F485842

General Info

Members Datasets Scaffolds Average Seq Length
923 433 922 151

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237141|2513893869
Length 187
Sequence PCPDRSQAYTRQRSSSINGTGHPRRKVRRVLEGSGGMLKSIDPMLNADVLYALRAMGHGDDLVLCDTNFPADAVARQTVLGQLLRIDNVPASRAARAILSVLPLDSFVDQPALRMEIVGQPDEIPPVQLEVQREIDAAEGRPFPMGSIERFAFYELAKKAYCVVQTGERRFYGCFVFKKGVIAPDAT

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
111 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
203 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
204 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
205 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
206 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
207 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
222 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
229 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
230 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
250 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
251 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
252 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
253 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
254 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
255 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
256 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
257 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
258 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
267 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
268 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
279 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
280 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
281 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
282 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
283 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
284 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
285 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
292 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
293 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
305 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
306 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
307 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
308 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
313 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
320 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
321 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
322 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
341 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
347 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
368 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
382 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
383 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
384 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
385 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
386 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
387 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
388 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
389 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
390 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
391 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
392 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
393 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
394 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
395 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
396 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
397 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
398 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
399 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
400 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
401 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
402 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
403 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
404 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
405 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
406 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
407 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
408 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
409 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
410 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
411 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
412 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
413 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
414 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
415 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
416 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
417 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
418 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
419 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
420 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
421 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
422 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
423 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
424 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
425 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
426 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
427 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
428 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
429 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
430 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
431 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
432 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
433 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.65
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.15
Nodule 1.08
Rhizoplane 3.14
Rhizosphere 69.77
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1005418 3300002739 Bacteria 1872
2 JGI25158J39367_1009134 3300002739 Bacteria 1363
3 JGI25152J39213_1011261 3300002773 Bacteria 1988
4 JGI25152J39213_1011297 3300002773 Bacteria 1982
5 JGI25150J39212_1002359 3300002774 Bacteria 4739
6 JGI25150J39212_1022189 3300002774 Bacteria 957
7 JGI25159J45721_1011623 3300002987 Bacteria 2145
8 JGI25159J45721_1012728 3300002987 Bacteria 1988
9 JGI25151J46595_10000406 3300003187 Bacteria 44525
10 JGI25151J46595_10033255 3300003187 Bacteria 1988
11 JGI25151J46595_10064048 3300003187 Bacteria 1153
12 JGI25153J46596_10027553 3300003215 Bacteria 1988
13 rootL2_10141541 3300003322 Bacteria 4350
14 JGI25160J50197_1015392 3300003354 Bacteria 2511
15 JGI25160J50197_1020567 3300003354 Bacteria 1988
16 JGI25161J50226_1006911 3300003374 Bacteria 1983
17 JGI25161J50226_1010928 3300003374 Bacteria 1174
18 Ga0006562J51391_1040460 3300003578 Bacteria 4850
19 Ga0006562J51391_1124565 3300003578 Bacteria 2460
20 Ga0006562J51391_1124567 3300003578 Bacteria 4070
21 Ga0055535_1000472 3300003761 Bacteria 36632
22 Ga0055542_1000103 3300003762 Bacteria 114989
23 Ga0055526_1018877 3300003771 Bacteria 2544
24 Ga0055526_1018911 3300003771 Bacteria 2538
25 Ga0055537_1003586 3300003773 Bacteria 4733
26 Ga0055537_1007518 3300003773 Bacteria 2618
27 Ga0055524_1017335 3300003775 Bacteria 2544
28 Ga0055524_1017395 3300003775 Bacteria 2538
29 Ga0055536_1010899 3300003781 Bacteria 3547
30 Ga0055536_1034514 3300003781 Bacteria 1276
31 Ga0055534_1010192 3300003784 Bacteria 1988
32 Ga0055534_1012069 3300003784 Bacteria 1726
33 Ga0055528_1016979 3300003790 Bacteria 2544
34 Ga0055528_1030302 3300003790 Bacteria 1439
35 Ga0055530_10000237 3300003791 Bacteria 49495
36 Ga0055540_1007368 3300003792 Bacteria 4169
37 Ga0055540_1008403 3300003792 Bacteria 3724
38 Ga0055531_10011793 3300003794 Bacteria 4173
39 Ga0055531_10011817 3300003794 Bacteria 4168
40 Ga0055543_1003354 3300004625 Bacteria 4771
41 Ga0055543_1009200 3300004625 Bacteria 2138
42 Ga0065165_1008049 3300005262 Bacteria 5034
43 Ga0065165_1114842 3300005262 Bacteria 658
44 Ga0065714_10075296 3300005288 Bacteria 2923
45 Ga0070658_10019982 3300005327 Bacteria 5364
46 Ga0070658_10032376 3300005327 Bacteria 4203
47 Ga0070658_10261262 3300005327 Bacteria 1470
48 Ga0070658_10271873 3300005327 Bacteria 1441
49 Ga0070658_11378341 3300005327 Bacteria 612
50 Ga0070683_100006332 3300005329 Bacteria 9926
51 Ga0070683_100067646 3300005329 Bacteria 3327
52 Ga0070683_100135431 3300005329 Bacteria 2332
53 Ga0070680_100015348 3300005336 Bacteria 6003
54 Ga0070680_100114202 3300005336 Bacteria 2250
55 Ga0070680_100233794 3300005336 Bacteria 1553
56 Ga0070680_100714838 3300005336 Bacteria 862
57 Ga0070682_100239938 3300005337 Bacteria 1301
58 Ga0070682_101040592 3300005337 Bacteria 682
59 Ga0068868_100225216 3300005338 Bacteria 1571
60 Ga0068868_101085255 3300005338 Bacteria 736
61 Ga0070660_100001578 3300005339 Bacteria 15674
62 Ga0070660_100015849 3300005339 Bacteria 5455
63 Ga0070660_100120289 3300005339 Bacteria 2095
64 Ga0070691_10008185 3300005341 Bacteria 4791
65 Ga0070691_10123137 3300005341 Bacteria 1307
66 Ga0070661_100279978 3300005344 Bacteria 1293
67 Ga0070661_100697843 3300005344 Bacteria 827
68 Ga0070668_100040395 3300005347 Bacteria 3569
69 Ga0070668_100421488 3300005347 Bacteria 1143
70 Ga0070668_101382104 3300005347 Bacteria 642
71 Ga0070669_100149021 3300005353 Bacteria 1810
72 Ga0070669_100250414 3300005353 Unclassified 1410
73 Ga0070671_100013007 3300005355 Bacteria 6707
74 Ga0070659_100017552 3300005366 Bacteria 5391
75 Ga0070659_100038550 3300005366 Bacteria 3727
76 Ga0070659_100154348 3300005366 Bacteria 1874
77 Ga0070659_101044432 3300005366 Bacteria 718
78 Ga0070667_100156905 3300005367 Bacteria 2002
79 Ga0070667_100396854 3300005367 Bacteria 1255
80 Ga0070709_10010591 3300005434 Bacteria 5111
81 Ga0070709_10199064 3300005434 Bacteria 1418
82 Ga0070714_100099670 3300005435 Bacteria 2557
83 Ga0070714_100148001 3300005435 Bacteria 2114
84 Ga0070714_100308818 3300005435 Bacteria 1476
85 Ga0070713_100004448 3300005436 Bacteria 9418
86 Ga0070713_100030867 3300005436 Bacteria 4262
87 Ga0070713_100615382 3300005436 Bacteria 1033
88 Ga0070713_100997171 3300005436 Bacteria 808
89 Ga0070710_10001577 3300005437 Bacteria 10759
90 Ga0070710_10075838 3300005437 Bacteria 1950
91 Ga0070710_10508384 3300005437 Bacteria 826
92 Ga0070711_100014177 3300005439 Bacteria 5018
93 Ga0070711_100019753 3300005439 Bacteria 4328
94 Ga0070663_100040167 3300005455 Bacteria 3274
95 Ga0070663_100084680 3300005455 Bacteria 2338
96 Ga0070663_100119562 3300005455 Bacteria 1988
97 Ga0070663_100153459 3300005455 Bacteria 1768
98 Ga0070678_100531447 3300005456 Bacteria 1042
99 Ga0070662_100091653 3300005457 Bacteria 2283
100 Ga0070662_101011728 3300005457 Bacteria 712
101 Ga0070681_10091120 3300005458 Bacteria 2999
102 Ga0068867_100273395 3300005459 Bacteria 1382
103 Ga0070685_10830052 3300005466 Bacteria 683
104 Ga0070706_100069093 3300005467 Bacteria 3267
105 Ga0070706_100966941 3300005467 Bacteria 786
106 Ga0070707_100054741 3300005468 Bacteria 3826
107 Ga0070707_100564913 3300005468 Bacteria 1100
108 Ga0070698_100072440 3300005471 Bacteria 3453
109 Ga0070698_100200459 3300005471 Bacteria 1932
110 Ga0070699_100157516 3300005518 Bacteria 2010
111 Ga0070699_100567984 3300005518 Bacteria 1033
112 Ga0070679_100045942 3300005530 Bacteria 4351
113 Ga0070679_100107906 3300005530 Bacteria 2770
114 Ga0070684_100127371 3300005535 Bacteria 2295
115 Ga0068853_100002181 3300005539 Bacteria 14587
116 Ga0068853_100005480 3300005539 Bacteria 9944
117 Ga0068853_100088454 3300005539 Bacteria 2719
118 Ga0070686_101449655 3300005544 Bacteria 577
119 Ga0070665_100098102 3300005548 Bacteria 2935
120 Ga0070704_100334497 3300005549 Bacteria 1273
121 Ga0068855_100000423 3300005563 Bacteria 52174
122 Ga0068855_100016471 3300005563 Bacteria 8889
123 Ga0068855_100037105 3300005563 Bacteria 5798
124 Ga0068855_100074913 3300005563 Bacteria 3930
125 Ga0068855_100083890 3300005563 Bacteria 3691
126 Ga0068855_100165212 3300005563 Bacteria 2510
127 Ga0068855_100189756 3300005563 Bacteria 2319
128 Ga0068855_100296346 3300005563 Bacteria 1792
129 Ga0068855_100465620 3300005563 Bacteria 1378
130 Ga0070664_100101995 3300005564 Bacteria 2496
131 Ga0070664_100206154 3300005564 Bacteria 1756
132 Ga0070664_100241353 3300005564 Bacteria 1622
133 Ga0068857_100017952 3300005577 Bacteria 6206
134 Ga0068857_100133082 3300005577 Bacteria 2244
135 Ga0068857_100216154 3300005577 Bacteria 1750
136 Ga0068854_100013039 3300005578 Bacteria 5448
137 Ga0068854_100094075 3300005578 Bacteria 2235
138 Ga0068854_100346883 3300005578 Bacteria 1214
139 Ga0068856_100181698 3300005614 Bacteria 2116
140 Ga0068856_100255084 3300005614 Bacteria 1769
141 Ga0068856_100417466 3300005614 Bacteria 1362
142 Ga0068856_101030719 3300005614 Bacteria 841
143 Ga0068852_100014980 3300005616 Bacteria 5992
144 Ga0068852_100015610 3300005616 Bacteria 5899
145 Ga0068852_100465596 3300005616 Bacteria 1254
146 Ga0068859_100919482 3300005617 Bacteria 959
147 Ga0068864_100306401 3300005618 Bacteria 1488
148 Ga0068866_10710168 3300005718 Bacteria 690
149 Ga0068861_100681114 3300005719 Bacteria 953
150 Ga0068851_10024638 3300005834 Bacteria 2946
151 Ga0068851_10096248 3300005834 Bacteria 1565
152 Ga0068851_10155634 3300005834 Bacteria 1252
153 Ga0068863_100020128 3300005841 Bacteria 6383
154 Ga0068860_101157934 3300005843 Bacteria 793
155 Ga0068862_100004007 3300005844 Bacteria 12490
156 Ga0068862_100036231 3300005844 Bacteria 4181
157 Ga0068862_100491887 3300005844 Bacteria 1163
158 Ga0081540_1006124 3300005983 Bacteria 8835
159 Ga0081540_1011066 3300005983 Bacteria 6057
160 Ga0081539_10171338 3300005985 Bacteria 1026
161 Ga0070717_10002120 3300006028 Bacteria 13913
162 Ga0070717_10006962 3300006028 Bacteria 8359
163 Ga0070717_10115331 3300006028 Bacteria 2296
164 Ga0070717_10241165 3300006028 Bacteria 1594
165 Ga0070717_10288364 3300006028 Bacteria 1457
166 Ga0070717_10688300 3300006028 Bacteria 929
167 Ga0075368_10035169 3300006042 Bacteria 1954
168 Ga0075363_100023308 3300006048 Bacteria 3135
169 Ga0075364_10180263 3300006051 Bacteria 1429
170 Ga0070715_10307728 3300006163 Bacteria 850
171 Ga0070716_100019421 3300006173 Bacteria 3552
172 Ga0070716_100281913 3300006173 Unclassified 1147
173 Ga0070716_100324534 3300006173 Bacteria 1080
174 Ga0070716_100396830 3300006173 Bacteria 991
175 Ga0070716_100958618 3300006173 Bacteria 674
176 Ga0070712_100007666 3300006175 Bacteria 6752
177 Ga0070712_100226681 3300006175 Bacteria 1482
178 Ga0075362_10020220 3300006177 Bacteria 2779
179 Ga0075362_10157620 3300006177 Bacteria 1092
180 Ga0075367_10006033 3300006178 Bacteria 6086
181 Ga0075367_10048006 3300006178 Bacteria 2513
182 Ga0075367_10069338 3300006178 Bacteria 2117
183 Ga0075367_10176884 3300006178 Bacteria 1330
184 Ga0075369_10521636 3300006186 Bacteria 566
185 Ga0075366_10013951 3300006195 Bacteria 4582
186 Ga0075366_10018767 3300006195 Bacteria 3996
187 Ga0075366_10039267 3300006195 Bacteria 2798
188 Ga0075366_10075959 3300006195 Bacteria 2005
189 Ga0075366_10108242 3300006195 Bacteria 1671
190 Ga0097621_100176247 3300006237 Bacteria 1845
191 Ga0075370_10002986 3300006353 Bacteria 7958
192 Ga0075370_10006253 3300006353 Bacteria 5978
193 Ga0075370_10092007 3300006353 Bacteria 1750
194 Ga0075370_10143668 3300006353 Bacteria 1396
195 Ga0075429_101151232 3300006880 Bacteria 677
196 Ga0068865_100677894 3300006881 Bacteria 879
197 Ga0097620_100919699 3300006931 Bacteria 959
198 Ga0099824_1025033 3300006942 Bacteria 3356
199 Ga0079104_1054443 3300006946 Bacteria 880
200 Ga0075435_100499031 3300007076 Bacteria 1052
201 Ga0099794_10016877 3300007265 Bacteria 3244
202 Ga0099794_10727777 3300007265 Bacteria 529
203 Ga0099795_10076871 3300007788 Bacteria 1270
204 Ga0105244_10048587 3300009036 Bacteria 2171
205 Ga0105240_10009195 3300009093 Bacteria 14013
206 Ga0105240_10027146 3300009093 Bacteria 7501
207 Ga0105240_10044578 3300009093 Bacteria 5635
208 Ga0105240_10510383 3300009093 Bacteria 1336
209 Ga0105240_10667183 3300009093 Bacteria 1138
210 Ga0105240_11191874 3300009093 Bacteria 807
211 Ga0105245_10136471 3300009098 Bacteria 2306
212 Ga0105247_10244317 3300009101 Bacteria 1224
213 Ga0105247_10254721 3300009101 Bacteria 1201
214 Ga0105243_10121266 3300009148 Bacteria 2204
215 Ga0105243_10178363 3300009148 Bacteria 1845
216 Ga0105243_10460035 3300009148 Bacteria 1196
217 Ga0105243_10524314 3300009148 Bacteria 1127
218 Ga0105241_10025534 3300009174 Bacteria 4391
219 Ga0105241_10068019 3300009174 Bacteria 2758
220 Ga0105242_10373470 3300009176 Bacteria 1323
221 Ga0105242_10654445 3300009176 Bacteria 1022
222 Ga0105242_10794996 3300009176 Bacteria 936
223 Ga0105242_12412674 3300009176 Bacteria 573
224 Ga0105237_10003331 3300009545 Bacteria 19133
225 Ga0105237_10019368 3300009545 Bacteria 7029
226 Ga0105237_10127158 3300009545 Bacteria 2543
227 Ga0105237_10481321 3300009545 Bacteria 1247
228 Ga0105237_10968939 3300009545 Bacteria 857
229 Ga0105238_10000062 3300009551 Bacteria 126356
230 Ga0105238_10016145 3300009551 Bacteria 7554
231 Ga0105238_10093716 3300009551 Bacteria 2991
232 Ga0105238_10302661 3300009551 Bacteria 1583
233 Ga0105238_10406754 3300009551 Bacteria 1355
234 Ga0105238_10654740 3300009551 Bacteria 1061
235 Ga0105249_10493335 3300009553 Bacteria 1269
236 Ga0099796_10448650 3300010159 Bacteria 573
237 Ga0105239_10001306 3300010375 Bacteria 33607
238 Ga0105239_10001659 3300010375 Bacteria 29335
239 Ga0105239_10044705 3300010375 Bacteria 4854
240 Ga0105239_10127565 3300010375 Bacteria 2828
241 Ga0105239_11349824 3300010375 Bacteria 823
242 Ga0105239_11392139 3300010375 Bacteria 810
243 Ga0105246_10025297 3300011119 Bacteria 3869
244 Ga0105246_10166409 3300011119 Bacteria 1684
245 Ga0105246_10294857 3300011119 Bacteria 1306
246 Ga0105246_11023442 3300011119 Bacteria 749
247 Ga0157347_1000658 3300012502 Bacteria 2360
248 Ga0157339_1019418 3300012505 Bacteria 709
249 Ga0157373_10090246 3300013100 Bacteria 2158
250 Ga0157371_10068435 3300013102 Bacteria 2513
251 Ga0157370_10017529 3300013104 Bacteria 7225
252 Ga0157370_10036407 3300013104 Bacteria 4775
253 Ga0157370_10203342 3300013104 Bacteria 1837
254 Ga0157370_10243453 3300013104 Bacteria 1664
255 Ga0157370_10273729 3300013104 Bacteria 1560
256 Ga0157369_10000280 3300013105 Bacteria 68583
257 Ga0157369_10016139 3300013105 Bacteria 8406
258 Ga0157369_10017304 3300013105 Bacteria 8103
259 Ga0157369_10035212 3300013105 Bacteria 5490
260 Ga0157369_10235749 3300013105 Bacteria 1912
261 Ga0157369_11434428 3300013105 Bacteria 703
262 Ga0171462_1008 3300013250 Bacteria 384318
263 Ga0157374_10016468 3300013296 Bacteria 6499
264 Ga0157374_10173708 3300013296 Bacteria 2103
265 Ga0157374_10888654 3300013296 Bacteria 908
266 Ga0157378_10169141 3300013297 Bacteria 2049
267 Ga0157378_10374389 3300013297 Bacteria 1397
268 Ga0157378_11482469 3300013297 Bacteria 723
269 Ga0163162_10709290 3300013306 Bacteria 1127
270 Ga0157372_10128397 3300013307 Bacteria 2915
271 Ga0157372_10341267 3300013307 Bacteria 1745
272 Ga0157372_10494282 3300013307 Bacteria 1426
273 Ga0157372_10796512 3300013307 Bacteria 1098
274 Ga0157375_10704688 3300013308 Bacteria 1163
275 Ga0157375_11797543 3300013308 Bacteria 727
276 Ga0163163_10013499 3300014325 Bacteria 7483
277 Ga0182008_10027012 3300014497 Bacteria 2909
278 Ga0182008_10037106 3300014497 Bacteria 2438
279 Ga0182008_10127263 3300014497 Bacteria 1269
280 Ga0157377_10618808 3300014745 Bacteria 775
281 Ga0182006_1001443 3300015261 Bacteria 14339
282 Ga0182006_1001447 3300015261 Bacteria 14319
283 Ga0182006_1241454 3300015261 Bacteria 594
284 Ga0182005_1024095 3300015265 Bacteria 1663
285 Ga0163161_10000072 3300017792 Bacteria 102352
286 Ga0206354_10978505 3300020081 Bacteria 1571
287 Ga0206354_11625524 3300020081 Bacteria 669
288 Ga0213873_10018658 3300021358 Bacteria 1598
289 Ga0213874_10151608 3300021377 Bacteria 809
290 Ga0213874_10158291 3300021377 Bacteria 794
291 Ga0213876_10003157 3300021384 Bacteria 9485
292 Ga0213876_10007769 3300021384 Bacteria 5821
293 Ga0213876_10024863 3300021384 Bacteria 3163
294 Ga0209436_104233 3300025208 Bacteria 3588
295 Ga0209436_104647 3300025208 Bacteria 3343
296 Ga0209672_101222 3300025228 Bacteria 10370
297 Ga0209147_100352 3300025229 Bacteria 33384
298 Ga0209258_100133 3300025242 Bacteria 174846
299 Ga0207425_1000352 3300025245 Bacteria 31908
300 Ga0207425_1012932 3300025245 Bacteria 1942
301 Ga0209148_1000188 3300025254 Bacteria 117310
302 Ga0209129_1000245 3300025258 Bacteria 56975
303 Ga0209129_1003468 3300025258 Bacteria 6835
304 Ga0209129_1004337 3300025258 Bacteria 5595
305 Ga0209129_1005779 3300025258 Bacteria 4236
306 Ga0209129_1034824 3300025258 Bacteria 822
307 Ga0209565_1000165 3300025263 Bacteria 86871
308 Ga0209565_1006089 3300025263 Bacteria 3425
309 Ga0209455_1000991 3300025272 Bacteria 14310
310 Ga0209673_1000454 3300025273 Bacteria 69331
311 Ga0209673_1001222 3300025273 Bacteria 27158
312 Ga0209673_1002781 3300025273 Bacteria 11385
313 Ga0209130_1000658 3300025284 Bacteria 31621
314 Ga0209130_1001097 3300025284 Bacteria 20097
315 Ga0209130_1012675 3300025284 Bacteria 2192
316 Ga0209675_1000823 3300025291 Bacteria 20435
317 Ga0209675_1011933 3300025291 Bacteria 2838
318 Ga0209676_1000111 3300025292 Bacteria 213411
319 Ga0209676_1010951 3300025292 Bacteria 3713
320 Ga0209025_1000157 3300025294 Bacteria 168790
321 Ga0209025_1000615 3300025294 Bacteria 64022
322 Ga0209025_1013697 3300025294 Bacteria 5068
323 Ga0209564_1000070 3300025295 Bacteria 303126
324 Ga0209564_1000352 3300025295 Bacteria 85941
325 Ga0209758_1000297 3300025297 Bacteria 97664
326 Ga0209758_1017089 3300025297 Bacteria 3639
327 Ga0209050_1000111 3300025298 Bacteria 213411
328 Ga0209256_1000047 3300025299 Bacteria 314709
329 Ga0209256_1000238 3300025299 Bacteria 97664
330 Ga0207426_1000194 3300025302 Bacteria 150009
331 Ga0207426_1000294 3300025302 Bacteria 98700
332 Ga0209051_1000046 3300025303 Bacteria 296424
333 Ga0209051_1036611 3300025303 Bacteria 1810
334 Ga0209257_1000344 3300025304 Bacteria 96578
335 Ga0209257_1004797 3300025304 Bacteria 10075
336 Ga0209257_1012644 3300025304 Bacteria 3869
337 Ga0207656_10006816 3300025321 Bacteria 4130
338 Ga0207656_10009713 3300025321 Bacteria 3577
339 Ga0207656_10071923 3300025321 Bacteria 1538
340 Ga0207692_10016579 3300025898 Bacteria 3267
341 Ga0207710_10377598 3300025900 Bacteria 725
342 Ga0207710_10468898 3300025900 Bacteria 651
343 Ga0207688_10034380 3300025901 Bacteria 2807
344 Ga0207680_10237913 3300025903 Bacteria 1254
345 Ga0207685_10254593 3300025905 Bacteria 850
346 Ga0207699_10217536 3300025906 Bacteria 1302
347 Ga0207705_10009898 3300025909 Bacteria 6941
348 Ga0207705_10017143 3300025909 Bacteria 5189
349 Ga0207684_10018442 3300025910 Bacteria 5975
350 Ga0207654_10292123 3300025911 Bacteria 1106
351 Ga0207707_10000363 3300025912 Bacteria 47616
352 Ga0207707_10000381 3300025912 Bacteria 46274
353 Ga0207707_10038137 3300025912 Bacteria 4199
354 Ga0207695_10000429 3300025913 Bacteria 92640
355 Ga0207695_10036629 3300025913 Bacteria 5301
356 Ga0207695_10076011 3300025913 Bacteria 3415
357 Ga0207695_10227547 3300025913 Bacteria 1770
358 Ga0207695_10344111 3300025913 Bacteria 1379
359 Ga0207695_10884654 3300025913 Bacteria 773
360 Ga0207671_10006678 3300025914 Bacteria 10222
361 Ga0207671_10030086 3300025914 Bacteria 4050
362 Ga0207671_10656899 3300025914 Bacteria 835
363 Ga0207693_10012494 3300025915 Bacteria 6858
364 Ga0207693_10179760 3300025915 Bacteria 1664
365 Ga0207660_10001000 3300025917 Bacteria 18768
366 Ga0207660_10230057 3300025917 Bacteria 1457
367 Ga0207660_10419730 3300025917 Bacteria 1079
368 Ga0207657_10000999 3300025919 Bacteria 30070
369 Ga0207657_10003720 3300025919 Bacteria 16206
370 Ga0207657_10012289 3300025919 Bacteria 8459
371 Ga0207649_10028628 3300025920 Bacteria 3281
372 Ga0207652_10001277 3300025921 Bacteria 22426
373 Ga0207652_10055493 3300025921 Bacteria 3408
374 Ga0207652_11083475 3300025921 Bacteria 701
375 Ga0207646_10110086 3300025922 Bacteria 2472
376 Ga0207646_10160356 3300025922 Bacteria 2029
377 Ga0207681_10594427 3300025923 Unclassified 914
378 Ga0207681_10691055 3300025923 Bacteria 848
379 Ga0207694_10000359 3300025924 Bacteria 42962
380 Ga0207694_10024718 3300025924 Bacteria 4563
381 Ga0207694_10536881 3300025924 Bacteria 981
382 Ga0207694_10989758 3300025924 Bacteria 711
383 Ga0207694_11054105 3300025924 Bacteria 688
384 Ga0207650_10061875 3300025925 Bacteria 2795
385 Ga0207700_10258875 3300025928 Unclassified 1489
386 Ga0207700_10338994 3300025928 Bacteria 1307
387 Ga0207700_10354379 3300025928 Bacteria 1278
388 Ga0207700_10515401 3300025928 Bacteria 1059
389 Ga0207700_11610333 3300025928 Bacteria 574
390 Ga0207664_10095101 3300025929 Bacteria 2451
391 Ga0207664_10194238 3300025929 Bacteria 1749
392 Ga0207644_10226051 3300025931 Bacteria 1485
393 Ga0207690_10024960 3300025932 Bacteria 3748
394 Ga0207690_10058242 3300025932 Bacteria 2612
395 Ga0207690_10315162 3300025932 Bacteria 1228
396 Ga0207690_10737849 3300025932 Bacteria 811
397 Ga0207706_10062308 3300025933 Bacteria 3284
398 Ga0207706_10085280 3300025933 Bacteria 2777
399 Ga0207709_10041320 3300025935 Bacteria 2766
400 Ga0207709_10298479 3300025935 Bacteria 1197
401 Ga0207704_10891445 3300025938 Bacteria 748
402 Ga0207704_11686589 3300025938 Bacteria 545
403 Ga0207665_10002228 3300025939 Bacteria 13082
404 Ga0207665_10496271 3300025939 Bacteria 942
405 Ga0207665_10633838 3300025939 Bacteria 837
406 Ga0207665_11317597 3300025939 Bacteria 576
407 Ga0207711_10322251 3300025941 Bacteria 1428
408 Ga0207661_10008299 3300025944 Bacteria 7420
409 Ga0207661_10464889 3300025944 Bacteria 1153
410 Ga0207661_10767168 3300025944 Bacteria 888
411 Ga0207679_10480848 3300025945 Bacteria 1106
412 Ga0207679_10866487 3300025945 Bacteria 825
413 Ga0207667_10000028 3300025949 Bacteria 334510
414 Ga0207667_10007770 3300025949 Bacteria 12820
415 Ga0207667_10013965 3300025949 Bacteria 9173
416 Ga0207667_10019832 3300025949 Bacteria 7494
417 Ga0207667_10049335 3300025949 Bacteria 4446
418 Ga0207667_10548572 3300025949 Bacteria 1169
419 Ga0207651_10461386 3300025960 Bacteria 1092
420 Ga0207668_10187751 3300025972 Bacteria 1635
421 Ga0207668_10258212 3300025972 Bacteria 1418
422 Ga0207640_10016150 3300025981 Bacteria 4336
423 Ga0207640_10091962 3300025981 Bacteria 2103
424 Ga0207640_10117685 3300025981 Bacteria 1897
425 Ga0207640_10246813 3300025981 Bacteria 1383
426 Ga0207640_10330806 3300025981 Bacteria 1217
427 Ga0207658_10119292 3300025986 Bacteria 2100
428 Ga0207658_10263531 3300025986 Bacteria 1470
429 Ga0207658_10664774 3300025986 Bacteria 940
430 Ga0207677_10319476 3300026023 Bacteria 1290
431 Ga0207677_10834059 3300026023 Bacteria 827
432 Ga0207677_10849350 3300026023 Bacteria 820
433 Ga0207677_11112435 3300026023 Bacteria 720
434 Ga0207703_10376367 3300026035 Bacteria 1312
435 Ga0207639_10020183 3300026041 Bacteria 4767
436 Ga0207639_10027605 3300026041 Bacteria 4137
437 Ga0207639_10079803 3300026041 Bacteria 2587
438 Ga0207639_10182245 3300026041 Bacteria 1787
439 Ga0207678_10010157 3300026067 Bacteria 8262
440 Ga0207678_10039882 3300026067 Bacteria 4074
441 Ga0207678_10247950 3300026067 Bacteria 1525
442 Ga0207678_10375537 3300026067 Bacteria 1228
443 Ga0207702_10176335 3300026078 Bacteria 1965
444 Ga0207702_10227369 3300026078 Bacteria 1742
445 Ga0207702_10438161 3300026078 Bacteria 1266
446 Ga0207702_10641435 3300026078 Bacteria 1044
447 Ga0207648_10049091 3300026089 Bacteria 3695
448 Ga0207648_10727135 3300026089 Unclassified 921
449 Ga0207676_10233716 3300026095 Bacteria 1645
450 Ga0207674_10007352 3300026116 Bacteria 12829
451 Ga0207674_10142181 3300026116 Bacteria 2359
452 Ga0207674_10177022 3300026116 Bacteria 2085
453 Ga0207674_10181324 3300026116 Bacteria 2057
454 Ga0207674_10443322 3300026116 Bacteria 1255
455 Ga0207675_100762838 3300026118 Bacteria 979
456 Ga0207675_101021671 3300026118 Bacteria 845
457 Ga0207683_11197858 3300026121 Bacteria 704
458 Ga0207698_10142144 3300026142 Bacteria 2070
459 Ga0207698_10330629 3300026142 Bacteria 1431
460 Ga0207698_10349852 3300026142 Bacteria 1395
461 Ga0207698_11108819 3300026142 Bacteria 804
462 Ga0207698_11151460 3300026142 Bacteria 789
463 Ga0207698_11421351 3300026142 Bacteria 709
464 Ga0209281_1039075 3300027111 Bacteria 807
465 Ga0209389_1000133 3300027296 Bacteria 65939
466 Ga0209389_1000413 3300027296 Bacteria 25381
467 Ga0209589_1010310 3300027357 Bacteria 13668
468 Ga0209489_100597 3300027361 Bacteria 69726
469 Ga0209489_115313 3300027361 Bacteria 4775
470 Ga0209700_100005 3300027363 Bacteria 573969
471 Ga0209179_1001501 3300027512 Bacteria 2880
472 Ga0209179_1041374 3300027512 Bacteria 971
473 Ga0209588_1142764 3300027671 Bacteria 761
474 Ga0209813_10004408 3300027866 Bacteria 3362
475 Ga0268266_10087499 3300028379 Bacteria 2726
476 Ga0268265_10024179 3300028380 Bacteria 4294
477 Ga0307515_10348776 3300028794 Bacteria 1128
478 Ga0265763_1005534 3300030763 Bacteria 1063
479 Ga0265340_10222850 3300031247 Bacteria 845
480 Ga0265339_10013672 3300031249 Bacteria 4916
481 Ga0265331_10027370 3300031250 Bacteria 2858
482 Ga0307513_10834302 3300031456 Bacteria 628
483 Ga0307508_10003734 3300031616 Bacteria 15233
484 Ga0307508_10103129 3300031616 Bacteria 2449
485 Ga0307508_10358559 3300031616 Bacteria 1049
486 Ga0307508_10470208 3300031616 Bacteria 851
487 Ga0307508_10690803 3300031616 Bacteria 629
488 Ga0307514_10006880 3300031649 Bacteria 9846
489 Ga0265314_10044600 3300031711 Bacteria 3143
490 Ga0265314_10094825 3300031711 Bacteria 1933
491 Ga0265342_10465326 3300031712 Bacteria 648
492 Ga0316576_10685720 3300031727 Bacteria 743
493 Ga0307516_10062391 3300031730 Bacteria 3612
494 Ga0307406_10119306 3300031901 Bacteria 1831
495 Ga0307412_10041808 3300031911 Bacteria 2973
496 Ga0307412_10291613 3300031911 Bacteria 1285
497 Ga0307416_100340513 3300032002 Bacteria 1512
498 Ga0307416_100660374 3300032002 Bacteria 1131
499 Ga0307416_100901528 3300032002 Bacteria 984
500 Ga0307414_10259224 3300032004 Bacteria 1450
501 Ga0307414_10484465 3300032004 Bacteria 1091
502 Ga0307510_10339666 3300033180 Bacteria 954
503 Ga0373959_0009197 3300034820 Bacteria 1698
504 Ga0373949_0216107 3300035090 Bacteria 581
505 Ga0373932_0147338 3300035112 Bacteria 805
506 Ga0373941_0082754 3300035115 Bacteria 1087
507 Ga0373946_0567826 3300035171 Bacteria 586
508 Ga0373962_0295430 3300035242 Bacteria 573
509 Ga0373931_0162798 3300035691 Bacteria 1309
510 Ga0373927_0936865 3300035695 Bacteria 571
511 Ga0373947_0166522 3300035725 Bacteria 1428
512 Ga0373937_1016648 3300036401 Bacteria 778
513 Ga0395899_0029309 3300037312 Bacteria 4140
514 Ga0395899_0033659 3300037312 Bacteria 3848
515 Ga0395899_0179017 3300037312 Unclassified 1489
516 Ga0395900_0000980 3300037418 Bacteria 37119
517 Ga0395900_0010175 3300037418 Bacteria 9621
518 Ga0395900_0021195 3300037418 Bacteria 6643
519 Ga0395900_0061122 3300037418 Bacteria 3874
520 Ga0395900_0088046 3300037418 Bacteria 3192
521 Ga0395900_0091955 3300037418 Bacteria 3117
522 Ga0395900_0686687 3300037418 Bacteria 958
523 Ga0395900_1655355 3300037418 Bacteria 551
524 Ga0395898_0001377 3300037466 Bacteria 34890
525 Ga0395898_0003446 3300037466 Bacteria 17687
526 Ga0395898_0370117 3300037466 Bacteria 1366
527 Ga0395898_0644073 3300037466 Bacteria 1002
528 Ga0395898_0806606 3300037466 Bacteria 879
529 Ga0395898_1242883 3300037466 Bacteria 675
530 Ga0395905_0012360 3300037471 Bacteria 8220
531 Ga0395905_0034815 3300037471 Bacteria 4729
532 Ga0395905_0064359 3300037471 Bacteria 3431
533 Ga0395905_0100041 3300037471 Bacteria 2722
534 Ga0395905_0400904 3300037471 Bacteria 1267
535 Ga0436364_1043978 3300037853 Bacteria 1651
536 Ga0395901_0000059 3300038443 Bacteria 152667
537 Ga0395901_0028854 3300038443 Bacteria 5707
538 Ga0395901_0048474 3300038443 Bacteria 4411
539 Ga0395901_0113628 3300038443 Bacteria 2844
540 Ga0395901_0227589 3300038443 Bacteria 1948
541 Ga0395901_0277583 3300038443 Bacteria 1742
542 Ga0395901_0354159 3300038443 Bacteria 1514
543 Ga0395901_1395843 3300038443 Bacteria 659
544 Ga0436365_0043975 3300039437 Bacteria 6582
545 Ga0436365_0178950 3300039437 Bacteria 2637
546 Ga0436365_0214722 3300039437 Bacteria 936
547 Ga0436365_0355981 3300039437 Bacteria 546
548 Ga0436365_0535444 3300039437 Bacteria 10170
549 Ga0436365_1886658 3300039437 Bacteria 26869
550 Ga0436360_0256668 3300039438 Bacteria 769
551 Ga0436363_0105824 3300039450 Bacteria 1923
552 Ga0436363_0882130 3300039450 Bacteria 933
553 Ga0436363_1382020 3300039450 Bacteria 5958
554 Ga0436363_1579194 3300039450 Bacteria 510
555 Ga0436362_0295315 3300039453 Bacteria 16615
556 Ga0439465_0060268 3300041413 Bacteria 1257
557 Ga0451800_0863443 3300041459 Bacteria 726
558 Ga0451807_0539834 3300041486 Bacteria 1380
559 Ga0451841_1174930 3300041498 Bacteria 1141
560 Ga0451845_0600722 3300041501 Bacteria 540
561 Ga0451851_0264887 3300041507 Bacteria 890
562 Ga0451855_0979810 3300041511 Bacteria 828
563 Ga0439445_0009835 3300042004 Bacteria 2258
564 Ga0439458_0136884 3300042157 Bacteria 651
565 Ga0439435_0022532 3300042436 Bacteria 1645
566 Ga0466969_0046480 3300044656 Bacteria 2153
567 Ga0466969_0107149 3300044656 Bacteria 1311
568 Ga0466972_0011625 3300044658 Bacteria 4420
569 Ga0466972_0183679 3300044658 Bacteria 980
570 Ga0466965_0140152 3300044683 Bacteria 1258
571 Ga0466966_0001064 3300044684 Bacteria 17544
572 Ga0466966_0012361 3300044684 Bacteria 5657
573 Ga0466966_0222152 3300044684 Bacteria 1140
574 Ga0466966_0227195 3300044684 Bacteria 1126
575 Ga0466961_0033786 3300044693 Bacteria 3286
576 Ga0466961_0078529 3300044693 Bacteria 2090
577 Ga0466961_0142208 3300044693 Bacteria 1501
578 Ga0466961_0202182 3300044693 Bacteria 1228
579 Ga0466963_0025561 3300044694 Bacteria 3767
580 Ga0466963_0528727 3300044694 Bacteria 833
581 Ga0466964_0538817 3300044706 Bacteria 632
582 Ga0466971_0012181 3300044719 Bacteria 3768
583 Ga0466971_0012659 3300044719 Bacteria 3699
584 Ga0466968_0009013 3300044735 Bacteria 3835
585 Ga0466970_0016296 3300044765 Bacteria 3828
586 Ga0466970_0068776 3300044765 Bacteria 1903
587 Ga0466970_0525544 3300044765 Bacteria 683
588 Ga0466957_0002214 3300044842 Bacteria 10425
589 Ga0466957_0025936 3300044842 Bacteria 3475
590 Ga0466957_0030036 3300044842 Bacteria 3244
591 Ga0466957_0503463 3300044842 Bacteria 840
592 Ga0466960_0030155 3300044901 Bacteria 2494
593 Ga0466959_0020527 3300045049 Bacteria 4869
594 Ga0466959_0044660 3300045049 Bacteria 3264
595 Ga0466959_0282418 3300045049 Bacteria 1139
596 Ga0466959_0510055 3300045049 Bacteria 812
597 Ga0466958_0145145 3300045836 Bacteria 1495
598 Ga0466958_0162432 3300045836 Bacteria 1412
599 Ga0466958_0400990 3300045836 Bacteria 885
600 Ga0466967_0053350 3300045976 Bacteria 3553
601 Ga0466967_0104657 3300045976 Bacteria 2591
602 Ga0466967_0226957 3300045976 Bacteria 1777
603 Ga0466967_0304118 3300045976 Bacteria 1535
604 Ga0466967_0798580 3300045976 Bacteria 937
605 Ga0495592_0860419 3300046454 Bacteria 535
606 Ga0495603_0446212 3300046455 Bacteria 741
607 Ga0495629_0352881 3300046459 Bacteria 1003
608 Ga0495629_0503033 3300046459 Bacteria 817
609 Ga0495638_0006956 3300046460 Bacteria 8165
610 Ga0495638_0021201 3300046460 Bacteria 4286
611 Ga0495638_0338042 3300046460 Bacteria 799
612 Ga0495641_0343052 3300046461 Bacteria 675
613 Ga0495580_0668337 3300046472 Bacteria 682
614 Ga0495582_0492145 3300046473 Bacteria 709
615 Ga0495605_0185877 3300046474 Bacteria 912
616 Ga0495584_0051802 3300046491 Bacteria 2066
617 Ga0495585_0012196 3300046492 Bacteria 5064
618 Ga0495583_0095423 3300046506 Bacteria 1276
619 Ga0495606_0000070 3300046507 Bacteria 177343
620 Ga0495610_0059335 3300046512 Bacteria 1826
621 Ga0495610_0156215 3300046512 Bacteria 968
622 Ga0495616_0000338 3300046513 Bacteria 37114
623 Ga0495616_0167596 3300046513 Bacteria 984
624 Ga0495620_0108176 3300046515 Bacteria 1103
625 Ga0495630_0026824 3300046517 Bacteria 4267
626 Ga0495631_0000163 3300046518 Bacteria 45348
627 Ga0495631_0086528 3300046518 Bacteria 1350
628 Ga0495637_0006808 3300046520 Bacteria 5718
629 Ga0495643_0167270 3300046522 Bacteria 1077
630 Ga0495644_0338533 3300046523 Bacteria 591
631 Ga0495654_0002141 3300046530 Bacteria 12881
632 Ga0495640_0910926 3300046533 Bacteria 521
633 Ga0495586_0456299 3300046535 Bacteria 737
634 Ga0495598_0075357 3300046537 Bacteria 1071
635 Ga0495609_0240161 3300046538 Bacteria 748
636 Ga0495621_0007800 3300046539 Bacteria 3181
637 Ga0495597_0091226 3300046542 Bacteria 1293
638 Ga0495645_0317356 3300046543 Bacteria 1013
639 Ga0495622_0180822 3300046557 Bacteria 946
640 Ga0495668_0273429 3300046616 Bacteria 925
641 Ga0495611_0036796 3300046648 Bacteria 2174
642 Ga0495625_0030946 3300046660 Bacteria 3986
643 Ga0495659_0166893 3300046664 Bacteria 891
644 Ga0495661_0086570 3300046665 Bacteria 1793
645 Ga0495588_0047906 3300046674 Bacteria 2195
646 Ga0495588_0353023 3300046674 Bacteria 772
647 Ga0495588_0583363 3300046674 Bacteria 586
648 Ga0495658_0647497 3300046683 Bacteria 677
649 Ga0495669_0407217 3300046684 Bacteria 659
650 Ga0495624_0146398 3300046690 Bacteria 1446
651 Ga0495624_0358164 3300046690 Bacteria 877
652 Ga0495670_0238839 3300046691 Bacteria 967
653 Ga0495671_0020470 3300046692 Bacteria 3485
654 Ga0495660_0065191 3300046810 Bacteria 1945
655 Ga0495660_0149755 3300046810 Bacteria 1153
656 Ga0495660_0322823 3300046810 Bacteria 693
657 Ga0495636_0399963 3300047318 Bacteria 654
658 Ga0495674_0021627 3300047319 Bacteria 5946
659 Ga0495672_0280902 3300047320 Bacteria 796
660 Ga0495676_0126961 3300047321 Bacteria 1847
661 Ga0495683_0146029 3300047323 Bacteria 1105
662 Ga0495673_0325341 3300047469 Bacteria 547
663 Ga0495686_0000841 3300047472 Bacteria 39404
664 Ga0495686_0016462 3300047472 Bacteria 5013
665 Ga0495686_0061464 3300047472 Bacteria 2332
666 Ga0495686_0069679 3300047472 Bacteria 2167
667 Ga0495686_0236830 3300047472 Bacteria 1031
668 Ga0495593_0068780 3300047673 Bacteria 1842
669 Ga0495614_0117617 3300048089 Bacteria 1170
670 Ga0495626_0116626 3300048091 Bacteria 1152
671 Ga0496100_0244298 3300048903 Bacteria 1326
672 Ga0496100_0374886 3300048903 Bacteria 1080
673 Ga0496100_1084555 3300048903 Bacteria 631
674 Ga0496100_1204923 3300048903 Bacteria 597
675 Ga0496101_0015961 3300048904 Bacteria 5067
676 Ga0496101_0152226 3300048904 Bacteria 1770
677 Ga0496101_0373053 3300048904 Bacteria 1122
678 Ga0496102_0012441 3300048905 Bacteria 7363
679 Ga0496102_0366272 3300048905 Bacteria 1357
680 Ga0496102_0837433 3300048905 Bacteria 842
681 Ga0496104_0623015 3300048907 Bacteria 988
682 Ga0496105_0117753 3300048908 Bacteria 2191
683 Ga0496106_0472082 3300048909 Bacteria 1008
684 Ga0496107_0761904 3300048910 Bacteria 710
685 Ga0496107_0944835 3300048910 Bacteria 627
686 Ga0496108_0044497 3300048911 Bacteria 3705
687 Ga0496108_0146790 3300048911 Bacteria 2034
688 Ga0496109_0023980 3300048912 Bacteria 5419
689 Ga0496109_0928889 3300048912 Bacteria 808
690 Ga0496110_0315646 3300048913 Bacteria 1423
691 Ga0496111_0072814 3300048914 Bacteria 2501
692 Ga0496112_0001369 3300048915 Bacteria 18577
693 Ga0496112_0868689 3300048915 Bacteria 825
694 Ga0496113_0026637 3300048916 Bacteria 4136
695 Ga0496114_0267821 3300048917 Bacteria 1505
696 Ga0496115_0617839 3300048918 Bacteria 860
697 Ga0496115_0862248 3300048918 Bacteria 701
698 Ga0496116_0213092 3300048919 Bacteria 999
699 Ga0496117_0075201 3300048920 Bacteria 2245
700 Ga0496118_0027891 3300048921 Bacteria 4769
701 Ga0496118_0040951 3300048921 Bacteria 3675
702 Ga0496119_0050269 3300048922 Bacteria 2571
703 Ga0496119_0210886 3300048922 Bacteria 999
704 Ga0496120_0162739 3300048923 Bacteria 1111
705 Ga0496121_0162838 3300048924 Bacteria 1629
706 Ga0496122_0086918 3300048925 Bacteria 2150
707 Ga0496122_0147041 3300048925 Bacteria 1462
708 Ga0496122_0399114 3300048925 Bacteria 699
709 Ga0496123_0036494 3300048926 Bacteria 3486
710 Ga0496123_0163448 3300048926 Bacteria 1184
711 Ga0496124_0076778 3300048927 Bacteria 2756
712 Ga0496124_0141331 3300048927 Bacteria 1899
713 Ga0496124_0393517 3300048927 Bacteria 964
714 Ga0496125_0061820 3300048928 Bacteria 3001
715 Ga0496125_0156338 3300048928 Bacteria 1557
716 Ga0496126_0003228 3300048929 Bacteria 20863
717 Ga0496126_0105058 3300048929 Bacteria 2467
718 Ga0501031_0090667 3300049568 Bacteria 1994
719 Ga0501031_0495842 3300049568 Bacteria 788
720 Ga0501032_0003313 3300049569 Bacteria 12388
721 Ga0501032_0171964 3300049569 Bacteria 1420
722 Ga0501032_0175532 3300049569 Bacteria 1404
723 Ga0501032_0182178 3300049569 Bacteria 1375
724 Ga0501032_0220955 3300049569 Bacteria 1233
725 Ga0501032_0391828 3300049569 Bacteria 893
726 Ga0501032_0730748 3300049569 Bacteria 627
727 Ga0501033_0003150 3300049570 Bacteria 13707
728 Ga0501033_0019795 3300049570 Bacteria 5087
729 Ga0501033_0041579 3300049570 Bacteria 3429
730 Ga0501033_0217898 3300049570 Bacteria 1359
731 Ga0501033_0808820 3300049570 Bacteria 633
732 Ga0501034_0154717 3300049571 Bacteria 2267
733 Ga0501034_0313426 3300049571 Bacteria 1503
734 Ga0501034_0423723 3300049571 Bacteria 1252
735 Ga0501034_0751190 3300049571 Bacteria 871
736 Ga0501034_1056850 3300049571 Bacteria 694
737 Ga0501036_0125883 3300049572 Bacteria 2164
738 Ga0501036_0132931 3300049572 Bacteria 2100
739 Ga0501036_0271533 3300049572 Bacteria 1420
740 Ga0501037_0000253 3300049573 Bacteria 45817
741 Ga0501037_0109735 3300049573 Bacteria 1988
742 Ga0501037_0120562 3300049573 Bacteria 1886
743 Ga0501037_0131266 3300049573 Bacteria 1796
744 Ga0501038_0133674 3300049574 Bacteria 2034
745 Ga0501038_0484681 3300049574 Bacteria 947
746 Ga0501039_0189303 3300049575 Bacteria 1618
747 Ga0501039_0248974 3300049575 Bacteria 1397
748 Ga0501043_0000100 3300049579 Bacteria 79167
749 Ga0501043_0023314 3300049579 Bacteria 4854
750 Ga0501043_0030141 3300049579 Bacteria 4262
751 Ga0501043_0031815 3300049579 Bacteria 4148
752 Ga0501043_0046356 3300049579 Bacteria 3418
753 Ga0501043_0157335 3300049579 Bacteria 1777
754 Ga0501043_0172300 3300049579 Bacteria 1688
755 Ga0501043_0189483 3300049579 Bacteria 1600
756 Ga0501043_0496323 3300049579 Bacteria 912
757 Ga0501046_0390643 3300049580 Bacteria 1006
758 Ga0501046_0490132 3300049580 Bacteria 881
759 Ga0501046_0562634 3300049580 Bacteria 812
760 Ga0501047_0032207 3300049581 Bacteria 5060
761 Ga0501047_0056248 3300049581 Bacteria 3804
762 Ga0501047_0151679 3300049581 Bacteria 2193
763 Ga0501047_0272527 3300049581 Bacteria 1538
764 Ga0501048_0237303 3300049582 Bacteria 1294
765 Ga0501048_0353955 3300049582 Bacteria 1047
766 Ga0501067_0026924 3300049583 Bacteria 3184
767 Ga0501067_0351789 3300049583 Bacteria 821
768 Ga0501067_0542681 3300049583 Bacteria 651
769 Ga0501067_0642945 3300049583 Bacteria 595
770 Ga0501067_0721111 3300049583 Bacteria 561
771 Ga0501068_0114351 3300049584 Bacteria 1680
772 Ga0501069_0000020 3300049585 Bacteria 122595
773 Ga0501069_0008202 3300049585 Bacteria 5484
774 Ga0501069_0037791 3300049585 Bacteria 2664
775 Ga0501069_0062709 3300049585 Bacteria 2076
776 Ga0501069_0434782 3300049585 Bacteria 779
777 Ga0501069_0724773 3300049585 Bacteria 601
778 Ga0501070_0000193 3300049586 Bacteria 57357
779 Ga0501070_0000595 3300049586 Bacteria 32980
780 Ga0501070_0000836 3300049586 Bacteria 27961
781 Ga0501070_0005381 3300049586 Bacteria 10920
782 Ga0501070_0017885 3300049586 Bacteria 5952
783 Ga0501070_0130201 3300049586 Bacteria 2079
784 Ga0501070_0500762 3300049586 Bacteria 976
785 Ga0501070_0732138 3300049586 Bacteria 780
786 Ga0501071_0145454 3300049587 Bacteria 1767
787 Ga0501071_0796822 3300049587 Bacteria 728
788 Ga0501072_0732140 3300049588 Bacteria 776
789 Ga0501072_0988501 3300049588 Bacteria 656
790 Ga0501073_0014669 3300049589 Bacteria 5693
791 Ga0501073_0044918 3300049589 Bacteria 3113
792 Ga0501073_0136308 3300049589 Bacteria 1701
793 Ga0501073_0847135 3300049589 Bacteria 630
794 Ga0501074_0000063 3300049590 Bacteria 51162
795 Ga0501074_0092478 3300049590 Bacteria 2166
796 Ga0501074_0334729 3300049590 Bacteria 1074
797 Ga0501074_0643287 3300049590 Bacteria 749
798 Ga0501079_0156949 3300049741 Bacteria 1774
799 Ga0501079_0530271 3300049741 Bacteria 926
800 Ga0501079_1446052 3300049741 Bacteria 541
801 Ga0501080_0004199 3300049742 Bacteria 12780
802 Ga0501080_0010754 3300049742 Bacteria 8371
803 Ga0501080_0053672 3300049742 Bacteria 3753
804 Ga0501080_0516665 3300049742 Bacteria 1066
805 Ga0501083_0000205 3300049744 Bacteria 38186
806 Ga0501083_0224427 3300049744 Bacteria 1224
807 Ga0501083_0346219 3300049744 Bacteria 966
808 Ga0501083_0562403 3300049744 Bacteria 742
809 Ga0501083_0911605 3300049744 Bacteria 572
810 Ga0501035_0000070 3300049822 Bacteria 127442
811 Ga0501035_0001992 3300049822 Bacteria 20414
812 Ga0501035_0002240 3300049822 Bacteria 19152
813 Ga0501035_0018210 3300049822 Bacteria 6469
814 Ga0501035_0028327 3300049822 Bacteria 5114
815 Ga0501035_0189028 3300049822 Bacteria 1771
816 Ga0501035_0296803 3300049822 Bacteria 1362
817 Ga0501044_0000037 3300049823 Bacteria 161924
818 Ga0501044_0023371 3300049823 Bacteria 6575
819 Ga0501044_0032505 3300049823 Bacteria 5485
820 Ga0501044_0051263 3300049823 Bacteria 4255
821 Ga0501044_0058214 3300049823 Bacteria 3963
822 Ga0501044_0061251 3300049823 Bacteria 3850
823 Ga0501044_0171458 3300049823 Bacteria 2141
824 Ga0501044_0243492 3300049823 Bacteria 1741
825 Ga0501044_0359298 3300049823 Bacteria 1375
826 Ga0501044_0398376 3300049823 Bacteria 1289
827 Ga0501044_0678625 3300049823 Bacteria 917
828 Ga0501044_0913825 3300049823 Bacteria 752
829 nmdc:mga03n38_815137_c1 3300050490 Bacteria 544
830 nmdc:mga0k408_1222_c1 3300050493 Bacteria 10920
831 nmdc:mga0k408_17605_c2 3300050493 Bacteria 2559
832 nmdc:mga0k408_66221_c1 3300050493 Bacteria 2104
833 nmdc:mga0k408_68564_c1 3300050493 Bacteria 2069
834 nmdc:mga0k408_80740_c1 3300050493 Bacteria 1904
835 nmdc:mga06z11_42901_c1 3300050494 Bacteria 2272
836 nmdc:mga06z11_628342_c1 3300050494 Bacteria 654
837 nmdc:mga04h51_132867_c1 3300050495 Bacteria 938
838 nmdc:mga07m45_12323_c1 3300050496 Bacteria 4516
839 nmdc:mga07m45_12524_c1 3300050496 Bacteria 4484
840 nmdc:mga07m45_221124_c1 3300050496 Bacteria 1102
841 nmdc:mga07m45_222503_c1 3300050496 Bacteria 1098
842 nmdc:mga07m45_225557_c1 3300050496 Bacteria 1090
843 nmdc:mga07m45_36017_c1 3300050496 Bacteria 2754
844 nmdc:mga05p37_1268362_c1 3300050507 Bacteria 754
845 nmdc:mga0sz30_323296_c1 3300050516 Bacteria 689
846 Ga0495601_0080115 3300053077 Bacteria 2095
847 Ga0495612_0432903 3300053078 Bacteria 600
848 Ga0500610_0003000 3300053079 Bacteria 6367
849 Ga0500610_0132941 3300053079 Bacteria 1263
850 Ga0500578_0092904 3300053086 Bacteria 1914
851 Ga0500578_0482243 3300053086 Bacteria 701
852 Ga0500643_041209 3300053087 Bacteria 1357
853 Ga0500644_0010325 3300053088 Bacteria 2526
854 Ga0500644_0419011 3300053088 Bacteria 585
855 Ga0500646_0016030 3300053090 Bacteria 1954
856 Ga0500647_0367973 3300053091 Bacteria 593
857 Ga0500651_0002595 3300053093 Bacteria 9597
858 Ga0500651_0014879 3300053093 Bacteria 4767
859 Ga0500651_0080404 3300053093 Bacteria 2019
860 Ga0500651_0146221 3300053093 Bacteria 1422
861 Ga0500566_0000003 3300053094 Bacteria 166820
862 Ga0500566_0489857 3300053094 Bacteria 531
863 Ga0500640_000494 3300053095 Bacteria 9782
864 Ga0500562_068929 3300053108 Bacteria 954
865 Ga0500571_000610 3300053110 Bacteria 14877
866 Ga0500572_000064 3300053111 Bacteria 32890
867 Ga0500572_068257 3300053111 Bacteria 1094
868 Ga0500591_062438 3300053115 Bacteria 1713
869 Ga0500592_023229 3300053116 Bacteria 1000
870 Ga0500593_001312 3300053117 Bacteria 8974
871 Ga0500594_0107655 3300053118 Bacteria 864
872 Ga0500594_0136375 3300053118 Bacteria 780
873 Ga0500594_0150956 3300053118 Bacteria 746
874 Ga0500594_0196935 3300053118 Bacteria 661
875 Ga0500595_001895 3300053119 Bacteria 10770
876 Ga0500607_002084 3300053121 Bacteria 16729
877 Ga0500608_010082 3300053122 Bacteria 4043
878 Ga0500608_049218 3300053122 Bacteria 2026
879 Ga0500614_000728 3300053123 Bacteria 8416
880 Ga0500614_197155 3300053123 Bacteria 620
881 Ga0500626_017227 3300053128 Bacteria 3173
882 Ga0500642_0000786 3300053130 Bacteria 9291
883 Ga0500655_002349 3300053133 Bacteria 3467
884 Ga0500655_027279 3300053133 Bacteria 1090
885 Ga0500658_0003124 3300053134 Bacteria 6327
886 Ga0500658_0004678 3300053134 Bacteria 5106
887 Ga0500559_0000697 3300053136 Bacteria 22073
888 Ga0500559_0023339 3300053136 Bacteria 2626
889 Ga0500564_016854 3300053138 Bacteria 3314
890 Ga0500568_0296634 3300053139 Bacteria 587
891 Ga0500573_0267064 3300053140 Bacteria 873
892 Ga0500574_031489 3300053141 Bacteria 1429
893 Ga0500577_0149039 3300053142 Bacteria 991
894 Ga0500577_0331944 3300053142 Bacteria 664
895 Ga0500588_0057214 3300053146 Bacteria 1237
896 Ga0500588_0099006 3300053146 Bacteria 1002
897 Ga0500603_000211 3300053150 Bacteria 15406
898 Ga0500604_0004630 3300053151 Bacteria 3645
899 Ga0500604_0115088 3300053151 Bacteria 896
900 Ga0500604_0243347 3300053151 Bacteria 622
901 Ga0500616_0000705 3300053153 Bacteria 38798
902 Ga0500616_0005404 3300053153 Bacteria 8671
903 Ga0500627_0155763 3300053158 Bacteria 1031
904 Ga0500630_004374 3300053159 Bacteria 6875
905 Ga0500633_0064090 3300053160 Bacteria 1299
906 Ga0500634_0112681 3300053161 Bacteria 1339
907 Ga0500634_0163162 3300053161 Bacteria 1026
908 Ga0500638_058028 3300053162 Bacteria 1864
909 Ga0500639_000042 3300053163 Bacteria 61423
910 Ga0500625_139109 3300053729 Bacteria 937
911 Ga0500609_009377 3300053731 Bacteria 1319
912 Ga0500565_003471 3300053734 Bacteria 1261
913 Ga0500596_004183 3300053735 Bacteria 2669
914 Ga0500596_004335 3300053735 Bacteria 2609
915 Ga0500587_015452 3300053739 Bacteria 972
916 Ga0501084_0460654 3300054114 Bacteria 1075
917 Ga0501084_0799963 3300054114 Bacteria 794
918 Ga0501082_0115365 3300060353 Bacteria 2326
919 Ga0466962_0011427 3300061719 Bacteria 4275
920 Ga0466962_0034602 3300061719 Bacteria 2419
921 Ga0466962_0038753 3300061719 Bacteria 2282
922 Ga0530510_0225753 3300061734 Bacteria 1393

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0798580 Ga0466967_0798580_12_422 115
2 3300009551 Ga0105238_10406754 Ga0105238_104067542 137
3 3300025924 Ga0207694_11054105 Ga0207694_110541051 137
4 3300037312 Ga0395899_0029309 Ga0395899_0029309_1793_2326 137
5 3300037418 Ga0395900_0000980 Ga0395900_0000980_17423_17911 137
6 3300037418 Ga0395900_0091955 Ga0395900_0091955_276_764 137
7 3300038443 Ga0395901_0000059 Ga0395901_0000059_27851_28339 137
8 3300044658 Ga0466972_0183679 Ga0466972_0183679_218_706 137
9 3300044684 Ga0466966_0001064 Ga0466966_0001064_13415_13903 137
10 3300044693 Ga0466961_0033786 Ga0466961_0033786_2785_3273 137
11 3300044719 Ga0466971_0012659 Ga0466971_0012659_130_618 137
12 3300044842 Ga0466957_0025936 Ga0466957_0025936_2540_3028 137
13 3300045836 Ga0466958_0145145 Ga0466958_0145145_583_1071 137
14 3300045976 Ga0466967_0226957 Ga0466967_0226957_10_498 137
15 3300061719 Ga0466962_0038753 Ga0466962_0038753_1034_1522 137
16 3300013102 Ga0157371_10068435 Ga0157371_100684352 141
17 3300013105 Ga0157369_10000280 Ga0157369_100002803 141
18 3300020081 Ga0206354_10978505 Ga0206354_109785051 141
19 3300037418 Ga0395900_0088046 Ga0395900_0088046_2447_2935 141
20 3300037466 Ga0395898_0001377 Ga0395898_0001377_31897_32385 141
21 3300038443 Ga0395901_0048474 Ga0395901_0048474_2485_2973 141
22 3300038443 Ga0395901_0354159 Ga0395901_0354159_74_562 141
23 3300039438 Ga0436360_0256668 Ga0436360_0256668_161_649 141
24 3300039450 Ga0436363_0105824 Ga0436363_0105824_27_518 142
25 3300039450 Ga0436363_0882130 Ga0436363_0882130_349_837 144
26 3300005843 Ga0068860_101157934 Ga0068860_1011579341 145
27 3300021384 Ga0213876_10007769 Ga0213876_100077697 145
28 3300039437 Ga0436365_1886658 Ga0436365_1886658_2722_3213 145
29 3300003792 Ga0055540_1008403 Ga0055540_10084033 149
30 3300005435 Ga0070714_100308818 Ga0070714_1003088182 149
31 3300005985 Ga0081539_10171338 Ga0081539_101713382 149
32 3300006880 Ga0075429_101151232 Ga0075429_1011512321 149
33 3300009148 Ga0105243_10178363 Ga0105243_101783632 149
34 3300049582 Ga0501048_0237303 Ga0501048_0237303_662_1114 149
35 3300049588 Ga0501072_0988501 Ga0501072_0988501_128_580 149
36 3300002739 JGI25158J39367_1005418 JGI25158J39367_10054183 150
37 3300002739 JGI25158J39367_1009134 JGI25158J39367_10091342 150
38 3300002773 JGI25152J39213_1011261 JGI25152J39213_10112612 150
39 3300002773 JGI25152J39213_1011297 JGI25152J39213_10112972 150
40 3300002774 JGI25150J39212_1002359 JGI25150J39212_10023593 150
41 3300002774 JGI25150J39212_1022189 JGI25150J39212_10221892 150
42 3300002987 JGI25159J45721_1011623 JGI25159J45721_10116233 150
43 3300002987 JGI25159J45721_1012728 JGI25159J45721_10127282 150
44 3300003187 JGI25151J46595_10000406 JGI25151J46595_1000040639 150
45 3300003187 JGI25151J46595_10033255 JGI25151J46595_100332552 150
46 3300003187 JGI25151J46595_10064048 JGI25151J46595_100640482 150
47 3300003215 JGI25153J46596_10027553 JGI25153J46596_100275532 150
48 3300003322 rootL2_10141541 rootL2_101415415 150
49 3300003354 JGI25160J50197_1015392 JGI25160J50197_10153922 150
50 3300003354 JGI25160J50197_1020567 JGI25160J50197_10205672 150
51 3300003374 JGI25161J50226_1006911 JGI25161J50226_10069112 150
52 3300003374 JGI25161J50226_1010928 JGI25161J50226_10109282 150
53 3300003578 Ga0006562J51391_1040460 Ga0006562J51391_10404603 150
54 3300003578 Ga0006562J51391_1124565 Ga0006562J51391_11245652 150
55 3300003578 Ga0006562J51391_1124567 Ga0006562J51391_11245673 150
56 3300003761 Ga0055535_1000472 Ga0055535_100047222 150
57 3300003762 Ga0055542_1000103 Ga0055542_100010383 150
58 3300003771 Ga0055526_1018877 Ga0055526_10188773 150
59 3300003771 Ga0055526_1018911 Ga0055526_10189113 150
60 3300003773 Ga0055537_1003586 Ga0055537_10035863 150
61 3300003773 Ga0055537_1007518 Ga0055537_10075182 150
62 3300003775 Ga0055524_1017335 Ga0055524_10173353 150
63 3300003775 Ga0055524_1017395 Ga0055524_10173953 150
64 3300003781 Ga0055536_1010899 Ga0055536_10108993 150
65 3300003781 Ga0055536_1034514 Ga0055536_10345142 150
66 3300003784 Ga0055534_1010192 Ga0055534_10101922 150
67 3300003784 Ga0055534_1012069 Ga0055534_10120692 150
68 3300003790 Ga0055528_1016979 Ga0055528_10169793 150
69 3300003790 Ga0055528_1030302 Ga0055528_10303021 150
70 3300003791 Ga0055530_10000237 Ga0055530_100002374 150
71 3300003792 Ga0055540_1007368 Ga0055540_10073682 150
72 3300003794 Ga0055531_10011793 Ga0055531_100117932 150
73 3300003794 Ga0055531_10011817 Ga0055531_100118173 150
74 3300004625 Ga0055543_1003354 Ga0055543_10033543 150
75 3300004625 Ga0055543_1009200 Ga0055543_10092001 150
76 3300005262 Ga0065165_1008049 Ga0065165_10080493 150
77 3300005262 Ga0065165_1114842 Ga0065165_11148421 150
78 3300005288 Ga0065714_10075296 Ga0065714_100752962 150
79 3300005327 Ga0070658_10019982 Ga0070658_100199822 150
80 3300005327 Ga0070658_10032376 Ga0070658_100323762 150
81 3300005327 Ga0070658_10261262 Ga0070658_102612622 150
82 3300005327 Ga0070658_10271873 Ga0070658_102718732 150
83 3300005327 Ga0070658_11378341 Ga0070658_113783411 150
84 3300005329 Ga0070683_100006332 Ga0070683_1000063323 150
85 3300005329 Ga0070683_100067646 Ga0070683_1000676463 150
86 3300005329 Ga0070683_100135431 Ga0070683_1001354313 150
87 3300005336 Ga0070680_100015348 Ga0070680_1000153483 150
88 3300005336 Ga0070680_100114202 Ga0070680_1001142022 150
89 3300005336 Ga0070680_100233794 Ga0070680_1002337942 150
90 3300005336 Ga0070680_100714838 Ga0070680_1007148381 150
91 3300005337 Ga0070682_100239938 Ga0070682_1002399383 150
92 3300005337 Ga0070682_101040592 Ga0070682_1010405921 150
93 3300005338 Ga0068868_100225216 Ga0068868_1002252162 150
94 3300005338 Ga0068868_101085255 Ga0068868_1010852551 150
95 3300005339 Ga0070660_100001578 Ga0070660_10000157812 150
96 3300005339 Ga0070660_100015849 Ga0070660_1000158492 150
97 3300005339 Ga0070660_100120289 Ga0070660_1001202892 150
98 3300005341 Ga0070691_10008185 Ga0070691_100081854 150
99 3300005341 Ga0070691_10123137 Ga0070691_101231373 150
100 3300005344 Ga0070661_100279978 Ga0070661_1002799782 150
101 3300005344 Ga0070661_100697843 Ga0070661_1006978431 150
102 3300005347 Ga0070668_100040395 Ga0070668_1000403952 150
103 3300005347 Ga0070668_100421488 Ga0070668_1004214882 150
104 3300005347 Ga0070668_101382104 Ga0070668_1013821041 150
105 3300005353 Ga0070669_100149021 Ga0070669_1001490211 150
106 3300005353 Ga0070669_100250414 Ga0070669_1002504142 150
107 3300005355 Ga0070671_100013007 Ga0070671_1000130073 150
108 3300005366 Ga0070659_100017552 Ga0070659_1000175522 150
109 3300005366 Ga0070659_100038550 Ga0070659_1000385503 150
110 3300005366 Ga0070659_100154348 Ga0070659_1001543482 150
111 3300005366 Ga0070659_101044432 Ga0070659_1010444321 150
112 3300005367 Ga0070667_100156905 Ga0070667_1001569053 150
113 3300005367 Ga0070667_100396854 Ga0070667_1003968542 150
114 3300005434 Ga0070709_10010591 Ga0070709_100105912 150
115 3300005434 Ga0070709_10199064 Ga0070709_101990641 150
116 3300005435 Ga0070714_100099670 Ga0070714_1000996703 150
117 3300005435 Ga0070714_100148001 Ga0070714_1001480013 150
118 3300005436 Ga0070713_100004448 Ga0070713_1000044486 150
119 3300005436 Ga0070713_100030867 Ga0070713_1000308672 150
120 3300005436 Ga0070713_100615382 Ga0070713_1006153822 150
121 3300005436 Ga0070713_100997171 Ga0070713_1009971711 150
122 3300005437 Ga0070710_10001577 Ga0070710_100015778 150
123 3300005437 Ga0070710_10075838 Ga0070710_100758382 150
124 3300005437 Ga0070710_10508384 Ga0070710_105083841 150
125 3300005439 Ga0070711_100014177 Ga0070711_1000141777 150
126 3300005439 Ga0070711_100019753 Ga0070711_1000197539 150
127 3300005455 Ga0070663_100040167 Ga0070663_1000401673 150
128 3300005455 Ga0070663_100084680 Ga0070663_1000846803 150
129 3300005455 Ga0070663_100119562 Ga0070663_1001195622 150
130 3300005455 Ga0070663_100153459 Ga0070663_1001534593 150
131 3300005456 Ga0070678_100531447 Ga0070678_1005314472 150
132 3300005457 Ga0070662_100091653 Ga0070662_1000916532 150
133 3300005457 Ga0070662_101011728 Ga0070662_1010117281 150
134 3300005458 Ga0070681_10091120 Ga0070681_100911202 150
135 3300005459 Ga0068867_100273395 Ga0068867_1002733952 150
136 3300005466 Ga0070685_10830052 Ga0070685_108300522 150
137 3300005467 Ga0070706_100069093 Ga0070706_1000690933 150
138 3300005467 Ga0070706_100966941 Ga0070706_1009669412 150
139 3300005468 Ga0070707_100054741 Ga0070707_1000547414 150
140 3300005468 Ga0070707_100564913 Ga0070707_1005649132 150
141 3300005471 Ga0070698_100072440 Ga0070698_1000724403 150
142 3300005471 Ga0070698_100200459 Ga0070698_1002004592 150
143 3300005518 Ga0070699_100157516 Ga0070699_1001575162 150
144 3300005518 Ga0070699_100567984 Ga0070699_1005679841 150
145 3300005530 Ga0070679_100045942 Ga0070679_1000459422 150
146 3300005530 Ga0070679_100107906 Ga0070679_1001079062 150
147 3300005535 Ga0070684_100127371 Ga0070684_1001273712 150
148 3300005539 Ga0068853_100002181 Ga0068853_10000218114 150
149 3300005539 Ga0068853_100005480 Ga0068853_1000054804 150
150 3300005539 Ga0068853_100088454 Ga0068853_1000884542 150
151 3300005544 Ga0070686_101449655 Ga0070686_1014496551 150
152 3300005548 Ga0070665_100098102 Ga0070665_1000981023 150
153 3300005549 Ga0070704_100334497 Ga0070704_1003344972 150
154 3300005563 Ga0068855_100000423 Ga0068855_10000042327 150
155 3300005563 Ga0068855_100016471 Ga0068855_1000164712 150
156 3300005563 Ga0068855_100037105 Ga0068855_1000371054 150
157 3300005563 Ga0068855_100074913 Ga0068855_1000749133 150
158 3300005563 Ga0068855_100083890 Ga0068855_1000838902 150
159 3300005563 Ga0068855_100165212 Ga0068855_1001652122 150
160 3300005563 Ga0068855_100189756 Ga0068855_1001897562 150
161 3300005563 Ga0068855_100296346 Ga0068855_1002963462 150
162 3300005563 Ga0068855_100465620 Ga0068855_1004656202 150
163 3300005564 Ga0070664_100101995 Ga0070664_1001019954 150
164 3300005564 Ga0070664_100206154 Ga0070664_1002061542 150
165 3300005564 Ga0070664_100241353 Ga0070664_1002413532 150
166 3300005577 Ga0068857_100017952 Ga0068857_1000179526 150
167 3300005577 Ga0068857_100133082 Ga0068857_1001330822 150
168 3300005577 Ga0068857_100216154 Ga0068857_1002161543 150
169 3300005578 Ga0068854_100013039 Ga0068854_1000130393 150
170 3300005578 Ga0068854_100094075 Ga0068854_1000940752 150
171 3300005578 Ga0068854_100346883 Ga0068854_1003468832 150
172 3300005614 Ga0068856_100181698 Ga0068856_1001816982 150
173 3300005614 Ga0068856_100255084 Ga0068856_1002550841 150
174 3300005614 Ga0068856_100417466 Ga0068856_1004174662 150
175 3300005614 Ga0068856_101030719 Ga0068856_1010307191 150
176 3300005616 Ga0068852_100014980 Ga0068852_1000149805 150
177 3300005616 Ga0068852_100015610 Ga0068852_1000156108 150
178 3300005616 Ga0068852_100465596 Ga0068852_1004655962 150
179 3300005617 Ga0068859_100919482 Ga0068859_1009194822 150
180 3300005618 Ga0068864_100306401 Ga0068864_1003064012 150
181 3300005718 Ga0068866_10710168 Ga0068866_107101682 150
182 3300005719 Ga0068861_100681114 Ga0068861_1006811142 150
183 3300005834 Ga0068851_10024638 Ga0068851_100246383 150
184 3300005834 Ga0068851_10096248 Ga0068851_100962482 150
185 3300005834 Ga0068851_10155634 Ga0068851_101556342 150
186 3300005841 Ga0068863_100020128 Ga0068863_1000201282 150
187 3300005844 Ga0068862_100004007 Ga0068862_1000040074 150
188 3300005844 Ga0068862_100036231 Ga0068862_1000362312 150
189 3300005844 Ga0068862_100491887 Ga0068862_1004918872 150
190 3300005983 Ga0081540_1006124 Ga0081540_10061246 150
191 3300005983 Ga0081540_1011066 Ga0081540_10110662 150
192 3300006028 Ga0070717_10002120 Ga0070717_1000212012 150
193 3300006028 Ga0070717_10006962 Ga0070717_100069629 150
194 3300006028 Ga0070717_10115331 Ga0070717_101153312 150
195 3300006028 Ga0070717_10241165 Ga0070717_102411652 150
196 3300006028 Ga0070717_10288364 Ga0070717_102883642 150
197 3300006028 Ga0070717_10688300 Ga0070717_106883001 150
198 3300006042 Ga0075368_10035169 Ga0075368_100351692 150
199 3300006048 Ga0075363_100023308 Ga0075363_1000233082 150
200 3300006051 Ga0075364_10180263 Ga0075364_101802632 150
201 3300006163 Ga0070715_10307728 Ga0070715_103077281 150
202 3300006173 Ga0070716_100019421 Ga0070716_1000194212 150
203 3300006173 Ga0070716_100281913 Ga0070716_1002819132 150
204 3300006173 Ga0070716_100324534 Ga0070716_1003245341 150
205 3300006173 Ga0070716_100396830 Ga0070716_1003968302 150
206 3300006173 Ga0070716_100958618 Ga0070716_1009586182 150
207 3300006175 Ga0070712_100007666 Ga0070712_1000076662 150
208 3300006175 Ga0070712_100226681 Ga0070712_1002266811 150
209 3300006177 Ga0075362_10020220 Ga0075362_100202202 150
210 3300006177 Ga0075362_10157620 Ga0075362_101576201 150
211 3300006178 Ga0075367_10006033 Ga0075367_100060332 150
212 3300006178 Ga0075367_10048006 Ga0075367_100480063 150
213 3300006178 Ga0075367_10069338 Ga0075367_100693382 150
214 3300006178 Ga0075367_10176884 Ga0075367_101768842 150
215 3300006186 Ga0075369_10521636 Ga0075369_105216361 150
216 3300006195 Ga0075366_10013951 Ga0075366_100139512 150
217 3300006195 Ga0075366_10018767 Ga0075366_100187674 150
218 3300006195 Ga0075366_10039267 Ga0075366_100392673 150
219 3300006195 Ga0075366_10075959 Ga0075366_100759592 150
220 3300006195 Ga0075366_10108242 Ga0075366_101082422 150
221 3300006237 Ga0097621_100176247 Ga0097621_1001762472 150
222 3300006353 Ga0075370_10002986 Ga0075370_100029863 150
223 3300006353 Ga0075370_10006253 Ga0075370_100062535 150
224 3300006353 Ga0075370_10092007 Ga0075370_100920072 150
225 3300006353 Ga0075370_10143668 Ga0075370_101436682 150
226 3300006881 Ga0068865_100677894 Ga0068865_1006778942 150
227 3300006931 Ga0097620_100919699 Ga0097620_1009196992 150
228 3300006942 Ga0099824_1025033 Ga0099824_10250331 150
229 3300006946 Ga0079104_1054443 Ga0079104_10544431 150
230 3300007076 Ga0075435_100499031 Ga0075435_1004990312 150
231 3300007265 Ga0099794_10016877 Ga0099794_100168773 150
232 3300007265 Ga0099794_10727777 Ga0099794_107277771 150
233 3300007788 Ga0099795_10076871 Ga0099795_100768712 150
234 3300009036 Ga0105244_10048587 Ga0105244_100485872 150
235 3300009093 Ga0105240_10009195 Ga0105240_1000919510 150
236 3300009093 Ga0105240_10027146 Ga0105240_100271463 150
237 3300009093 Ga0105240_10044578 Ga0105240_100445781 150
238 3300009093 Ga0105240_10510383 Ga0105240_105103832 150
239 3300009093 Ga0105240_10667183 Ga0105240_106671832 150
240 3300009093 Ga0105240_11191874 Ga0105240_111918741 150
241 3300009098 Ga0105245_10136471 Ga0105245_101364713 150
242 3300009101 Ga0105247_10244317 Ga0105247_102443172 150
243 3300009101 Ga0105247_10254721 Ga0105247_102547212 150
244 3300009148 Ga0105243_10121266 Ga0105243_101212662 150
245 3300009148 Ga0105243_10460035 Ga0105243_104600352 150
246 3300009148 Ga0105243_10524314 Ga0105243_105243142 150
247 3300009174 Ga0105241_10025534 Ga0105241_100255344 150
248 3300009174 Ga0105241_10068019 Ga0105241_100680192 150
249 3300009176 Ga0105242_10373470 Ga0105242_103734702 150
250 3300009176 Ga0105242_10654445 Ga0105242_106544452 150
251 3300009176 Ga0105242_10794996 Ga0105242_107949962 150
252 3300009176 Ga0105242_12412674 Ga0105242_124126741 150
253 3300009545 Ga0105237_10003331 Ga0105237_100033313 150
254 3300009545 Ga0105237_10019368 Ga0105237_100193686 150
255 3300009545 Ga0105237_10127158 Ga0105237_101271582 150
256 3300009545 Ga0105237_10481321 Ga0105237_104813212 150
257 3300009545 Ga0105237_10968939 Ga0105237_109689392 150
258 3300009551 Ga0105238_10000062 Ga0105238_1000006289 150
259 3300009551 Ga0105238_10016145 Ga0105238_100161451 150
260 3300009551 Ga0105238_10093716 Ga0105238_100937164 150
261 3300009551 Ga0105238_10302661 Ga0105238_103026612 150
262 3300009551 Ga0105238_10654740 Ga0105238_106547402 150
263 3300009553 Ga0105249_10493335 Ga0105249_104933352 150
264 3300010159 Ga0099796_10448650 Ga0099796_104486501 150
265 3300010375 Ga0105239_10001306 Ga0105239_100013062 150
266 3300010375 Ga0105239_10001659 Ga0105239_100016594 150
267 3300010375 Ga0105239_10044705 Ga0105239_100447054 150
268 3300010375 Ga0105239_10127565 Ga0105239_101275653 150
269 3300010375 Ga0105239_11349824 Ga0105239_113498241 150
270 3300010375 Ga0105239_11392139 Ga0105239_113921391 150
271 3300011119 Ga0105246_10025297 Ga0105246_100252972 150
272 3300011119 Ga0105246_10166409 Ga0105246_101664092 150
273 3300011119 Ga0105246_10294857 Ga0105246_102948571 150
274 3300011119 Ga0105246_11023442 Ga0105246_110234421 150
275 3300012502 Ga0157347_1000658 Ga0157347_10006582 150
276 3300012505 Ga0157339_1019418 Ga0157339_10194182 150
277 3300013100 Ga0157373_10090246 Ga0157373_100902462 150
278 3300013104 Ga0157370_10017529 Ga0157370_100175296 150
279 3300013104 Ga0157370_10036407 Ga0157370_100364074 150
280 3300013104 Ga0157370_10203342 Ga0157370_102033422 150
281 3300013104 Ga0157370_10243453 Ga0157370_102434532 150
282 3300013104 Ga0157370_10273729 Ga0157370_102737292 150
283 3300013105 Ga0157369_10016139 Ga0157369_100161397 150
284 3300013105 Ga0157369_10017304 Ga0157369_100173041 150
285 3300013105 Ga0157369_10035212 Ga0157369_100352124 150
286 3300013105 Ga0157369_10235749 Ga0157369_102357492 150
287 3300013105 Ga0157369_11434428 Ga0157369_114344282 150
288 3300013250 Ga0171462_1008 Ga0171462_1008187 150
289 3300013296 Ga0157374_10016468 Ga0157374_100164685 150
290 3300013296 Ga0157374_10173708 Ga0157374_101737082 150
291 3300013296 Ga0157374_10888654 Ga0157374_108886541 150
292 3300013297 Ga0157378_10169141 Ga0157378_101691413 150
293 3300013297 Ga0157378_10374389 Ga0157378_103743892 150
294 3300013297 Ga0157378_11482469 Ga0157378_114824691 150
295 3300013306 Ga0163162_10709290 Ga0163162_107092901 150
296 3300013307 Ga0157372_10128397 Ga0157372_101283972 150
297 3300013307 Ga0157372_10341267 Ga0157372_103412673 150
298 3300013307 Ga0157372_10494282 Ga0157372_104942822 150
299 3300013307 Ga0157372_10796512 Ga0157372_107965122 150
300 3300013308 Ga0157375_10704688 Ga0157375_107046882 150
301 3300013308 Ga0157375_11797543 Ga0157375_117975431 150
302 3300014325 Ga0163163_10013499 Ga0163163_100134995 150
303 3300014497 Ga0182008_10027012 Ga0182008_100270122 150
304 3300014497 Ga0182008_10037106 Ga0182008_100371062 150
305 3300014497 Ga0182008_10127263 Ga0182008_101272632 150
306 3300014745 Ga0157377_10618808 Ga0157377_106188081 150
307 3300015261 Ga0182006_1001443 Ga0182006_10014434 150
308 3300015261 Ga0182006_1001447 Ga0182006_10014478 150
309 3300015261 Ga0182006_1241454 Ga0182006_12414541 150
310 3300015265 Ga0182005_1024095 Ga0182005_10240952 150
311 3300017792 Ga0163161_10000072 Ga0163161_1000007235 150
312 3300020081 Ga0206354_11625524 Ga0206354_116255241 150
313 3300021358 Ga0213873_10018658 Ga0213873_100186582 150
314 3300021377 Ga0213874_10151608 Ga0213874_101516081 150
315 3300021377 Ga0213874_10158291 Ga0213874_101582912 150
316 3300021384 Ga0213876_10003157 Ga0213876_100031572 150
317 3300021384 Ga0213876_10024863 Ga0213876_100248634 150
318 3300025208 Ga0209436_104233 Ga0209436_1042333 150
319 3300025208 Ga0209436_104647 Ga0209436_1046473 150
320 3300025228 Ga0209672_101222 Ga0209672_1012223 150
321 3300025229 Ga0209147_100352 Ga0209147_10035223 150
322 3300025242 Ga0209258_100133 Ga0209258_10013377 150
323 3300025245 Ga0207425_1000352 Ga0207425_100035226 150
324 3300025245 Ga0207425_1012932 Ga0207425_10129322 150
325 3300025254 Ga0209148_1000188 Ga0209148_100018885 150
326 3300025258 Ga0209129_1000245 Ga0209129_100024536 150
327 3300025258 Ga0209129_1003468 Ga0209129_10034686 150
328 3300025258 Ga0209129_1004337 Ga0209129_10043373 150
329 3300025258 Ga0209129_1005779 Ga0209129_10057794 150
330 3300025258 Ga0209129_1034824 Ga0209129_10348242 150
331 3300025263 Ga0209565_1000165 Ga0209565_100016569 150
332 3300025263 Ga0209565_1006089 Ga0209565_10060893 150
333 3300025272 Ga0209455_1000991 Ga0209455_10009916 150
334 3300025273 Ga0209673_1000454 Ga0209673_100045455 150
335 3300025273 Ga0209673_1001222 Ga0209673_100122224 150
336 3300025273 Ga0209673_1002781 Ga0209673_10027812 150
337 3300025284 Ga0209130_1000658 Ga0209130_10006582 150
338 3300025284 Ga0209130_1001097 Ga0209130_10010979 150
339 3300025284 Ga0209130_1012675 Ga0209130_10126752 150
340 3300025291 Ga0209675_1000823 Ga0209675_100082310 150
341 3300025291 Ga0209675_1011933 Ga0209675_10119333 150
342 3300025292 Ga0209676_1000111 Ga0209676_1000111106 150
343 3300025292 Ga0209676_1010951 Ga0209676_10109512 150
344 3300025294 Ga0209025_1000157 Ga0209025_100015749 150
345 3300025294 Ga0209025_1000615 Ga0209025_100061536 150
346 3300025294 Ga0209025_1013697 Ga0209025_10136975 150
347 3300025295 Ga0209564_1000070 Ga0209564_1000070215 150
348 3300025295 Ga0209564_1000352 Ga0209564_100035269 150
349 3300025297 Ga0209758_1000297 Ga0209758_100029769 150
350 3300025297 Ga0209758_1017089 Ga0209758_10170893 150
351 3300025298 Ga0209050_1000111 Ga0209050_100011185 150
352 3300025299 Ga0209256_1000047 Ga0209256_1000047227 150
353 3300025299 Ga0209256_1000238 Ga0209256_100023869 150
354 3300025302 Ga0207426_1000194 Ga0207426_100019450 150
355 3300025302 Ga0207426_1000294 Ga0207426_100029469 150
356 3300025303 Ga0209051_1000046 Ga0209051_1000046255 150
357 3300025303 Ga0209051_1036611 Ga0209051_10366113 150
358 3300025304 Ga0209257_1000344 Ga0209257_100034466 150
359 3300025304 Ga0209257_1004797 Ga0209257_10047979 150
360 3300025304 Ga0209257_1012644 Ga0209257_10126443 150
361 3300025321 Ga0207656_10006816 Ga0207656_100068163 150
362 3300025321 Ga0207656_10009713 Ga0207656_100097133 150
363 3300025321 Ga0207656_10071923 Ga0207656_100719232 150
364 3300025898 Ga0207692_10016579 Ga0207692_100165794 150
365 3300025900 Ga0207710_10377598 Ga0207710_103775981 150
366 3300025900 Ga0207710_10468898 Ga0207710_104688981 150
367 3300025901 Ga0207688_10034380 Ga0207688_100343801 150
368 3300025903 Ga0207680_10237913 Ga0207680_102379132 150
369 3300025905 Ga0207685_10254593 Ga0207685_102545931 150
370 3300025906 Ga0207699_10217536 Ga0207699_102175362 150
371 3300025909 Ga0207705_10009898 Ga0207705_100098983 150
372 3300025909 Ga0207705_10017143 Ga0207705_100171435 150
373 3300025910 Ga0207684_10018442 Ga0207684_100184427 150
374 3300025911 Ga0207654_10292123 Ga0207654_102921231 150
375 3300025912 Ga0207707_10000363 Ga0207707_1000036344 150
376 3300025912 Ga0207707_10000381 Ga0207707_1000038130 150
377 3300025912 Ga0207707_10038137 Ga0207707_100381374 150
378 3300025913 Ga0207695_10000429 Ga0207695_1000042918 150
379 3300025913 Ga0207695_10036629 Ga0207695_100366292 150
380 3300025913 Ga0207695_10076011 Ga0207695_100760112 150
381 3300025913 Ga0207695_10227547 Ga0207695_102275472 150
382 3300025913 Ga0207695_10344111 Ga0207695_103441112 150
383 3300025913 Ga0207695_10884654 Ga0207695_108846542 150
384 3300025914 Ga0207671_10006678 Ga0207671_100066782 150
385 3300025914 Ga0207671_10030086 Ga0207671_100300864 150
386 3300025914 Ga0207671_10656899 Ga0207671_106568991 150
387 3300025915 Ga0207693_10012494 Ga0207693_100124942 150
388 3300025915 Ga0207693_10179760 Ga0207693_101797601 150
389 3300025917 Ga0207660_10001000 Ga0207660_100010006 150
390 3300025917 Ga0207660_10230057 Ga0207660_102300571 150
391 3300025917 Ga0207660_10419730 Ga0207660_104197302 150
392 3300025919 Ga0207657_10000999 Ga0207657_1000099911 150
393 3300025919 Ga0207657_10003720 Ga0207657_100037204 150
394 3300025919 Ga0207657_10012289 Ga0207657_100122894 150
395 3300025920 Ga0207649_10028628 Ga0207649_100286283 150
396 3300025921 Ga0207652_10001277 Ga0207652_1000127710 150
397 3300025921 Ga0207652_10055493 Ga0207652_100554932 150
398 3300025921 Ga0207652_11083475 Ga0207652_110834752 150
399 3300025922 Ga0207646_10110086 Ga0207646_101100862 150
400 3300025922 Ga0207646_10160356 Ga0207646_101603562 150
401 3300025923 Ga0207681_10594427 Ga0207681_105944271 150
402 3300025923 Ga0207681_10691055 Ga0207681_106910551 150
403 3300025924 Ga0207694_10000359 Ga0207694_1000035918 150
404 3300025924 Ga0207694_10024718 Ga0207694_100247183 150
405 3300025924 Ga0207694_10536881 Ga0207694_105368812 150
406 3300025924 Ga0207694_10989758 Ga0207694_109897581 150
407 3300025925 Ga0207650_10061875 Ga0207650_100618752 150
408 3300025928 Ga0207700_10258875 Ga0207700_102588752 150
409 3300025928 Ga0207700_10338994 Ga0207700_103389942 150
410 3300025928 Ga0207700_10354379 Ga0207700_103543792 150
411 3300025928 Ga0207700_10515401 Ga0207700_105154011 150
412 3300025928 Ga0207700_11610333 Ga0207700_116103331 150
413 3300025929 Ga0207664_10095101 Ga0207664_100951012 150
414 3300025929 Ga0207664_10194238 Ga0207664_101942382 150
415 3300025931 Ga0207644_10226051 Ga0207644_102260512 150
416 3300025932 Ga0207690_10024960 Ga0207690_100249602 150
417 3300025932 Ga0207690_10058242 Ga0207690_100582422 150
418 3300025932 Ga0207690_10315162 Ga0207690_103151622 150
419 3300025932 Ga0207690_10737849 Ga0207690_107378492 150
420 3300025933 Ga0207706_10062308 Ga0207706_100623082 150
421 3300025933 Ga0207706_10085280 Ga0207706_100852802 150
422 3300025935 Ga0207709_10041320 Ga0207709_100413203 150
423 3300025935 Ga0207709_10298479 Ga0207709_102984791 150
424 3300025938 Ga0207704_10891445 Ga0207704_108914451 150
425 3300025938 Ga0207704_11686589 Ga0207704_116865891 150
426 3300025939 Ga0207665_10002228 Ga0207665_1000222810 150
427 3300025939 Ga0207665_10496271 Ga0207665_104962712 150
428 3300025939 Ga0207665_10633838 Ga0207665_106338382 150
429 3300025939 Ga0207665_11317597 Ga0207665_113175971 150
430 3300025941 Ga0207711_10322251 Ga0207711_103222511 150
431 3300025944 Ga0207661_10008299 Ga0207661_100082993 150
432 3300025944 Ga0207661_10464889 Ga0207661_104648891 150
433 3300025944 Ga0207661_10767168 Ga0207661_107671681 150
434 3300025945 Ga0207679_10480848 Ga0207679_104808481 150
435 3300025945 Ga0207679_10866487 Ga0207679_108664871 150
436 3300025949 Ga0207667_10000028 Ga0207667_10000028176 150
437 3300025949 Ga0207667_10007770 Ga0207667_100077703 150
438 3300025949 Ga0207667_10013965 Ga0207667_100139653 150
439 3300025949 Ga0207667_10019832 Ga0207667_100198326 150
440 3300025949 Ga0207667_10049335 Ga0207667_100493352 150
441 3300025949 Ga0207667_10548572 Ga0207667_105485721 150
442 3300025960 Ga0207651_10461386 Ga0207651_104613862 150
443 3300025972 Ga0207668_10187751 Ga0207668_101877512 150
444 3300025972 Ga0207668_10258212 Ga0207668_102582121 150
445 3300025981 Ga0207640_10016150 Ga0207640_100161501 150
446 3300025981 Ga0207640_10091962 Ga0207640_100919622 150
447 3300025981 Ga0207640_10117685 Ga0207640_101176852 150
448 3300025981 Ga0207640_10246813 Ga0207640_102468132 150
449 3300025981 Ga0207640_10330806 Ga0207640_103308061 150
450 3300025986 Ga0207658_10119292 Ga0207658_101192922 150
451 3300025986 Ga0207658_10263531 Ga0207658_102635312 150
452 3300025986 Ga0207658_10664774 Ga0207658_106647741 150
453 3300026023 Ga0207677_10319476 Ga0207677_103194762 150
454 3300026023 Ga0207677_10834059 Ga0207677_108340591 150
455 3300026023 Ga0207677_10849350 Ga0207677_108493502 150
456 3300026023 Ga0207677_11112435 Ga0207677_111124352 150
457 3300026035 Ga0207703_10376367 Ga0207703_103763672 150
458 3300026041 Ga0207639_10020183 Ga0207639_100201834 150
459 3300026041 Ga0207639_10027605 Ga0207639_100276053 150
460 3300026041 Ga0207639_10079803 Ga0207639_100798033 150
461 3300026041 Ga0207639_10182245 Ga0207639_101822453 150
462 3300026067 Ga0207678_10010157 Ga0207678_100101573 150
463 3300026067 Ga0207678_10039882 Ga0207678_100398823 150
464 3300026067 Ga0207678_10247950 Ga0207678_102479502 150
465 3300026067 Ga0207678_10375537 Ga0207678_103755372 150
466 3300026078 Ga0207702_10176335 Ga0207702_101763352 150
467 3300026078 Ga0207702_10227369 Ga0207702_102273692 150
468 3300026078 Ga0207702_10438161 Ga0207702_104381612 150
469 3300026078 Ga0207702_10641435 Ga0207702_106414351 150
470 3300026089 Ga0207648_10049091 Ga0207648_100490913 150
471 3300026089 Ga0207648_10727135 Ga0207648_107271352 150
472 3300026095 Ga0207676_10233716 Ga0207676_102337162 150
473 3300026116 Ga0207674_10007352 Ga0207674_1000735211 150
474 3300026116 Ga0207674_10142181 Ga0207674_101421813 150
475 3300026116 Ga0207674_10177022 Ga0207674_101770222 150
476 3300026116 Ga0207674_10181324 Ga0207674_101813242 150
477 3300026116 Ga0207674_10443322 Ga0207674_104433222 150
478 3300026118 Ga0207675_100762838 Ga0207675_1007628382 150
479 3300026118 Ga0207675_101021671 Ga0207675_1010216712 150
480 3300026121 Ga0207683_11197858 Ga0207683_111978581 150
481 3300026142 Ga0207698_10142144 Ga0207698_101421442 150
482 3300026142 Ga0207698_10330629 Ga0207698_103306291 150
483 3300026142 Ga0207698_10349852 Ga0207698_103498522 150
484 3300026142 Ga0207698_11108819 Ga0207698_111088192 150
485 3300026142 Ga0207698_11151460 Ga0207698_111514602 150
486 3300026142 Ga0207698_11421351 Ga0207698_114213511 150
487 3300027111 Ga0209281_1039075 Ga0209281_10390751 150
488 3300027296 Ga0209389_1000133 Ga0209389_100013338 150
489 3300027296 Ga0209389_1000413 Ga0209389_10004136 150
490 3300027357 Ga0209589_1010310 Ga0209589_10103106 150
491 3300027361 Ga0209489_100597 Ga0209489_10059794 150
492 3300027361 Ga0209489_115313 Ga0209489_1153131 150
493 3300027363 Ga0209700_100005 Ga0209700_100005542 150
494 3300027512 Ga0209179_1001501 Ga0209179_10015013 150
495 3300027512 Ga0209179_1041374 Ga0209179_10413742 150
496 3300027671 Ga0209588_1142764 Ga0209588_11427641 150
497 3300027866 Ga0209813_10004408 Ga0209813_100044083 150
498 3300028379 Ga0268266_10087499 Ga0268266_100874992 150
499 3300028380 Ga0268265_10024179 Ga0268265_100241793 150
500 3300028794 Ga0307515_10348776 Ga0307515_103487762 150
501 3300030763 Ga0265763_1005534 Ga0265763_10055341 150
502 3300031247 Ga0265340_10222850 Ga0265340_102228502 150
503 3300031249 Ga0265339_10013672 Ga0265339_100136721 150
504 3300031250 Ga0265331_10027370 Ga0265331_100273703 150
505 3300031456 Ga0307513_10834302 Ga0307513_108343021 150
506 3300031616 Ga0307508_10003734 Ga0307508_100037346 150
507 3300031616 Ga0307508_10103129 Ga0307508_101031292 150
508 3300031616 Ga0307508_10358559 Ga0307508_103585592 150
509 3300031616 Ga0307508_10470208 Ga0307508_104702082 150
510 3300031616 Ga0307508_10690803 Ga0307508_106908032 150
511 3300031649 Ga0307514_10006880 Ga0307514_100068803 150
512 3300031711 Ga0265314_10044600 Ga0265314_100446003 150
513 3300031711 Ga0265314_10094825 Ga0265314_100948252 150
514 3300031712 Ga0265342_10465326 Ga0265342_104653262 150
515 3300031727 Ga0316576_10685720 Ga0316576_106857202 150
516 3300031730 Ga0307516_10062391 Ga0307516_100623914 150
517 3300031901 Ga0307406_10119306 Ga0307406_101193062 150
518 3300031911 Ga0307412_10041808 Ga0307412_100418081 150
519 3300031911 Ga0307412_10291613 Ga0307412_102916132 150
520 3300032002 Ga0307416_100340513 Ga0307416_1003405132 150
521 3300032002 Ga0307416_100660374 Ga0307416_1006603742 150
522 3300032002 Ga0307416_100901528 Ga0307416_1009015282 150
523 3300032004 Ga0307414_10259224 Ga0307414_102592242 150
524 3300032004 Ga0307414_10484465 Ga0307414_104844652 150
525 3300033180 Ga0307510_10339666 Ga0307510_103396662 150
526 3300034820 Ga0373959_0009197 Ga0373959_0009197_595_1050 150
527 3300035090 Ga0373949_0216107 Ga0373949_0216107_44_499 150
528 3300035112 Ga0373932_0147338 Ga0373932_0147338_67_525 150
529 3300035115 Ga0373941_0082754 Ga0373941_0082754_39_494 150
530 3300035171 Ga0373946_0567826 Ga0373946_0567826_61_516 150
531 3300035242 Ga0373962_0295430 Ga0373962_0295430_12_467 150
532 3300035691 Ga0373931_0162798 Ga0373931_0162798_377_832 150
533 3300035695 Ga0373927_0936865 Ga0373927_0936865_26_481 150
534 3300035725 Ga0373947_0166522 Ga0373947_0166522_422_877 150
535 3300036401 Ga0373937_1016648 Ga0373937_1016648_197_652 150
536 3300037312 Ga0395899_0033659 Ga0395899_0033659_2366_2818 150
537 3300037312 Ga0395899_0179017 Ga0395899_0179017_658_1122 150
538 3300037418 Ga0395900_0010175 Ga0395900_0010175_7634_8089 150
539 3300037418 Ga0395900_0021195 Ga0395900_0021195_4439_4903 150
540 3300037418 Ga0395900_0061122 Ga0395900_0061122_1770_2222 150
541 3300037418 Ga0395900_0686687 Ga0395900_0686687_454_906 150
542 3300037418 Ga0395900_1655355 Ga0395900_1655355_25_477 150
543 3300037466 Ga0395898_0003446 Ga0395898_0003446_16991_17446 150
544 3300037466 Ga0395898_0370117 Ga0395898_0370117_703_1155 150
545 3300037466 Ga0395898_0644073 Ga0395898_0644073_355_807 150
546 3300037466 Ga0395898_0806606 Ga0395898_0806606_30_482 150
547 3300037466 Ga0395898_1242883 Ga0395898_1242883_198_650 150
548 3300037471 Ga0395905_0012360 Ga0395905_0012360_1975_2499 150
549 3300037471 Ga0395905_0034815 Ga0395905_0034815_1877_2341 150
550 3300037471 Ga0395905_0064359 Ga0395905_0064359_1864_2316 150
551 3300037471 Ga0395905_0100041 Ga0395905_0100041_446_901 150
552 3300037471 Ga0395905_0400904 Ga0395905_0400904_734_1186 150
553 3300037853 Ga0436364_1043978 Ga0436364_1043978_784_1242 150
554 3300038443 Ga0395901_0028854 Ga0395901_0028854_2655_3107 150
555 3300038443 Ga0395901_0113628 Ga0395901_0113628_2114_2569 150
556 3300038443 Ga0395901_0227589 Ga0395901_0227589_1152_1604 150
557 3300038443 Ga0395901_0277583 Ga0395901_0277583_743_1195 150
558 3300038443 Ga0395901_1395843 Ga0395901_1395843_73_528 150
559 3300039437 Ga0436365_0043975 Ga0436365_0043975_5709_6161 150
560 3300039437 Ga0436365_0178950 Ga0436365_0178950_751_1206 150
561 3300039437 Ga0436365_0214722 Ga0436365_0214722_47_502 150
562 3300039437 Ga0436365_0355981 Ga0436365_0355981_56_511 150
563 3300039437 Ga0436365_0535444 Ga0436365_0535444_6536_6991 150
564 3300039450 Ga0436363_1382020 Ga0436363_1382020_427_882 150
565 3300039450 Ga0436363_1579194 Ga0436363_1579194_24_479 150
566 3300039453 Ga0436362_0295315 Ga0436362_0295315_1006_1461 150
567 3300041413 Ga0439465_0060268 Ga0439465_0060268_457_912 150
568 3300041459 Ga0451800_0863443 Ga0451800_0863443_64_516 150
569 3300041486 Ga0451807_0539834 Ga0451807_0539834_462_914 150
570 3300041498 Ga0451841_1174930 Ga0451841_1174930_474_926 150
571 3300041501 Ga0451845_0600722 Ga0451845_0600722_33_491 150
572 3300041507 Ga0451851_0264887 Ga0451851_0264887_14_472 150
573 3300041511 Ga0451855_0979810 Ga0451855_0979810_31_483 150
574 3300042004 Ga0439445_0009835 Ga0439445_0009835_1713_2168 150
575 3300042157 Ga0439458_0136884 Ga0439458_0136884_44_496 150
576 3300042436 Ga0439435_0022532 Ga0439435_0022532_451_903 150
577 3300044656 Ga0466969_0046480 Ga0466969_0046480_507_962 150
578 3300044656 Ga0466969_0107149 Ga0466969_0107149_790_1248 150
579 3300044658 Ga0466972_0011625 Ga0466972_0011625_1171_1626 150
580 3300044683 Ga0466965_0140152 Ga0466965_0140152_222_704 150
581 3300044684 Ga0466966_0012361 Ga0466966_0012361_3799_4257 150
582 3300044684 Ga0466966_0222152 Ga0466966_0222152_588_1043 150
583 3300044684 Ga0466966_0227195 Ga0466966_0227195_522_1004 150
584 3300044693 Ga0466961_0078529 Ga0466961_0078529_122_604 150
585 3300044693 Ga0466961_0142208 Ga0466961_0142208_34_516 150
586 3300044693 Ga0466961_0202182 Ga0466961_0202182_80_535 150
587 3300044694 Ga0466963_0025561 Ga0466963_0025561_1670_2152 150
588 3300044694 Ga0466963_0528727 Ga0466963_0528727_318_773 150
589 3300044706 Ga0466964_0538817 Ga0466964_0538817_35_517 150
590 3300044719 Ga0466971_0012181 Ga0466971_0012181_3251_3733 150
591 3300044735 Ga0466968_0009013 Ga0466968_0009013_2379_2834 150
592 3300044765 Ga0466970_0016296 Ga0466970_0016296_280_762 150
593 3300044765 Ga0466970_0068776 Ga0466970_0068776_816_1271 150
594 3300044765 Ga0466970_0525544 Ga0466970_0525544_201_653 150
595 3300044842 Ga0466957_0002214 Ga0466957_0002214_5675_6157 150
596 3300044842 Ga0466957_0030036 Ga0466957_0030036_820_1275 150
597 3300044842 Ga0466957_0503463 Ga0466957_0503463_371_826 150
598 3300044901 Ga0466960_0030155 Ga0466960_0030155_1558_2013 150
599 3300045049 Ga0466959_0020527 Ga0466959_0020527_2446_2901 150
600 3300045049 Ga0466959_0044660 Ga0466959_0044660_703_1185 150
601 3300045049 Ga0466959_0282418 Ga0466959_0282418_537_995 150
602 3300045049 Ga0466959_0510055 Ga0466959_0510055_253_708 150
603 3300045836 Ga0466958_0162432 Ga0466958_0162432_758_1216 150
604 3300045836 Ga0466958_0400990 Ga0466958_0400990_282_764 150
605 3300045976 Ga0466967_0053350 Ga0466967_0053350_2559_3014 150
606 3300045976 Ga0466967_0104657 Ga0466967_0104657_786_1238 150
607 3300045976 Ga0466967_0304118 Ga0466967_0304118_574_1056 150
608 3300046454 Ga0495592_0860419 Ga0495592_0860419_65_520 150
609 3300046455 Ga0495603_0446212 Ga0495603_0446212_155_610 150
610 3300046459 Ga0495629_0352881 Ga0495629_0352881_145_597 150
611 3300046459 Ga0495629_0503033 Ga0495629_0503033_152_604 150
612 3300046460 Ga0495638_0006956 Ga0495638_0006956_2112_2567 150
613 3300046460 Ga0495638_0021201 Ga0495638_0021201_523_975 150
614 3300046460 Ga0495638_0338042 Ga0495638_0338042_213_671 150
615 3300046461 Ga0495641_0343052 Ga0495641_0343052_25_480 150
616 3300046472 Ga0495580_0668337 Ga0495580_0668337_188_643 150
617 3300046473 Ga0495582_0492145 Ga0495582_0492145_149_601 150
618 3300046474 Ga0495605_0185877 Ga0495605_0185877_123_578 150
619 3300046491 Ga0495584_0051802 Ga0495584_0051802_431_886 150
620 3300046492 Ga0495585_0012196 Ga0495585_0012196_4132_4587 150
621 3300046506 Ga0495583_0095423 Ga0495583_0095423_141_593 150
622 3300046507 Ga0495606_0000070 Ga0495606_0000070_106310_106762 150
623 3300046512 Ga0495610_0059335 Ga0495610_0059335_232_684 150
624 3300046512 Ga0495610_0156215 Ga0495610_0156215_385_837 150
625 3300046513 Ga0495616_0000338 Ga0495616_0000338_21292_21744 150
626 3300046513 Ga0495616_0167596 Ga0495616_0167596_39_494 150
627 3300046515 Ga0495620_0108176 Ga0495620_0108176_458_910 150
628 3300046517 Ga0495630_0026824 Ga0495630_0026824_1409_1864 150
629 3300046518 Ga0495631_0000163 Ga0495631_0000163_20824_21276 150
630 3300046518 Ga0495631_0086528 Ga0495631_0086528_74_529 150
631 3300046520 Ga0495637_0006808 Ga0495637_0006808_1237_1689 150
632 3300046522 Ga0495643_0167270 Ga0495643_0167270_134_589 150
633 3300046523 Ga0495644_0338533 Ga0495644_0338533_116_571 150
634 3300046530 Ga0495654_0002141 Ga0495654_0002141_2307_2759 150
635 3300046533 Ga0495640_0910926 Ga0495640_0910926_41_496 150
636 3300046535 Ga0495586_0456299 Ga0495586_0456299_137_592 150
637 3300046537 Ga0495598_0075357 Ga0495598_0075357_94_549 150
638 3300046538 Ga0495609_0240161 Ga0495609_0240161_222_677 150
639 3300046539 Ga0495621_0007800 Ga0495621_0007800_2194_2646 150
640 3300046542 Ga0495597_0091226 Ga0495597_0091226_547_1002 150
641 3300046543 Ga0495645_0317356 Ga0495645_0317356_288_743 150
642 3300046557 Ga0495622_0180822 Ga0495622_0180822_398_850 150
643 3300046616 Ga0495668_0273429 Ga0495668_0273429_123_578 150
644 3300046648 Ga0495611_0036796 Ga0495611_0036796_1239_1691 150
645 3300046660 Ga0495625_0030946 Ga0495625_0030946_635_1087 150
646 3300046664 Ga0495659_0166893 Ga0495659_0166893_262_717 150
647 3300046665 Ga0495661_0086570 Ga0495661_0086570_182_637 150
648 3300046674 Ga0495588_0047906 Ga0495588_0047906_1100_1552 150
649 3300046674 Ga0495588_0353023 Ga0495588_0353023_154_606 150
650 3300046674 Ga0495588_0583363 Ga0495588_0583363_114_569 150
651 3300046683 Ga0495658_0647497 Ga0495658_0647497_103_555 150
652 3300046684 Ga0495669_0407217 Ga0495669_0407217_144_599 150
653 3300046690 Ga0495624_0146398 Ga0495624_0146398_864_1316 150
654 3300046690 Ga0495624_0358164 Ga0495624_0358164_304_759 150
655 3300046691 Ga0495670_0238839 Ga0495670_0238839_212_667 150
656 3300046692 Ga0495671_0020470 Ga0495671_0020470_2020_2472 150
657 3300046810 Ga0495660_0065191 Ga0495660_0065191_1380_1832 150
658 3300046810 Ga0495660_0149755 Ga0495660_0149755_539_991 150
659 3300046810 Ga0495660_0322823 Ga0495660_0322823_107_562 150
660 3300047318 Ga0495636_0399963 Ga0495636_0399963_34_489 150
661 3300047319 Ga0495674_0021627 Ga0495674_0021627_4612_5157 150
662 3300047320 Ga0495672_0280902 Ga0495672_0280902_223_681 150
663 3300047321 Ga0495676_0126961 Ga0495676_0126961_760_1212 150
664 3300047323 Ga0495683_0146029 Ga0495683_0146029_12_467 150
665 3300047469 Ga0495673_0325341 Ga0495673_0325341_15_470 150
666 3300047472 Ga0495686_0000841 Ga0495686_0000841_7389_7841 150
667 3300047472 Ga0495686_0016462 Ga0495686_0016462_3123_3575 150
668 3300047472 Ga0495686_0061464 Ga0495686_0061464_363_818 150
669 3300047472 Ga0495686_0069679 Ga0495686_0069679_1200_1652 150
670 3300047472 Ga0495686_0236830 Ga0495686_0236830_488_946 150
671 3300047673 Ga0495593_0068780 Ga0495593_0068780_757_1209 150
672 3300048089 Ga0495614_0117617 Ga0495614_0117617_113_565 150
673 3300048091 Ga0495626_0116626 Ga0495626_0116626_62_517 150
674 3300048903 Ga0496100_0244298 Ga0496100_0244298_477_932 150
675 3300048903 Ga0496100_0374886 Ga0496100_0374886_546_998 150
676 3300048903 Ga0496100_1084555 Ga0496100_1084555_133_588 150
677 3300048903 Ga0496100_1204923 Ga0496100_1204923_31_486 150
678 3300048904 Ga0496101_0015961 Ga0496101_0015961_2127_2579 150
679 3300048904 Ga0496101_0152226 Ga0496101_0152226_1095_1550 150
680 3300048904 Ga0496101_0373053 Ga0496101_0373053_614_1069 150
681 3300048905 Ga0496102_0012441 Ga0496102_0012441_5958_6413 150
682 3300048905 Ga0496102_0366272 Ga0496102_0366272_617_1099 150
683 3300048905 Ga0496102_0837433 Ga0496102_0837433_161_616 150
684 3300048907 Ga0496104_0623015 Ga0496104_0623015_303_758 150
685 3300048908 Ga0496105_0117753 Ga0496105_0117753_584_1039 150
686 3300048909 Ga0496106_0472082 Ga0496106_0472082_519_974 150
687 3300048910 Ga0496107_0761904 Ga0496107_0761904_45_497 150
688 3300048910 Ga0496107_0944835 Ga0496107_0944835_97_552 150
689 3300048911 Ga0496108_0044497 Ga0496108_0044497_2288_2743 150
690 3300048911 Ga0496108_0146790 Ga0496108_0146790_526_981 150
691 3300048912 Ga0496109_0023980 Ga0496109_0023980_4477_4932 150
692 3300048912 Ga0496109_0928889 Ga0496109_0928889_26_481 150
693 3300048913 Ga0496110_0315646 Ga0496110_0315646_738_1193 150
694 3300048914 Ga0496111_0072814 Ga0496111_0072814_124_579 150
695 3300048915 Ga0496112_0001369 Ga0496112_0001369_8800_9255 150
696 3300048915 Ga0496112_0868689 Ga0496112_0868689_142_597 150
697 3300048916 Ga0496113_0026637 Ga0496113_0026637_485_940 150
698 3300048917 Ga0496114_0267821 Ga0496114_0267821_477_932 150
699 3300048918 Ga0496115_0617839 Ga0496115_0617839_121_573 150
700 3300048918 Ga0496115_0862248 Ga0496115_0862248_115_570 150
701 3300048919 Ga0496116_0213092 Ga0496116_0213092_261_713 150
702 3300048920 Ga0496117_0075201 Ga0496117_0075201_699_1151 150
703 3300048921 Ga0496118_0027891 Ga0496118_0027891_3434_3889 150
704 3300048921 Ga0496118_0040951 Ga0496118_0040951_1891_2343 150
705 3300048922 Ga0496119_0050269 Ga0496119_0050269_1366_1818 150
706 3300048922 Ga0496119_0210886 Ga0496119_0210886_177_632 150
707 3300048923 Ga0496120_0162739 Ga0496120_0162739_109_564 150
708 3300048924 Ga0496121_0162838 Ga0496121_0162838_856_1311 150
709 3300048925 Ga0496122_0086918 Ga0496122_0086918_67_519 150
710 3300048925 Ga0496122_0147041 Ga0496122_0147041_580_1032 150
711 3300048925 Ga0496122_0399114 Ga0496122_0399114_146_601 150
712 3300048926 Ga0496123_0036494 Ga0496123_0036494_2272_2724 150
713 3300048926 Ga0496123_0163448 Ga0496123_0163448_509_961 150
714 3300048927 Ga0496124_0076778 Ga0496124_0076778_672_1124 150
715 3300048927 Ga0496124_0141331 Ga0496124_0141331_373_825 150
716 3300048927 Ga0496124_0393517 Ga0496124_0393517_19_474 150
717 3300048928 Ga0496125_0061820 Ga0496125_0061820_2062_2517 150
718 3300048928 Ga0496125_0156338 Ga0496125_0156338_1070_1522 150
719 3300048929 Ga0496126_0003228 Ga0496126_0003228_13045_13509 150
720 3300048929 Ga0496126_0105058 Ga0496126_0105058_1318_1770 150
721 3300049568 Ga0501031_0090667 Ga0501031_0090667_320_775 150
722 3300049568 Ga0501031_0495842 Ga0501031_0495842_280_732 150
723 3300049569 Ga0501032_0003313 Ga0501032_0003313_4173_4625 150
724 3300049569 Ga0501032_0171964 Ga0501032_0171964_608_1063 150
725 3300049569 Ga0501032_0175532 Ga0501032_0175532_457_915 150
726 3300049569 Ga0501032_0182178 Ga0501032_0182178_172_627 150
727 3300049569 Ga0501032_0220955 Ga0501032_0220955_516_971 150
728 3300049569 Ga0501032_0391828 Ga0501032_0391828_22_477 150
729 3300049569 Ga0501032_0730748 Ga0501032_0730748_28_480 150
730 3300049570 Ga0501033_0003150 Ga0501033_0003150_11852_12304 150
731 3300049570 Ga0501033_0019795 Ga0501033_0019795_1292_1744 150
732 3300049570 Ga0501033_0041579 Ga0501033_0041579_2024_2476 150
733 3300049570 Ga0501033_0217898 Ga0501033_0217898_148_648 150
734 3300049570 Ga0501033_0808820 Ga0501033_0808820_100_555 150
735 3300049571 Ga0501034_0154717 Ga0501034_0154717_943_1398 150
736 3300049571 Ga0501034_0313426 Ga0501034_0313426_676_1128 150
737 3300049571 Ga0501034_0423723 Ga0501034_0423723_28_483 150
738 3300049571 Ga0501034_0751190 Ga0501034_0751190_45_497 150
739 3300049571 Ga0501034_1056850 Ga0501034_1056850_216_671 150
740 3300049572 Ga0501036_0125883 Ga0501036_0125883_1360_1815 150
741 3300049572 Ga0501036_0132931 Ga0501036_0132931_1479_1931 150
742 3300049572 Ga0501036_0271533 Ga0501036_0271533_328_825 150
743 3300049573 Ga0501037_0000253 Ga0501037_0000253_31284_31736 150
744 3300049573 Ga0501037_0109735 Ga0501037_0109735_1232_1684 150
745 3300049573 Ga0501037_0120562 Ga0501037_0120562_78_530 150
746 3300049573 Ga0501037_0131266 Ga0501037_0131266_781_1236 150
747 3300049574 Ga0501038_0133674 Ga0501038_0133674_570_1022 150
748 3300049574 Ga0501038_0484681 Ga0501038_0484681_367_909 150
749 3300049575 Ga0501039_0189303 Ga0501039_0189303_807_1262 150
750 3300049575 Ga0501039_0248974 Ga0501039_0248974_562_1014 150
751 3300049579 Ga0501043_0000100 Ga0501043_0000100_16610_17062 150
752 3300049579 Ga0501043_0023314 Ga0501043_0023314_3392_3850 150
753 3300049579 Ga0501043_0030141 Ga0501043_0030141_3375_3830 150
754 3300049579 Ga0501043_0031815 Ga0501043_0031815_1334_1786 150
755 3300049579 Ga0501043_0046356 Ga0501043_0046356_29_529 150
756 3300049579 Ga0501043_0157335 Ga0501043_0157335_382_834 150
757 3300049579 Ga0501043_0172300 Ga0501043_0172300_33_485 150
758 3300049579 Ga0501043_0189483 Ga0501043_0189483_1046_1501 150
759 3300049579 Ga0501043_0496323 Ga0501043_0496323_112_564 150
760 3300049580 Ga0501046_0390643 Ga0501046_0390643_485_937 150
761 3300049580 Ga0501046_0490132 Ga0501046_0490132_227_682 150
762 3300049580 Ga0501046_0562634 Ga0501046_0562634_125_580 150
763 3300049581 Ga0501047_0032207 Ga0501047_0032207_1116_1568 150
764 3300049581 Ga0501047_0056248 Ga0501047_0056248_20_475 150
765 3300049581 Ga0501047_0151679 Ga0501047_0151679_464_916 150
766 3300049581 Ga0501047_0272527 Ga0501047_0272527_379_879 150
767 3300049582 Ga0501048_0353955 Ga0501048_0353955_28_483 150
768 3300049583 Ga0501067_0026924 Ga0501067_0026924_1409_1861 150
769 3300049583 Ga0501067_0351789 Ga0501067_0351789_300_758 150
770 3300049583 Ga0501067_0542681 Ga0501067_0542681_133_630 150
771 3300049583 Ga0501067_0642945 Ga0501067_0642945_105_560 150
772 3300049583 Ga0501067_0721111 Ga0501067_0721111_47_499 150
773 3300049584 Ga0501068_0114351 Ga0501068_0114351_951_1406 150
774 3300049585 Ga0501069_0000020 Ga0501069_0000020_91001_91453 150
775 3300049585 Ga0501069_0008202 Ga0501069_0008202_1655_2107 150
776 3300049585 Ga0501069_0037791 Ga0501069_0037791_1611_2063 150
777 3300049585 Ga0501069_0062709 Ga0501069_0062709_1122_1574 150
778 3300049585 Ga0501069_0434782 Ga0501069_0434782_131_586 150
779 3300049585 Ga0501069_0724773 Ga0501069_0724773_87_539 150
780 3300049586 Ga0501070_0000193 Ga0501070_0000193_40870_41322 150
781 3300049586 Ga0501070_0000595 Ga0501070_0000595_22269_22721 150
782 3300049586 Ga0501070_0000836 Ga0501070_0000836_18576_19028 150
783 3300049586 Ga0501070_0005381 Ga0501070_0005381_1598_2050 150
784 3300049586 Ga0501070_0017885 Ga0501070_0017885_1790_2245 150
785 3300049586 Ga0501070_0130201 Ga0501070_0130201_576_1031 150
786 3300049586 Ga0501070_0500762 Ga0501070_0500762_26_481 150
787 3300049586 Ga0501070_0732138 Ga0501070_0732138_65_517 150
788 3300049587 Ga0501071_0145454 Ga0501071_0145454_1271_1729 150
789 3300049587 Ga0501071_0796822 Ga0501071_0796822_104_556 150
790 3300049588 Ga0501072_0732140 Ga0501072_0732140_85_540 150
791 3300049589 Ga0501073_0014669 Ga0501073_0014669_3590_4045 150
792 3300049589 Ga0501073_0044918 Ga0501073_0044918_2423_2875 150
793 3300049589 Ga0501073_0136308 Ga0501073_0136308_1026_1478 150
794 3300049589 Ga0501073_0847135 Ga0501073_0847135_156_608 150
795 3300049590 Ga0501074_0000063 Ga0501074_0000063_37488_37940 150
796 3300049590 Ga0501074_0092478 Ga0501074_0092478_1652_2107 150
797 3300049590 Ga0501074_0334729 Ga0501074_0334729_573_1028 150
798 3300049590 Ga0501074_0643287 Ga0501074_0643287_124_576 150
799 3300049741 Ga0501079_0156949 Ga0501079_0156949_732_1184 150
800 3300049741 Ga0501079_0530271 Ga0501079_0530271_131_586 150
801 3300049741 Ga0501079_1446052 Ga0501079_1446052_59_514 150
802 3300049742 Ga0501080_0004199 Ga0501080_0004199_2596_3048 150
803 3300049742 Ga0501080_0010754 Ga0501080_0010754_7440_7892 150
804 3300049742 Ga0501080_0053672 Ga0501080_0053672_2478_2933 150
805 3300049742 Ga0501080_0516665 Ga0501080_0516665_427_924 150
806 3300049744 Ga0501083_0000205 Ga0501083_0000205_23267_23719 150
807 3300049744 Ga0501083_0224427 Ga0501083_0224427_178_633 150
808 3300049744 Ga0501083_0346219 Ga0501083_0346219_297_752 150
809 3300049744 Ga0501083_0562403 Ga0501083_0562403_251_703 150
810 3300049744 Ga0501083_0911605 Ga0501083_0911605_23_475 150
811 3300049822 Ga0501035_0000070 Ga0501035_0000070_31143_31595 150
812 3300049822 Ga0501035_0001992 Ga0501035_0001992_9799_10251 150
813 3300049822 Ga0501035_0002240 Ga0501035_0002240_5781_6233 150
814 3300049822 Ga0501035_0018210 Ga0501035_0018210_5202_5699 150
815 3300049822 Ga0501035_0028327 Ga0501035_0028327_15_530 150
816 3300049822 Ga0501035_0189028 Ga0501035_0189028_119_574 150
817 3300049822 Ga0501035_0296803 Ga0501035_0296803_654_1106 150
818 3300049823 Ga0501044_0000037 Ga0501044_0000037_23791_24243 150
819 3300049823 Ga0501044_0023371 Ga0501044_0023371_2782_3240 150
820 3300049823 Ga0501044_0032505 Ga0501044_0032505_2370_2822 150
821 3300049823 Ga0501044_0051263 Ga0501044_0051263_283_735 150
822 3300049823 Ga0501044_0058214 Ga0501044_0058214_543_995 150
823 3300049823 Ga0501044_0061251 Ga0501044_0061251_2715_3167 150
824 3300049823 Ga0501044_0171458 Ga0501044_0171458_476_991 150
825 3300049823 Ga0501044_0243492 Ga0501044_0243492_1202_1657 150
826 3300049823 Ga0501044_0359298 Ga0501044_0359298_419_874 150
827 3300049823 Ga0501044_0398376 Ga0501044_0398376_316_816 150
828 3300049823 Ga0501044_0678625 Ga0501044_0678625_404_859 150
829 3300049823 Ga0501044_0913825 Ga0501044_0913825_79_531 150
830 3300050490 nmdc:mga03n38_815137_c1 nmdc:mga03n38_815137_c1_32_484 150
831 3300050493 nmdc:mga0k408_1222_c1 nmdc:mga0k408_1222_c1_6494_6949 150
832 3300050493 nmdc:mga0k408_17605_c2 nmdc:mga0k408_17605_c2_131_679 150
833 3300050493 nmdc:mga0k408_66221_c1 nmdc:mga0k408_66221_c1_607_1059 150
834 3300050493 nmdc:mga0k408_68564_c1 nmdc:mga0k408_68564_c1_438_893 150
835 3300050493 nmdc:mga0k408_80740_c1 nmdc:mga0k408_80740_c1_684_1139 150
836 3300050494 nmdc:mga06z11_42901_c1 nmdc:mga06z11_42901_c1_38_586 150
837 3300050494 nmdc:mga06z11_628342_c1 nmdc:mga06z11_628342_c1_91_546 150
838 3300050495 nmdc:mga04h51_132867_c1 nmdc:mga04h51_132867_c1_307_762 150
839 3300050496 nmdc:mga07m45_12323_c1 nmdc:mga07m45_12323_c1_1249_1797 150
840 3300050496 nmdc:mga07m45_12524_c1 nmdc:mga07m45_12524_c1_2253_2705 150
841 3300050496 nmdc:mga07m45_221124_c1 nmdc:mga07m45_221124_c1_177_632 150
842 3300050496 nmdc:mga07m45_222503_c1 nmdc:mga07m45_222503_c1_126_578 150
843 3300050496 nmdc:mga07m45_225557_c1 nmdc:mga07m45_225557_c1_164_619 150
844 3300050496 nmdc:mga07m45_36017_c1 nmdc:mga07m45_36017_c1_714_1166 150
845 3300050507 nmdc:mga05p37_1268362_c1 nmdc:mga05p37_1268362_c1_277_732 150
846 3300050516 nmdc:mga0sz30_323296_c1 nmdc:mga0sz30_323296_c1_53_508 150
847 3300053077 Ga0495601_0080115 Ga0495601_0080115_1429_1884 150
848 3300053078 Ga0495612_0432903 Ga0495612_0432903_101_556 150
849 3300053079 Ga0500610_0003000 Ga0500610_0003000_2999_3451 150
850 3300053079 Ga0500610_0132941 Ga0500610_0132941_432_884 150
851 3300053086 Ga0500578_0092904 Ga0500578_0092904_216_674 150
852 3300053086 Ga0500578_0482243 Ga0500578_0482243_140_598 150
853 3300053087 Ga0500643_041209 Ga0500643_041209_326_778 150
854 3300053088 Ga0500644_0010325 Ga0500644_0010325_266_724 150
855 3300053088 Ga0500644_0419011 Ga0500644_0419011_75_530 150
856 3300053090 Ga0500646_0016030 Ga0500646_0016030_1185_1643 150
857 3300053091 Ga0500647_0367973 Ga0500647_0367973_81_536 150
858 3300053093 Ga0500651_0002595 Ga0500651_0002595_7612_8064 150
859 3300053093 Ga0500651_0014879 Ga0500651_0014879_1227_1685 150
860 3300053093 Ga0500651_0080404 Ga0500651_0080404_466_924 150
861 3300053093 Ga0500651_0146221 Ga0500651_0146221_641_1099 150
862 3300053094 Ga0500566_0000003 Ga0500566_0000003_64760_65215 150
863 3300053094 Ga0500566_0489857 Ga0500566_0489857_35_493 150
864 3300053095 Ga0500640_000494 Ga0500640_000494_8117_8572 150
865 3300053108 Ga0500562_068929 Ga0500562_068929_236_688 150
866 3300053110 Ga0500571_000610 Ga0500571_000610_2280_2732 150
867 3300053111 Ga0500572_000064 Ga0500572_000064_22412_22867 150
868 3300053111 Ga0500572_068257 Ga0500572_068257_549_1001 150
869 3300053115 Ga0500591_062438 Ga0500591_062438_340_795 150
870 3300053116 Ga0500592_023229 Ga0500592_023229_21_479 150
871 3300053117 Ga0500593_001312 Ga0500593_001312_6241_6693 150
872 3300053118 Ga0500594_0107655 Ga0500594_0107655_184_642 150
873 3300053118 Ga0500594_0136375 Ga0500594_0136375_283_741 150
874 3300053118 Ga0500594_0150956 Ga0500594_0150956_152_604 150
875 3300053118 Ga0500594_0196935 Ga0500594_0196935_68_526 150
876 3300053119 Ga0500595_001895 Ga0500595_001895_595_1053 150
877 3300053121 Ga0500607_002084 Ga0500607_002084_15084_15536 150
878 3300053122 Ga0500608_010082 Ga0500608_010082_1109_1561 150
879 3300053122 Ga0500608_049218 Ga0500608_049218_598_1053 150
880 3300053123 Ga0500614_000728 Ga0500614_000728_2000_2455 150
881 3300053123 Ga0500614_197155 Ga0500614_197155_77_535 150
882 3300053128 Ga0500626_017227 Ga0500626_017227_2345_2797 150
883 3300053130 Ga0500642_0000786 Ga0500642_0000786_3216_3674 150
884 3300053133 Ga0500655_002349 Ga0500655_002349_685_1137 150
885 3300053133 Ga0500655_027279 Ga0500655_027279_434_892 150
886 3300053134 Ga0500658_0003124 Ga0500658_0003124_2100_2552 150
887 3300053134 Ga0500658_0004678 Ga0500658_0004678_3426_3878 150
888 3300053136 Ga0500559_0000697 Ga0500559_0000697_18001_18456 150
889 3300053136 Ga0500559_0023339 Ga0500559_0023339_1315_1767 150
890 3300053138 Ga0500564_016854 Ga0500564_016854_1092_1544 150
891 3300053139 Ga0500568_0296634 Ga0500568_0296634_39_497 150
892 3300053140 Ga0500573_0267064 Ga0500573_0267064_256_708 150
893 3300053141 Ga0500574_031489 Ga0500574_031489_679_1131 150
894 3300053142 Ga0500577_0149039 Ga0500577_0149039_115_573 150
895 3300053142 Ga0500577_0331944 Ga0500577_0331944_165_623 150
896 3300053146 Ga0500588_0057214 Ga0500588_0057214_311_769 150
897 3300053146 Ga0500588_0099006 Ga0500588_0099006_200_658 150
898 3300053150 Ga0500603_000211 Ga0500603_000211_14482_14937 150
899 3300053151 Ga0500604_0004630 Ga0500604_0004630_70_528 150
900 3300053151 Ga0500604_0115088 Ga0500604_0115088_218_670 150
901 3300053151 Ga0500604_0243347 Ga0500604_0243347_96_554 150
902 3300053153 Ga0500616_0000705 Ga0500616_0000705_11028_11486 150
903 3300053153 Ga0500616_0005404 Ga0500616_0005404_3408_3860 150
904 3300053158 Ga0500627_0155763 Ga0500627_0155763_61_513 150
905 3300053159 Ga0500630_004374 Ga0500630_004374_850_1305 150
906 3300053160 Ga0500633_0064090 Ga0500633_0064090_770_1228 150
907 3300053161 Ga0500634_0112681 Ga0500634_0112681_136_594 150
908 3300053161 Ga0500634_0163162 Ga0500634_0163162_531_986 150
909 3300053162 Ga0500638_058028 Ga0500638_058028_1179_1634 150
910 3300053163 Ga0500639_000042 Ga0500639_000042_49503_49958 150
911 3300053729 Ga0500625_139109 Ga0500625_139109_158_610 150
912 3300053731 Ga0500609_009377 Ga0500609_009377_581_1039 150
913 3300053734 Ga0500565_003471 Ga0500565_003471_228_680 150
914 3300053735 Ga0500596_004183 Ga0500596_004183_1062_1517 150
915 3300053735 Ga0500596_004335 Ga0500596_004335_455_907 150
916 3300053739 Ga0500587_015452 Ga0500587_015452_425_883 150
917 3300054114 Ga0501084_0460654 Ga0501084_0460654_547_1005 150
918 3300054114 Ga0501084_0799963 Ga0501084_0799963_65_520 150
919 3300060353 Ga0501082_0115365 Ga0501082_0115365_1370_1822 150
920 3300061719 Ga0466962_0011427 Ga0466962_0011427_123_605 150
921 3300061719 Ga0466962_0034602 Ga0466962_0034602_297_752 150
922 3300061734 Ga0530510_0225753 Ga0530510_0225753_570_1025 150
923 iso_pu_bacteria 2513237141 2513893869 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05025

RbsD_FucU

RbsD / FucU transport protein family

39

182

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ob5-assembly1.cif.gz_A-2 crystal structure of protein atu2016, putative sugar binding protein 0.9711 1 146
2ob5-assembly1.cif.gz_A-2 crystal structure of protein atu2016, putative sugar binding protein 0.9393 1 146
3mvk-assembly1.cif.gz_G the crystal structure of fucu from bifidobacterium longum to 1.65a 0.9261 5 146
3mvk-assembly5.cif.gz_D the crystal structure of fucu from bifidobacterium longum to 1.65a 0.9242 5 146
4a34-assembly1.cif.gz_B crystal structure of the fucose mutarotase in complex with l-fucose from streptococcus pneumoniae 0.9224 2 147
ID Description Score Start End Superfamily
2ob5A00 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9654 1 146 3.40.1650.10
2ob5A00 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9328 1 146 3.40.1650.10
4a34B01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9268 10 144 3.40.1650.10
4a34B01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.92 10 144 3.40.1650.10
3mvkF01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8984 10 144 3.40.1650.10
ID Description Score Start End GO Terms
AF-A0A5C1WDZ3-F1-model_v4 Ribose ABC transporter 0.9819 1 148 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A529FKN9-F1-model_v4 Ribose ABC transporter 0.9808 48 150 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193
AF-A0A812JVH4-F1-model_v4 Ribokinase (RK) (EC 2.7.1.15) 0.9788 1 148 GO:0004747
GO:0005524
GO:0005634
GO:0005829
GO:0016853
GO:0019303
GO:0046872
GO:0048029
AF-A0A382PLN9-F1-model_v4 L-fucose mutarotase (EC 5.1.3.29) 0.978 20 150 GO:0006004
GO:0016857
GO:0036065
GO:0042806
AF-A0A6A4ULI4-F1-model_v4 D-ribose pyranase 0.9759 1 146 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193

Feature Viewer

pLDDT pTM Quality
95.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map