F485842
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 923 | 433 | 922 | 151 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2513237141|2513893869 |
| Length | 187 |
| Sequence | PCPDRSQAYTRQRSSSINGTGHPRRKVRRVLEGSGGMLKSIDPMLNADVLYALRAMGHGDDLVLCDTNFPADAVARQTVLGQLLRIDNVPASRAARAILSVLPLDSFVDQPALRMEIVGQPDEIPPVQLEVQREIDAAEGRPFPMGSIERFAFYELAKKAYCVVQTGERRFYGCFVFKKGVIAPDAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 111 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 213 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 219 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 223 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 229 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 247 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 248 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 249 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 250 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 253 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 254 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 255 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 256 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 257 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 258 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 259 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 260 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 267 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 268 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 269 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 270 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 328 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 329 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 330 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 331 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 332 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 341 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 342 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 343 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 344 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 345 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 346 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 347 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 348 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 349 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 350 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 351 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 378 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 379 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 380 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 381 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 388 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 390 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 391 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 392 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 394 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 395 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 398 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 399 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 400 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 401 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 403 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 404 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 405 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 407 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 408 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 410 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 412 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 413 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 414 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 415 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 416 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 419 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 421 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 422 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 423 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 425 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 426 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 427 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 428 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 429 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 430 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 433 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0.65 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.15 |
| Nodule | 1.08 |
| Rhizoplane | 3.14 |
| Rhizosphere | 69.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1005418 | 3300002739 | Bacteria | 1872 |
| 2 | JGI25158J39367_1009134 | 3300002739 | Bacteria | 1363 |
| 3 | JGI25152J39213_1011261 | 3300002773 | Bacteria | 1988 |
| 4 | JGI25152J39213_1011297 | 3300002773 | Bacteria | 1982 |
| 5 | JGI25150J39212_1002359 | 3300002774 | Bacteria | 4739 |
| 6 | JGI25150J39212_1022189 | 3300002774 | Bacteria | 957 |
| 7 | JGI25159J45721_1011623 | 3300002987 | Bacteria | 2145 |
| 8 | JGI25159J45721_1012728 | 3300002987 | Bacteria | 1988 |
| 9 | JGI25151J46595_10000406 | 3300003187 | Bacteria | 44525 |
| 10 | JGI25151J46595_10033255 | 3300003187 | Bacteria | 1988 |
| 11 | JGI25151J46595_10064048 | 3300003187 | Bacteria | 1153 |
| 12 | JGI25153J46596_10027553 | 3300003215 | Bacteria | 1988 |
| 13 | rootL2_10141541 | 3300003322 | Bacteria | 4350 |
| 14 | JGI25160J50197_1015392 | 3300003354 | Bacteria | 2511 |
| 15 | JGI25160J50197_1020567 | 3300003354 | Bacteria | 1988 |
| 16 | JGI25161J50226_1006911 | 3300003374 | Bacteria | 1983 |
| 17 | JGI25161J50226_1010928 | 3300003374 | Bacteria | 1174 |
| 18 | Ga0006562J51391_1040460 | 3300003578 | Bacteria | 4850 |
| 19 | Ga0006562J51391_1124565 | 3300003578 | Bacteria | 2460 |
| 20 | Ga0006562J51391_1124567 | 3300003578 | Bacteria | 4070 |
| 21 | Ga0055535_1000472 | 3300003761 | Bacteria | 36632 |
| 22 | Ga0055542_1000103 | 3300003762 | Bacteria | 114989 |
| 23 | Ga0055526_1018877 | 3300003771 | Bacteria | 2544 |
| 24 | Ga0055526_1018911 | 3300003771 | Bacteria | 2538 |
| 25 | Ga0055537_1003586 | 3300003773 | Bacteria | 4733 |
| 26 | Ga0055537_1007518 | 3300003773 | Bacteria | 2618 |
| 27 | Ga0055524_1017335 | 3300003775 | Bacteria | 2544 |
| 28 | Ga0055524_1017395 | 3300003775 | Bacteria | 2538 |
| 29 | Ga0055536_1010899 | 3300003781 | Bacteria | 3547 |
| 30 | Ga0055536_1034514 | 3300003781 | Bacteria | 1276 |
| 31 | Ga0055534_1010192 | 3300003784 | Bacteria | 1988 |
| 32 | Ga0055534_1012069 | 3300003784 | Bacteria | 1726 |
| 33 | Ga0055528_1016979 | 3300003790 | Bacteria | 2544 |
| 34 | Ga0055528_1030302 | 3300003790 | Bacteria | 1439 |
| 35 | Ga0055530_10000237 | 3300003791 | Bacteria | 49495 |
| 36 | Ga0055540_1007368 | 3300003792 | Bacteria | 4169 |
| 37 | Ga0055540_1008403 | 3300003792 | Bacteria | 3724 |
| 38 | Ga0055531_10011793 | 3300003794 | Bacteria | 4173 |
| 39 | Ga0055531_10011817 | 3300003794 | Bacteria | 4168 |
| 40 | Ga0055543_1003354 | 3300004625 | Bacteria | 4771 |
| 41 | Ga0055543_1009200 | 3300004625 | Bacteria | 2138 |
| 42 | Ga0065165_1008049 | 3300005262 | Bacteria | 5034 |
| 43 | Ga0065165_1114842 | 3300005262 | Bacteria | 658 |
| 44 | Ga0065714_10075296 | 3300005288 | Bacteria | 2923 |
| 45 | Ga0070658_10019982 | 3300005327 | Bacteria | 5364 |
| 46 | Ga0070658_10032376 | 3300005327 | Bacteria | 4203 |
| 47 | Ga0070658_10261262 | 3300005327 | Bacteria | 1470 |
| 48 | Ga0070658_10271873 | 3300005327 | Bacteria | 1441 |
| 49 | Ga0070658_11378341 | 3300005327 | Bacteria | 612 |
| 50 | Ga0070683_100006332 | 3300005329 | Bacteria | 9926 |
| 51 | Ga0070683_100067646 | 3300005329 | Bacteria | 3327 |
| 52 | Ga0070683_100135431 | 3300005329 | Bacteria | 2332 |
| 53 | Ga0070680_100015348 | 3300005336 | Bacteria | 6003 |
| 54 | Ga0070680_100114202 | 3300005336 | Bacteria | 2250 |
| 55 | Ga0070680_100233794 | 3300005336 | Bacteria | 1553 |
| 56 | Ga0070680_100714838 | 3300005336 | Bacteria | 862 |
| 57 | Ga0070682_100239938 | 3300005337 | Bacteria | 1301 |
| 58 | Ga0070682_101040592 | 3300005337 | Bacteria | 682 |
| 59 | Ga0068868_100225216 | 3300005338 | Bacteria | 1571 |
| 60 | Ga0068868_101085255 | 3300005338 | Bacteria | 736 |
| 61 | Ga0070660_100001578 | 3300005339 | Bacteria | 15674 |
| 62 | Ga0070660_100015849 | 3300005339 | Bacteria | 5455 |
| 63 | Ga0070660_100120289 | 3300005339 | Bacteria | 2095 |
| 64 | Ga0070691_10008185 | 3300005341 | Bacteria | 4791 |
| 65 | Ga0070691_10123137 | 3300005341 | Bacteria | 1307 |
| 66 | Ga0070661_100279978 | 3300005344 | Bacteria | 1293 |
| 67 | Ga0070661_100697843 | 3300005344 | Bacteria | 827 |
| 68 | Ga0070668_100040395 | 3300005347 | Bacteria | 3569 |
| 69 | Ga0070668_100421488 | 3300005347 | Bacteria | 1143 |
| 70 | Ga0070668_101382104 | 3300005347 | Bacteria | 642 |
| 71 | Ga0070669_100149021 | 3300005353 | Bacteria | 1810 |
| 72 | Ga0070669_100250414 | 3300005353 | Unclassified | 1410 |
| 73 | Ga0070671_100013007 | 3300005355 | Bacteria | 6707 |
| 74 | Ga0070659_100017552 | 3300005366 | Bacteria | 5391 |
| 75 | Ga0070659_100038550 | 3300005366 | Bacteria | 3727 |
| 76 | Ga0070659_100154348 | 3300005366 | Bacteria | 1874 |
| 77 | Ga0070659_101044432 | 3300005366 | Bacteria | 718 |
| 78 | Ga0070667_100156905 | 3300005367 | Bacteria | 2002 |
| 79 | Ga0070667_100396854 | 3300005367 | Bacteria | 1255 |
| 80 | Ga0070709_10010591 | 3300005434 | Bacteria | 5111 |
| 81 | Ga0070709_10199064 | 3300005434 | Bacteria | 1418 |
| 82 | Ga0070714_100099670 | 3300005435 | Bacteria | 2557 |
| 83 | Ga0070714_100148001 | 3300005435 | Bacteria | 2114 |
| 84 | Ga0070714_100308818 | 3300005435 | Bacteria | 1476 |
| 85 | Ga0070713_100004448 | 3300005436 | Bacteria | 9418 |
| 86 | Ga0070713_100030867 | 3300005436 | Bacteria | 4262 |
| 87 | Ga0070713_100615382 | 3300005436 | Bacteria | 1033 |
| 88 | Ga0070713_100997171 | 3300005436 | Bacteria | 808 |
| 89 | Ga0070710_10001577 | 3300005437 | Bacteria | 10759 |
| 90 | Ga0070710_10075838 | 3300005437 | Bacteria | 1950 |
| 91 | Ga0070710_10508384 | 3300005437 | Bacteria | 826 |
| 92 | Ga0070711_100014177 | 3300005439 | Bacteria | 5018 |
| 93 | Ga0070711_100019753 | 3300005439 | Bacteria | 4328 |
| 94 | Ga0070663_100040167 | 3300005455 | Bacteria | 3274 |
| 95 | Ga0070663_100084680 | 3300005455 | Bacteria | 2338 |
| 96 | Ga0070663_100119562 | 3300005455 | Bacteria | 1988 |
| 97 | Ga0070663_100153459 | 3300005455 | Bacteria | 1768 |
| 98 | Ga0070678_100531447 | 3300005456 | Bacteria | 1042 |
| 99 | Ga0070662_100091653 | 3300005457 | Bacteria | 2283 |
| 100 | Ga0070662_101011728 | 3300005457 | Bacteria | 712 |
| 101 | Ga0070681_10091120 | 3300005458 | Bacteria | 2999 |
| 102 | Ga0068867_100273395 | 3300005459 | Bacteria | 1382 |
| 103 | Ga0070685_10830052 | 3300005466 | Bacteria | 683 |
| 104 | Ga0070706_100069093 | 3300005467 | Bacteria | 3267 |
| 105 | Ga0070706_100966941 | 3300005467 | Bacteria | 786 |
| 106 | Ga0070707_100054741 | 3300005468 | Bacteria | 3826 |
| 107 | Ga0070707_100564913 | 3300005468 | Bacteria | 1100 |
| 108 | Ga0070698_100072440 | 3300005471 | Bacteria | 3453 |
| 109 | Ga0070698_100200459 | 3300005471 | Bacteria | 1932 |
| 110 | Ga0070699_100157516 | 3300005518 | Bacteria | 2010 |
| 111 | Ga0070699_100567984 | 3300005518 | Bacteria | 1033 |
| 112 | Ga0070679_100045942 | 3300005530 | Bacteria | 4351 |
| 113 | Ga0070679_100107906 | 3300005530 | Bacteria | 2770 |
| 114 | Ga0070684_100127371 | 3300005535 | Bacteria | 2295 |
| 115 | Ga0068853_100002181 | 3300005539 | Bacteria | 14587 |
| 116 | Ga0068853_100005480 | 3300005539 | Bacteria | 9944 |
| 117 | Ga0068853_100088454 | 3300005539 | Bacteria | 2719 |
| 118 | Ga0070686_101449655 | 3300005544 | Bacteria | 577 |
| 119 | Ga0070665_100098102 | 3300005548 | Bacteria | 2935 |
| 120 | Ga0070704_100334497 | 3300005549 | Bacteria | 1273 |
| 121 | Ga0068855_100000423 | 3300005563 | Bacteria | 52174 |
| 122 | Ga0068855_100016471 | 3300005563 | Bacteria | 8889 |
| 123 | Ga0068855_100037105 | 3300005563 | Bacteria | 5798 |
| 124 | Ga0068855_100074913 | 3300005563 | Bacteria | 3930 |
| 125 | Ga0068855_100083890 | 3300005563 | Bacteria | 3691 |
| 126 | Ga0068855_100165212 | 3300005563 | Bacteria | 2510 |
| 127 | Ga0068855_100189756 | 3300005563 | Bacteria | 2319 |
| 128 | Ga0068855_100296346 | 3300005563 | Bacteria | 1792 |
| 129 | Ga0068855_100465620 | 3300005563 | Bacteria | 1378 |
| 130 | Ga0070664_100101995 | 3300005564 | Bacteria | 2496 |
| 131 | Ga0070664_100206154 | 3300005564 | Bacteria | 1756 |
| 132 | Ga0070664_100241353 | 3300005564 | Bacteria | 1622 |
| 133 | Ga0068857_100017952 | 3300005577 | Bacteria | 6206 |
| 134 | Ga0068857_100133082 | 3300005577 | Bacteria | 2244 |
| 135 | Ga0068857_100216154 | 3300005577 | Bacteria | 1750 |
| 136 | Ga0068854_100013039 | 3300005578 | Bacteria | 5448 |
| 137 | Ga0068854_100094075 | 3300005578 | Bacteria | 2235 |
| 138 | Ga0068854_100346883 | 3300005578 | Bacteria | 1214 |
| 139 | Ga0068856_100181698 | 3300005614 | Bacteria | 2116 |
| 140 | Ga0068856_100255084 | 3300005614 | Bacteria | 1769 |
| 141 | Ga0068856_100417466 | 3300005614 | Bacteria | 1362 |
| 142 | Ga0068856_101030719 | 3300005614 | Bacteria | 841 |
| 143 | Ga0068852_100014980 | 3300005616 | Bacteria | 5992 |
| 144 | Ga0068852_100015610 | 3300005616 | Bacteria | 5899 |
| 145 | Ga0068852_100465596 | 3300005616 | Bacteria | 1254 |
| 146 | Ga0068859_100919482 | 3300005617 | Bacteria | 959 |
| 147 | Ga0068864_100306401 | 3300005618 | Bacteria | 1488 |
| 148 | Ga0068866_10710168 | 3300005718 | Bacteria | 690 |
| 149 | Ga0068861_100681114 | 3300005719 | Bacteria | 953 |
| 150 | Ga0068851_10024638 | 3300005834 | Bacteria | 2946 |
| 151 | Ga0068851_10096248 | 3300005834 | Bacteria | 1565 |
| 152 | Ga0068851_10155634 | 3300005834 | Bacteria | 1252 |
| 153 | Ga0068863_100020128 | 3300005841 | Bacteria | 6383 |
| 154 | Ga0068860_101157934 | 3300005843 | Bacteria | 793 |
| 155 | Ga0068862_100004007 | 3300005844 | Bacteria | 12490 |
| 156 | Ga0068862_100036231 | 3300005844 | Bacteria | 4181 |
| 157 | Ga0068862_100491887 | 3300005844 | Bacteria | 1163 |
| 158 | Ga0081540_1006124 | 3300005983 | Bacteria | 8835 |
| 159 | Ga0081540_1011066 | 3300005983 | Bacteria | 6057 |
| 160 | Ga0081539_10171338 | 3300005985 | Bacteria | 1026 |
| 161 | Ga0070717_10002120 | 3300006028 | Bacteria | 13913 |
| 162 | Ga0070717_10006962 | 3300006028 | Bacteria | 8359 |
| 163 | Ga0070717_10115331 | 3300006028 | Bacteria | 2296 |
| 164 | Ga0070717_10241165 | 3300006028 | Bacteria | 1594 |
| 165 | Ga0070717_10288364 | 3300006028 | Bacteria | 1457 |
| 166 | Ga0070717_10688300 | 3300006028 | Bacteria | 929 |
| 167 | Ga0075368_10035169 | 3300006042 | Bacteria | 1954 |
| 168 | Ga0075363_100023308 | 3300006048 | Bacteria | 3135 |
| 169 | Ga0075364_10180263 | 3300006051 | Bacteria | 1429 |
| 170 | Ga0070715_10307728 | 3300006163 | Bacteria | 850 |
| 171 | Ga0070716_100019421 | 3300006173 | Bacteria | 3552 |
| 172 | Ga0070716_100281913 | 3300006173 | Unclassified | 1147 |
| 173 | Ga0070716_100324534 | 3300006173 | Bacteria | 1080 |
| 174 | Ga0070716_100396830 | 3300006173 | Bacteria | 991 |
| 175 | Ga0070716_100958618 | 3300006173 | Bacteria | 674 |
| 176 | Ga0070712_100007666 | 3300006175 | Bacteria | 6752 |
| 177 | Ga0070712_100226681 | 3300006175 | Bacteria | 1482 |
| 178 | Ga0075362_10020220 | 3300006177 | Bacteria | 2779 |
| 179 | Ga0075362_10157620 | 3300006177 | Bacteria | 1092 |
| 180 | Ga0075367_10006033 | 3300006178 | Bacteria | 6086 |
| 181 | Ga0075367_10048006 | 3300006178 | Bacteria | 2513 |
| 182 | Ga0075367_10069338 | 3300006178 | Bacteria | 2117 |
| 183 | Ga0075367_10176884 | 3300006178 | Bacteria | 1330 |
| 184 | Ga0075369_10521636 | 3300006186 | Bacteria | 566 |
| 185 | Ga0075366_10013951 | 3300006195 | Bacteria | 4582 |
| 186 | Ga0075366_10018767 | 3300006195 | Bacteria | 3996 |
| 187 | Ga0075366_10039267 | 3300006195 | Bacteria | 2798 |
| 188 | Ga0075366_10075959 | 3300006195 | Bacteria | 2005 |
| 189 | Ga0075366_10108242 | 3300006195 | Bacteria | 1671 |
| 190 | Ga0097621_100176247 | 3300006237 | Bacteria | 1845 |
| 191 | Ga0075370_10002986 | 3300006353 | Bacteria | 7958 |
| 192 | Ga0075370_10006253 | 3300006353 | Bacteria | 5978 |
| 193 | Ga0075370_10092007 | 3300006353 | Bacteria | 1750 |
| 194 | Ga0075370_10143668 | 3300006353 | Bacteria | 1396 |
| 195 | Ga0075429_101151232 | 3300006880 | Bacteria | 677 |
| 196 | Ga0068865_100677894 | 3300006881 | Bacteria | 879 |
| 197 | Ga0097620_100919699 | 3300006931 | Bacteria | 959 |
| 198 | Ga0099824_1025033 | 3300006942 | Bacteria | 3356 |
| 199 | Ga0079104_1054443 | 3300006946 | Bacteria | 880 |
| 200 | Ga0075435_100499031 | 3300007076 | Bacteria | 1052 |
| 201 | Ga0099794_10016877 | 3300007265 | Bacteria | 3244 |
| 202 | Ga0099794_10727777 | 3300007265 | Bacteria | 529 |
| 203 | Ga0099795_10076871 | 3300007788 | Bacteria | 1270 |
| 204 | Ga0105244_10048587 | 3300009036 | Bacteria | 2171 |
| 205 | Ga0105240_10009195 | 3300009093 | Bacteria | 14013 |
| 206 | Ga0105240_10027146 | 3300009093 | Bacteria | 7501 |
| 207 | Ga0105240_10044578 | 3300009093 | Bacteria | 5635 |
| 208 | Ga0105240_10510383 | 3300009093 | Bacteria | 1336 |
| 209 | Ga0105240_10667183 | 3300009093 | Bacteria | 1138 |
| 210 | Ga0105240_11191874 | 3300009093 | Bacteria | 807 |
| 211 | Ga0105245_10136471 | 3300009098 | Bacteria | 2306 |
| 212 | Ga0105247_10244317 | 3300009101 | Bacteria | 1224 |
| 213 | Ga0105247_10254721 | 3300009101 | Bacteria | 1201 |
| 214 | Ga0105243_10121266 | 3300009148 | Bacteria | 2204 |
| 215 | Ga0105243_10178363 | 3300009148 | Bacteria | 1845 |
| 216 | Ga0105243_10460035 | 3300009148 | Bacteria | 1196 |
| 217 | Ga0105243_10524314 | 3300009148 | Bacteria | 1127 |
| 218 | Ga0105241_10025534 | 3300009174 | Bacteria | 4391 |
| 219 | Ga0105241_10068019 | 3300009174 | Bacteria | 2758 |
| 220 | Ga0105242_10373470 | 3300009176 | Bacteria | 1323 |
| 221 | Ga0105242_10654445 | 3300009176 | Bacteria | 1022 |
| 222 | Ga0105242_10794996 | 3300009176 | Bacteria | 936 |
| 223 | Ga0105242_12412674 | 3300009176 | Bacteria | 573 |
| 224 | Ga0105237_10003331 | 3300009545 | Bacteria | 19133 |
| 225 | Ga0105237_10019368 | 3300009545 | Bacteria | 7029 |
| 226 | Ga0105237_10127158 | 3300009545 | Bacteria | 2543 |
| 227 | Ga0105237_10481321 | 3300009545 | Bacteria | 1247 |
| 228 | Ga0105237_10968939 | 3300009545 | Bacteria | 857 |
| 229 | Ga0105238_10000062 | 3300009551 | Bacteria | 126356 |
| 230 | Ga0105238_10016145 | 3300009551 | Bacteria | 7554 |
| 231 | Ga0105238_10093716 | 3300009551 | Bacteria | 2991 |
| 232 | Ga0105238_10302661 | 3300009551 | Bacteria | 1583 |
| 233 | Ga0105238_10406754 | 3300009551 | Bacteria | 1355 |
| 234 | Ga0105238_10654740 | 3300009551 | Bacteria | 1061 |
| 235 | Ga0105249_10493335 | 3300009553 | Bacteria | 1269 |
| 236 | Ga0099796_10448650 | 3300010159 | Bacteria | 573 |
| 237 | Ga0105239_10001306 | 3300010375 | Bacteria | 33607 |
| 238 | Ga0105239_10001659 | 3300010375 | Bacteria | 29335 |
| 239 | Ga0105239_10044705 | 3300010375 | Bacteria | 4854 |
| 240 | Ga0105239_10127565 | 3300010375 | Bacteria | 2828 |
| 241 | Ga0105239_11349824 | 3300010375 | Bacteria | 823 |
| 242 | Ga0105239_11392139 | 3300010375 | Bacteria | 810 |
| 243 | Ga0105246_10025297 | 3300011119 | Bacteria | 3869 |
| 244 | Ga0105246_10166409 | 3300011119 | Bacteria | 1684 |
| 245 | Ga0105246_10294857 | 3300011119 | Bacteria | 1306 |
| 246 | Ga0105246_11023442 | 3300011119 | Bacteria | 749 |
| 247 | Ga0157347_1000658 | 3300012502 | Bacteria | 2360 |
| 248 | Ga0157339_1019418 | 3300012505 | Bacteria | 709 |
| 249 | Ga0157373_10090246 | 3300013100 | Bacteria | 2158 |
| 250 | Ga0157371_10068435 | 3300013102 | Bacteria | 2513 |
| 251 | Ga0157370_10017529 | 3300013104 | Bacteria | 7225 |
| 252 | Ga0157370_10036407 | 3300013104 | Bacteria | 4775 |
| 253 | Ga0157370_10203342 | 3300013104 | Bacteria | 1837 |
| 254 | Ga0157370_10243453 | 3300013104 | Bacteria | 1664 |
| 255 | Ga0157370_10273729 | 3300013104 | Bacteria | 1560 |
| 256 | Ga0157369_10000280 | 3300013105 | Bacteria | 68583 |
| 257 | Ga0157369_10016139 | 3300013105 | Bacteria | 8406 |
| 258 | Ga0157369_10017304 | 3300013105 | Bacteria | 8103 |
| 259 | Ga0157369_10035212 | 3300013105 | Bacteria | 5490 |
| 260 | Ga0157369_10235749 | 3300013105 | Bacteria | 1912 |
| 261 | Ga0157369_11434428 | 3300013105 | Bacteria | 703 |
| 262 | Ga0171462_1008 | 3300013250 | Bacteria | 384318 |
| 263 | Ga0157374_10016468 | 3300013296 | Bacteria | 6499 |
| 264 | Ga0157374_10173708 | 3300013296 | Bacteria | 2103 |
| 265 | Ga0157374_10888654 | 3300013296 | Bacteria | 908 |
| 266 | Ga0157378_10169141 | 3300013297 | Bacteria | 2049 |
| 267 | Ga0157378_10374389 | 3300013297 | Bacteria | 1397 |
| 268 | Ga0157378_11482469 | 3300013297 | Bacteria | 723 |
| 269 | Ga0163162_10709290 | 3300013306 | Bacteria | 1127 |
| 270 | Ga0157372_10128397 | 3300013307 | Bacteria | 2915 |
| 271 | Ga0157372_10341267 | 3300013307 | Bacteria | 1745 |
| 272 | Ga0157372_10494282 | 3300013307 | Bacteria | 1426 |
| 273 | Ga0157372_10796512 | 3300013307 | Bacteria | 1098 |
| 274 | Ga0157375_10704688 | 3300013308 | Bacteria | 1163 |
| 275 | Ga0157375_11797543 | 3300013308 | Bacteria | 727 |
| 276 | Ga0163163_10013499 | 3300014325 | Bacteria | 7483 |
| 277 | Ga0182008_10027012 | 3300014497 | Bacteria | 2909 |
| 278 | Ga0182008_10037106 | 3300014497 | Bacteria | 2438 |
| 279 | Ga0182008_10127263 | 3300014497 | Bacteria | 1269 |
| 280 | Ga0157377_10618808 | 3300014745 | Bacteria | 775 |
| 281 | Ga0182006_1001443 | 3300015261 | Bacteria | 14339 |
| 282 | Ga0182006_1001447 | 3300015261 | Bacteria | 14319 |
| 283 | Ga0182006_1241454 | 3300015261 | Bacteria | 594 |
| 284 | Ga0182005_1024095 | 3300015265 | Bacteria | 1663 |
| 285 | Ga0163161_10000072 | 3300017792 | Bacteria | 102352 |
| 286 | Ga0206354_10978505 | 3300020081 | Bacteria | 1571 |
| 287 | Ga0206354_11625524 | 3300020081 | Bacteria | 669 |
| 288 | Ga0213873_10018658 | 3300021358 | Bacteria | 1598 |
| 289 | Ga0213874_10151608 | 3300021377 | Bacteria | 809 |
| 290 | Ga0213874_10158291 | 3300021377 | Bacteria | 794 |
| 291 | Ga0213876_10003157 | 3300021384 | Bacteria | 9485 |
| 292 | Ga0213876_10007769 | 3300021384 | Bacteria | 5821 |
| 293 | Ga0213876_10024863 | 3300021384 | Bacteria | 3163 |
| 294 | Ga0209436_104233 | 3300025208 | Bacteria | 3588 |
| 295 | Ga0209436_104647 | 3300025208 | Bacteria | 3343 |
| 296 | Ga0209672_101222 | 3300025228 | Bacteria | 10370 |
| 297 | Ga0209147_100352 | 3300025229 | Bacteria | 33384 |
| 298 | Ga0209258_100133 | 3300025242 | Bacteria | 174846 |
| 299 | Ga0207425_1000352 | 3300025245 | Bacteria | 31908 |
| 300 | Ga0207425_1012932 | 3300025245 | Bacteria | 1942 |
| 301 | Ga0209148_1000188 | 3300025254 | Bacteria | 117310 |
| 302 | Ga0209129_1000245 | 3300025258 | Bacteria | 56975 |
| 303 | Ga0209129_1003468 | 3300025258 | Bacteria | 6835 |
| 304 | Ga0209129_1004337 | 3300025258 | Bacteria | 5595 |
| 305 | Ga0209129_1005779 | 3300025258 | Bacteria | 4236 |
| 306 | Ga0209129_1034824 | 3300025258 | Bacteria | 822 |
| 307 | Ga0209565_1000165 | 3300025263 | Bacteria | 86871 |
| 308 | Ga0209565_1006089 | 3300025263 | Bacteria | 3425 |
| 309 | Ga0209455_1000991 | 3300025272 | Bacteria | 14310 |
| 310 | Ga0209673_1000454 | 3300025273 | Bacteria | 69331 |
| 311 | Ga0209673_1001222 | 3300025273 | Bacteria | 27158 |
| 312 | Ga0209673_1002781 | 3300025273 | Bacteria | 11385 |
| 313 | Ga0209130_1000658 | 3300025284 | Bacteria | 31621 |
| 314 | Ga0209130_1001097 | 3300025284 | Bacteria | 20097 |
| 315 | Ga0209130_1012675 | 3300025284 | Bacteria | 2192 |
| 316 | Ga0209675_1000823 | 3300025291 | Bacteria | 20435 |
| 317 | Ga0209675_1011933 | 3300025291 | Bacteria | 2838 |
| 318 | Ga0209676_1000111 | 3300025292 | Bacteria | 213411 |
| 319 | Ga0209676_1010951 | 3300025292 | Bacteria | 3713 |
| 320 | Ga0209025_1000157 | 3300025294 | Bacteria | 168790 |
| 321 | Ga0209025_1000615 | 3300025294 | Bacteria | 64022 |
| 322 | Ga0209025_1013697 | 3300025294 | Bacteria | 5068 |
| 323 | Ga0209564_1000070 | 3300025295 | Bacteria | 303126 |
| 324 | Ga0209564_1000352 | 3300025295 | Bacteria | 85941 |
| 325 | Ga0209758_1000297 | 3300025297 | Bacteria | 97664 |
| 326 | Ga0209758_1017089 | 3300025297 | Bacteria | 3639 |
| 327 | Ga0209050_1000111 | 3300025298 | Bacteria | 213411 |
| 328 | Ga0209256_1000047 | 3300025299 | Bacteria | 314709 |
| 329 | Ga0209256_1000238 | 3300025299 | Bacteria | 97664 |
| 330 | Ga0207426_1000194 | 3300025302 | Bacteria | 150009 |
| 331 | Ga0207426_1000294 | 3300025302 | Bacteria | 98700 |
| 332 | Ga0209051_1000046 | 3300025303 | Bacteria | 296424 |
| 333 | Ga0209051_1036611 | 3300025303 | Bacteria | 1810 |
| 334 | Ga0209257_1000344 | 3300025304 | Bacteria | 96578 |
| 335 | Ga0209257_1004797 | 3300025304 | Bacteria | 10075 |
| 336 | Ga0209257_1012644 | 3300025304 | Bacteria | 3869 |
| 337 | Ga0207656_10006816 | 3300025321 | Bacteria | 4130 |
| 338 | Ga0207656_10009713 | 3300025321 | Bacteria | 3577 |
| 339 | Ga0207656_10071923 | 3300025321 | Bacteria | 1538 |
| 340 | Ga0207692_10016579 | 3300025898 | Bacteria | 3267 |
| 341 | Ga0207710_10377598 | 3300025900 | Bacteria | 725 |
| 342 | Ga0207710_10468898 | 3300025900 | Bacteria | 651 |
| 343 | Ga0207688_10034380 | 3300025901 | Bacteria | 2807 |
| 344 | Ga0207680_10237913 | 3300025903 | Bacteria | 1254 |
| 345 | Ga0207685_10254593 | 3300025905 | Bacteria | 850 |
| 346 | Ga0207699_10217536 | 3300025906 | Bacteria | 1302 |
| 347 | Ga0207705_10009898 | 3300025909 | Bacteria | 6941 |
| 348 | Ga0207705_10017143 | 3300025909 | Bacteria | 5189 |
| 349 | Ga0207684_10018442 | 3300025910 | Bacteria | 5975 |
| 350 | Ga0207654_10292123 | 3300025911 | Bacteria | 1106 |
| 351 | Ga0207707_10000363 | 3300025912 | Bacteria | 47616 |
| 352 | Ga0207707_10000381 | 3300025912 | Bacteria | 46274 |
| 353 | Ga0207707_10038137 | 3300025912 | Bacteria | 4199 |
| 354 | Ga0207695_10000429 | 3300025913 | Bacteria | 92640 |
| 355 | Ga0207695_10036629 | 3300025913 | Bacteria | 5301 |
| 356 | Ga0207695_10076011 | 3300025913 | Bacteria | 3415 |
| 357 | Ga0207695_10227547 | 3300025913 | Bacteria | 1770 |
| 358 | Ga0207695_10344111 | 3300025913 | Bacteria | 1379 |
| 359 | Ga0207695_10884654 | 3300025913 | Bacteria | 773 |
| 360 | Ga0207671_10006678 | 3300025914 | Bacteria | 10222 |
| 361 | Ga0207671_10030086 | 3300025914 | Bacteria | 4050 |
| 362 | Ga0207671_10656899 | 3300025914 | Bacteria | 835 |
| 363 | Ga0207693_10012494 | 3300025915 | Bacteria | 6858 |
| 364 | Ga0207693_10179760 | 3300025915 | Bacteria | 1664 |
| 365 | Ga0207660_10001000 | 3300025917 | Bacteria | 18768 |
| 366 | Ga0207660_10230057 | 3300025917 | Bacteria | 1457 |
| 367 | Ga0207660_10419730 | 3300025917 | Bacteria | 1079 |
| 368 | Ga0207657_10000999 | 3300025919 | Bacteria | 30070 |
| 369 | Ga0207657_10003720 | 3300025919 | Bacteria | 16206 |
| 370 | Ga0207657_10012289 | 3300025919 | Bacteria | 8459 |
| 371 | Ga0207649_10028628 | 3300025920 | Bacteria | 3281 |
| 372 | Ga0207652_10001277 | 3300025921 | Bacteria | 22426 |
| 373 | Ga0207652_10055493 | 3300025921 | Bacteria | 3408 |
| 374 | Ga0207652_11083475 | 3300025921 | Bacteria | 701 |
| 375 | Ga0207646_10110086 | 3300025922 | Bacteria | 2472 |
| 376 | Ga0207646_10160356 | 3300025922 | Bacteria | 2029 |
| 377 | Ga0207681_10594427 | 3300025923 | Unclassified | 914 |
| 378 | Ga0207681_10691055 | 3300025923 | Bacteria | 848 |
| 379 | Ga0207694_10000359 | 3300025924 | Bacteria | 42962 |
| 380 | Ga0207694_10024718 | 3300025924 | Bacteria | 4563 |
| 381 | Ga0207694_10536881 | 3300025924 | Bacteria | 981 |
| 382 | Ga0207694_10989758 | 3300025924 | Bacteria | 711 |
| 383 | Ga0207694_11054105 | 3300025924 | Bacteria | 688 |
| 384 | Ga0207650_10061875 | 3300025925 | Bacteria | 2795 |
| 385 | Ga0207700_10258875 | 3300025928 | Unclassified | 1489 |
| 386 | Ga0207700_10338994 | 3300025928 | Bacteria | 1307 |
| 387 | Ga0207700_10354379 | 3300025928 | Bacteria | 1278 |
| 388 | Ga0207700_10515401 | 3300025928 | Bacteria | 1059 |
| 389 | Ga0207700_11610333 | 3300025928 | Bacteria | 574 |
| 390 | Ga0207664_10095101 | 3300025929 | Bacteria | 2451 |
| 391 | Ga0207664_10194238 | 3300025929 | Bacteria | 1749 |
| 392 | Ga0207644_10226051 | 3300025931 | Bacteria | 1485 |
| 393 | Ga0207690_10024960 | 3300025932 | Bacteria | 3748 |
| 394 | Ga0207690_10058242 | 3300025932 | Bacteria | 2612 |
| 395 | Ga0207690_10315162 | 3300025932 | Bacteria | 1228 |
| 396 | Ga0207690_10737849 | 3300025932 | Bacteria | 811 |
| 397 | Ga0207706_10062308 | 3300025933 | Bacteria | 3284 |
| 398 | Ga0207706_10085280 | 3300025933 | Bacteria | 2777 |
| 399 | Ga0207709_10041320 | 3300025935 | Bacteria | 2766 |
| 400 | Ga0207709_10298479 | 3300025935 | Bacteria | 1197 |
| 401 | Ga0207704_10891445 | 3300025938 | Bacteria | 748 |
| 402 | Ga0207704_11686589 | 3300025938 | Bacteria | 545 |
| 403 | Ga0207665_10002228 | 3300025939 | Bacteria | 13082 |
| 404 | Ga0207665_10496271 | 3300025939 | Bacteria | 942 |
| 405 | Ga0207665_10633838 | 3300025939 | Bacteria | 837 |
| 406 | Ga0207665_11317597 | 3300025939 | Bacteria | 576 |
| 407 | Ga0207711_10322251 | 3300025941 | Bacteria | 1428 |
| 408 | Ga0207661_10008299 | 3300025944 | Bacteria | 7420 |
| 409 | Ga0207661_10464889 | 3300025944 | Bacteria | 1153 |
| 410 | Ga0207661_10767168 | 3300025944 | Bacteria | 888 |
| 411 | Ga0207679_10480848 | 3300025945 | Bacteria | 1106 |
| 412 | Ga0207679_10866487 | 3300025945 | Bacteria | 825 |
| 413 | Ga0207667_10000028 | 3300025949 | Bacteria | 334510 |
| 414 | Ga0207667_10007770 | 3300025949 | Bacteria | 12820 |
| 415 | Ga0207667_10013965 | 3300025949 | Bacteria | 9173 |
| 416 | Ga0207667_10019832 | 3300025949 | Bacteria | 7494 |
| 417 | Ga0207667_10049335 | 3300025949 | Bacteria | 4446 |
| 418 | Ga0207667_10548572 | 3300025949 | Bacteria | 1169 |
| 419 | Ga0207651_10461386 | 3300025960 | Bacteria | 1092 |
| 420 | Ga0207668_10187751 | 3300025972 | Bacteria | 1635 |
| 421 | Ga0207668_10258212 | 3300025972 | Bacteria | 1418 |
| 422 | Ga0207640_10016150 | 3300025981 | Bacteria | 4336 |
| 423 | Ga0207640_10091962 | 3300025981 | Bacteria | 2103 |
| 424 | Ga0207640_10117685 | 3300025981 | Bacteria | 1897 |
| 425 | Ga0207640_10246813 | 3300025981 | Bacteria | 1383 |
| 426 | Ga0207640_10330806 | 3300025981 | Bacteria | 1217 |
| 427 | Ga0207658_10119292 | 3300025986 | Bacteria | 2100 |
| 428 | Ga0207658_10263531 | 3300025986 | Bacteria | 1470 |
| 429 | Ga0207658_10664774 | 3300025986 | Bacteria | 940 |
| 430 | Ga0207677_10319476 | 3300026023 | Bacteria | 1290 |
| 431 | Ga0207677_10834059 | 3300026023 | Bacteria | 827 |
| 432 | Ga0207677_10849350 | 3300026023 | Bacteria | 820 |
| 433 | Ga0207677_11112435 | 3300026023 | Bacteria | 720 |
| 434 | Ga0207703_10376367 | 3300026035 | Bacteria | 1312 |
| 435 | Ga0207639_10020183 | 3300026041 | Bacteria | 4767 |
| 436 | Ga0207639_10027605 | 3300026041 | Bacteria | 4137 |
| 437 | Ga0207639_10079803 | 3300026041 | Bacteria | 2587 |
| 438 | Ga0207639_10182245 | 3300026041 | Bacteria | 1787 |
| 439 | Ga0207678_10010157 | 3300026067 | Bacteria | 8262 |
| 440 | Ga0207678_10039882 | 3300026067 | Bacteria | 4074 |
| 441 | Ga0207678_10247950 | 3300026067 | Bacteria | 1525 |
| 442 | Ga0207678_10375537 | 3300026067 | Bacteria | 1228 |
| 443 | Ga0207702_10176335 | 3300026078 | Bacteria | 1965 |
| 444 | Ga0207702_10227369 | 3300026078 | Bacteria | 1742 |
| 445 | Ga0207702_10438161 | 3300026078 | Bacteria | 1266 |
| 446 | Ga0207702_10641435 | 3300026078 | Bacteria | 1044 |
| 447 | Ga0207648_10049091 | 3300026089 | Bacteria | 3695 |
| 448 | Ga0207648_10727135 | 3300026089 | Unclassified | 921 |
| 449 | Ga0207676_10233716 | 3300026095 | Bacteria | 1645 |
| 450 | Ga0207674_10007352 | 3300026116 | Bacteria | 12829 |
| 451 | Ga0207674_10142181 | 3300026116 | Bacteria | 2359 |
| 452 | Ga0207674_10177022 | 3300026116 | Bacteria | 2085 |
| 453 | Ga0207674_10181324 | 3300026116 | Bacteria | 2057 |
| 454 | Ga0207674_10443322 | 3300026116 | Bacteria | 1255 |
| 455 | Ga0207675_100762838 | 3300026118 | Bacteria | 979 |
| 456 | Ga0207675_101021671 | 3300026118 | Bacteria | 845 |
| 457 | Ga0207683_11197858 | 3300026121 | Bacteria | 704 |
| 458 | Ga0207698_10142144 | 3300026142 | Bacteria | 2070 |
| 459 | Ga0207698_10330629 | 3300026142 | Bacteria | 1431 |
| 460 | Ga0207698_10349852 | 3300026142 | Bacteria | 1395 |
| 461 | Ga0207698_11108819 | 3300026142 | Bacteria | 804 |
| 462 | Ga0207698_11151460 | 3300026142 | Bacteria | 789 |
| 463 | Ga0207698_11421351 | 3300026142 | Bacteria | 709 |
| 464 | Ga0209281_1039075 | 3300027111 | Bacteria | 807 |
| 465 | Ga0209389_1000133 | 3300027296 | Bacteria | 65939 |
| 466 | Ga0209389_1000413 | 3300027296 | Bacteria | 25381 |
| 467 | Ga0209589_1010310 | 3300027357 | Bacteria | 13668 |
| 468 | Ga0209489_100597 | 3300027361 | Bacteria | 69726 |
| 469 | Ga0209489_115313 | 3300027361 | Bacteria | 4775 |
| 470 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 471 | Ga0209179_1001501 | 3300027512 | Bacteria | 2880 |
| 472 | Ga0209179_1041374 | 3300027512 | Bacteria | 971 |
| 473 | Ga0209588_1142764 | 3300027671 | Bacteria | 761 |
| 474 | Ga0209813_10004408 | 3300027866 | Bacteria | 3362 |
| 475 | Ga0268266_10087499 | 3300028379 | Bacteria | 2726 |
| 476 | Ga0268265_10024179 | 3300028380 | Bacteria | 4294 |
| 477 | Ga0307515_10348776 | 3300028794 | Bacteria | 1128 |
| 478 | Ga0265763_1005534 | 3300030763 | Bacteria | 1063 |
| 479 | Ga0265340_10222850 | 3300031247 | Bacteria | 845 |
| 480 | Ga0265339_10013672 | 3300031249 | Bacteria | 4916 |
| 481 | Ga0265331_10027370 | 3300031250 | Bacteria | 2858 |
| 482 | Ga0307513_10834302 | 3300031456 | Bacteria | 628 |
| 483 | Ga0307508_10003734 | 3300031616 | Bacteria | 15233 |
| 484 | Ga0307508_10103129 | 3300031616 | Bacteria | 2449 |
| 485 | Ga0307508_10358559 | 3300031616 | Bacteria | 1049 |
| 486 | Ga0307508_10470208 | 3300031616 | Bacteria | 851 |
| 487 | Ga0307508_10690803 | 3300031616 | Bacteria | 629 |
| 488 | Ga0307514_10006880 | 3300031649 | Bacteria | 9846 |
| 489 | Ga0265314_10044600 | 3300031711 | Bacteria | 3143 |
| 490 | Ga0265314_10094825 | 3300031711 | Bacteria | 1933 |
| 491 | Ga0265342_10465326 | 3300031712 | Bacteria | 648 |
| 492 | Ga0316576_10685720 | 3300031727 | Bacteria | 743 |
| 493 | Ga0307516_10062391 | 3300031730 | Bacteria | 3612 |
| 494 | Ga0307406_10119306 | 3300031901 | Bacteria | 1831 |
| 495 | Ga0307412_10041808 | 3300031911 | Bacteria | 2973 |
| 496 | Ga0307412_10291613 | 3300031911 | Bacteria | 1285 |
| 497 | Ga0307416_100340513 | 3300032002 | Bacteria | 1512 |
| 498 | Ga0307416_100660374 | 3300032002 | Bacteria | 1131 |
| 499 | Ga0307416_100901528 | 3300032002 | Bacteria | 984 |
| 500 | Ga0307414_10259224 | 3300032004 | Bacteria | 1450 |
| 501 | Ga0307414_10484465 | 3300032004 | Bacteria | 1091 |
| 502 | Ga0307510_10339666 | 3300033180 | Bacteria | 954 |
| 503 | Ga0373959_0009197 | 3300034820 | Bacteria | 1698 |
| 504 | Ga0373949_0216107 | 3300035090 | Bacteria | 581 |
| 505 | Ga0373932_0147338 | 3300035112 | Bacteria | 805 |
| 506 | Ga0373941_0082754 | 3300035115 | Bacteria | 1087 |
| 507 | Ga0373946_0567826 | 3300035171 | Bacteria | 586 |
| 508 | Ga0373962_0295430 | 3300035242 | Bacteria | 573 |
| 509 | Ga0373931_0162798 | 3300035691 | Bacteria | 1309 |
| 510 | Ga0373927_0936865 | 3300035695 | Bacteria | 571 |
| 511 | Ga0373947_0166522 | 3300035725 | Bacteria | 1428 |
| 512 | Ga0373937_1016648 | 3300036401 | Bacteria | 778 |
| 513 | Ga0395899_0029309 | 3300037312 | Bacteria | 4140 |
| 514 | Ga0395899_0033659 | 3300037312 | Bacteria | 3848 |
| 515 | Ga0395899_0179017 | 3300037312 | Unclassified | 1489 |
| 516 | Ga0395900_0000980 | 3300037418 | Bacteria | 37119 |
| 517 | Ga0395900_0010175 | 3300037418 | Bacteria | 9621 |
| 518 | Ga0395900_0021195 | 3300037418 | Bacteria | 6643 |
| 519 | Ga0395900_0061122 | 3300037418 | Bacteria | 3874 |
| 520 | Ga0395900_0088046 | 3300037418 | Bacteria | 3192 |
| 521 | Ga0395900_0091955 | 3300037418 | Bacteria | 3117 |
| 522 | Ga0395900_0686687 | 3300037418 | Bacteria | 958 |
| 523 | Ga0395900_1655355 | 3300037418 | Bacteria | 551 |
| 524 | Ga0395898_0001377 | 3300037466 | Bacteria | 34890 |
| 525 | Ga0395898_0003446 | 3300037466 | Bacteria | 17687 |
| 526 | Ga0395898_0370117 | 3300037466 | Bacteria | 1366 |
| 527 | Ga0395898_0644073 | 3300037466 | Bacteria | 1002 |
| 528 | Ga0395898_0806606 | 3300037466 | Bacteria | 879 |
| 529 | Ga0395898_1242883 | 3300037466 | Bacteria | 675 |
| 530 | Ga0395905_0012360 | 3300037471 | Bacteria | 8220 |
| 531 | Ga0395905_0034815 | 3300037471 | Bacteria | 4729 |
| 532 | Ga0395905_0064359 | 3300037471 | Bacteria | 3431 |
| 533 | Ga0395905_0100041 | 3300037471 | Bacteria | 2722 |
| 534 | Ga0395905_0400904 | 3300037471 | Bacteria | 1267 |
| 535 | Ga0436364_1043978 | 3300037853 | Bacteria | 1651 |
| 536 | Ga0395901_0000059 | 3300038443 | Bacteria | 152667 |
| 537 | Ga0395901_0028854 | 3300038443 | Bacteria | 5707 |
| 538 | Ga0395901_0048474 | 3300038443 | Bacteria | 4411 |
| 539 | Ga0395901_0113628 | 3300038443 | Bacteria | 2844 |
| 540 | Ga0395901_0227589 | 3300038443 | Bacteria | 1948 |
| 541 | Ga0395901_0277583 | 3300038443 | Bacteria | 1742 |
| 542 | Ga0395901_0354159 | 3300038443 | Bacteria | 1514 |
| 543 | Ga0395901_1395843 | 3300038443 | Bacteria | 659 |
| 544 | Ga0436365_0043975 | 3300039437 | Bacteria | 6582 |
| 545 | Ga0436365_0178950 | 3300039437 | Bacteria | 2637 |
| 546 | Ga0436365_0214722 | 3300039437 | Bacteria | 936 |
| 547 | Ga0436365_0355981 | 3300039437 | Bacteria | 546 |
| 548 | Ga0436365_0535444 | 3300039437 | Bacteria | 10170 |
| 549 | Ga0436365_1886658 | 3300039437 | Bacteria | 26869 |
| 550 | Ga0436360_0256668 | 3300039438 | Bacteria | 769 |
| 551 | Ga0436363_0105824 | 3300039450 | Bacteria | 1923 |
| 552 | Ga0436363_0882130 | 3300039450 | Bacteria | 933 |
| 553 | Ga0436363_1382020 | 3300039450 | Bacteria | 5958 |
| 554 | Ga0436363_1579194 | 3300039450 | Bacteria | 510 |
| 555 | Ga0436362_0295315 | 3300039453 | Bacteria | 16615 |
| 556 | Ga0439465_0060268 | 3300041413 | Bacteria | 1257 |
| 557 | Ga0451800_0863443 | 3300041459 | Bacteria | 726 |
| 558 | Ga0451807_0539834 | 3300041486 | Bacteria | 1380 |
| 559 | Ga0451841_1174930 | 3300041498 | Bacteria | 1141 |
| 560 | Ga0451845_0600722 | 3300041501 | Bacteria | 540 |
| 561 | Ga0451851_0264887 | 3300041507 | Bacteria | 890 |
| 562 | Ga0451855_0979810 | 3300041511 | Bacteria | 828 |
| 563 | Ga0439445_0009835 | 3300042004 | Bacteria | 2258 |
| 564 | Ga0439458_0136884 | 3300042157 | Bacteria | 651 |
| 565 | Ga0439435_0022532 | 3300042436 | Bacteria | 1645 |
| 566 | Ga0466969_0046480 | 3300044656 | Bacteria | 2153 |
| 567 | Ga0466969_0107149 | 3300044656 | Bacteria | 1311 |
| 568 | Ga0466972_0011625 | 3300044658 | Bacteria | 4420 |
| 569 | Ga0466972_0183679 | 3300044658 | Bacteria | 980 |
| 570 | Ga0466965_0140152 | 3300044683 | Bacteria | 1258 |
| 571 | Ga0466966_0001064 | 3300044684 | Bacteria | 17544 |
| 572 | Ga0466966_0012361 | 3300044684 | Bacteria | 5657 |
| 573 | Ga0466966_0222152 | 3300044684 | Bacteria | 1140 |
| 574 | Ga0466966_0227195 | 3300044684 | Bacteria | 1126 |
| 575 | Ga0466961_0033786 | 3300044693 | Bacteria | 3286 |
| 576 | Ga0466961_0078529 | 3300044693 | Bacteria | 2090 |
| 577 | Ga0466961_0142208 | 3300044693 | Bacteria | 1501 |
| 578 | Ga0466961_0202182 | 3300044693 | Bacteria | 1228 |
| 579 | Ga0466963_0025561 | 3300044694 | Bacteria | 3767 |
| 580 | Ga0466963_0528727 | 3300044694 | Bacteria | 833 |
| 581 | Ga0466964_0538817 | 3300044706 | Bacteria | 632 |
| 582 | Ga0466971_0012181 | 3300044719 | Bacteria | 3768 |
| 583 | Ga0466971_0012659 | 3300044719 | Bacteria | 3699 |
| 584 | Ga0466968_0009013 | 3300044735 | Bacteria | 3835 |
| 585 | Ga0466970_0016296 | 3300044765 | Bacteria | 3828 |
| 586 | Ga0466970_0068776 | 3300044765 | Bacteria | 1903 |
| 587 | Ga0466970_0525544 | 3300044765 | Bacteria | 683 |
| 588 | Ga0466957_0002214 | 3300044842 | Bacteria | 10425 |
| 589 | Ga0466957_0025936 | 3300044842 | Bacteria | 3475 |
| 590 | Ga0466957_0030036 | 3300044842 | Bacteria | 3244 |
| 591 | Ga0466957_0503463 | 3300044842 | Bacteria | 840 |
| 592 | Ga0466960_0030155 | 3300044901 | Bacteria | 2494 |
| 593 | Ga0466959_0020527 | 3300045049 | Bacteria | 4869 |
| 594 | Ga0466959_0044660 | 3300045049 | Bacteria | 3264 |
| 595 | Ga0466959_0282418 | 3300045049 | Bacteria | 1139 |
| 596 | Ga0466959_0510055 | 3300045049 | Bacteria | 812 |
| 597 | Ga0466958_0145145 | 3300045836 | Bacteria | 1495 |
| 598 | Ga0466958_0162432 | 3300045836 | Bacteria | 1412 |
| 599 | Ga0466958_0400990 | 3300045836 | Bacteria | 885 |
| 600 | Ga0466967_0053350 | 3300045976 | Bacteria | 3553 |
| 601 | Ga0466967_0104657 | 3300045976 | Bacteria | 2591 |
| 602 | Ga0466967_0226957 | 3300045976 | Bacteria | 1777 |
| 603 | Ga0466967_0304118 | 3300045976 | Bacteria | 1535 |
| 604 | Ga0466967_0798580 | 3300045976 | Bacteria | 937 |
| 605 | Ga0495592_0860419 | 3300046454 | Bacteria | 535 |
| 606 | Ga0495603_0446212 | 3300046455 | Bacteria | 741 |
| 607 | Ga0495629_0352881 | 3300046459 | Bacteria | 1003 |
| 608 | Ga0495629_0503033 | 3300046459 | Bacteria | 817 |
| 609 | Ga0495638_0006956 | 3300046460 | Bacteria | 8165 |
| 610 | Ga0495638_0021201 | 3300046460 | Bacteria | 4286 |
| 611 | Ga0495638_0338042 | 3300046460 | Bacteria | 799 |
| 612 | Ga0495641_0343052 | 3300046461 | Bacteria | 675 |
| 613 | Ga0495580_0668337 | 3300046472 | Bacteria | 682 |
| 614 | Ga0495582_0492145 | 3300046473 | Bacteria | 709 |
| 615 | Ga0495605_0185877 | 3300046474 | Bacteria | 912 |
| 616 | Ga0495584_0051802 | 3300046491 | Bacteria | 2066 |
| 617 | Ga0495585_0012196 | 3300046492 | Bacteria | 5064 |
| 618 | Ga0495583_0095423 | 3300046506 | Bacteria | 1276 |
| 619 | Ga0495606_0000070 | 3300046507 | Bacteria | 177343 |
| 620 | Ga0495610_0059335 | 3300046512 | Bacteria | 1826 |
| 621 | Ga0495610_0156215 | 3300046512 | Bacteria | 968 |
| 622 | Ga0495616_0000338 | 3300046513 | Bacteria | 37114 |
| 623 | Ga0495616_0167596 | 3300046513 | Bacteria | 984 |
| 624 | Ga0495620_0108176 | 3300046515 | Bacteria | 1103 |
| 625 | Ga0495630_0026824 | 3300046517 | Bacteria | 4267 |
| 626 | Ga0495631_0000163 | 3300046518 | Bacteria | 45348 |
| 627 | Ga0495631_0086528 | 3300046518 | Bacteria | 1350 |
| 628 | Ga0495637_0006808 | 3300046520 | Bacteria | 5718 |
| 629 | Ga0495643_0167270 | 3300046522 | Bacteria | 1077 |
| 630 | Ga0495644_0338533 | 3300046523 | Bacteria | 591 |
| 631 | Ga0495654_0002141 | 3300046530 | Bacteria | 12881 |
| 632 | Ga0495640_0910926 | 3300046533 | Bacteria | 521 |
| 633 | Ga0495586_0456299 | 3300046535 | Bacteria | 737 |
| 634 | Ga0495598_0075357 | 3300046537 | Bacteria | 1071 |
| 635 | Ga0495609_0240161 | 3300046538 | Bacteria | 748 |
| 636 | Ga0495621_0007800 | 3300046539 | Bacteria | 3181 |
| 637 | Ga0495597_0091226 | 3300046542 | Bacteria | 1293 |
| 638 | Ga0495645_0317356 | 3300046543 | Bacteria | 1013 |
| 639 | Ga0495622_0180822 | 3300046557 | Bacteria | 946 |
| 640 | Ga0495668_0273429 | 3300046616 | Bacteria | 925 |
| 641 | Ga0495611_0036796 | 3300046648 | Bacteria | 2174 |
| 642 | Ga0495625_0030946 | 3300046660 | Bacteria | 3986 |
| 643 | Ga0495659_0166893 | 3300046664 | Bacteria | 891 |
| 644 | Ga0495661_0086570 | 3300046665 | Bacteria | 1793 |
| 645 | Ga0495588_0047906 | 3300046674 | Bacteria | 2195 |
| 646 | Ga0495588_0353023 | 3300046674 | Bacteria | 772 |
| 647 | Ga0495588_0583363 | 3300046674 | Bacteria | 586 |
| 648 | Ga0495658_0647497 | 3300046683 | Bacteria | 677 |
| 649 | Ga0495669_0407217 | 3300046684 | Bacteria | 659 |
| 650 | Ga0495624_0146398 | 3300046690 | Bacteria | 1446 |
| 651 | Ga0495624_0358164 | 3300046690 | Bacteria | 877 |
| 652 | Ga0495670_0238839 | 3300046691 | Bacteria | 967 |
| 653 | Ga0495671_0020470 | 3300046692 | Bacteria | 3485 |
| 654 | Ga0495660_0065191 | 3300046810 | Bacteria | 1945 |
| 655 | Ga0495660_0149755 | 3300046810 | Bacteria | 1153 |
| 656 | Ga0495660_0322823 | 3300046810 | Bacteria | 693 |
| 657 | Ga0495636_0399963 | 3300047318 | Bacteria | 654 |
| 658 | Ga0495674_0021627 | 3300047319 | Bacteria | 5946 |
| 659 | Ga0495672_0280902 | 3300047320 | Bacteria | 796 |
| 660 | Ga0495676_0126961 | 3300047321 | Bacteria | 1847 |
| 661 | Ga0495683_0146029 | 3300047323 | Bacteria | 1105 |
| 662 | Ga0495673_0325341 | 3300047469 | Bacteria | 547 |
| 663 | Ga0495686_0000841 | 3300047472 | Bacteria | 39404 |
| 664 | Ga0495686_0016462 | 3300047472 | Bacteria | 5013 |
| 665 | Ga0495686_0061464 | 3300047472 | Bacteria | 2332 |
| 666 | Ga0495686_0069679 | 3300047472 | Bacteria | 2167 |
| 667 | Ga0495686_0236830 | 3300047472 | Bacteria | 1031 |
| 668 | Ga0495593_0068780 | 3300047673 | Bacteria | 1842 |
| 669 | Ga0495614_0117617 | 3300048089 | Bacteria | 1170 |
| 670 | Ga0495626_0116626 | 3300048091 | Bacteria | 1152 |
| 671 | Ga0496100_0244298 | 3300048903 | Bacteria | 1326 |
| 672 | Ga0496100_0374886 | 3300048903 | Bacteria | 1080 |
| 673 | Ga0496100_1084555 | 3300048903 | Bacteria | 631 |
| 674 | Ga0496100_1204923 | 3300048903 | Bacteria | 597 |
| 675 | Ga0496101_0015961 | 3300048904 | Bacteria | 5067 |
| 676 | Ga0496101_0152226 | 3300048904 | Bacteria | 1770 |
| 677 | Ga0496101_0373053 | 3300048904 | Bacteria | 1122 |
| 678 | Ga0496102_0012441 | 3300048905 | Bacteria | 7363 |
| 679 | Ga0496102_0366272 | 3300048905 | Bacteria | 1357 |
| 680 | Ga0496102_0837433 | 3300048905 | Bacteria | 842 |
| 681 | Ga0496104_0623015 | 3300048907 | Bacteria | 988 |
| 682 | Ga0496105_0117753 | 3300048908 | Bacteria | 2191 |
| 683 | Ga0496106_0472082 | 3300048909 | Bacteria | 1008 |
| 684 | Ga0496107_0761904 | 3300048910 | Bacteria | 710 |
| 685 | Ga0496107_0944835 | 3300048910 | Bacteria | 627 |
| 686 | Ga0496108_0044497 | 3300048911 | Bacteria | 3705 |
| 687 | Ga0496108_0146790 | 3300048911 | Bacteria | 2034 |
| 688 | Ga0496109_0023980 | 3300048912 | Bacteria | 5419 |
| 689 | Ga0496109_0928889 | 3300048912 | Bacteria | 808 |
| 690 | Ga0496110_0315646 | 3300048913 | Bacteria | 1423 |
| 691 | Ga0496111_0072814 | 3300048914 | Bacteria | 2501 |
| 692 | Ga0496112_0001369 | 3300048915 | Bacteria | 18577 |
| 693 | Ga0496112_0868689 | 3300048915 | Bacteria | 825 |
| 694 | Ga0496113_0026637 | 3300048916 | Bacteria | 4136 |
| 695 | Ga0496114_0267821 | 3300048917 | Bacteria | 1505 |
| 696 | Ga0496115_0617839 | 3300048918 | Bacteria | 860 |
| 697 | Ga0496115_0862248 | 3300048918 | Bacteria | 701 |
| 698 | Ga0496116_0213092 | 3300048919 | Bacteria | 999 |
| 699 | Ga0496117_0075201 | 3300048920 | Bacteria | 2245 |
| 700 | Ga0496118_0027891 | 3300048921 | Bacteria | 4769 |
| 701 | Ga0496118_0040951 | 3300048921 | Bacteria | 3675 |
| 702 | Ga0496119_0050269 | 3300048922 | Bacteria | 2571 |
| 703 | Ga0496119_0210886 | 3300048922 | Bacteria | 999 |
| 704 | Ga0496120_0162739 | 3300048923 | Bacteria | 1111 |
| 705 | Ga0496121_0162838 | 3300048924 | Bacteria | 1629 |
| 706 | Ga0496122_0086918 | 3300048925 | Bacteria | 2150 |
| 707 | Ga0496122_0147041 | 3300048925 | Bacteria | 1462 |
| 708 | Ga0496122_0399114 | 3300048925 | Bacteria | 699 |
| 709 | Ga0496123_0036494 | 3300048926 | Bacteria | 3486 |
| 710 | Ga0496123_0163448 | 3300048926 | Bacteria | 1184 |
| 711 | Ga0496124_0076778 | 3300048927 | Bacteria | 2756 |
| 712 | Ga0496124_0141331 | 3300048927 | Bacteria | 1899 |
| 713 | Ga0496124_0393517 | 3300048927 | Bacteria | 964 |
| 714 | Ga0496125_0061820 | 3300048928 | Bacteria | 3001 |
| 715 | Ga0496125_0156338 | 3300048928 | Bacteria | 1557 |
| 716 | Ga0496126_0003228 | 3300048929 | Bacteria | 20863 |
| 717 | Ga0496126_0105058 | 3300048929 | Bacteria | 2467 |
| 718 | Ga0501031_0090667 | 3300049568 | Bacteria | 1994 |
| 719 | Ga0501031_0495842 | 3300049568 | Bacteria | 788 |
| 720 | Ga0501032_0003313 | 3300049569 | Bacteria | 12388 |
| 721 | Ga0501032_0171964 | 3300049569 | Bacteria | 1420 |
| 722 | Ga0501032_0175532 | 3300049569 | Bacteria | 1404 |
| 723 | Ga0501032_0182178 | 3300049569 | Bacteria | 1375 |
| 724 | Ga0501032_0220955 | 3300049569 | Bacteria | 1233 |
| 725 | Ga0501032_0391828 | 3300049569 | Bacteria | 893 |
| 726 | Ga0501032_0730748 | 3300049569 | Bacteria | 627 |
| 727 | Ga0501033_0003150 | 3300049570 | Bacteria | 13707 |
| 728 | Ga0501033_0019795 | 3300049570 | Bacteria | 5087 |
| 729 | Ga0501033_0041579 | 3300049570 | Bacteria | 3429 |
| 730 | Ga0501033_0217898 | 3300049570 | Bacteria | 1359 |
| 731 | Ga0501033_0808820 | 3300049570 | Bacteria | 633 |
| 732 | Ga0501034_0154717 | 3300049571 | Bacteria | 2267 |
| 733 | Ga0501034_0313426 | 3300049571 | Bacteria | 1503 |
| 734 | Ga0501034_0423723 | 3300049571 | Bacteria | 1252 |
| 735 | Ga0501034_0751190 | 3300049571 | Bacteria | 871 |
| 736 | Ga0501034_1056850 | 3300049571 | Bacteria | 694 |
| 737 | Ga0501036_0125883 | 3300049572 | Bacteria | 2164 |
| 738 | Ga0501036_0132931 | 3300049572 | Bacteria | 2100 |
| 739 | Ga0501036_0271533 | 3300049572 | Bacteria | 1420 |
| 740 | Ga0501037_0000253 | 3300049573 | Bacteria | 45817 |
| 741 | Ga0501037_0109735 | 3300049573 | Bacteria | 1988 |
| 742 | Ga0501037_0120562 | 3300049573 | Bacteria | 1886 |
| 743 | Ga0501037_0131266 | 3300049573 | Bacteria | 1796 |
| 744 | Ga0501038_0133674 | 3300049574 | Bacteria | 2034 |
| 745 | Ga0501038_0484681 | 3300049574 | Bacteria | 947 |
| 746 | Ga0501039_0189303 | 3300049575 | Bacteria | 1618 |
| 747 | Ga0501039_0248974 | 3300049575 | Bacteria | 1397 |
| 748 | Ga0501043_0000100 | 3300049579 | Bacteria | 79167 |
| 749 | Ga0501043_0023314 | 3300049579 | Bacteria | 4854 |
| 750 | Ga0501043_0030141 | 3300049579 | Bacteria | 4262 |
| 751 | Ga0501043_0031815 | 3300049579 | Bacteria | 4148 |
| 752 | Ga0501043_0046356 | 3300049579 | Bacteria | 3418 |
| 753 | Ga0501043_0157335 | 3300049579 | Bacteria | 1777 |
| 754 | Ga0501043_0172300 | 3300049579 | Bacteria | 1688 |
| 755 | Ga0501043_0189483 | 3300049579 | Bacteria | 1600 |
| 756 | Ga0501043_0496323 | 3300049579 | Bacteria | 912 |
| 757 | Ga0501046_0390643 | 3300049580 | Bacteria | 1006 |
| 758 | Ga0501046_0490132 | 3300049580 | Bacteria | 881 |
| 759 | Ga0501046_0562634 | 3300049580 | Bacteria | 812 |
| 760 | Ga0501047_0032207 | 3300049581 | Bacteria | 5060 |
| 761 | Ga0501047_0056248 | 3300049581 | Bacteria | 3804 |
| 762 | Ga0501047_0151679 | 3300049581 | Bacteria | 2193 |
| 763 | Ga0501047_0272527 | 3300049581 | Bacteria | 1538 |
| 764 | Ga0501048_0237303 | 3300049582 | Bacteria | 1294 |
| 765 | Ga0501048_0353955 | 3300049582 | Bacteria | 1047 |
| 766 | Ga0501067_0026924 | 3300049583 | Bacteria | 3184 |
| 767 | Ga0501067_0351789 | 3300049583 | Bacteria | 821 |
| 768 | Ga0501067_0542681 | 3300049583 | Bacteria | 651 |
| 769 | Ga0501067_0642945 | 3300049583 | Bacteria | 595 |
| 770 | Ga0501067_0721111 | 3300049583 | Bacteria | 561 |
| 771 | Ga0501068_0114351 | 3300049584 | Bacteria | 1680 |
| 772 | Ga0501069_0000020 | 3300049585 | Bacteria | 122595 |
| 773 | Ga0501069_0008202 | 3300049585 | Bacteria | 5484 |
| 774 | Ga0501069_0037791 | 3300049585 | Bacteria | 2664 |
| 775 | Ga0501069_0062709 | 3300049585 | Bacteria | 2076 |
| 776 | Ga0501069_0434782 | 3300049585 | Bacteria | 779 |
| 777 | Ga0501069_0724773 | 3300049585 | Bacteria | 601 |
| 778 | Ga0501070_0000193 | 3300049586 | Bacteria | 57357 |
| 779 | Ga0501070_0000595 | 3300049586 | Bacteria | 32980 |
| 780 | Ga0501070_0000836 | 3300049586 | Bacteria | 27961 |
| 781 | Ga0501070_0005381 | 3300049586 | Bacteria | 10920 |
| 782 | Ga0501070_0017885 | 3300049586 | Bacteria | 5952 |
| 783 | Ga0501070_0130201 | 3300049586 | Bacteria | 2079 |
| 784 | Ga0501070_0500762 | 3300049586 | Bacteria | 976 |
| 785 | Ga0501070_0732138 | 3300049586 | Bacteria | 780 |
| 786 | Ga0501071_0145454 | 3300049587 | Bacteria | 1767 |
| 787 | Ga0501071_0796822 | 3300049587 | Bacteria | 728 |
| 788 | Ga0501072_0732140 | 3300049588 | Bacteria | 776 |
| 789 | Ga0501072_0988501 | 3300049588 | Bacteria | 656 |
| 790 | Ga0501073_0014669 | 3300049589 | Bacteria | 5693 |
| 791 | Ga0501073_0044918 | 3300049589 | Bacteria | 3113 |
| 792 | Ga0501073_0136308 | 3300049589 | Bacteria | 1701 |
| 793 | Ga0501073_0847135 | 3300049589 | Bacteria | 630 |
| 794 | Ga0501074_0000063 | 3300049590 | Bacteria | 51162 |
| 795 | Ga0501074_0092478 | 3300049590 | Bacteria | 2166 |
| 796 | Ga0501074_0334729 | 3300049590 | Bacteria | 1074 |
| 797 | Ga0501074_0643287 | 3300049590 | Bacteria | 749 |
| 798 | Ga0501079_0156949 | 3300049741 | Bacteria | 1774 |
| 799 | Ga0501079_0530271 | 3300049741 | Bacteria | 926 |
| 800 | Ga0501079_1446052 | 3300049741 | Bacteria | 541 |
| 801 | Ga0501080_0004199 | 3300049742 | Bacteria | 12780 |
| 802 | Ga0501080_0010754 | 3300049742 | Bacteria | 8371 |
| 803 | Ga0501080_0053672 | 3300049742 | Bacteria | 3753 |
| 804 | Ga0501080_0516665 | 3300049742 | Bacteria | 1066 |
| 805 | Ga0501083_0000205 | 3300049744 | Bacteria | 38186 |
| 806 | Ga0501083_0224427 | 3300049744 | Bacteria | 1224 |
| 807 | Ga0501083_0346219 | 3300049744 | Bacteria | 966 |
| 808 | Ga0501083_0562403 | 3300049744 | Bacteria | 742 |
| 809 | Ga0501083_0911605 | 3300049744 | Bacteria | 572 |
| 810 | Ga0501035_0000070 | 3300049822 | Bacteria | 127442 |
| 811 | Ga0501035_0001992 | 3300049822 | Bacteria | 20414 |
| 812 | Ga0501035_0002240 | 3300049822 | Bacteria | 19152 |
| 813 | Ga0501035_0018210 | 3300049822 | Bacteria | 6469 |
| 814 | Ga0501035_0028327 | 3300049822 | Bacteria | 5114 |
| 815 | Ga0501035_0189028 | 3300049822 | Bacteria | 1771 |
| 816 | Ga0501035_0296803 | 3300049822 | Bacteria | 1362 |
| 817 | Ga0501044_0000037 | 3300049823 | Bacteria | 161924 |
| 818 | Ga0501044_0023371 | 3300049823 | Bacteria | 6575 |
| 819 | Ga0501044_0032505 | 3300049823 | Bacteria | 5485 |
| 820 | Ga0501044_0051263 | 3300049823 | Bacteria | 4255 |
| 821 | Ga0501044_0058214 | 3300049823 | Bacteria | 3963 |
| 822 | Ga0501044_0061251 | 3300049823 | Bacteria | 3850 |
| 823 | Ga0501044_0171458 | 3300049823 | Bacteria | 2141 |
| 824 | Ga0501044_0243492 | 3300049823 | Bacteria | 1741 |
| 825 | Ga0501044_0359298 | 3300049823 | Bacteria | 1375 |
| 826 | Ga0501044_0398376 | 3300049823 | Bacteria | 1289 |
| 827 | Ga0501044_0678625 | 3300049823 | Bacteria | 917 |
| 828 | Ga0501044_0913825 | 3300049823 | Bacteria | 752 |
| 829 | nmdc:mga03n38_815137_c1 | 3300050490 | Bacteria | 544 |
| 830 | nmdc:mga0k408_1222_c1 | 3300050493 | Bacteria | 10920 |
| 831 | nmdc:mga0k408_17605_c2 | 3300050493 | Bacteria | 2559 |
| 832 | nmdc:mga0k408_66221_c1 | 3300050493 | Bacteria | 2104 |
| 833 | nmdc:mga0k408_68564_c1 | 3300050493 | Bacteria | 2069 |
| 834 | nmdc:mga0k408_80740_c1 | 3300050493 | Bacteria | 1904 |
| 835 | nmdc:mga06z11_42901_c1 | 3300050494 | Bacteria | 2272 |
| 836 | nmdc:mga06z11_628342_c1 | 3300050494 | Bacteria | 654 |
| 837 | nmdc:mga04h51_132867_c1 | 3300050495 | Bacteria | 938 |
| 838 | nmdc:mga07m45_12323_c1 | 3300050496 | Bacteria | 4516 |
| 839 | nmdc:mga07m45_12524_c1 | 3300050496 | Bacteria | 4484 |
| 840 | nmdc:mga07m45_221124_c1 | 3300050496 | Bacteria | 1102 |
| 841 | nmdc:mga07m45_222503_c1 | 3300050496 | Bacteria | 1098 |
| 842 | nmdc:mga07m45_225557_c1 | 3300050496 | Bacteria | 1090 |
| 843 | nmdc:mga07m45_36017_c1 | 3300050496 | Bacteria | 2754 |
| 844 | nmdc:mga05p37_1268362_c1 | 3300050507 | Bacteria | 754 |
| 845 | nmdc:mga0sz30_323296_c1 | 3300050516 | Bacteria | 689 |
| 846 | Ga0495601_0080115 | 3300053077 | Bacteria | 2095 |
| 847 | Ga0495612_0432903 | 3300053078 | Bacteria | 600 |
| 848 | Ga0500610_0003000 | 3300053079 | Bacteria | 6367 |
| 849 | Ga0500610_0132941 | 3300053079 | Bacteria | 1263 |
| 850 | Ga0500578_0092904 | 3300053086 | Bacteria | 1914 |
| 851 | Ga0500578_0482243 | 3300053086 | Bacteria | 701 |
| 852 | Ga0500643_041209 | 3300053087 | Bacteria | 1357 |
| 853 | Ga0500644_0010325 | 3300053088 | Bacteria | 2526 |
| 854 | Ga0500644_0419011 | 3300053088 | Bacteria | 585 |
| 855 | Ga0500646_0016030 | 3300053090 | Bacteria | 1954 |
| 856 | Ga0500647_0367973 | 3300053091 | Bacteria | 593 |
| 857 | Ga0500651_0002595 | 3300053093 | Bacteria | 9597 |
| 858 | Ga0500651_0014879 | 3300053093 | Bacteria | 4767 |
| 859 | Ga0500651_0080404 | 3300053093 | Bacteria | 2019 |
| 860 | Ga0500651_0146221 | 3300053093 | Bacteria | 1422 |
| 861 | Ga0500566_0000003 | 3300053094 | Bacteria | 166820 |
| 862 | Ga0500566_0489857 | 3300053094 | Bacteria | 531 |
| 863 | Ga0500640_000494 | 3300053095 | Bacteria | 9782 |
| 864 | Ga0500562_068929 | 3300053108 | Bacteria | 954 |
| 865 | Ga0500571_000610 | 3300053110 | Bacteria | 14877 |
| 866 | Ga0500572_000064 | 3300053111 | Bacteria | 32890 |
| 867 | Ga0500572_068257 | 3300053111 | Bacteria | 1094 |
| 868 | Ga0500591_062438 | 3300053115 | Bacteria | 1713 |
| 869 | Ga0500592_023229 | 3300053116 | Bacteria | 1000 |
| 870 | Ga0500593_001312 | 3300053117 | Bacteria | 8974 |
| 871 | Ga0500594_0107655 | 3300053118 | Bacteria | 864 |
| 872 | Ga0500594_0136375 | 3300053118 | Bacteria | 780 |
| 873 | Ga0500594_0150956 | 3300053118 | Bacteria | 746 |
| 874 | Ga0500594_0196935 | 3300053118 | Bacteria | 661 |
| 875 | Ga0500595_001895 | 3300053119 | Bacteria | 10770 |
| 876 | Ga0500607_002084 | 3300053121 | Bacteria | 16729 |
| 877 | Ga0500608_010082 | 3300053122 | Bacteria | 4043 |
| 878 | Ga0500608_049218 | 3300053122 | Bacteria | 2026 |
| 879 | Ga0500614_000728 | 3300053123 | Bacteria | 8416 |
| 880 | Ga0500614_197155 | 3300053123 | Bacteria | 620 |
| 881 | Ga0500626_017227 | 3300053128 | Bacteria | 3173 |
| 882 | Ga0500642_0000786 | 3300053130 | Bacteria | 9291 |
| 883 | Ga0500655_002349 | 3300053133 | Bacteria | 3467 |
| 884 | Ga0500655_027279 | 3300053133 | Bacteria | 1090 |
| 885 | Ga0500658_0003124 | 3300053134 | Bacteria | 6327 |
| 886 | Ga0500658_0004678 | 3300053134 | Bacteria | 5106 |
| 887 | Ga0500559_0000697 | 3300053136 | Bacteria | 22073 |
| 888 | Ga0500559_0023339 | 3300053136 | Bacteria | 2626 |
| 889 | Ga0500564_016854 | 3300053138 | Bacteria | 3314 |
| 890 | Ga0500568_0296634 | 3300053139 | Bacteria | 587 |
| 891 | Ga0500573_0267064 | 3300053140 | Bacteria | 873 |
| 892 | Ga0500574_031489 | 3300053141 | Bacteria | 1429 |
| 893 | Ga0500577_0149039 | 3300053142 | Bacteria | 991 |
| 894 | Ga0500577_0331944 | 3300053142 | Bacteria | 664 |
| 895 | Ga0500588_0057214 | 3300053146 | Bacteria | 1237 |
| 896 | Ga0500588_0099006 | 3300053146 | Bacteria | 1002 |
| 897 | Ga0500603_000211 | 3300053150 | Bacteria | 15406 |
| 898 | Ga0500604_0004630 | 3300053151 | Bacteria | 3645 |
| 899 | Ga0500604_0115088 | 3300053151 | Bacteria | 896 |
| 900 | Ga0500604_0243347 | 3300053151 | Bacteria | 622 |
| 901 | Ga0500616_0000705 | 3300053153 | Bacteria | 38798 |
| 902 | Ga0500616_0005404 | 3300053153 | Bacteria | 8671 |
| 903 | Ga0500627_0155763 | 3300053158 | Bacteria | 1031 |
| 904 | Ga0500630_004374 | 3300053159 | Bacteria | 6875 |
| 905 | Ga0500633_0064090 | 3300053160 | Bacteria | 1299 |
| 906 | Ga0500634_0112681 | 3300053161 | Bacteria | 1339 |
| 907 | Ga0500634_0163162 | 3300053161 | Bacteria | 1026 |
| 908 | Ga0500638_058028 | 3300053162 | Bacteria | 1864 |
| 909 | Ga0500639_000042 | 3300053163 | Bacteria | 61423 |
| 910 | Ga0500625_139109 | 3300053729 | Bacteria | 937 |
| 911 | Ga0500609_009377 | 3300053731 | Bacteria | 1319 |
| 912 | Ga0500565_003471 | 3300053734 | Bacteria | 1261 |
| 913 | Ga0500596_004183 | 3300053735 | Bacteria | 2669 |
| 914 | Ga0500596_004335 | 3300053735 | Bacteria | 2609 |
| 915 | Ga0500587_015452 | 3300053739 | Bacteria | 972 |
| 916 | Ga0501084_0460654 | 3300054114 | Bacteria | 1075 |
| 917 | Ga0501084_0799963 | 3300054114 | Bacteria | 794 |
| 918 | Ga0501082_0115365 | 3300060353 | Bacteria | 2326 |
| 919 | Ga0466962_0011427 | 3300061719 | Bacteria | 4275 |
| 920 | Ga0466962_0034602 | 3300061719 | Bacteria | 2419 |
| 921 | Ga0466962_0038753 | 3300061719 | Bacteria | 2282 |
| 922 | Ga0530510_0225753 | 3300061734 | Bacteria | 1393 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0798580 | Ga0466967_0798580_12_422 | 115 |
| 2 | 3300009551 | Ga0105238_10406754 | Ga0105238_104067542 | 137 |
| 3 | 3300025924 | Ga0207694_11054105 | Ga0207694_110541051 | 137 |
| 4 | 3300037312 | Ga0395899_0029309 | Ga0395899_0029309_1793_2326 | 137 |
| 5 | 3300037418 | Ga0395900_0000980 | Ga0395900_0000980_17423_17911 | 137 |
| 6 | 3300037418 | Ga0395900_0091955 | Ga0395900_0091955_276_764 | 137 |
| 7 | 3300038443 | Ga0395901_0000059 | Ga0395901_0000059_27851_28339 | 137 |
| 8 | 3300044658 | Ga0466972_0183679 | Ga0466972_0183679_218_706 | 137 |
| 9 | 3300044684 | Ga0466966_0001064 | Ga0466966_0001064_13415_13903 | 137 |
| 10 | 3300044693 | Ga0466961_0033786 | Ga0466961_0033786_2785_3273 | 137 |
| 11 | 3300044719 | Ga0466971_0012659 | Ga0466971_0012659_130_618 | 137 |
| 12 | 3300044842 | Ga0466957_0025936 | Ga0466957_0025936_2540_3028 | 137 |
| 13 | 3300045836 | Ga0466958_0145145 | Ga0466958_0145145_583_1071 | 137 |
| 14 | 3300045976 | Ga0466967_0226957 | Ga0466967_0226957_10_498 | 137 |
| 15 | 3300061719 | Ga0466962_0038753 | Ga0466962_0038753_1034_1522 | 137 |
| 16 | 3300013102 | Ga0157371_10068435 | Ga0157371_100684352 | 141 |
| 17 | 3300013105 | Ga0157369_10000280 | Ga0157369_100002803 | 141 |
| 18 | 3300020081 | Ga0206354_10978505 | Ga0206354_109785051 | 141 |
| 19 | 3300037418 | Ga0395900_0088046 | Ga0395900_0088046_2447_2935 | 141 |
| 20 | 3300037466 | Ga0395898_0001377 | Ga0395898_0001377_31897_32385 | 141 |
| 21 | 3300038443 | Ga0395901_0048474 | Ga0395901_0048474_2485_2973 | 141 |
| 22 | 3300038443 | Ga0395901_0354159 | Ga0395901_0354159_74_562 | 141 |
| 23 | 3300039438 | Ga0436360_0256668 | Ga0436360_0256668_161_649 | 141 |
| 24 | 3300039450 | Ga0436363_0105824 | Ga0436363_0105824_27_518 | 142 |
| 25 | 3300039450 | Ga0436363_0882130 | Ga0436363_0882130_349_837 | 144 |
| 26 | 3300005843 | Ga0068860_101157934 | Ga0068860_1011579341 | 145 |
| 27 | 3300021384 | Ga0213876_10007769 | Ga0213876_100077697 | 145 |
| 28 | 3300039437 | Ga0436365_1886658 | Ga0436365_1886658_2722_3213 | 145 |
| 29 | 3300003792 | Ga0055540_1008403 | Ga0055540_10084033 | 149 |
| 30 | 3300005435 | Ga0070714_100308818 | Ga0070714_1003088182 | 149 |
| 31 | 3300005985 | Ga0081539_10171338 | Ga0081539_101713382 | 149 |
| 32 | 3300006880 | Ga0075429_101151232 | Ga0075429_1011512321 | 149 |
| 33 | 3300009148 | Ga0105243_10178363 | Ga0105243_101783632 | 149 |
| 34 | 3300049582 | Ga0501048_0237303 | Ga0501048_0237303_662_1114 | 149 |
| 35 | 3300049588 | Ga0501072_0988501 | Ga0501072_0988501_128_580 | 149 |
| 36 | 3300002739 | JGI25158J39367_1005418 | JGI25158J39367_10054183 | 150 |
| 37 | 3300002739 | JGI25158J39367_1009134 | JGI25158J39367_10091342 | 150 |
| 38 | 3300002773 | JGI25152J39213_1011261 | JGI25152J39213_10112612 | 150 |
| 39 | 3300002773 | JGI25152J39213_1011297 | JGI25152J39213_10112972 | 150 |
| 40 | 3300002774 | JGI25150J39212_1002359 | JGI25150J39212_10023593 | 150 |
| 41 | 3300002774 | JGI25150J39212_1022189 | JGI25150J39212_10221892 | 150 |
| 42 | 3300002987 | JGI25159J45721_1011623 | JGI25159J45721_10116233 | 150 |
| 43 | 3300002987 | JGI25159J45721_1012728 | JGI25159J45721_10127282 | 150 |
| 44 | 3300003187 | JGI25151J46595_10000406 | JGI25151J46595_1000040639 | 150 |
| 45 | 3300003187 | JGI25151J46595_10033255 | JGI25151J46595_100332552 | 150 |
| 46 | 3300003187 | JGI25151J46595_10064048 | JGI25151J46595_100640482 | 150 |
| 47 | 3300003215 | JGI25153J46596_10027553 | JGI25153J46596_100275532 | 150 |
| 48 | 3300003322 | rootL2_10141541 | rootL2_101415415 | 150 |
| 49 | 3300003354 | JGI25160J50197_1015392 | JGI25160J50197_10153922 | 150 |
| 50 | 3300003354 | JGI25160J50197_1020567 | JGI25160J50197_10205672 | 150 |
| 51 | 3300003374 | JGI25161J50226_1006911 | JGI25161J50226_10069112 | 150 |
| 52 | 3300003374 | JGI25161J50226_1010928 | JGI25161J50226_10109282 | 150 |
| 53 | 3300003578 | Ga0006562J51391_1040460 | Ga0006562J51391_10404603 | 150 |
| 54 | 3300003578 | Ga0006562J51391_1124565 | Ga0006562J51391_11245652 | 150 |
| 55 | 3300003578 | Ga0006562J51391_1124567 | Ga0006562J51391_11245673 | 150 |
| 56 | 3300003761 | Ga0055535_1000472 | Ga0055535_100047222 | 150 |
| 57 | 3300003762 | Ga0055542_1000103 | Ga0055542_100010383 | 150 |
| 58 | 3300003771 | Ga0055526_1018877 | Ga0055526_10188773 | 150 |
| 59 | 3300003771 | Ga0055526_1018911 | Ga0055526_10189113 | 150 |
| 60 | 3300003773 | Ga0055537_1003586 | Ga0055537_10035863 | 150 |
| 61 | 3300003773 | Ga0055537_1007518 | Ga0055537_10075182 | 150 |
| 62 | 3300003775 | Ga0055524_1017335 | Ga0055524_10173353 | 150 |
| 63 | 3300003775 | Ga0055524_1017395 | Ga0055524_10173953 | 150 |
| 64 | 3300003781 | Ga0055536_1010899 | Ga0055536_10108993 | 150 |
| 65 | 3300003781 | Ga0055536_1034514 | Ga0055536_10345142 | 150 |
| 66 | 3300003784 | Ga0055534_1010192 | Ga0055534_10101922 | 150 |
| 67 | 3300003784 | Ga0055534_1012069 | Ga0055534_10120692 | 150 |
| 68 | 3300003790 | Ga0055528_1016979 | Ga0055528_10169793 | 150 |
| 69 | 3300003790 | Ga0055528_1030302 | Ga0055528_10303021 | 150 |
| 70 | 3300003791 | Ga0055530_10000237 | Ga0055530_100002374 | 150 |
| 71 | 3300003792 | Ga0055540_1007368 | Ga0055540_10073682 | 150 |
| 72 | 3300003794 | Ga0055531_10011793 | Ga0055531_100117932 | 150 |
| 73 | 3300003794 | Ga0055531_10011817 | Ga0055531_100118173 | 150 |
| 74 | 3300004625 | Ga0055543_1003354 | Ga0055543_10033543 | 150 |
| 75 | 3300004625 | Ga0055543_1009200 | Ga0055543_10092001 | 150 |
| 76 | 3300005262 | Ga0065165_1008049 | Ga0065165_10080493 | 150 |
| 77 | 3300005262 | Ga0065165_1114842 | Ga0065165_11148421 | 150 |
| 78 | 3300005288 | Ga0065714_10075296 | Ga0065714_100752962 | 150 |
| 79 | 3300005327 | Ga0070658_10019982 | Ga0070658_100199822 | 150 |
| 80 | 3300005327 | Ga0070658_10032376 | Ga0070658_100323762 | 150 |
| 81 | 3300005327 | Ga0070658_10261262 | Ga0070658_102612622 | 150 |
| 82 | 3300005327 | Ga0070658_10271873 | Ga0070658_102718732 | 150 |
| 83 | 3300005327 | Ga0070658_11378341 | Ga0070658_113783411 | 150 |
| 84 | 3300005329 | Ga0070683_100006332 | Ga0070683_1000063323 | 150 |
| 85 | 3300005329 | Ga0070683_100067646 | Ga0070683_1000676463 | 150 |
| 86 | 3300005329 | Ga0070683_100135431 | Ga0070683_1001354313 | 150 |
| 87 | 3300005336 | Ga0070680_100015348 | Ga0070680_1000153483 | 150 |
| 88 | 3300005336 | Ga0070680_100114202 | Ga0070680_1001142022 | 150 |
| 89 | 3300005336 | Ga0070680_100233794 | Ga0070680_1002337942 | 150 |
| 90 | 3300005336 | Ga0070680_100714838 | Ga0070680_1007148381 | 150 |
| 91 | 3300005337 | Ga0070682_100239938 | Ga0070682_1002399383 | 150 |
| 92 | 3300005337 | Ga0070682_101040592 | Ga0070682_1010405921 | 150 |
| 93 | 3300005338 | Ga0068868_100225216 | Ga0068868_1002252162 | 150 |
| 94 | 3300005338 | Ga0068868_101085255 | Ga0068868_1010852551 | 150 |
| 95 | 3300005339 | Ga0070660_100001578 | Ga0070660_10000157812 | 150 |
| 96 | 3300005339 | Ga0070660_100015849 | Ga0070660_1000158492 | 150 |
| 97 | 3300005339 | Ga0070660_100120289 | Ga0070660_1001202892 | 150 |
| 98 | 3300005341 | Ga0070691_10008185 | Ga0070691_100081854 | 150 |
| 99 | 3300005341 | Ga0070691_10123137 | Ga0070691_101231373 | 150 |
| 100 | 3300005344 | Ga0070661_100279978 | Ga0070661_1002799782 | 150 |
| 101 | 3300005344 | Ga0070661_100697843 | Ga0070661_1006978431 | 150 |
| 102 | 3300005347 | Ga0070668_100040395 | Ga0070668_1000403952 | 150 |
| 103 | 3300005347 | Ga0070668_100421488 | Ga0070668_1004214882 | 150 |
| 104 | 3300005347 | Ga0070668_101382104 | Ga0070668_1013821041 | 150 |
| 105 | 3300005353 | Ga0070669_100149021 | Ga0070669_1001490211 | 150 |
| 106 | 3300005353 | Ga0070669_100250414 | Ga0070669_1002504142 | 150 |
| 107 | 3300005355 | Ga0070671_100013007 | Ga0070671_1000130073 | 150 |
| 108 | 3300005366 | Ga0070659_100017552 | Ga0070659_1000175522 | 150 |
| 109 | 3300005366 | Ga0070659_100038550 | Ga0070659_1000385503 | 150 |
| 110 | 3300005366 | Ga0070659_100154348 | Ga0070659_1001543482 | 150 |
| 111 | 3300005366 | Ga0070659_101044432 | Ga0070659_1010444321 | 150 |
| 112 | 3300005367 | Ga0070667_100156905 | Ga0070667_1001569053 | 150 |
| 113 | 3300005367 | Ga0070667_100396854 | Ga0070667_1003968542 | 150 |
| 114 | 3300005434 | Ga0070709_10010591 | Ga0070709_100105912 | 150 |
| 115 | 3300005434 | Ga0070709_10199064 | Ga0070709_101990641 | 150 |
| 116 | 3300005435 | Ga0070714_100099670 | Ga0070714_1000996703 | 150 |
| 117 | 3300005435 | Ga0070714_100148001 | Ga0070714_1001480013 | 150 |
| 118 | 3300005436 | Ga0070713_100004448 | Ga0070713_1000044486 | 150 |
| 119 | 3300005436 | Ga0070713_100030867 | Ga0070713_1000308672 | 150 |
| 120 | 3300005436 | Ga0070713_100615382 | Ga0070713_1006153822 | 150 |
| 121 | 3300005436 | Ga0070713_100997171 | Ga0070713_1009971711 | 150 |
| 122 | 3300005437 | Ga0070710_10001577 | Ga0070710_100015778 | 150 |
| 123 | 3300005437 | Ga0070710_10075838 | Ga0070710_100758382 | 150 |
| 124 | 3300005437 | Ga0070710_10508384 | Ga0070710_105083841 | 150 |
| 125 | 3300005439 | Ga0070711_100014177 | Ga0070711_1000141777 | 150 |
| 126 | 3300005439 | Ga0070711_100019753 | Ga0070711_1000197539 | 150 |
| 127 | 3300005455 | Ga0070663_100040167 | Ga0070663_1000401673 | 150 |
| 128 | 3300005455 | Ga0070663_100084680 | Ga0070663_1000846803 | 150 |
| 129 | 3300005455 | Ga0070663_100119562 | Ga0070663_1001195622 | 150 |
| 130 | 3300005455 | Ga0070663_100153459 | Ga0070663_1001534593 | 150 |
| 131 | 3300005456 | Ga0070678_100531447 | Ga0070678_1005314472 | 150 |
| 132 | 3300005457 | Ga0070662_100091653 | Ga0070662_1000916532 | 150 |
| 133 | 3300005457 | Ga0070662_101011728 | Ga0070662_1010117281 | 150 |
| 134 | 3300005458 | Ga0070681_10091120 | Ga0070681_100911202 | 150 |
| 135 | 3300005459 | Ga0068867_100273395 | Ga0068867_1002733952 | 150 |
| 136 | 3300005466 | Ga0070685_10830052 | Ga0070685_108300522 | 150 |
| 137 | 3300005467 | Ga0070706_100069093 | Ga0070706_1000690933 | 150 |
| 138 | 3300005467 | Ga0070706_100966941 | Ga0070706_1009669412 | 150 |
| 139 | 3300005468 | Ga0070707_100054741 | Ga0070707_1000547414 | 150 |
| 140 | 3300005468 | Ga0070707_100564913 | Ga0070707_1005649132 | 150 |
| 141 | 3300005471 | Ga0070698_100072440 | Ga0070698_1000724403 | 150 |
| 142 | 3300005471 | Ga0070698_100200459 | Ga0070698_1002004592 | 150 |
| 143 | 3300005518 | Ga0070699_100157516 | Ga0070699_1001575162 | 150 |
| 144 | 3300005518 | Ga0070699_100567984 | Ga0070699_1005679841 | 150 |
| 145 | 3300005530 | Ga0070679_100045942 | Ga0070679_1000459422 | 150 |
| 146 | 3300005530 | Ga0070679_100107906 | Ga0070679_1001079062 | 150 |
| 147 | 3300005535 | Ga0070684_100127371 | Ga0070684_1001273712 | 150 |
| 148 | 3300005539 | Ga0068853_100002181 | Ga0068853_10000218114 | 150 |
| 149 | 3300005539 | Ga0068853_100005480 | Ga0068853_1000054804 | 150 |
| 150 | 3300005539 | Ga0068853_100088454 | Ga0068853_1000884542 | 150 |
| 151 | 3300005544 | Ga0070686_101449655 | Ga0070686_1014496551 | 150 |
| 152 | 3300005548 | Ga0070665_100098102 | Ga0070665_1000981023 | 150 |
| 153 | 3300005549 | Ga0070704_100334497 | Ga0070704_1003344972 | 150 |
| 154 | 3300005563 | Ga0068855_100000423 | Ga0068855_10000042327 | 150 |
| 155 | 3300005563 | Ga0068855_100016471 | Ga0068855_1000164712 | 150 |
| 156 | 3300005563 | Ga0068855_100037105 | Ga0068855_1000371054 | 150 |
| 157 | 3300005563 | Ga0068855_100074913 | Ga0068855_1000749133 | 150 |
| 158 | 3300005563 | Ga0068855_100083890 | Ga0068855_1000838902 | 150 |
| 159 | 3300005563 | Ga0068855_100165212 | Ga0068855_1001652122 | 150 |
| 160 | 3300005563 | Ga0068855_100189756 | Ga0068855_1001897562 | 150 |
| 161 | 3300005563 | Ga0068855_100296346 | Ga0068855_1002963462 | 150 |
| 162 | 3300005563 | Ga0068855_100465620 | Ga0068855_1004656202 | 150 |
| 163 | 3300005564 | Ga0070664_100101995 | Ga0070664_1001019954 | 150 |
| 164 | 3300005564 | Ga0070664_100206154 | Ga0070664_1002061542 | 150 |
| 165 | 3300005564 | Ga0070664_100241353 | Ga0070664_1002413532 | 150 |
| 166 | 3300005577 | Ga0068857_100017952 | Ga0068857_1000179526 | 150 |
| 167 | 3300005577 | Ga0068857_100133082 | Ga0068857_1001330822 | 150 |
| 168 | 3300005577 | Ga0068857_100216154 | Ga0068857_1002161543 | 150 |
| 169 | 3300005578 | Ga0068854_100013039 | Ga0068854_1000130393 | 150 |
| 170 | 3300005578 | Ga0068854_100094075 | Ga0068854_1000940752 | 150 |
| 171 | 3300005578 | Ga0068854_100346883 | Ga0068854_1003468832 | 150 |
| 172 | 3300005614 | Ga0068856_100181698 | Ga0068856_1001816982 | 150 |
| 173 | 3300005614 | Ga0068856_100255084 | Ga0068856_1002550841 | 150 |
| 174 | 3300005614 | Ga0068856_100417466 | Ga0068856_1004174662 | 150 |
| 175 | 3300005614 | Ga0068856_101030719 | Ga0068856_1010307191 | 150 |
| 176 | 3300005616 | Ga0068852_100014980 | Ga0068852_1000149805 | 150 |
| 177 | 3300005616 | Ga0068852_100015610 | Ga0068852_1000156108 | 150 |
| 178 | 3300005616 | Ga0068852_100465596 | Ga0068852_1004655962 | 150 |
| 179 | 3300005617 | Ga0068859_100919482 | Ga0068859_1009194822 | 150 |
| 180 | 3300005618 | Ga0068864_100306401 | Ga0068864_1003064012 | 150 |
| 181 | 3300005718 | Ga0068866_10710168 | Ga0068866_107101682 | 150 |
| 182 | 3300005719 | Ga0068861_100681114 | Ga0068861_1006811142 | 150 |
| 183 | 3300005834 | Ga0068851_10024638 | Ga0068851_100246383 | 150 |
| 184 | 3300005834 | Ga0068851_10096248 | Ga0068851_100962482 | 150 |
| 185 | 3300005834 | Ga0068851_10155634 | Ga0068851_101556342 | 150 |
| 186 | 3300005841 | Ga0068863_100020128 | Ga0068863_1000201282 | 150 |
| 187 | 3300005844 | Ga0068862_100004007 | Ga0068862_1000040074 | 150 |
| 188 | 3300005844 | Ga0068862_100036231 | Ga0068862_1000362312 | 150 |
| 189 | 3300005844 | Ga0068862_100491887 | Ga0068862_1004918872 | 150 |
| 190 | 3300005983 | Ga0081540_1006124 | Ga0081540_10061246 | 150 |
| 191 | 3300005983 | Ga0081540_1011066 | Ga0081540_10110662 | 150 |
| 192 | 3300006028 | Ga0070717_10002120 | Ga0070717_1000212012 | 150 |
| 193 | 3300006028 | Ga0070717_10006962 | Ga0070717_100069629 | 150 |
| 194 | 3300006028 | Ga0070717_10115331 | Ga0070717_101153312 | 150 |
| 195 | 3300006028 | Ga0070717_10241165 | Ga0070717_102411652 | 150 |
| 196 | 3300006028 | Ga0070717_10288364 | Ga0070717_102883642 | 150 |
| 197 | 3300006028 | Ga0070717_10688300 | Ga0070717_106883001 | 150 |
| 198 | 3300006042 | Ga0075368_10035169 | Ga0075368_100351692 | 150 |
| 199 | 3300006048 | Ga0075363_100023308 | Ga0075363_1000233082 | 150 |
| 200 | 3300006051 | Ga0075364_10180263 | Ga0075364_101802632 | 150 |
| 201 | 3300006163 | Ga0070715_10307728 | Ga0070715_103077281 | 150 |
| 202 | 3300006173 | Ga0070716_100019421 | Ga0070716_1000194212 | 150 |
| 203 | 3300006173 | Ga0070716_100281913 | Ga0070716_1002819132 | 150 |
| 204 | 3300006173 | Ga0070716_100324534 | Ga0070716_1003245341 | 150 |
| 205 | 3300006173 | Ga0070716_100396830 | Ga0070716_1003968302 | 150 |
| 206 | 3300006173 | Ga0070716_100958618 | Ga0070716_1009586182 | 150 |
| 207 | 3300006175 | Ga0070712_100007666 | Ga0070712_1000076662 | 150 |
| 208 | 3300006175 | Ga0070712_100226681 | Ga0070712_1002266811 | 150 |
| 209 | 3300006177 | Ga0075362_10020220 | Ga0075362_100202202 | 150 |
| 210 | 3300006177 | Ga0075362_10157620 | Ga0075362_101576201 | 150 |
| 211 | 3300006178 | Ga0075367_10006033 | Ga0075367_100060332 | 150 |
| 212 | 3300006178 | Ga0075367_10048006 | Ga0075367_100480063 | 150 |
| 213 | 3300006178 | Ga0075367_10069338 | Ga0075367_100693382 | 150 |
| 214 | 3300006178 | Ga0075367_10176884 | Ga0075367_101768842 | 150 |
| 215 | 3300006186 | Ga0075369_10521636 | Ga0075369_105216361 | 150 |
| 216 | 3300006195 | Ga0075366_10013951 | Ga0075366_100139512 | 150 |
| 217 | 3300006195 | Ga0075366_10018767 | Ga0075366_100187674 | 150 |
| 218 | 3300006195 | Ga0075366_10039267 | Ga0075366_100392673 | 150 |
| 219 | 3300006195 | Ga0075366_10075959 | Ga0075366_100759592 | 150 |
| 220 | 3300006195 | Ga0075366_10108242 | Ga0075366_101082422 | 150 |
| 221 | 3300006237 | Ga0097621_100176247 | Ga0097621_1001762472 | 150 |
| 222 | 3300006353 | Ga0075370_10002986 | Ga0075370_100029863 | 150 |
| 223 | 3300006353 | Ga0075370_10006253 | Ga0075370_100062535 | 150 |
| 224 | 3300006353 | Ga0075370_10092007 | Ga0075370_100920072 | 150 |
| 225 | 3300006353 | Ga0075370_10143668 | Ga0075370_101436682 | 150 |
| 226 | 3300006881 | Ga0068865_100677894 | Ga0068865_1006778942 | 150 |
| 227 | 3300006931 | Ga0097620_100919699 | Ga0097620_1009196992 | 150 |
| 228 | 3300006942 | Ga0099824_1025033 | Ga0099824_10250331 | 150 |
| 229 | 3300006946 | Ga0079104_1054443 | Ga0079104_10544431 | 150 |
| 230 | 3300007076 | Ga0075435_100499031 | Ga0075435_1004990312 | 150 |
| 231 | 3300007265 | Ga0099794_10016877 | Ga0099794_100168773 | 150 |
| 232 | 3300007265 | Ga0099794_10727777 | Ga0099794_107277771 | 150 |
| 233 | 3300007788 | Ga0099795_10076871 | Ga0099795_100768712 | 150 |
| 234 | 3300009036 | Ga0105244_10048587 | Ga0105244_100485872 | 150 |
| 235 | 3300009093 | Ga0105240_10009195 | Ga0105240_1000919510 | 150 |
| 236 | 3300009093 | Ga0105240_10027146 | Ga0105240_100271463 | 150 |
| 237 | 3300009093 | Ga0105240_10044578 | Ga0105240_100445781 | 150 |
| 238 | 3300009093 | Ga0105240_10510383 | Ga0105240_105103832 | 150 |
| 239 | 3300009093 | Ga0105240_10667183 | Ga0105240_106671832 | 150 |
| 240 | 3300009093 | Ga0105240_11191874 | Ga0105240_111918741 | 150 |
| 241 | 3300009098 | Ga0105245_10136471 | Ga0105245_101364713 | 150 |
| 242 | 3300009101 | Ga0105247_10244317 | Ga0105247_102443172 | 150 |
| 243 | 3300009101 | Ga0105247_10254721 | Ga0105247_102547212 | 150 |
| 244 | 3300009148 | Ga0105243_10121266 | Ga0105243_101212662 | 150 |
| 245 | 3300009148 | Ga0105243_10460035 | Ga0105243_104600352 | 150 |
| 246 | 3300009148 | Ga0105243_10524314 | Ga0105243_105243142 | 150 |
| 247 | 3300009174 | Ga0105241_10025534 | Ga0105241_100255344 | 150 |
| 248 | 3300009174 | Ga0105241_10068019 | Ga0105241_100680192 | 150 |
| 249 | 3300009176 | Ga0105242_10373470 | Ga0105242_103734702 | 150 |
| 250 | 3300009176 | Ga0105242_10654445 | Ga0105242_106544452 | 150 |
| 251 | 3300009176 | Ga0105242_10794996 | Ga0105242_107949962 | 150 |
| 252 | 3300009176 | Ga0105242_12412674 | Ga0105242_124126741 | 150 |
| 253 | 3300009545 | Ga0105237_10003331 | Ga0105237_100033313 | 150 |
| 254 | 3300009545 | Ga0105237_10019368 | Ga0105237_100193686 | 150 |
| 255 | 3300009545 | Ga0105237_10127158 | Ga0105237_101271582 | 150 |
| 256 | 3300009545 | Ga0105237_10481321 | Ga0105237_104813212 | 150 |
| 257 | 3300009545 | Ga0105237_10968939 | Ga0105237_109689392 | 150 |
| 258 | 3300009551 | Ga0105238_10000062 | Ga0105238_1000006289 | 150 |
| 259 | 3300009551 | Ga0105238_10016145 | Ga0105238_100161451 | 150 |
| 260 | 3300009551 | Ga0105238_10093716 | Ga0105238_100937164 | 150 |
| 261 | 3300009551 | Ga0105238_10302661 | Ga0105238_103026612 | 150 |
| 262 | 3300009551 | Ga0105238_10654740 | Ga0105238_106547402 | 150 |
| 263 | 3300009553 | Ga0105249_10493335 | Ga0105249_104933352 | 150 |
| 264 | 3300010159 | Ga0099796_10448650 | Ga0099796_104486501 | 150 |
| 265 | 3300010375 | Ga0105239_10001306 | Ga0105239_100013062 | 150 |
| 266 | 3300010375 | Ga0105239_10001659 | Ga0105239_100016594 | 150 |
| 267 | 3300010375 | Ga0105239_10044705 | Ga0105239_100447054 | 150 |
| 268 | 3300010375 | Ga0105239_10127565 | Ga0105239_101275653 | 150 |
| 269 | 3300010375 | Ga0105239_11349824 | Ga0105239_113498241 | 150 |
| 270 | 3300010375 | Ga0105239_11392139 | Ga0105239_113921391 | 150 |
| 271 | 3300011119 | Ga0105246_10025297 | Ga0105246_100252972 | 150 |
| 272 | 3300011119 | Ga0105246_10166409 | Ga0105246_101664092 | 150 |
| 273 | 3300011119 | Ga0105246_10294857 | Ga0105246_102948571 | 150 |
| 274 | 3300011119 | Ga0105246_11023442 | Ga0105246_110234421 | 150 |
| 275 | 3300012502 | Ga0157347_1000658 | Ga0157347_10006582 | 150 |
| 276 | 3300012505 | Ga0157339_1019418 | Ga0157339_10194182 | 150 |
| 277 | 3300013100 | Ga0157373_10090246 | Ga0157373_100902462 | 150 |
| 278 | 3300013104 | Ga0157370_10017529 | Ga0157370_100175296 | 150 |
| 279 | 3300013104 | Ga0157370_10036407 | Ga0157370_100364074 | 150 |
| 280 | 3300013104 | Ga0157370_10203342 | Ga0157370_102033422 | 150 |
| 281 | 3300013104 | Ga0157370_10243453 | Ga0157370_102434532 | 150 |
| 282 | 3300013104 | Ga0157370_10273729 | Ga0157370_102737292 | 150 |
| 283 | 3300013105 | Ga0157369_10016139 | Ga0157369_100161397 | 150 |
| 284 | 3300013105 | Ga0157369_10017304 | Ga0157369_100173041 | 150 |
| 285 | 3300013105 | Ga0157369_10035212 | Ga0157369_100352124 | 150 |
| 286 | 3300013105 | Ga0157369_10235749 | Ga0157369_102357492 | 150 |
| 287 | 3300013105 | Ga0157369_11434428 | Ga0157369_114344282 | 150 |
| 288 | 3300013250 | Ga0171462_1008 | Ga0171462_1008187 | 150 |
| 289 | 3300013296 | Ga0157374_10016468 | Ga0157374_100164685 | 150 |
| 290 | 3300013296 | Ga0157374_10173708 | Ga0157374_101737082 | 150 |
| 291 | 3300013296 | Ga0157374_10888654 | Ga0157374_108886541 | 150 |
| 292 | 3300013297 | Ga0157378_10169141 | Ga0157378_101691413 | 150 |
| 293 | 3300013297 | Ga0157378_10374389 | Ga0157378_103743892 | 150 |
| 294 | 3300013297 | Ga0157378_11482469 | Ga0157378_114824691 | 150 |
| 295 | 3300013306 | Ga0163162_10709290 | Ga0163162_107092901 | 150 |
| 296 | 3300013307 | Ga0157372_10128397 | Ga0157372_101283972 | 150 |
| 297 | 3300013307 | Ga0157372_10341267 | Ga0157372_103412673 | 150 |
| 298 | 3300013307 | Ga0157372_10494282 | Ga0157372_104942822 | 150 |
| 299 | 3300013307 | Ga0157372_10796512 | Ga0157372_107965122 | 150 |
| 300 | 3300013308 | Ga0157375_10704688 | Ga0157375_107046882 | 150 |
| 301 | 3300013308 | Ga0157375_11797543 | Ga0157375_117975431 | 150 |
| 302 | 3300014325 | Ga0163163_10013499 | Ga0163163_100134995 | 150 |
| 303 | 3300014497 | Ga0182008_10027012 | Ga0182008_100270122 | 150 |
| 304 | 3300014497 | Ga0182008_10037106 | Ga0182008_100371062 | 150 |
| 305 | 3300014497 | Ga0182008_10127263 | Ga0182008_101272632 | 150 |
| 306 | 3300014745 | Ga0157377_10618808 | Ga0157377_106188081 | 150 |
| 307 | 3300015261 | Ga0182006_1001443 | Ga0182006_10014434 | 150 |
| 308 | 3300015261 | Ga0182006_1001447 | Ga0182006_10014478 | 150 |
| 309 | 3300015261 | Ga0182006_1241454 | Ga0182006_12414541 | 150 |
| 310 | 3300015265 | Ga0182005_1024095 | Ga0182005_10240952 | 150 |
| 311 | 3300017792 | Ga0163161_10000072 | Ga0163161_1000007235 | 150 |
| 312 | 3300020081 | Ga0206354_11625524 | Ga0206354_116255241 | 150 |
| 313 | 3300021358 | Ga0213873_10018658 | Ga0213873_100186582 | 150 |
| 314 | 3300021377 | Ga0213874_10151608 | Ga0213874_101516081 | 150 |
| 315 | 3300021377 | Ga0213874_10158291 | Ga0213874_101582912 | 150 |
| 316 | 3300021384 | Ga0213876_10003157 | Ga0213876_100031572 | 150 |
| 317 | 3300021384 | Ga0213876_10024863 | Ga0213876_100248634 | 150 |
| 318 | 3300025208 | Ga0209436_104233 | Ga0209436_1042333 | 150 |
| 319 | 3300025208 | Ga0209436_104647 | Ga0209436_1046473 | 150 |
| 320 | 3300025228 | Ga0209672_101222 | Ga0209672_1012223 | 150 |
| 321 | 3300025229 | Ga0209147_100352 | Ga0209147_10035223 | 150 |
| 322 | 3300025242 | Ga0209258_100133 | Ga0209258_10013377 | 150 |
| 323 | 3300025245 | Ga0207425_1000352 | Ga0207425_100035226 | 150 |
| 324 | 3300025245 | Ga0207425_1012932 | Ga0207425_10129322 | 150 |
| 325 | 3300025254 | Ga0209148_1000188 | Ga0209148_100018885 | 150 |
| 326 | 3300025258 | Ga0209129_1000245 | Ga0209129_100024536 | 150 |
| 327 | 3300025258 | Ga0209129_1003468 | Ga0209129_10034686 | 150 |
| 328 | 3300025258 | Ga0209129_1004337 | Ga0209129_10043373 | 150 |
| 329 | 3300025258 | Ga0209129_1005779 | Ga0209129_10057794 | 150 |
| 330 | 3300025258 | Ga0209129_1034824 | Ga0209129_10348242 | 150 |
| 331 | 3300025263 | Ga0209565_1000165 | Ga0209565_100016569 | 150 |
| 332 | 3300025263 | Ga0209565_1006089 | Ga0209565_10060893 | 150 |
| 333 | 3300025272 | Ga0209455_1000991 | Ga0209455_10009916 | 150 |
| 334 | 3300025273 | Ga0209673_1000454 | Ga0209673_100045455 | 150 |
| 335 | 3300025273 | Ga0209673_1001222 | Ga0209673_100122224 | 150 |
| 336 | 3300025273 | Ga0209673_1002781 | Ga0209673_10027812 | 150 |
| 337 | 3300025284 | Ga0209130_1000658 | Ga0209130_10006582 | 150 |
| 338 | 3300025284 | Ga0209130_1001097 | Ga0209130_10010979 | 150 |
| 339 | 3300025284 | Ga0209130_1012675 | Ga0209130_10126752 | 150 |
| 340 | 3300025291 | Ga0209675_1000823 | Ga0209675_100082310 | 150 |
| 341 | 3300025291 | Ga0209675_1011933 | Ga0209675_10119333 | 150 |
| 342 | 3300025292 | Ga0209676_1000111 | Ga0209676_1000111106 | 150 |
| 343 | 3300025292 | Ga0209676_1010951 | Ga0209676_10109512 | 150 |
| 344 | 3300025294 | Ga0209025_1000157 | Ga0209025_100015749 | 150 |
| 345 | 3300025294 | Ga0209025_1000615 | Ga0209025_100061536 | 150 |
| 346 | 3300025294 | Ga0209025_1013697 | Ga0209025_10136975 | 150 |
| 347 | 3300025295 | Ga0209564_1000070 | Ga0209564_1000070215 | 150 |
| 348 | 3300025295 | Ga0209564_1000352 | Ga0209564_100035269 | 150 |
| 349 | 3300025297 | Ga0209758_1000297 | Ga0209758_100029769 | 150 |
| 350 | 3300025297 | Ga0209758_1017089 | Ga0209758_10170893 | 150 |
| 351 | 3300025298 | Ga0209050_1000111 | Ga0209050_100011185 | 150 |
| 352 | 3300025299 | Ga0209256_1000047 | Ga0209256_1000047227 | 150 |
| 353 | 3300025299 | Ga0209256_1000238 | Ga0209256_100023869 | 150 |
| 354 | 3300025302 | Ga0207426_1000194 | Ga0207426_100019450 | 150 |
| 355 | 3300025302 | Ga0207426_1000294 | Ga0207426_100029469 | 150 |
| 356 | 3300025303 | Ga0209051_1000046 | Ga0209051_1000046255 | 150 |
| 357 | 3300025303 | Ga0209051_1036611 | Ga0209051_10366113 | 150 |
| 358 | 3300025304 | Ga0209257_1000344 | Ga0209257_100034466 | 150 |
| 359 | 3300025304 | Ga0209257_1004797 | Ga0209257_10047979 | 150 |
| 360 | 3300025304 | Ga0209257_1012644 | Ga0209257_10126443 | 150 |
| 361 | 3300025321 | Ga0207656_10006816 | Ga0207656_100068163 | 150 |
| 362 | 3300025321 | Ga0207656_10009713 | Ga0207656_100097133 | 150 |
| 363 | 3300025321 | Ga0207656_10071923 | Ga0207656_100719232 | 150 |
| 364 | 3300025898 | Ga0207692_10016579 | Ga0207692_100165794 | 150 |
| 365 | 3300025900 | Ga0207710_10377598 | Ga0207710_103775981 | 150 |
| 366 | 3300025900 | Ga0207710_10468898 | Ga0207710_104688981 | 150 |
| 367 | 3300025901 | Ga0207688_10034380 | Ga0207688_100343801 | 150 |
| 368 | 3300025903 | Ga0207680_10237913 | Ga0207680_102379132 | 150 |
| 369 | 3300025905 | Ga0207685_10254593 | Ga0207685_102545931 | 150 |
| 370 | 3300025906 | Ga0207699_10217536 | Ga0207699_102175362 | 150 |
| 371 | 3300025909 | Ga0207705_10009898 | Ga0207705_100098983 | 150 |
| 372 | 3300025909 | Ga0207705_10017143 | Ga0207705_100171435 | 150 |
| 373 | 3300025910 | Ga0207684_10018442 | Ga0207684_100184427 | 150 |
| 374 | 3300025911 | Ga0207654_10292123 | Ga0207654_102921231 | 150 |
| 375 | 3300025912 | Ga0207707_10000363 | Ga0207707_1000036344 | 150 |
| 376 | 3300025912 | Ga0207707_10000381 | Ga0207707_1000038130 | 150 |
| 377 | 3300025912 | Ga0207707_10038137 | Ga0207707_100381374 | 150 |
| 378 | 3300025913 | Ga0207695_10000429 | Ga0207695_1000042918 | 150 |
| 379 | 3300025913 | Ga0207695_10036629 | Ga0207695_100366292 | 150 |
| 380 | 3300025913 | Ga0207695_10076011 | Ga0207695_100760112 | 150 |
| 381 | 3300025913 | Ga0207695_10227547 | Ga0207695_102275472 | 150 |
| 382 | 3300025913 | Ga0207695_10344111 | Ga0207695_103441112 | 150 |
| 383 | 3300025913 | Ga0207695_10884654 | Ga0207695_108846542 | 150 |
| 384 | 3300025914 | Ga0207671_10006678 | Ga0207671_100066782 | 150 |
| 385 | 3300025914 | Ga0207671_10030086 | Ga0207671_100300864 | 150 |
| 386 | 3300025914 | Ga0207671_10656899 | Ga0207671_106568991 | 150 |
| 387 | 3300025915 | Ga0207693_10012494 | Ga0207693_100124942 | 150 |
| 388 | 3300025915 | Ga0207693_10179760 | Ga0207693_101797601 | 150 |
| 389 | 3300025917 | Ga0207660_10001000 | Ga0207660_100010006 | 150 |
| 390 | 3300025917 | Ga0207660_10230057 | Ga0207660_102300571 | 150 |
| 391 | 3300025917 | Ga0207660_10419730 | Ga0207660_104197302 | 150 |
| 392 | 3300025919 | Ga0207657_10000999 | Ga0207657_1000099911 | 150 |
| 393 | 3300025919 | Ga0207657_10003720 | Ga0207657_100037204 | 150 |
| 394 | 3300025919 | Ga0207657_10012289 | Ga0207657_100122894 | 150 |
| 395 | 3300025920 | Ga0207649_10028628 | Ga0207649_100286283 | 150 |
| 396 | 3300025921 | Ga0207652_10001277 | Ga0207652_1000127710 | 150 |
| 397 | 3300025921 | Ga0207652_10055493 | Ga0207652_100554932 | 150 |
| 398 | 3300025921 | Ga0207652_11083475 | Ga0207652_110834752 | 150 |
| 399 | 3300025922 | Ga0207646_10110086 | Ga0207646_101100862 | 150 |
| 400 | 3300025922 | Ga0207646_10160356 | Ga0207646_101603562 | 150 |
| 401 | 3300025923 | Ga0207681_10594427 | Ga0207681_105944271 | 150 |
| 402 | 3300025923 | Ga0207681_10691055 | Ga0207681_106910551 | 150 |
| 403 | 3300025924 | Ga0207694_10000359 | Ga0207694_1000035918 | 150 |
| 404 | 3300025924 | Ga0207694_10024718 | Ga0207694_100247183 | 150 |
| 405 | 3300025924 | Ga0207694_10536881 | Ga0207694_105368812 | 150 |
| 406 | 3300025924 | Ga0207694_10989758 | Ga0207694_109897581 | 150 |
| 407 | 3300025925 | Ga0207650_10061875 | Ga0207650_100618752 | 150 |
| 408 | 3300025928 | Ga0207700_10258875 | Ga0207700_102588752 | 150 |
| 409 | 3300025928 | Ga0207700_10338994 | Ga0207700_103389942 | 150 |
| 410 | 3300025928 | Ga0207700_10354379 | Ga0207700_103543792 | 150 |
| 411 | 3300025928 | Ga0207700_10515401 | Ga0207700_105154011 | 150 |
| 412 | 3300025928 | Ga0207700_11610333 | Ga0207700_116103331 | 150 |
| 413 | 3300025929 | Ga0207664_10095101 | Ga0207664_100951012 | 150 |
| 414 | 3300025929 | Ga0207664_10194238 | Ga0207664_101942382 | 150 |
| 415 | 3300025931 | Ga0207644_10226051 | Ga0207644_102260512 | 150 |
| 416 | 3300025932 | Ga0207690_10024960 | Ga0207690_100249602 | 150 |
| 417 | 3300025932 | Ga0207690_10058242 | Ga0207690_100582422 | 150 |
| 418 | 3300025932 | Ga0207690_10315162 | Ga0207690_103151622 | 150 |
| 419 | 3300025932 | Ga0207690_10737849 | Ga0207690_107378492 | 150 |
| 420 | 3300025933 | Ga0207706_10062308 | Ga0207706_100623082 | 150 |
| 421 | 3300025933 | Ga0207706_10085280 | Ga0207706_100852802 | 150 |
| 422 | 3300025935 | Ga0207709_10041320 | Ga0207709_100413203 | 150 |
| 423 | 3300025935 | Ga0207709_10298479 | Ga0207709_102984791 | 150 |
| 424 | 3300025938 | Ga0207704_10891445 | Ga0207704_108914451 | 150 |
| 425 | 3300025938 | Ga0207704_11686589 | Ga0207704_116865891 | 150 |
| 426 | 3300025939 | Ga0207665_10002228 | Ga0207665_1000222810 | 150 |
| 427 | 3300025939 | Ga0207665_10496271 | Ga0207665_104962712 | 150 |
| 428 | 3300025939 | Ga0207665_10633838 | Ga0207665_106338382 | 150 |
| 429 | 3300025939 | Ga0207665_11317597 | Ga0207665_113175971 | 150 |
| 430 | 3300025941 | Ga0207711_10322251 | Ga0207711_103222511 | 150 |
| 431 | 3300025944 | Ga0207661_10008299 | Ga0207661_100082993 | 150 |
| 432 | 3300025944 | Ga0207661_10464889 | Ga0207661_104648891 | 150 |
| 433 | 3300025944 | Ga0207661_10767168 | Ga0207661_107671681 | 150 |
| 434 | 3300025945 | Ga0207679_10480848 | Ga0207679_104808481 | 150 |
| 435 | 3300025945 | Ga0207679_10866487 | Ga0207679_108664871 | 150 |
| 436 | 3300025949 | Ga0207667_10000028 | Ga0207667_10000028176 | 150 |
| 437 | 3300025949 | Ga0207667_10007770 | Ga0207667_100077703 | 150 |
| 438 | 3300025949 | Ga0207667_10013965 | Ga0207667_100139653 | 150 |
| 439 | 3300025949 | Ga0207667_10019832 | Ga0207667_100198326 | 150 |
| 440 | 3300025949 | Ga0207667_10049335 | Ga0207667_100493352 | 150 |
| 441 | 3300025949 | Ga0207667_10548572 | Ga0207667_105485721 | 150 |
| 442 | 3300025960 | Ga0207651_10461386 | Ga0207651_104613862 | 150 |
| 443 | 3300025972 | Ga0207668_10187751 | Ga0207668_101877512 | 150 |
| 444 | 3300025972 | Ga0207668_10258212 | Ga0207668_102582121 | 150 |
| 445 | 3300025981 | Ga0207640_10016150 | Ga0207640_100161501 | 150 |
| 446 | 3300025981 | Ga0207640_10091962 | Ga0207640_100919622 | 150 |
| 447 | 3300025981 | Ga0207640_10117685 | Ga0207640_101176852 | 150 |
| 448 | 3300025981 | Ga0207640_10246813 | Ga0207640_102468132 | 150 |
| 449 | 3300025981 | Ga0207640_10330806 | Ga0207640_103308061 | 150 |
| 450 | 3300025986 | Ga0207658_10119292 | Ga0207658_101192922 | 150 |
| 451 | 3300025986 | Ga0207658_10263531 | Ga0207658_102635312 | 150 |
| 452 | 3300025986 | Ga0207658_10664774 | Ga0207658_106647741 | 150 |
| 453 | 3300026023 | Ga0207677_10319476 | Ga0207677_103194762 | 150 |
| 454 | 3300026023 | Ga0207677_10834059 | Ga0207677_108340591 | 150 |
| 455 | 3300026023 | Ga0207677_10849350 | Ga0207677_108493502 | 150 |
| 456 | 3300026023 | Ga0207677_11112435 | Ga0207677_111124352 | 150 |
| 457 | 3300026035 | Ga0207703_10376367 | Ga0207703_103763672 | 150 |
| 458 | 3300026041 | Ga0207639_10020183 | Ga0207639_100201834 | 150 |
| 459 | 3300026041 | Ga0207639_10027605 | Ga0207639_100276053 | 150 |
| 460 | 3300026041 | Ga0207639_10079803 | Ga0207639_100798033 | 150 |
| 461 | 3300026041 | Ga0207639_10182245 | Ga0207639_101822453 | 150 |
| 462 | 3300026067 | Ga0207678_10010157 | Ga0207678_100101573 | 150 |
| 463 | 3300026067 | Ga0207678_10039882 | Ga0207678_100398823 | 150 |
| 464 | 3300026067 | Ga0207678_10247950 | Ga0207678_102479502 | 150 |
| 465 | 3300026067 | Ga0207678_10375537 | Ga0207678_103755372 | 150 |
| 466 | 3300026078 | Ga0207702_10176335 | Ga0207702_101763352 | 150 |
| 467 | 3300026078 | Ga0207702_10227369 | Ga0207702_102273692 | 150 |
| 468 | 3300026078 | Ga0207702_10438161 | Ga0207702_104381612 | 150 |
| 469 | 3300026078 | Ga0207702_10641435 | Ga0207702_106414351 | 150 |
| 470 | 3300026089 | Ga0207648_10049091 | Ga0207648_100490913 | 150 |
| 471 | 3300026089 | Ga0207648_10727135 | Ga0207648_107271352 | 150 |
| 472 | 3300026095 | Ga0207676_10233716 | Ga0207676_102337162 | 150 |
| 473 | 3300026116 | Ga0207674_10007352 | Ga0207674_1000735211 | 150 |
| 474 | 3300026116 | Ga0207674_10142181 | Ga0207674_101421813 | 150 |
| 475 | 3300026116 | Ga0207674_10177022 | Ga0207674_101770222 | 150 |
| 476 | 3300026116 | Ga0207674_10181324 | Ga0207674_101813242 | 150 |
| 477 | 3300026116 | Ga0207674_10443322 | Ga0207674_104433222 | 150 |
| 478 | 3300026118 | Ga0207675_100762838 | Ga0207675_1007628382 | 150 |
| 479 | 3300026118 | Ga0207675_101021671 | Ga0207675_1010216712 | 150 |
| 480 | 3300026121 | Ga0207683_11197858 | Ga0207683_111978581 | 150 |
| 481 | 3300026142 | Ga0207698_10142144 | Ga0207698_101421442 | 150 |
| 482 | 3300026142 | Ga0207698_10330629 | Ga0207698_103306291 | 150 |
| 483 | 3300026142 | Ga0207698_10349852 | Ga0207698_103498522 | 150 |
| 484 | 3300026142 | Ga0207698_11108819 | Ga0207698_111088192 | 150 |
| 485 | 3300026142 | Ga0207698_11151460 | Ga0207698_111514602 | 150 |
| 486 | 3300026142 | Ga0207698_11421351 | Ga0207698_114213511 | 150 |
| 487 | 3300027111 | Ga0209281_1039075 | Ga0209281_10390751 | 150 |
| 488 | 3300027296 | Ga0209389_1000133 | Ga0209389_100013338 | 150 |
| 489 | 3300027296 | Ga0209389_1000413 | Ga0209389_10004136 | 150 |
| 490 | 3300027357 | Ga0209589_1010310 | Ga0209589_10103106 | 150 |
| 491 | 3300027361 | Ga0209489_100597 | Ga0209489_10059794 | 150 |
| 492 | 3300027361 | Ga0209489_115313 | Ga0209489_1153131 | 150 |
| 493 | 3300027363 | Ga0209700_100005 | Ga0209700_100005542 | 150 |
| 494 | 3300027512 | Ga0209179_1001501 | Ga0209179_10015013 | 150 |
| 495 | 3300027512 | Ga0209179_1041374 | Ga0209179_10413742 | 150 |
| 496 | 3300027671 | Ga0209588_1142764 | Ga0209588_11427641 | 150 |
| 497 | 3300027866 | Ga0209813_10004408 | Ga0209813_100044083 | 150 |
| 498 | 3300028379 | Ga0268266_10087499 | Ga0268266_100874992 | 150 |
| 499 | 3300028380 | Ga0268265_10024179 | Ga0268265_100241793 | 150 |
| 500 | 3300028794 | Ga0307515_10348776 | Ga0307515_103487762 | 150 |
| 501 | 3300030763 | Ga0265763_1005534 | Ga0265763_10055341 | 150 |
| 502 | 3300031247 | Ga0265340_10222850 | Ga0265340_102228502 | 150 |
| 503 | 3300031249 | Ga0265339_10013672 | Ga0265339_100136721 | 150 |
| 504 | 3300031250 | Ga0265331_10027370 | Ga0265331_100273703 | 150 |
| 505 | 3300031456 | Ga0307513_10834302 | Ga0307513_108343021 | 150 |
| 506 | 3300031616 | Ga0307508_10003734 | Ga0307508_100037346 | 150 |
| 507 | 3300031616 | Ga0307508_10103129 | Ga0307508_101031292 | 150 |
| 508 | 3300031616 | Ga0307508_10358559 | Ga0307508_103585592 | 150 |
| 509 | 3300031616 | Ga0307508_10470208 | Ga0307508_104702082 | 150 |
| 510 | 3300031616 | Ga0307508_10690803 | Ga0307508_106908032 | 150 |
| 511 | 3300031649 | Ga0307514_10006880 | Ga0307514_100068803 | 150 |
| 512 | 3300031711 | Ga0265314_10044600 | Ga0265314_100446003 | 150 |
| 513 | 3300031711 | Ga0265314_10094825 | Ga0265314_100948252 | 150 |
| 514 | 3300031712 | Ga0265342_10465326 | Ga0265342_104653262 | 150 |
| 515 | 3300031727 | Ga0316576_10685720 | Ga0316576_106857202 | 150 |
| 516 | 3300031730 | Ga0307516_10062391 | Ga0307516_100623914 | 150 |
| 517 | 3300031901 | Ga0307406_10119306 | Ga0307406_101193062 | 150 |
| 518 | 3300031911 | Ga0307412_10041808 | Ga0307412_100418081 | 150 |
| 519 | 3300031911 | Ga0307412_10291613 | Ga0307412_102916132 | 150 |
| 520 | 3300032002 | Ga0307416_100340513 | Ga0307416_1003405132 | 150 |
| 521 | 3300032002 | Ga0307416_100660374 | Ga0307416_1006603742 | 150 |
| 522 | 3300032002 | Ga0307416_100901528 | Ga0307416_1009015282 | 150 |
| 523 | 3300032004 | Ga0307414_10259224 | Ga0307414_102592242 | 150 |
| 524 | 3300032004 | Ga0307414_10484465 | Ga0307414_104844652 | 150 |
| 525 | 3300033180 | Ga0307510_10339666 | Ga0307510_103396662 | 150 |
| 526 | 3300034820 | Ga0373959_0009197 | Ga0373959_0009197_595_1050 | 150 |
| 527 | 3300035090 | Ga0373949_0216107 | Ga0373949_0216107_44_499 | 150 |
| 528 | 3300035112 | Ga0373932_0147338 | Ga0373932_0147338_67_525 | 150 |
| 529 | 3300035115 | Ga0373941_0082754 | Ga0373941_0082754_39_494 | 150 |
| 530 | 3300035171 | Ga0373946_0567826 | Ga0373946_0567826_61_516 | 150 |
| 531 | 3300035242 | Ga0373962_0295430 | Ga0373962_0295430_12_467 | 150 |
| 532 | 3300035691 | Ga0373931_0162798 | Ga0373931_0162798_377_832 | 150 |
| 533 | 3300035695 | Ga0373927_0936865 | Ga0373927_0936865_26_481 | 150 |
| 534 | 3300035725 | Ga0373947_0166522 | Ga0373947_0166522_422_877 | 150 |
| 535 | 3300036401 | Ga0373937_1016648 | Ga0373937_1016648_197_652 | 150 |
| 536 | 3300037312 | Ga0395899_0033659 | Ga0395899_0033659_2366_2818 | 150 |
| 537 | 3300037312 | Ga0395899_0179017 | Ga0395899_0179017_658_1122 | 150 |
| 538 | 3300037418 | Ga0395900_0010175 | Ga0395900_0010175_7634_8089 | 150 |
| 539 | 3300037418 | Ga0395900_0021195 | Ga0395900_0021195_4439_4903 | 150 |
| 540 | 3300037418 | Ga0395900_0061122 | Ga0395900_0061122_1770_2222 | 150 |
| 541 | 3300037418 | Ga0395900_0686687 | Ga0395900_0686687_454_906 | 150 |
| 542 | 3300037418 | Ga0395900_1655355 | Ga0395900_1655355_25_477 | 150 |
| 543 | 3300037466 | Ga0395898_0003446 | Ga0395898_0003446_16991_17446 | 150 |
| 544 | 3300037466 | Ga0395898_0370117 | Ga0395898_0370117_703_1155 | 150 |
| 545 | 3300037466 | Ga0395898_0644073 | Ga0395898_0644073_355_807 | 150 |
| 546 | 3300037466 | Ga0395898_0806606 | Ga0395898_0806606_30_482 | 150 |
| 547 | 3300037466 | Ga0395898_1242883 | Ga0395898_1242883_198_650 | 150 |
| 548 | 3300037471 | Ga0395905_0012360 | Ga0395905_0012360_1975_2499 | 150 |
| 549 | 3300037471 | Ga0395905_0034815 | Ga0395905_0034815_1877_2341 | 150 |
| 550 | 3300037471 | Ga0395905_0064359 | Ga0395905_0064359_1864_2316 | 150 |
| 551 | 3300037471 | Ga0395905_0100041 | Ga0395905_0100041_446_901 | 150 |
| 552 | 3300037471 | Ga0395905_0400904 | Ga0395905_0400904_734_1186 | 150 |
| 553 | 3300037853 | Ga0436364_1043978 | Ga0436364_1043978_784_1242 | 150 |
| 554 | 3300038443 | Ga0395901_0028854 | Ga0395901_0028854_2655_3107 | 150 |
| 555 | 3300038443 | Ga0395901_0113628 | Ga0395901_0113628_2114_2569 | 150 |
| 556 | 3300038443 | Ga0395901_0227589 | Ga0395901_0227589_1152_1604 | 150 |
| 557 | 3300038443 | Ga0395901_0277583 | Ga0395901_0277583_743_1195 | 150 |
| 558 | 3300038443 | Ga0395901_1395843 | Ga0395901_1395843_73_528 | 150 |
| 559 | 3300039437 | Ga0436365_0043975 | Ga0436365_0043975_5709_6161 | 150 |
| 560 | 3300039437 | Ga0436365_0178950 | Ga0436365_0178950_751_1206 | 150 |
| 561 | 3300039437 | Ga0436365_0214722 | Ga0436365_0214722_47_502 | 150 |
| 562 | 3300039437 | Ga0436365_0355981 | Ga0436365_0355981_56_511 | 150 |
| 563 | 3300039437 | Ga0436365_0535444 | Ga0436365_0535444_6536_6991 | 150 |
| 564 | 3300039450 | Ga0436363_1382020 | Ga0436363_1382020_427_882 | 150 |
| 565 | 3300039450 | Ga0436363_1579194 | Ga0436363_1579194_24_479 | 150 |
| 566 | 3300039453 | Ga0436362_0295315 | Ga0436362_0295315_1006_1461 | 150 |
| 567 | 3300041413 | Ga0439465_0060268 | Ga0439465_0060268_457_912 | 150 |
| 568 | 3300041459 | Ga0451800_0863443 | Ga0451800_0863443_64_516 | 150 |
| 569 | 3300041486 | Ga0451807_0539834 | Ga0451807_0539834_462_914 | 150 |
| 570 | 3300041498 | Ga0451841_1174930 | Ga0451841_1174930_474_926 | 150 |
| 571 | 3300041501 | Ga0451845_0600722 | Ga0451845_0600722_33_491 | 150 |
| 572 | 3300041507 | Ga0451851_0264887 | Ga0451851_0264887_14_472 | 150 |
| 573 | 3300041511 | Ga0451855_0979810 | Ga0451855_0979810_31_483 | 150 |
| 574 | 3300042004 | Ga0439445_0009835 | Ga0439445_0009835_1713_2168 | 150 |
| 575 | 3300042157 | Ga0439458_0136884 | Ga0439458_0136884_44_496 | 150 |
| 576 | 3300042436 | Ga0439435_0022532 | Ga0439435_0022532_451_903 | 150 |
| 577 | 3300044656 | Ga0466969_0046480 | Ga0466969_0046480_507_962 | 150 |
| 578 | 3300044656 | Ga0466969_0107149 | Ga0466969_0107149_790_1248 | 150 |
| 579 | 3300044658 | Ga0466972_0011625 | Ga0466972_0011625_1171_1626 | 150 |
| 580 | 3300044683 | Ga0466965_0140152 | Ga0466965_0140152_222_704 | 150 |
| 581 | 3300044684 | Ga0466966_0012361 | Ga0466966_0012361_3799_4257 | 150 |
| 582 | 3300044684 | Ga0466966_0222152 | Ga0466966_0222152_588_1043 | 150 |
| 583 | 3300044684 | Ga0466966_0227195 | Ga0466966_0227195_522_1004 | 150 |
| 584 | 3300044693 | Ga0466961_0078529 | Ga0466961_0078529_122_604 | 150 |
| 585 | 3300044693 | Ga0466961_0142208 | Ga0466961_0142208_34_516 | 150 |
| 586 | 3300044693 | Ga0466961_0202182 | Ga0466961_0202182_80_535 | 150 |
| 587 | 3300044694 | Ga0466963_0025561 | Ga0466963_0025561_1670_2152 | 150 |
| 588 | 3300044694 | Ga0466963_0528727 | Ga0466963_0528727_318_773 | 150 |
| 589 | 3300044706 | Ga0466964_0538817 | Ga0466964_0538817_35_517 | 150 |
| 590 | 3300044719 | Ga0466971_0012181 | Ga0466971_0012181_3251_3733 | 150 |
| 591 | 3300044735 | Ga0466968_0009013 | Ga0466968_0009013_2379_2834 | 150 |
| 592 | 3300044765 | Ga0466970_0016296 | Ga0466970_0016296_280_762 | 150 |
| 593 | 3300044765 | Ga0466970_0068776 | Ga0466970_0068776_816_1271 | 150 |
| 594 | 3300044765 | Ga0466970_0525544 | Ga0466970_0525544_201_653 | 150 |
| 595 | 3300044842 | Ga0466957_0002214 | Ga0466957_0002214_5675_6157 | 150 |
| 596 | 3300044842 | Ga0466957_0030036 | Ga0466957_0030036_820_1275 | 150 |
| 597 | 3300044842 | Ga0466957_0503463 | Ga0466957_0503463_371_826 | 150 |
| 598 | 3300044901 | Ga0466960_0030155 | Ga0466960_0030155_1558_2013 | 150 |
| 599 | 3300045049 | Ga0466959_0020527 | Ga0466959_0020527_2446_2901 | 150 |
| 600 | 3300045049 | Ga0466959_0044660 | Ga0466959_0044660_703_1185 | 150 |
| 601 | 3300045049 | Ga0466959_0282418 | Ga0466959_0282418_537_995 | 150 |
| 602 | 3300045049 | Ga0466959_0510055 | Ga0466959_0510055_253_708 | 150 |
| 603 | 3300045836 | Ga0466958_0162432 | Ga0466958_0162432_758_1216 | 150 |
| 604 | 3300045836 | Ga0466958_0400990 | Ga0466958_0400990_282_764 | 150 |
| 605 | 3300045976 | Ga0466967_0053350 | Ga0466967_0053350_2559_3014 | 150 |
| 606 | 3300045976 | Ga0466967_0104657 | Ga0466967_0104657_786_1238 | 150 |
| 607 | 3300045976 | Ga0466967_0304118 | Ga0466967_0304118_574_1056 | 150 |
| 608 | 3300046454 | Ga0495592_0860419 | Ga0495592_0860419_65_520 | 150 |
| 609 | 3300046455 | Ga0495603_0446212 | Ga0495603_0446212_155_610 | 150 |
| 610 | 3300046459 | Ga0495629_0352881 | Ga0495629_0352881_145_597 | 150 |
| 611 | 3300046459 | Ga0495629_0503033 | Ga0495629_0503033_152_604 | 150 |
| 612 | 3300046460 | Ga0495638_0006956 | Ga0495638_0006956_2112_2567 | 150 |
| 613 | 3300046460 | Ga0495638_0021201 | Ga0495638_0021201_523_975 | 150 |
| 614 | 3300046460 | Ga0495638_0338042 | Ga0495638_0338042_213_671 | 150 |
| 615 | 3300046461 | Ga0495641_0343052 | Ga0495641_0343052_25_480 | 150 |
| 616 | 3300046472 | Ga0495580_0668337 | Ga0495580_0668337_188_643 | 150 |
| 617 | 3300046473 | Ga0495582_0492145 | Ga0495582_0492145_149_601 | 150 |
| 618 | 3300046474 | Ga0495605_0185877 | Ga0495605_0185877_123_578 | 150 |
| 619 | 3300046491 | Ga0495584_0051802 | Ga0495584_0051802_431_886 | 150 |
| 620 | 3300046492 | Ga0495585_0012196 | Ga0495585_0012196_4132_4587 | 150 |
| 621 | 3300046506 | Ga0495583_0095423 | Ga0495583_0095423_141_593 | 150 |
| 622 | 3300046507 | Ga0495606_0000070 | Ga0495606_0000070_106310_106762 | 150 |
| 623 | 3300046512 | Ga0495610_0059335 | Ga0495610_0059335_232_684 | 150 |
| 624 | 3300046512 | Ga0495610_0156215 | Ga0495610_0156215_385_837 | 150 |
| 625 | 3300046513 | Ga0495616_0000338 | Ga0495616_0000338_21292_21744 | 150 |
| 626 | 3300046513 | Ga0495616_0167596 | Ga0495616_0167596_39_494 | 150 |
| 627 | 3300046515 | Ga0495620_0108176 | Ga0495620_0108176_458_910 | 150 |
| 628 | 3300046517 | Ga0495630_0026824 | Ga0495630_0026824_1409_1864 | 150 |
| 629 | 3300046518 | Ga0495631_0000163 | Ga0495631_0000163_20824_21276 | 150 |
| 630 | 3300046518 | Ga0495631_0086528 | Ga0495631_0086528_74_529 | 150 |
| 631 | 3300046520 | Ga0495637_0006808 | Ga0495637_0006808_1237_1689 | 150 |
| 632 | 3300046522 | Ga0495643_0167270 | Ga0495643_0167270_134_589 | 150 |
| 633 | 3300046523 | Ga0495644_0338533 | Ga0495644_0338533_116_571 | 150 |
| 634 | 3300046530 | Ga0495654_0002141 | Ga0495654_0002141_2307_2759 | 150 |
| 635 | 3300046533 | Ga0495640_0910926 | Ga0495640_0910926_41_496 | 150 |
| 636 | 3300046535 | Ga0495586_0456299 | Ga0495586_0456299_137_592 | 150 |
| 637 | 3300046537 | Ga0495598_0075357 | Ga0495598_0075357_94_549 | 150 |
| 638 | 3300046538 | Ga0495609_0240161 | Ga0495609_0240161_222_677 | 150 |
| 639 | 3300046539 | Ga0495621_0007800 | Ga0495621_0007800_2194_2646 | 150 |
| 640 | 3300046542 | Ga0495597_0091226 | Ga0495597_0091226_547_1002 | 150 |
| 641 | 3300046543 | Ga0495645_0317356 | Ga0495645_0317356_288_743 | 150 |
| 642 | 3300046557 | Ga0495622_0180822 | Ga0495622_0180822_398_850 | 150 |
| 643 | 3300046616 | Ga0495668_0273429 | Ga0495668_0273429_123_578 | 150 |
| 644 | 3300046648 | Ga0495611_0036796 | Ga0495611_0036796_1239_1691 | 150 |
| 645 | 3300046660 | Ga0495625_0030946 | Ga0495625_0030946_635_1087 | 150 |
| 646 | 3300046664 | Ga0495659_0166893 | Ga0495659_0166893_262_717 | 150 |
| 647 | 3300046665 | Ga0495661_0086570 | Ga0495661_0086570_182_637 | 150 |
| 648 | 3300046674 | Ga0495588_0047906 | Ga0495588_0047906_1100_1552 | 150 |
| 649 | 3300046674 | Ga0495588_0353023 | Ga0495588_0353023_154_606 | 150 |
| 650 | 3300046674 | Ga0495588_0583363 | Ga0495588_0583363_114_569 | 150 |
| 651 | 3300046683 | Ga0495658_0647497 | Ga0495658_0647497_103_555 | 150 |
| 652 | 3300046684 | Ga0495669_0407217 | Ga0495669_0407217_144_599 | 150 |
| 653 | 3300046690 | Ga0495624_0146398 | Ga0495624_0146398_864_1316 | 150 |
| 654 | 3300046690 | Ga0495624_0358164 | Ga0495624_0358164_304_759 | 150 |
| 655 | 3300046691 | Ga0495670_0238839 | Ga0495670_0238839_212_667 | 150 |
| 656 | 3300046692 | Ga0495671_0020470 | Ga0495671_0020470_2020_2472 | 150 |
| 657 | 3300046810 | Ga0495660_0065191 | Ga0495660_0065191_1380_1832 | 150 |
| 658 | 3300046810 | Ga0495660_0149755 | Ga0495660_0149755_539_991 | 150 |
| 659 | 3300046810 | Ga0495660_0322823 | Ga0495660_0322823_107_562 | 150 |
| 660 | 3300047318 | Ga0495636_0399963 | Ga0495636_0399963_34_489 | 150 |
| 661 | 3300047319 | Ga0495674_0021627 | Ga0495674_0021627_4612_5157 | 150 |
| 662 | 3300047320 | Ga0495672_0280902 | Ga0495672_0280902_223_681 | 150 |
| 663 | 3300047321 | Ga0495676_0126961 | Ga0495676_0126961_760_1212 | 150 |
| 664 | 3300047323 | Ga0495683_0146029 | Ga0495683_0146029_12_467 | 150 |
| 665 | 3300047469 | Ga0495673_0325341 | Ga0495673_0325341_15_470 | 150 |
| 666 | 3300047472 | Ga0495686_0000841 | Ga0495686_0000841_7389_7841 | 150 |
| 667 | 3300047472 | Ga0495686_0016462 | Ga0495686_0016462_3123_3575 | 150 |
| 668 | 3300047472 | Ga0495686_0061464 | Ga0495686_0061464_363_818 | 150 |
| 669 | 3300047472 | Ga0495686_0069679 | Ga0495686_0069679_1200_1652 | 150 |
| 670 | 3300047472 | Ga0495686_0236830 | Ga0495686_0236830_488_946 | 150 |
| 671 | 3300047673 | Ga0495593_0068780 | Ga0495593_0068780_757_1209 | 150 |
| 672 | 3300048089 | Ga0495614_0117617 | Ga0495614_0117617_113_565 | 150 |
| 673 | 3300048091 | Ga0495626_0116626 | Ga0495626_0116626_62_517 | 150 |
| 674 | 3300048903 | Ga0496100_0244298 | Ga0496100_0244298_477_932 | 150 |
| 675 | 3300048903 | Ga0496100_0374886 | Ga0496100_0374886_546_998 | 150 |
| 676 | 3300048903 | Ga0496100_1084555 | Ga0496100_1084555_133_588 | 150 |
| 677 | 3300048903 | Ga0496100_1204923 | Ga0496100_1204923_31_486 | 150 |
| 678 | 3300048904 | Ga0496101_0015961 | Ga0496101_0015961_2127_2579 | 150 |
| 679 | 3300048904 | Ga0496101_0152226 | Ga0496101_0152226_1095_1550 | 150 |
| 680 | 3300048904 | Ga0496101_0373053 | Ga0496101_0373053_614_1069 | 150 |
| 681 | 3300048905 | Ga0496102_0012441 | Ga0496102_0012441_5958_6413 | 150 |
| 682 | 3300048905 | Ga0496102_0366272 | Ga0496102_0366272_617_1099 | 150 |
| 683 | 3300048905 | Ga0496102_0837433 | Ga0496102_0837433_161_616 | 150 |
| 684 | 3300048907 | Ga0496104_0623015 | Ga0496104_0623015_303_758 | 150 |
| 685 | 3300048908 | Ga0496105_0117753 | Ga0496105_0117753_584_1039 | 150 |
| 686 | 3300048909 | Ga0496106_0472082 | Ga0496106_0472082_519_974 | 150 |
| 687 | 3300048910 | Ga0496107_0761904 | Ga0496107_0761904_45_497 | 150 |
| 688 | 3300048910 | Ga0496107_0944835 | Ga0496107_0944835_97_552 | 150 |
| 689 | 3300048911 | Ga0496108_0044497 | Ga0496108_0044497_2288_2743 | 150 |
| 690 | 3300048911 | Ga0496108_0146790 | Ga0496108_0146790_526_981 | 150 |
| 691 | 3300048912 | Ga0496109_0023980 | Ga0496109_0023980_4477_4932 | 150 |
| 692 | 3300048912 | Ga0496109_0928889 | Ga0496109_0928889_26_481 | 150 |
| 693 | 3300048913 | Ga0496110_0315646 | Ga0496110_0315646_738_1193 | 150 |
| 694 | 3300048914 | Ga0496111_0072814 | Ga0496111_0072814_124_579 | 150 |
| 695 | 3300048915 | Ga0496112_0001369 | Ga0496112_0001369_8800_9255 | 150 |
| 696 | 3300048915 | Ga0496112_0868689 | Ga0496112_0868689_142_597 | 150 |
| 697 | 3300048916 | Ga0496113_0026637 | Ga0496113_0026637_485_940 | 150 |
| 698 | 3300048917 | Ga0496114_0267821 | Ga0496114_0267821_477_932 | 150 |
| 699 | 3300048918 | Ga0496115_0617839 | Ga0496115_0617839_121_573 | 150 |
| 700 | 3300048918 | Ga0496115_0862248 | Ga0496115_0862248_115_570 | 150 |
| 701 | 3300048919 | Ga0496116_0213092 | Ga0496116_0213092_261_713 | 150 |
| 702 | 3300048920 | Ga0496117_0075201 | Ga0496117_0075201_699_1151 | 150 |
| 703 | 3300048921 | Ga0496118_0027891 | Ga0496118_0027891_3434_3889 | 150 |
| 704 | 3300048921 | Ga0496118_0040951 | Ga0496118_0040951_1891_2343 | 150 |
| 705 | 3300048922 | Ga0496119_0050269 | Ga0496119_0050269_1366_1818 | 150 |
| 706 | 3300048922 | Ga0496119_0210886 | Ga0496119_0210886_177_632 | 150 |
| 707 | 3300048923 | Ga0496120_0162739 | Ga0496120_0162739_109_564 | 150 |
| 708 | 3300048924 | Ga0496121_0162838 | Ga0496121_0162838_856_1311 | 150 |
| 709 | 3300048925 | Ga0496122_0086918 | Ga0496122_0086918_67_519 | 150 |
| 710 | 3300048925 | Ga0496122_0147041 | Ga0496122_0147041_580_1032 | 150 |
| 711 | 3300048925 | Ga0496122_0399114 | Ga0496122_0399114_146_601 | 150 |
| 712 | 3300048926 | Ga0496123_0036494 | Ga0496123_0036494_2272_2724 | 150 |
| 713 | 3300048926 | Ga0496123_0163448 | Ga0496123_0163448_509_961 | 150 |
| 714 | 3300048927 | Ga0496124_0076778 | Ga0496124_0076778_672_1124 | 150 |
| 715 | 3300048927 | Ga0496124_0141331 | Ga0496124_0141331_373_825 | 150 |
| 716 | 3300048927 | Ga0496124_0393517 | Ga0496124_0393517_19_474 | 150 |
| 717 | 3300048928 | Ga0496125_0061820 | Ga0496125_0061820_2062_2517 | 150 |
| 718 | 3300048928 | Ga0496125_0156338 | Ga0496125_0156338_1070_1522 | 150 |
| 719 | 3300048929 | Ga0496126_0003228 | Ga0496126_0003228_13045_13509 | 150 |
| 720 | 3300048929 | Ga0496126_0105058 | Ga0496126_0105058_1318_1770 | 150 |
| 721 | 3300049568 | Ga0501031_0090667 | Ga0501031_0090667_320_775 | 150 |
| 722 | 3300049568 | Ga0501031_0495842 | Ga0501031_0495842_280_732 | 150 |
| 723 | 3300049569 | Ga0501032_0003313 | Ga0501032_0003313_4173_4625 | 150 |
| 724 | 3300049569 | Ga0501032_0171964 | Ga0501032_0171964_608_1063 | 150 |
| 725 | 3300049569 | Ga0501032_0175532 | Ga0501032_0175532_457_915 | 150 |
| 726 | 3300049569 | Ga0501032_0182178 | Ga0501032_0182178_172_627 | 150 |
| 727 | 3300049569 | Ga0501032_0220955 | Ga0501032_0220955_516_971 | 150 |
| 728 | 3300049569 | Ga0501032_0391828 | Ga0501032_0391828_22_477 | 150 |
| 729 | 3300049569 | Ga0501032_0730748 | Ga0501032_0730748_28_480 | 150 |
| 730 | 3300049570 | Ga0501033_0003150 | Ga0501033_0003150_11852_12304 | 150 |
| 731 | 3300049570 | Ga0501033_0019795 | Ga0501033_0019795_1292_1744 | 150 |
| 732 | 3300049570 | Ga0501033_0041579 | Ga0501033_0041579_2024_2476 | 150 |
| 733 | 3300049570 | Ga0501033_0217898 | Ga0501033_0217898_148_648 | 150 |
| 734 | 3300049570 | Ga0501033_0808820 | Ga0501033_0808820_100_555 | 150 |
| 735 | 3300049571 | Ga0501034_0154717 | Ga0501034_0154717_943_1398 | 150 |
| 736 | 3300049571 | Ga0501034_0313426 | Ga0501034_0313426_676_1128 | 150 |
| 737 | 3300049571 | Ga0501034_0423723 | Ga0501034_0423723_28_483 | 150 |
| 738 | 3300049571 | Ga0501034_0751190 | Ga0501034_0751190_45_497 | 150 |
| 739 | 3300049571 | Ga0501034_1056850 | Ga0501034_1056850_216_671 | 150 |
| 740 | 3300049572 | Ga0501036_0125883 | Ga0501036_0125883_1360_1815 | 150 |
| 741 | 3300049572 | Ga0501036_0132931 | Ga0501036_0132931_1479_1931 | 150 |
| 742 | 3300049572 | Ga0501036_0271533 | Ga0501036_0271533_328_825 | 150 |
| 743 | 3300049573 | Ga0501037_0000253 | Ga0501037_0000253_31284_31736 | 150 |
| 744 | 3300049573 | Ga0501037_0109735 | Ga0501037_0109735_1232_1684 | 150 |
| 745 | 3300049573 | Ga0501037_0120562 | Ga0501037_0120562_78_530 | 150 |
| 746 | 3300049573 | Ga0501037_0131266 | Ga0501037_0131266_781_1236 | 150 |
| 747 | 3300049574 | Ga0501038_0133674 | Ga0501038_0133674_570_1022 | 150 |
| 748 | 3300049574 | Ga0501038_0484681 | Ga0501038_0484681_367_909 | 150 |
| 749 | 3300049575 | Ga0501039_0189303 | Ga0501039_0189303_807_1262 | 150 |
| 750 | 3300049575 | Ga0501039_0248974 | Ga0501039_0248974_562_1014 | 150 |
| 751 | 3300049579 | Ga0501043_0000100 | Ga0501043_0000100_16610_17062 | 150 |
| 752 | 3300049579 | Ga0501043_0023314 | Ga0501043_0023314_3392_3850 | 150 |
| 753 | 3300049579 | Ga0501043_0030141 | Ga0501043_0030141_3375_3830 | 150 |
| 754 | 3300049579 | Ga0501043_0031815 | Ga0501043_0031815_1334_1786 | 150 |
| 755 | 3300049579 | Ga0501043_0046356 | Ga0501043_0046356_29_529 | 150 |
| 756 | 3300049579 | Ga0501043_0157335 | Ga0501043_0157335_382_834 | 150 |
| 757 | 3300049579 | Ga0501043_0172300 | Ga0501043_0172300_33_485 | 150 |
| 758 | 3300049579 | Ga0501043_0189483 | Ga0501043_0189483_1046_1501 | 150 |
| 759 | 3300049579 | Ga0501043_0496323 | Ga0501043_0496323_112_564 | 150 |
| 760 | 3300049580 | Ga0501046_0390643 | Ga0501046_0390643_485_937 | 150 |
| 761 | 3300049580 | Ga0501046_0490132 | Ga0501046_0490132_227_682 | 150 |
| 762 | 3300049580 | Ga0501046_0562634 | Ga0501046_0562634_125_580 | 150 |
| 763 | 3300049581 | Ga0501047_0032207 | Ga0501047_0032207_1116_1568 | 150 |
| 764 | 3300049581 | Ga0501047_0056248 | Ga0501047_0056248_20_475 | 150 |
| 765 | 3300049581 | Ga0501047_0151679 | Ga0501047_0151679_464_916 | 150 |
| 766 | 3300049581 | Ga0501047_0272527 | Ga0501047_0272527_379_879 | 150 |
| 767 | 3300049582 | Ga0501048_0353955 | Ga0501048_0353955_28_483 | 150 |
| 768 | 3300049583 | Ga0501067_0026924 | Ga0501067_0026924_1409_1861 | 150 |
| 769 | 3300049583 | Ga0501067_0351789 | Ga0501067_0351789_300_758 | 150 |
| 770 | 3300049583 | Ga0501067_0542681 | Ga0501067_0542681_133_630 | 150 |
| 771 | 3300049583 | Ga0501067_0642945 | Ga0501067_0642945_105_560 | 150 |
| 772 | 3300049583 | Ga0501067_0721111 | Ga0501067_0721111_47_499 | 150 |
| 773 | 3300049584 | Ga0501068_0114351 | Ga0501068_0114351_951_1406 | 150 |
| 774 | 3300049585 | Ga0501069_0000020 | Ga0501069_0000020_91001_91453 | 150 |
| 775 | 3300049585 | Ga0501069_0008202 | Ga0501069_0008202_1655_2107 | 150 |
| 776 | 3300049585 | Ga0501069_0037791 | Ga0501069_0037791_1611_2063 | 150 |
| 777 | 3300049585 | Ga0501069_0062709 | Ga0501069_0062709_1122_1574 | 150 |
| 778 | 3300049585 | Ga0501069_0434782 | Ga0501069_0434782_131_586 | 150 |
| 779 | 3300049585 | Ga0501069_0724773 | Ga0501069_0724773_87_539 | 150 |
| 780 | 3300049586 | Ga0501070_0000193 | Ga0501070_0000193_40870_41322 | 150 |
| 781 | 3300049586 | Ga0501070_0000595 | Ga0501070_0000595_22269_22721 | 150 |
| 782 | 3300049586 | Ga0501070_0000836 | Ga0501070_0000836_18576_19028 | 150 |
| 783 | 3300049586 | Ga0501070_0005381 | Ga0501070_0005381_1598_2050 | 150 |
| 784 | 3300049586 | Ga0501070_0017885 | Ga0501070_0017885_1790_2245 | 150 |
| 785 | 3300049586 | Ga0501070_0130201 | Ga0501070_0130201_576_1031 | 150 |
| 786 | 3300049586 | Ga0501070_0500762 | Ga0501070_0500762_26_481 | 150 |
| 787 | 3300049586 | Ga0501070_0732138 | Ga0501070_0732138_65_517 | 150 |
| 788 | 3300049587 | Ga0501071_0145454 | Ga0501071_0145454_1271_1729 | 150 |
| 789 | 3300049587 | Ga0501071_0796822 | Ga0501071_0796822_104_556 | 150 |
| 790 | 3300049588 | Ga0501072_0732140 | Ga0501072_0732140_85_540 | 150 |
| 791 | 3300049589 | Ga0501073_0014669 | Ga0501073_0014669_3590_4045 | 150 |
| 792 | 3300049589 | Ga0501073_0044918 | Ga0501073_0044918_2423_2875 | 150 |
| 793 | 3300049589 | Ga0501073_0136308 | Ga0501073_0136308_1026_1478 | 150 |
| 794 | 3300049589 | Ga0501073_0847135 | Ga0501073_0847135_156_608 | 150 |
| 795 | 3300049590 | Ga0501074_0000063 | Ga0501074_0000063_37488_37940 | 150 |
| 796 | 3300049590 | Ga0501074_0092478 | Ga0501074_0092478_1652_2107 | 150 |
| 797 | 3300049590 | Ga0501074_0334729 | Ga0501074_0334729_573_1028 | 150 |
| 798 | 3300049590 | Ga0501074_0643287 | Ga0501074_0643287_124_576 | 150 |
| 799 | 3300049741 | Ga0501079_0156949 | Ga0501079_0156949_732_1184 | 150 |
| 800 | 3300049741 | Ga0501079_0530271 | Ga0501079_0530271_131_586 | 150 |
| 801 | 3300049741 | Ga0501079_1446052 | Ga0501079_1446052_59_514 | 150 |
| 802 | 3300049742 | Ga0501080_0004199 | Ga0501080_0004199_2596_3048 | 150 |
| 803 | 3300049742 | Ga0501080_0010754 | Ga0501080_0010754_7440_7892 | 150 |
| 804 | 3300049742 | Ga0501080_0053672 | Ga0501080_0053672_2478_2933 | 150 |
| 805 | 3300049742 | Ga0501080_0516665 | Ga0501080_0516665_427_924 | 150 |
| 806 | 3300049744 | Ga0501083_0000205 | Ga0501083_0000205_23267_23719 | 150 |
| 807 | 3300049744 | Ga0501083_0224427 | Ga0501083_0224427_178_633 | 150 |
| 808 | 3300049744 | Ga0501083_0346219 | Ga0501083_0346219_297_752 | 150 |
| 809 | 3300049744 | Ga0501083_0562403 | Ga0501083_0562403_251_703 | 150 |
| 810 | 3300049744 | Ga0501083_0911605 | Ga0501083_0911605_23_475 | 150 |
| 811 | 3300049822 | Ga0501035_0000070 | Ga0501035_0000070_31143_31595 | 150 |
| 812 | 3300049822 | Ga0501035_0001992 | Ga0501035_0001992_9799_10251 | 150 |
| 813 | 3300049822 | Ga0501035_0002240 | Ga0501035_0002240_5781_6233 | 150 |
| 814 | 3300049822 | Ga0501035_0018210 | Ga0501035_0018210_5202_5699 | 150 |
| 815 | 3300049822 | Ga0501035_0028327 | Ga0501035_0028327_15_530 | 150 |
| 816 | 3300049822 | Ga0501035_0189028 | Ga0501035_0189028_119_574 | 150 |
| 817 | 3300049822 | Ga0501035_0296803 | Ga0501035_0296803_654_1106 | 150 |
| 818 | 3300049823 | Ga0501044_0000037 | Ga0501044_0000037_23791_24243 | 150 |
| 819 | 3300049823 | Ga0501044_0023371 | Ga0501044_0023371_2782_3240 | 150 |
| 820 | 3300049823 | Ga0501044_0032505 | Ga0501044_0032505_2370_2822 | 150 |
| 821 | 3300049823 | Ga0501044_0051263 | Ga0501044_0051263_283_735 | 150 |
| 822 | 3300049823 | Ga0501044_0058214 | Ga0501044_0058214_543_995 | 150 |
| 823 | 3300049823 | Ga0501044_0061251 | Ga0501044_0061251_2715_3167 | 150 |
| 824 | 3300049823 | Ga0501044_0171458 | Ga0501044_0171458_476_991 | 150 |
| 825 | 3300049823 | Ga0501044_0243492 | Ga0501044_0243492_1202_1657 | 150 |
| 826 | 3300049823 | Ga0501044_0359298 | Ga0501044_0359298_419_874 | 150 |
| 827 | 3300049823 | Ga0501044_0398376 | Ga0501044_0398376_316_816 | 150 |
| 828 | 3300049823 | Ga0501044_0678625 | Ga0501044_0678625_404_859 | 150 |
| 829 | 3300049823 | Ga0501044_0913825 | Ga0501044_0913825_79_531 | 150 |
| 830 | 3300050490 | nmdc:mga03n38_815137_c1 | nmdc:mga03n38_815137_c1_32_484 | 150 |
| 831 | 3300050493 | nmdc:mga0k408_1222_c1 | nmdc:mga0k408_1222_c1_6494_6949 | 150 |
| 832 | 3300050493 | nmdc:mga0k408_17605_c2 | nmdc:mga0k408_17605_c2_131_679 | 150 |
| 833 | 3300050493 | nmdc:mga0k408_66221_c1 | nmdc:mga0k408_66221_c1_607_1059 | 150 |
| 834 | 3300050493 | nmdc:mga0k408_68564_c1 | nmdc:mga0k408_68564_c1_438_893 | 150 |
| 835 | 3300050493 | nmdc:mga0k408_80740_c1 | nmdc:mga0k408_80740_c1_684_1139 | 150 |
| 836 | 3300050494 | nmdc:mga06z11_42901_c1 | nmdc:mga06z11_42901_c1_38_586 | 150 |
| 837 | 3300050494 | nmdc:mga06z11_628342_c1 | nmdc:mga06z11_628342_c1_91_546 | 150 |
| 838 | 3300050495 | nmdc:mga04h51_132867_c1 | nmdc:mga04h51_132867_c1_307_762 | 150 |
| 839 | 3300050496 | nmdc:mga07m45_12323_c1 | nmdc:mga07m45_12323_c1_1249_1797 | 150 |
| 840 | 3300050496 | nmdc:mga07m45_12524_c1 | nmdc:mga07m45_12524_c1_2253_2705 | 150 |
| 841 | 3300050496 | nmdc:mga07m45_221124_c1 | nmdc:mga07m45_221124_c1_177_632 | 150 |
| 842 | 3300050496 | nmdc:mga07m45_222503_c1 | nmdc:mga07m45_222503_c1_126_578 | 150 |
| 843 | 3300050496 | nmdc:mga07m45_225557_c1 | nmdc:mga07m45_225557_c1_164_619 | 150 |
| 844 | 3300050496 | nmdc:mga07m45_36017_c1 | nmdc:mga07m45_36017_c1_714_1166 | 150 |
| 845 | 3300050507 | nmdc:mga05p37_1268362_c1 | nmdc:mga05p37_1268362_c1_277_732 | 150 |
| 846 | 3300050516 | nmdc:mga0sz30_323296_c1 | nmdc:mga0sz30_323296_c1_53_508 | 150 |
| 847 | 3300053077 | Ga0495601_0080115 | Ga0495601_0080115_1429_1884 | 150 |
| 848 | 3300053078 | Ga0495612_0432903 | Ga0495612_0432903_101_556 | 150 |
| 849 | 3300053079 | Ga0500610_0003000 | Ga0500610_0003000_2999_3451 | 150 |
| 850 | 3300053079 | Ga0500610_0132941 | Ga0500610_0132941_432_884 | 150 |
| 851 | 3300053086 | Ga0500578_0092904 | Ga0500578_0092904_216_674 | 150 |
| 852 | 3300053086 | Ga0500578_0482243 | Ga0500578_0482243_140_598 | 150 |
| 853 | 3300053087 | Ga0500643_041209 | Ga0500643_041209_326_778 | 150 |
| 854 | 3300053088 | Ga0500644_0010325 | Ga0500644_0010325_266_724 | 150 |
| 855 | 3300053088 | Ga0500644_0419011 | Ga0500644_0419011_75_530 | 150 |
| 856 | 3300053090 | Ga0500646_0016030 | Ga0500646_0016030_1185_1643 | 150 |
| 857 | 3300053091 | Ga0500647_0367973 | Ga0500647_0367973_81_536 | 150 |
| 858 | 3300053093 | Ga0500651_0002595 | Ga0500651_0002595_7612_8064 | 150 |
| 859 | 3300053093 | Ga0500651_0014879 | Ga0500651_0014879_1227_1685 | 150 |
| 860 | 3300053093 | Ga0500651_0080404 | Ga0500651_0080404_466_924 | 150 |
| 861 | 3300053093 | Ga0500651_0146221 | Ga0500651_0146221_641_1099 | 150 |
| 862 | 3300053094 | Ga0500566_0000003 | Ga0500566_0000003_64760_65215 | 150 |
| 863 | 3300053094 | Ga0500566_0489857 | Ga0500566_0489857_35_493 | 150 |
| 864 | 3300053095 | Ga0500640_000494 | Ga0500640_000494_8117_8572 | 150 |
| 865 | 3300053108 | Ga0500562_068929 | Ga0500562_068929_236_688 | 150 |
| 866 | 3300053110 | Ga0500571_000610 | Ga0500571_000610_2280_2732 | 150 |
| 867 | 3300053111 | Ga0500572_000064 | Ga0500572_000064_22412_22867 | 150 |
| 868 | 3300053111 | Ga0500572_068257 | Ga0500572_068257_549_1001 | 150 |
| 869 | 3300053115 | Ga0500591_062438 | Ga0500591_062438_340_795 | 150 |
| 870 | 3300053116 | Ga0500592_023229 | Ga0500592_023229_21_479 | 150 |
| 871 | 3300053117 | Ga0500593_001312 | Ga0500593_001312_6241_6693 | 150 |
| 872 | 3300053118 | Ga0500594_0107655 | Ga0500594_0107655_184_642 | 150 |
| 873 | 3300053118 | Ga0500594_0136375 | Ga0500594_0136375_283_741 | 150 |
| 874 | 3300053118 | Ga0500594_0150956 | Ga0500594_0150956_152_604 | 150 |
| 875 | 3300053118 | Ga0500594_0196935 | Ga0500594_0196935_68_526 | 150 |
| 876 | 3300053119 | Ga0500595_001895 | Ga0500595_001895_595_1053 | 150 |
| 877 | 3300053121 | Ga0500607_002084 | Ga0500607_002084_15084_15536 | 150 |
| 878 | 3300053122 | Ga0500608_010082 | Ga0500608_010082_1109_1561 | 150 |
| 879 | 3300053122 | Ga0500608_049218 | Ga0500608_049218_598_1053 | 150 |
| 880 | 3300053123 | Ga0500614_000728 | Ga0500614_000728_2000_2455 | 150 |
| 881 | 3300053123 | Ga0500614_197155 | Ga0500614_197155_77_535 | 150 |
| 882 | 3300053128 | Ga0500626_017227 | Ga0500626_017227_2345_2797 | 150 |
| 883 | 3300053130 | Ga0500642_0000786 | Ga0500642_0000786_3216_3674 | 150 |
| 884 | 3300053133 | Ga0500655_002349 | Ga0500655_002349_685_1137 | 150 |
| 885 | 3300053133 | Ga0500655_027279 | Ga0500655_027279_434_892 | 150 |
| 886 | 3300053134 | Ga0500658_0003124 | Ga0500658_0003124_2100_2552 | 150 |
| 887 | 3300053134 | Ga0500658_0004678 | Ga0500658_0004678_3426_3878 | 150 |
| 888 | 3300053136 | Ga0500559_0000697 | Ga0500559_0000697_18001_18456 | 150 |
| 889 | 3300053136 | Ga0500559_0023339 | Ga0500559_0023339_1315_1767 | 150 |
| 890 | 3300053138 | Ga0500564_016854 | Ga0500564_016854_1092_1544 | 150 |
| 891 | 3300053139 | Ga0500568_0296634 | Ga0500568_0296634_39_497 | 150 |
| 892 | 3300053140 | Ga0500573_0267064 | Ga0500573_0267064_256_708 | 150 |
| 893 | 3300053141 | Ga0500574_031489 | Ga0500574_031489_679_1131 | 150 |
| 894 | 3300053142 | Ga0500577_0149039 | Ga0500577_0149039_115_573 | 150 |
| 895 | 3300053142 | Ga0500577_0331944 | Ga0500577_0331944_165_623 | 150 |
| 896 | 3300053146 | Ga0500588_0057214 | Ga0500588_0057214_311_769 | 150 |
| 897 | 3300053146 | Ga0500588_0099006 | Ga0500588_0099006_200_658 | 150 |
| 898 | 3300053150 | Ga0500603_000211 | Ga0500603_000211_14482_14937 | 150 |
| 899 | 3300053151 | Ga0500604_0004630 | Ga0500604_0004630_70_528 | 150 |
| 900 | 3300053151 | Ga0500604_0115088 | Ga0500604_0115088_218_670 | 150 |
| 901 | 3300053151 | Ga0500604_0243347 | Ga0500604_0243347_96_554 | 150 |
| 902 | 3300053153 | Ga0500616_0000705 | Ga0500616_0000705_11028_11486 | 150 |
| 903 | 3300053153 | Ga0500616_0005404 | Ga0500616_0005404_3408_3860 | 150 |
| 904 | 3300053158 | Ga0500627_0155763 | Ga0500627_0155763_61_513 | 150 |
| 905 | 3300053159 | Ga0500630_004374 | Ga0500630_004374_850_1305 | 150 |
| 906 | 3300053160 | Ga0500633_0064090 | Ga0500633_0064090_770_1228 | 150 |
| 907 | 3300053161 | Ga0500634_0112681 | Ga0500634_0112681_136_594 | 150 |
| 908 | 3300053161 | Ga0500634_0163162 | Ga0500634_0163162_531_986 | 150 |
| 909 | 3300053162 | Ga0500638_058028 | Ga0500638_058028_1179_1634 | 150 |
| 910 | 3300053163 | Ga0500639_000042 | Ga0500639_000042_49503_49958 | 150 |
| 911 | 3300053729 | Ga0500625_139109 | Ga0500625_139109_158_610 | 150 |
| 912 | 3300053731 | Ga0500609_009377 | Ga0500609_009377_581_1039 | 150 |
| 913 | 3300053734 | Ga0500565_003471 | Ga0500565_003471_228_680 | 150 |
| 914 | 3300053735 | Ga0500596_004183 | Ga0500596_004183_1062_1517 | 150 |
| 915 | 3300053735 | Ga0500596_004335 | Ga0500596_004335_455_907 | 150 |
| 916 | 3300053739 | Ga0500587_015452 | Ga0500587_015452_425_883 | 150 |
| 917 | 3300054114 | Ga0501084_0460654 | Ga0501084_0460654_547_1005 | 150 |
| 918 | 3300054114 | Ga0501084_0799963 | Ga0501084_0799963_65_520 | 150 |
| 919 | 3300060353 | Ga0501082_0115365 | Ga0501082_0115365_1370_1822 | 150 |
| 920 | 3300061719 | Ga0466962_0011427 | Ga0466962_0011427_123_605 | 150 |
| 921 | 3300061719 | Ga0466962_0034602 | Ga0466962_0034602_297_752 | 150 |
| 922 | 3300061734 | Ga0530510_0225753 | Ga0530510_0225753_570_1025 | 150 |
| 923 | iso_pu_bacteria | 2513237141 | 2513893869 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ob5-assembly1.cif.gz_A-2 | crystal structure of protein atu2016, putative sugar binding protein | 0.9711 | 1 | 146 |
| 2ob5-assembly1.cif.gz_A-2 | crystal structure of protein atu2016, putative sugar binding protein | 0.9393 | 1 | 146 |
| 3mvk-assembly1.cif.gz_G | the crystal structure of fucu from bifidobacterium longum to 1.65a | 0.9261 | 5 | 146 |
| 3mvk-assembly5.cif.gz_D | the crystal structure of fucu from bifidobacterium longum to 1.65a | 0.9242 | 5 | 146 |
| 4a34-assembly1.cif.gz_B | crystal structure of the fucose mutarotase in complex with l-fucose from streptococcus pneumoniae | 0.9224 | 2 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ob5A00 | Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain | 0.9654 | 1 | 146 | 3.40.1650.10 |
| 2ob5A00 | Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain | 0.9328 | 1 | 146 | 3.40.1650.10 |
| 4a34B01 | Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain | 0.9268 | 10 | 144 | 3.40.1650.10 |
| 4a34B01 | Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain | 0.92 | 10 | 144 | 3.40.1650.10 |
| 3mvkF01 | Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain | 0.8984 | 10 | 144 | 3.40.1650.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C1WDZ3-F1-model_v4 | Ribose ABC transporter | 0.9819 | 1 | 148 |
GO:0006004
GO:0016857 GO:0036065 GO:0042806 GO:0062193 |
| AF-A0A529FKN9-F1-model_v4 | Ribose ABC transporter | 0.9808 | 48 | 150 |
GO:0006004
GO:0016857 GO:0036065 GO:0042806 GO:0062193 |
| AF-A0A812JVH4-F1-model_v4 | Ribokinase (RK) (EC 2.7.1.15) | 0.9788 | 1 | 148 |
GO:0004747
GO:0005524 GO:0005634 GO:0005829 GO:0016853 GO:0019303 GO:0046872 GO:0048029 |
| AF-A0A382PLN9-F1-model_v4 | L-fucose mutarotase (EC 5.1.3.29) | 0.978 | 20 | 150 |
GO:0006004
GO:0016857 GO:0036065 GO:0042806 |
| AF-A0A6A4ULI4-F1-model_v4 | D-ribose pyranase | 0.9759 | 1 | 146 |
GO:0006004
GO:0016857 GO:0036065 GO:0042806 GO:0062193 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar