ga0373943_0003024 | Ga0373943_0003024_3322_4167 | 281 |
| 761 | 3300035171 | Ga0373946_0001257 | Ga0373946_0001257_4676_5521 | 281 |
| 762 | 3300035172 | Ga0373955_0062635 | Ga0373955_0062635_1174_2019 | 281 |
| 763 | 3300035410 | Ga0373924_0059079 | Ga0373924_0059079_367_1233 | 281 |
| 764 | 3300035692 | Ga0373935_0000494 | Ga0373935_0000494_8571_9416 | 281 |
| 765 | 3300035692 | Ga0373935_0026690 | Ga0373935_0026690_1694_2539 | 281 |
| 766 | 3300035695 | Ga0373927_0002352 | Ga0373927_0002352_3970_4815 | 281 |
| 767 | 3300035695 | Ga0373927_0003247 | Ga0373927_0003247_10054_10899 | 281 |
| 768 | 3300035695 | Ga0373927_0025356 | Ga0373927_0025356_1927_2778 | 281 |
| 769 | 3300035695 | Ga0373927_0074932 | Ga0373927_0074932_741_1586 | 281 |
| 770 | 3300035724 | Ga0373933_0046219 | Ga0373933_0046219_1623_2468 | 281 |
| 771 | 3300035724 | Ga0373933_0091492 | Ga0373933_0091492_87_932 | 281 |
| 772 | 3300035725 | Ga0373947_0002117 | Ga0373947_0002117_6583_7449 | 281 |
| 773 | 3300035725 | Ga0373947_0018954 | Ga0373947_0018954_1720_2565 | 281 |
| 774 | 3300035725 | Ga0373947_0019786 | Ga0373947_0019786_2252_3097 | 281 |
| 775 | 3300036401 | Ga0373937_0037849 | Ga0373937_0037849_318_1163 | 281 |
| 776 | 3300037068 | Ga0373925_0007070 | Ga0373925_0007070_6596_7441 | 281 |
| 777 | 3300037068 | Ga0373925_0010310 | Ga0373925_0010310_5407_6252 | 281 |
| 778 | 3300037068 | Ga0373925_0123949 | Ga0373925_0123949_41_886 | 281 |
| 779 | 3300037471 | Ga0395905_0021852 | Ga0395905_0021852_81_944 | 281 |
| 780 | 3300037853 | Ga0436364_1135391 | Ga0436364_1135391_1165_2010 | 281 |
| 781 | 3300039447 | Ga0436361_0394385 | Ga0436361_0394385_1329_2174 | 281 |
| 782 | 3300039453 | Ga0436362_0891589 | Ga0436362_0891589_112_957 | 281 |
| 783 | 3300044656 | Ga0466969_0121896 | Ga0466969_0121896_173_1018 | 281 |
| 784 | 3300044693 | Ga0466961_0036986 | Ga0466961_0036986_2235_3080 | 281 |
| 785 | 3300044765 | Ga0466970_0221241 | Ga0466970_0221241_134_979 | 281 |
| 786 | 3300045049 | Ga0466959_0018100 | Ga0466959_0018100_1099_1944 | 281 |
| 787 | 3300046454 | Ga0495592_0006647 | Ga0495592_0006647_1114_1959 | 281 |
| 788 | 3300046455 | Ga0495603_0000237 | Ga0495603_0000237_24735_25580 | 281 |
| 789 | 3300046455 | Ga0495603_0003340 | Ga0495603_0003340_1153_2019 | 281 |
| 790 | 3300046455 | Ga0495603_0015322 | Ga0495603_0015322_505_1356 | 281 |
| 791 | 3300046459 | Ga0495629_0000772 | Ga0495629_0000772_8619_9464 | 281 |
| 792 | 3300046460 | Ga0495638_0006370 | Ga0495638_0006370_2204_3049 | 281 |
| 793 | 3300046461 | Ga0495641_0004443 | Ga0495641_0004443_7260_8105 | 281 |
| 794 | 3300046472 | Ga0495580_0001324 | Ga0495580_0001324_12429_13274 | 281 |
| 795 | 3300046472 | Ga0495580_0029759 | Ga0495580_0029759_715_1560 | 281 |
| 796 | 3300046472 | Ga0495580_0063318 | Ga0495580_0063318_885_1751 | 281 |
| 797 | 3300046473 | Ga0495582_0000209 | Ga0495582_0000209_21341_22186 | 281 |
| 798 | 3300046473 | Ga0495582_0059605 | Ga0495582_0059605_233_1078 | 281 |
| 799 | 3300046475 | Ga0495639_0000387 | Ga0495639_0000387_70_915 | 281 |
| 800 | 3300046476 | Ga0495662_0000761 | Ga0495662_0000761_3410_4255 | 281 |
| 801 | 3300046477 | Ga0495664_0012587 | Ga0495664_0012587_2482_3327 | 281 |
| 802 | 3300046477 | Ga0495664_0093177 | Ga0495664_0093177_134_979 | 281 |
| 803 | 3300046499 | Ga0495594_0000342 | Ga0495594_0000342_17517_18362 | 281 |
| 804 | 3300046507 | Ga0495606_0014740 | Ga0495606_0014740_3379_4224 | 281 |
| 805 | 3300046511 | Ga0495608_0019186 | Ga0495608_0019186_1094_1960 | 281 |
| 806 | 3300046514 | Ga0495618_0008116 | Ga0495618_0008116_3005_3850 | 281 |
| 807 | 3300046514 | Ga0495618_0036244 | Ga0495618_0036244_2186_3052 | 281 |
| 808 | 3300046516 | Ga0495628_0009216 | Ga0495628_0009216_2164_3009 | 281 |
| 809 | 3300046516 | Ga0495628_0201524 | Ga0495628_0201524_434_1300 | 281 |
| 810 | 3300046516 | Ga0495628_0202193 | Ga0495628_0202193_11_856 | 281 |
| 811 | 3300046517 | Ga0495630_0003363 | Ga0495630_0003363_8718_9563 | 281 |
| 812 | 3300046517 | Ga0495630_0022815 | Ga0495630_0022815_2247_3092 | 281 |
| 813 | 3300046523 | Ga0495644_0026225 | Ga0495644_0026225_95_940 | 281 |
| 814 | 3300046524 | Ga0495648_0040010 | Ga0495648_0040010_820_1665 | 281 |
| 815 | 3300046526 | Ga0495666_0029720 | Ga0495666_0029720_1734_2579 | 281 |
| 816 | 3300046529 | Ga0495652_0033432 | Ga0495652_0033432_2964_3809 | 281 |
| 817 | 3300046529 | Ga0495652_0085364 | Ga0495652_0085364_644_1489 | 281 |
| 818 | 3300046531 | Ga0495665_0000280 | Ga0495665_0000280_14460_15305 | 281 |
| 819 | 3300046533 | Ga0495640_0001578 | Ga0495640_0001578_2405_3250 | 281 |
| 820 | 3300046533 | Ga0495640_0216550 | Ga0495640_0216550_31_897 | 281 |
| 821 | 3300046536 | Ga0495587_0178134 | Ga0495587_0178134_347_1192 | 281 |
| 822 | 3300046543 | Ga0495645_0010457 | Ga0495645_0010457_225_1070 | 281 |
| 823 | 3300046543 | Ga0495645_0075217 | Ga0495645_0075217_920_1765 | 281 |
| 824 | 3300046543 | Ga0495645_0113729 | Ga0495645_0113729_594_1460 | 281 |
| 825 | 3300046557 | Ga0495622_0011893 | Ga0495622_0011893_1209_2054 | 281 |
| 826 | 3300046559 | Ga0495667_0014422 | Ga0495667_0014422_692_1558 | 281 |
| 827 | 3300046559 | Ga0495667_0064231 | Ga0495667_0064231_1546_2391 | 281 |
| 828 | 3300046615 | Ga0495656_0082383 | Ga0495656_0082383_432_1277 | 281 |
| 829 | 3300046642 | Ga0495634_0000865 | Ga0495634_0000865_19666_20511 | 281 |
| 830 | 3300046642 | Ga0495634_0013143 | Ga0495634_0013143_3893_4738 | 281 |
| 831 | 3300046642 | Ga0495634_0059031 | Ga0495634_0059031_244_1110 | 281 |
| 832 | 3300046663 | Ga0495635_0004387 | Ga0495635_0004387_3132_3977 | 281 |
| 833 | 3300046674 | Ga0495588_0068193 | Ga0495588_0068193_258_1103 | 281 |
| 834 | 3300046675 | Ga0495657_0064940 | Ga0495657_0064940_560_1426 | 281 |
| 835 | 3300046678 | Ga0495599_0006315 | Ga0495599_0006315_1256_2101 | 281 |
| 836 | 3300046678 | Ga0495599_0110554 | Ga0495599_0110554_144_989 | 281 |
| 837 | 3300046678 | Ga0495599_0112341 | Ga0495599_0112341_693_1538 | 281 |
| 838 | 3300046678 | Ga0495599_0178968 | Ga0495599_0178968_303_1169 | 281 |
| 839 | 3300046679 | Ga0495623_0076303 | Ga0495623_0076303_1172_2038 | 281 |
| 840 | 3300046679 | Ga0495623_0150420 | Ga0495623_0150420_18_863 | 281 |
| 841 | 3300046680 | Ga0495646_0020456 | Ga0495646_0020456_930_1775 | 281 |
| 842 | 3300046680 | Ga0495646_0166663 | Ga0495646_0166663_308_1153 | 281 |
| 843 | 3300046683 | Ga0495658_0004391 | Ga0495658_0004391_3586_4431 | 281 |
| 844 | 3300046683 | Ga0495658_0008880 | Ga0495658_0008880_182_1027 | 281 |
| 845 | 3300046684 | Ga0495669_0005176 | Ga0495669_0005176_943_1788 | 281 |
| 846 | 3300046689 | Ga0495613_0003086 | Ga0495613_0003086_3025_3870 | 281 |
| 847 | 3300046689 | Ga0495613_0167372 | Ga0495613_0167372_31_897 | 281 |
| 848 | 3300046689 | Ga0495613_0323434 | Ga0495613_0323434_40_885 | 281 |
| 849 | 3300046690 | Ga0495624_0001082 | Ga0495624_0001082_12662_13507 | 281 |
| 850 | 3300046690 | Ga0495624_0096431 | Ga0495624_0096431_836_1702 | 281 |
| 851 | 3300046694 | Ga0495649_0043342 | Ga0495649_0043342_1056_1901 | 281 |
| 852 | 3300046794 | Ga0495589_0107261 | Ga0495589_0107261_494_1339 | 281 |
| 853 | 3300046809 | Ga0495600_0038148 | Ga0495600_0038148_158_1024 | 281 |
| 854 | 3300047315 | Ga0495581_0010372 | Ga0495581_0010372_2528_3373 | 281 |
| 855 | 3300047315 | Ga0495581_0058487 | Ga0495581_0058487_988_1833 | 281 |
| 856 | 3300047319 | Ga0495674_0004372 | Ga0495674_0004372_11110_11955 | 281 |
| 857 | 3300047319 | Ga0495674_0021149 | Ga0495674_0021149_1229_2074 | 281 |
| 858 | 3300047319 | Ga0495674_0024884 | Ga0495674_0024884_263_1108 | 281 |
| 859 | 3300047319 | Ga0495674_0100461 | Ga0495674_0100461_1177_2043 | 281 |
| 860 | 3300047321 | Ga0495676_0071413 | Ga0495676_0071413_1746_2591 | 281 |
| 861 | 3300047321 | Ga0495676_0121617 | Ga0495676_0121617_934_1779 | 281 |
| 862 | 3300047322 | Ga0495680_0151947 | Ga0495680_0151947_130_996 | 281 |
| 863 | 3300047444 | Ga0495675_0077940 | Ga0495675_0077940_770_1636 | 281 |
| 864 | 3300047471 | Ga0495684_0005777 | Ga0495684_0005777_4734_5579 | 281 |
| 865 | 3300047472 | Ga0495686_0023315 | Ga0495686_0023315_852_1697 | 281 |
| 866 | 3300047673 | Ga0495593_0000238 | Ga0495593_0000238_8511_9356 | 281 |
| 867 | 3300047673 | Ga0495593_0007681 | Ga0495593_0007681_1709_2554 | 281 |
| 868 | 3300048089 | Ga0495614_0028011 | Ga0495614_0028011_680_1525 | 281 |
| 869 | 3300048903 | Ga0496100_0071299 | Ga0496100_0071299_104_1093 | 281 |
| 870 | 3300048904 | Ga0496101_0023004 | Ga0496101_0023004_160_1149 | 281 |
| 871 | 3300048905 | Ga0496102_0055964 | Ga0496102_0055964_1139_2128 | 281 |
| 872 | 3300048907 | Ga0496104_0019755 | Ga0496104_0019755_3719_4588 | 281 |
| 873 | 3300048907 | Ga0496104_0194120 | Ga0496104_0194120_252_1097 | 281 |
| 874 | 3300048908 | Ga0496105_0091652 | Ga0496105_0091652_1171_2016 | 281 |
| 875 | 3300048909 | Ga0496106_0080265 | Ga0496106_0080265_894_1763 | 281 |
| 876 | 3300048911 | Ga0496108_0013227 | Ga0496108_0013227_5559_6404 | 281 |
| 877 | 3300048911 | Ga0496108_0023662 | Ga0496108_0023662_3711_4580 | 281 |
| 878 | 3300048912 | Ga0496109_0044910 | Ga0496109_0044910_861_1706 | 281 |
| 879 | 3300048913 | Ga0496110_0044847 | Ga0496110_0044847_1411_2400 | 281 |
| 880 | 3300048915 | Ga0496112_0055817 | Ga0496112_0055817_468_1457 | 281 |
| 881 | 3300048915 | Ga0496112_0119384 | Ga0496112_0119384_920_1765 | 281 |
| 882 | 3300048915 | Ga0496112_0459600 | Ga0496112_0459600_51_896 | 281 |
| 883 | 3300048916 | Ga0496113_0197939 | Ga0496113_0197939_513_1358 | 281 |
| 884 | 3300048917 | Ga0496114_0049745 | Ga0496114_0049745_2298_3287 | 281 |
| 885 | 3300048917 | Ga0496114_0150162 | Ga0496114_0150162_622_1467 | 281 |
| 886 | 3300048918 | Ga0496115_0005249 | Ga0496115_0005249_6665_7654 | 281 |
| 887 | 3300048918 | Ga0496115_0049447 | Ga0496115_0049447_1108_1953 | 281 |
| 888 | 3300048918 | Ga0496115_0131634 | Ga0496115_0131634_237_1082 | 281 |
| 889 | 3300048922 | Ga0496119_0031299 | Ga0496119_0031299_2539_3411 | 281 |
| 890 | 3300048922 | Ga0496119_0057292 | Ga0496119_0057292_52_897 | 281 |
| 891 | 3300048924 | Ga0496121_0001361 | Ga0496121_0001361_3293_4165 | 281 |
| 892 | 3300048929 | Ga0496126_0055894 | Ga0496126_0055894_711_1556 | 281 |
| 893 | 3300049586 | Ga0501070_0033362 | Ga0501070_0033362_2987_3832 | 281 |
| 894 | 3300049741 | Ga0501079_0442365 | Ga0501079_0442365_13_858 | 281 |
| 895 | 3300049742 | Ga0501080_0005894 | Ga0501080_0005894_6640_7485 | 281 |
| 896 | 3300049823 | Ga0501044_0011998 | Ga0501044_0011998_576_1421 | 281 |
| 897 | 3300053077 | Ga0495601_0060441 | Ga0495601_0060441_762_1607 | 281 |
| 898 | 3300053077 | Ga0495601_0222194 | Ga0495601_0222194_342_1208 | 281 |
| 899 | 3300053078 | Ga0495612_0008556 | Ga0495612_0008556_587_1432 | 281 |
| 900 | 3300053085 | Ga0495619_0083357 | Ga0495619_0083357_324_1169 | 281 |
| 901 | 3300053088 | Ga0500644_0112559 | Ga0500644_0112559_132_977 | 281 |
| 902 | 3300053093 | Ga0500651_0012304 | Ga0500651_0012304_3594_4439 | 281 |
| 903 | 3300053102 | Ga0500554_001732 | Ga0500554_001732_2110_2961 | 281 |
| 904 | 3300053105 | Ga0500557_000047 | Ga0500557_000047_1422_2267 | 281 |
| 905 | 3300053119 | Ga0500595_002385 | Ga0500595_002385_8042_8914 | 281 |
| 906 | 3300053119 | Ga0500595_027503 | Ga0500595_027503_452_1297 | 281 |
| 907 | 3300053123 | Ga0500614_049953 | Ga0500614_049953_69_914 | 281 |
| 908 | 3300053134 | Ga0500658_0008212 | Ga0500658_0008212_1122_1967 | 281 |
| 909 | 3300053136 | Ga0500559_0002659 | Ga0500559_0002659_5741_6586 | 281 |
| 910 | 3300053142 | Ga0500577_0014053 | Ga0500577_0014053_1507_2352 | 281 |
| 911 | 3300053146 | Ga0500588_0018546 | Ga0500588_0018546_787_1632 | 281 |
| 912 | 3300053150 | Ga0500603_000324 | Ga0500603_000324_4336_5187 | 281 |
| 913 | 3300053177 | Ga0500636_0045565 | Ga0500636_0045565_46_891 | 281 |
| 914 | 3300053177 | Ga0500636_0162117 | Ga0500636_0162117_268_1113 | 281 |
| 915 | 3300053178 | Ga0500637_0000582 | Ga0500637_0000582_2153_3004 | 281 |
| 916 | 3300053725 | Ga0500576_005569 | Ga0500576_005569_3233_4078 | 281 |
| 917 | 3300053731 | Ga0500609_002144 | Ga0500609_002144_1075_1920 | 281 |
| 918 | 3300053737 | Ga0500601_000014 | Ga0500601_000014_34189_35034 | 281 |
| 919 | 3300055283 | Ga0500661_001823 | Ga0500661_001823_2439_3284 | 281 |
| 920 | iso_pu_bacteria | 2513237141 | 2513888386 | 281 |
| 921 | iso_pu_bacteria | 2885366525 | 2885367411 | 281 |
| 922 | iso_pu_bacteria | 2922393267 | 2922399304 | 281 |
| 923 | iso_pu_bacteria | 2932801729 | 2932803637 | 281 |
| 924 | iso_pu_bacteria | 3005483717 | 3005486314 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9177 | 22 | 241 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9162 | 22 | 241 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9146 | 23 | 241 |
| 4jbw-assembly1.cif.gz_A | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.9058 | 23 | 241 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9034 | 25 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9648 | 25 | 267 | 3.40.50.300 |
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9493 | 25 | 267 | 3.40.50.300 |
| af_Q47538_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9309 | 24 | 259 | 3.40.50.300 |
| af_Q47538_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9234 | 24 | 259 | 3.40.50.300 |
| af_Q2G1I6_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9232 | 24 | 271 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534WP09-F1-model_v4 | ABC transporter ATP-binding protein | 0.96 | 21 | 272 |
GO:0005524
GO:0016887 |
| AF-A0A536PA20-F1-model_v4 | ABC transporter ATP-binding protein | 0.9581 | 22 | 277 |
GO:0005524
GO:0016887 |
| AF-A0A534UJK3-F1-model_v4 | ABC transporter ATP-binding protein | 0.957 | 24 | 271 |
GO:0005524
GO:0016887 |
| AF-A0A1F4EWG6-F1-model_v4 | ABC transporter | 0.9568 | 21 | 272 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A132MFY1-F1-model_v4 | Mannosyltransferase | 0.9568 | 24 | 272 |
GO:0005524
GO:0016757 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar