F485838

General Info

Members Datasets Scaffolds Average Seq Length
923 369 1846 97

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0393467|Ga0496108_0393467_17_358
Length 113
Sequence LNPERTLNLDECDDAMNIQAMMKQAQQMQERLKKQMAELRVEATAGGGMVTVVVNGSKQLLSLKIDPEVVVKEDVEMLQDLILAAVNDAQRKADEQMAQTMGGMMGGLQIPGL

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
236 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
237 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
238 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
239 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
240 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
241 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
242 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
243 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
244 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
245 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
246 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
247 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
248 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
252 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
253 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
273 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
287 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
314 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
315 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
335 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
336 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
337 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
338 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
339 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
340 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
341 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
342 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
343 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
361 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
362 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
369 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 3.58
Rhizosphere 95.99
Stem 0
Stem Tuber 0
Unclassified 12.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0393467 3300048911 Bacteria 1210
2 JGI24737J22298_10160877 3300001990 Bacteria 663
3 JGI24742J22300_10067528 3300002244 Unclassified 663
4 Ga0058863_11942793 3300004799 Bacteria 585
5 Ga0058861_11514866 3300004800 Bacteria 519
6 Ga0058862_12227631 3300004803 Bacteria 625
7 Ga0065714_10123868 3300005288 Bacteria 1317
8 Ga0065704_10006424 3300005289 Unclassified 3681
9 Ga0065704_10209307 3300005289 Bacteria 1115
10 Ga0065704_10288932 3300005289 Unclassified 907
11 Ga0065704_10304264 3300005289 Bacteria 874
12 Ga0065704_10397950 3300005289 Bacteria 755
13 Ga0065704_10744257 3300005289 Bacteria 544
14 Ga0065712_10032912 3300005290 Unclassified 1235
15 Ga0065712_10085353 3300005290 Bacteria 2699
16 Ga0065712_10091049 3300005290 Bacteria 2393
17 Ga0065712_10461986 3300005290 Bacteria 676
18 Ga0065715_10000908 3300005293 Bacteria 10564
19 Ga0065715_10027509 3300005293 Bacteria 1807
20 Ga0065715_10036259 3300005293 Unclassified 935
21 Ga0065715_10223050 3300005293 Unclassified 1264
22 Ga0065715_10224866 3300005293 Bacteria 1257
23 Ga0065715_10603148 3300005293 Bacteria 691
24 Ga0065715_10915665 3300005293 Unclassified 570
25 Ga0065707_10105001 3300005295 Bacteria 2667
26 Ga0065707_10203694 3300005295 Bacteria 1298
27 Ga0065707_10329184 3300005295 Bacteria 952
28 Ga0065707_10701550 3300005295 Bacteria 639
29 Ga0070676_10189530 3300005328 Unclassified 1342
30 Ga0070676_10255356 3300005328 Unclassified 1171
31 Ga0070683_100553375 3300005329 Bacteria 1100
32 Ga0070683_100658116 3300005329 Bacteria 1003
33 Ga0070683_100840049 3300005329 Bacteria 881
34 Ga0070683_101652648 3300005329 Bacteria 616
35 Ga0070690_100134887 3300005330 Bacteria 1671
36 Ga0070670_100031373 3300005331 Bacteria 4576
37 Ga0070670_100376385 3300005331 Bacteria 1250
38 Ga0070670_101075449 3300005331 Unclassified 733
39 Ga0070670_102113895 3300005331 Bacteria 519
40 Ga0070677_10297758 3300005333 Bacteria 818
41 Ga0068869_100128890 3300005334 Bacteria 1943
42 Ga0068869_100342135 3300005334 Unclassified 1217
43 Ga0070666_10636188 3300005335 Unclassified 780
44 Ga0070680_100528123 3300005336 Bacteria 1010
45 Ga0070680_101014220 3300005336 Unclassified 717
46 Ga0068868_100644371 3300005338 Bacteria 943
47 Ga0068868_100787238 3300005338 Bacteria 857
48 Ga0070660_100243468 3300005339 Bacteria 1465
49 Ga0070689_100036559 3300005340 Bacteria 3756
50 Ga0070689_100752539 3300005340 Bacteria 854
51 Ga0070689_100960214 3300005340 Bacteria 759
52 Ga0070687_100022360 3300005343 Bacteria 2988
53 Ga0070661_100115308 3300005344 Bacteria 2009
54 Ga0070661_100230363 3300005344 Bacteria 1424
55 Ga0070661_100348071 3300005344 Bacteria 1162
56 Ga0070661_101055155 3300005344 Bacteria 676
57 Ga0070661_101618286 3300005344 Bacteria 548
58 Ga0070661_101949239 3300005344 Bacteria 500
59 Ga0070692_10061365 3300005345 Bacteria 1981
60 Ga0070692_10510166 3300005345 Bacteria 781
61 Ga0070692_10766598 3300005345 Bacteria 656
62 Ga0070668_100071055 3300005347 Bacteria 2711
63 Ga0070668_101587567 3300005347 Bacteria 599
64 Ga0070669_100008493 3300005353 Bacteria 7331
65 Ga0070669_100328715 3300005353 Bacteria 1236
66 Ga0070669_100754139 3300005353 Bacteria 825
67 Ga0070669_101527425 3300005353 Bacteria 581
68 Ga0070675_100027450 3300005354 Bacteria 4573
69 Ga0070675_100318945 3300005354 Bacteria 1373
70 Ga0070675_100424898 3300005354 Bacteria 1189
71 Ga0070675_102069838 3300005354 Bacteria 525
72 Ga0070671_100003405 3300005355 Bacteria 12404
73 Ga0070671_100615431 3300005355 Bacteria 939
74 Ga0070671_100809673 3300005355 Bacteria 816
75 Ga0070671_101707890 3300005355 Bacteria 559
76 Ga0070674_101088203 3300005356 Bacteria 705
77 Ga0070673_100383281 3300005364 Unclassified 1254
78 Ga0070673_100695243 3300005364 Unclassified 933
79 Ga0070673_100756642 3300005364 Bacteria 895
80 Ga0070673_102405969 3300005364 Unclassified 501
81 Ga0070688_100364126 3300005365 Unclassified 1062
82 Ga0070688_100409694 3300005365 Bacteria 1005
83 Ga0070688_101438411 3300005365 Unclassified 560
84 Ga0070659_100211419 3300005366 Bacteria 1599
85 Ga0070659_100663451 3300005366 Unclassified 900
86 Ga0070667_100109311 3300005367 Unclassified 2396
87 Ga0070667_100832312 3300005367 Bacteria 858
88 Ga0070667_101338788 3300005367 Bacteria 671
89 Ga0070667_101644953 3300005367 Bacteria 604
90 Ga0070667_102205397 3300005367 Bacteria 519
91 Ga0070667_102272337 3300005367 Bacteria 511
92 Ga0070709_10729783 3300005434 Bacteria 773
93 Ga0070713_100106743 3300005436 Unclassified 2435
94 Ga0070701_10015529 3300005438 Bacteria 3519
95 Ga0070701_10016127 3300005438 Bacteria 3465
96 Ga0070701_10124474 3300005438 Bacteria 1457
97 Ga0070711_100107282 3300005439 Bacteria 2043
98 Ga0070705_100015397 3300005440 Bacteria 3954
99 Ga0070705_100370335 3300005440 Bacteria 1051
100 Ga0070700_100074264 3300005441 Bacteria 2178
101 Ga0070700_100424142 3300005441 Bacteria 1006
102 Ga0070700_102009479 3300005441 Bacteria 502
103 Ga0070694_100173371 3300005444 Bacteria 1590
104 Ga0070694_100216452 3300005444 Bacteria 1435
105 Ga0070708_100015138 3300005445 Bacteria 6362
106 Ga0070708_101213001 3300005445 Bacteria 706
107 Ga0070663_100654084 3300005455 Bacteria 889
108 Ga0070678_100289962 3300005456 Bacteria 1387
109 Ga0070678_100445022 3300005456 Bacteria 1134
110 Ga0070678_100462006 3300005456 Bacteria 1114
111 Ga0070678_100907267 3300005456 Bacteria 806
112 Ga0070662_100033724 3300005457 Bacteria 3606
113 Ga0070681_10106447 3300005458 Bacteria 2746
114 Ga0070681_10795138 3300005458 Unclassified 863
115 Ga0070681_10803848 3300005458 Bacteria 857
116 Ga0070681_10893077 3300005458 Bacteria 807
117 Ga0070681_10953870 3300005458 Bacteria 777
118 Ga0068867_100043229 3300005459 Bacteria 3298
119 Ga0068867_100044922 3300005459 Bacteria 3238
120 Ga0068867_100320176 3300005459 Bacteria 1284
121 Ga0068867_101485849 3300005459 Bacteria 630
122 Ga0070685_10116049 3300005466 Bacteria 1656
123 Ga0070685_10289430 3300005466 Bacteria 1100
124 Ga0070706_100194698 3300005467 Bacteria 1894
125 Ga0070706_101207617 3300005467 Bacteria 695
126 Ga0070706_101818069 3300005467 Bacteria 554
127 Ga0070698_100170183 3300005471 Bacteria 2120
128 Ga0070698_100188747 3300005471 Bacteria 1999
129 Ga0070698_101703859 3300005471 Bacteria 583
130 Ga0070698_102112437 3300005471 Bacteria 517
131 Ga0070699_100014913 3300005518 Bacteria 6681
132 Ga0070699_100228534 3300005518 Bacteria 1659
133 Ga0070699_100523696 3300005518 Bacteria 1078
134 Ga0070699_101905045 3300005518 Bacteria 544
135 Ga0070679_100110730 3300005530 Bacteria 2732
136 Ga0070679_100344593 3300005530 Bacteria 1438
137 Ga0070679_100359394 3300005530 Bacteria 1403
138 Ga0070679_100490162 3300005530 Bacteria 1173
139 Ga0070684_100220424 3300005535 Bacteria 1731
140 Ga0070684_100332838 3300005535 Bacteria 1395
141 Ga0070684_100378937 3300005535 Bacteria 1303
142 Ga0070684_100986119 3300005535 Bacteria 791
143 Ga0070684_101522259 3300005535 Bacteria 631
144 Ga0070684_102205226 3300005535 Bacteria 520
145 Ga0070684_102226308 3300005535 Bacteria 517
146 Ga0070697_100411175 3300005536 Bacteria 1175
147 Ga0068853_101695186 3300005539 Bacteria 613
148 Ga0068853_102205070 3300005539 Bacteria 534
149 Ga0070672_100065956 3300005543 Bacteria 2865
150 Ga0070672_100241641 3300005543 Bacteria 1519
151 Ga0070672_100558951 3300005543 Bacteria 994
152 Ga0070672_100677547 3300005543 Bacteria 902
153 Ga0070672_100841352 3300005543 Bacteria 809
154 Ga0070686_100107007 3300005544 Bacteria 1899
155 Ga0070686_100584798 3300005544 Bacteria 878
156 Ga0070686_100836416 3300005544 Bacteria 744
157 Ga0070695_101020221 3300005545 Bacteria 674
158 Ga0070695_101326621 3300005545 Bacteria 595
159 Ga0070696_100028389 3300005546 Bacteria 3818
160 Ga0070696_100700065 3300005546 Bacteria 826
161 Ga0070665_100086227 3300005548 Bacteria 3145
162 Ga0070665_100164579 3300005548 Bacteria 2220
163 Ga0070704_100005985 3300005549 Bacteria 7131
164 Ga0070704_100175678 3300005549 Bacteria 1708
165 Ga0070704_102040122 3300005549 Bacteria 532
166 Ga0070704_102077365 3300005549 Bacteria 528
167 Ga0068855_100379781 3300005563 Bacteria 1552
168 Ga0070664_100218447 3300005564 Bacteria 1705
169 Ga0070664_100365578 3300005564 Bacteria 1314
170 Ga0070664_100468997 3300005564 Bacteria 1157
171 Ga0070664_100627941 3300005564 Bacteria 997
172 Ga0070664_100663487 3300005564 Bacteria 970
173 Ga0070664_100787355 3300005564 Bacteria 889
174 Ga0070664_102164126 3300005564 Bacteria 528
175 Ga0068857_100039935 3300005577 Bacteria 4159
176 Ga0068857_102126192 3300005577 Bacteria 551
177 Ga0068854_100357206 3300005578 Bacteria 1198
178 Ga0068854_100546338 3300005578 Bacteria 982
179 Ga0068856_100258074 3300005614 Unclassified 1758
180 Ga0068856_100494467 3300005614 Bacteria 1244
181 Ga0070702_100183372 3300005615 Unclassified 1371
182 Ga0070702_100535123 3300005615 Unclassified 867
183 Ga0070702_100870396 3300005615 Archaea 703
184 Ga0068852_101155942 3300005616 Unclassified 795
185 Ga0068859_100013724 3300005617 Bacteria 8123
186 Ga0068859_100038639 3300005617 Bacteria 4788
187 Ga0068859_100100963 3300005617 Bacteria 2941
188 Ga0068859_100448131 3300005617 Bacteria 1387
189 Ga0068859_100561173 3300005617 Bacteria 1236
190 Ga0068859_100885404 3300005617 Bacteria 978
191 Ga0068859_101949873 3300005617 Unclassified 648
192 Ga0068859_102708972 3300005617 Unclassified 545
193 Ga0068864_100026452 3300005618 Bacteria 4893
194 Ga0068864_100058932 3300005618 Bacteria 3320
195 Ga0068864_100130358 3300005618 Bacteria 2258
196 Ga0068866_10293908 3300005718 Unclassified 1012
197 Ga0068866_10379916 3300005718 Bacteria 905
198 Ga0068861_100006122 3300005719 Bacteria 8188
199 Ga0068861_100187875 3300005719 Bacteria 1725
200 Ga0068861_100203112 3300005719 Bacteria 1665
201 Ga0068861_100735992 3300005719 Bacteria 920
202 Ga0068861_100939294 3300005719 Bacteria 822
203 Ga0068861_101575118 3300005719 Bacteria 647
204 Ga0068870_10000530 3300005840 Bacteria 14387
205 Ga0068870_10246266 3300005840 Bacteria 1106
206 Ga0068870_10365319 3300005840 Unclassified 930
207 Ga0068870_10384969 3300005840 Bacteria 909
208 Ga0068863_100073304 3300005841 Bacteria 3239
209 Ga0068863_100291250 3300005841 Unclassified 1582
210 Ga0068863_100715731 3300005841 Bacteria 996
211 Ga0068863_101107131 3300005841 Unclassified 797
212 Ga0068858_100110447 3300005842 Bacteria 2567
213 Ga0068858_100381503 3300005842 Bacteria 1353
214 Ga0068858_100463014 3300005842 Unclassified 1223
215 Ga0068858_100641635 3300005842 Bacteria 1032
216 Ga0068858_100796527 3300005842 Bacteria 922
217 Ga0068860_100030802 3300005843 Bacteria 5158
218 Ga0068860_100108983 3300005843 Bacteria 2647
219 Ga0068860_100152807 3300005843 Bacteria 2223
220 Ga0068860_100277219 3300005843 Bacteria 1638
221 Ga0068860_100382285 3300005843 Unclassified 1390
222 Ga0068860_100791011 3300005843 Bacteria 962
223 Ga0068860_101726907 3300005843 Bacteria 648
224 Ga0068862_100001873 3300005844 Bacteria 19052
225 Ga0068862_100171255 3300005844 Unclassified 1944
226 Ga0068862_100285930 3300005844 Bacteria 1513
227 Ga0068862_101091786 3300005844 Bacteria 793
228 Ga0068862_102376614 3300005844 Bacteria 542
229 Ga0081455_10253638 3300005937 Bacteria 1285
230 Ga0081539_10000010 3300005985 Bacteria 484386
231 Ga0070717_10219643 3300006028 Bacteria 1670
232 Ga0075365_10019585 3300006038 Bacteria 4180
233 Ga0075432_10332771 3300006058 Unclassified 639
234 Ga0070715_10301871 3300006163 Bacteria 857
235 Ga0070715_10503771 3300006163 Bacteria 694
236 Ga0070716_100435505 3300006173 Bacteria 952
237 Ga0070716_101279630 3300006173 Bacteria 592
238 Ga0070712_100226358 3300006175 Bacteria 1483
239 Ga0097621_100066438 3300006237 Bacteria 2970
240 Ga0097621_100076644 3300006237 Bacteria 2774
241 Ga0097621_100111462 3300006237 Bacteria 2312
242 Ga0097621_100139568 3300006237 Unclassified 2070
243 Ga0097621_100179772 3300006237 Bacteria 1827
244 Ga0097621_100728164 3300006237 Bacteria 915
245 Ga0097621_100874488 3300006237 Bacteria 836
246 Ga0097621_100936684 3300006237 Bacteria 808
247 Ga0068871_100059820 3300006358 Bacteria 3105
248 Ga0068871_100099305 3300006358 Bacteria 2437
249 Ga0068871_100121883 3300006358 Bacteria 2203
250 Ga0068871_100180486 3300006358 Bacteria 1814
251 Ga0068871_100199704 3300006358 Bacteria 1726
252 Ga0075428_100063659 3300006844 Bacteria 4038
253 Ga0075428_100445114 3300006844 Bacteria 1388
254 Ga0075428_100454744 3300006844 Bacteria 1371
255 Ga0075428_101734263 3300006844 Unclassified 651
256 Ga0075428_102202373 3300006844 Bacteria 569
257 Ga0075428_102262932 3300006844 Unclassified 560
258 Ga0075430_100072094 3300006846 Bacteria 2897
259 Ga0075430_100117699 3300006846 Bacteria 2215
260 Ga0075430_100225365 3300006846 Bacteria 1555
261 Ga0075430_101322164 3300006846 Bacteria 593
262 Ga0075431_100015224 3300006847 Bacteria 7793
263 Ga0075431_100034839 3300006847 Bacteria 5185
264 Ga0075431_100043753 3300006847 Bacteria 4620
265 Ga0075433_10005599 3300006852 Bacteria 9875
266 Ga0075433_11347663 3300006852 Bacteria 618
267 Ga0075434_100004883 3300006871 Bacteria 12148
268 Ga0075434_100068741 3300006871 Bacteria 3530
269 Ga0075434_100203542 3300006871 Bacteria 2000
270 Ga0075434_101066003 3300006871 Bacteria 822
271 Ga0075429_100053157 3300006880 Bacteria 3525
272 Ga0075429_100073740 3300006880 Bacteria 2972
273 Ga0075429_100243933 3300006880 Bacteria 1573
274 Ga0075429_100466376 3300006880 Bacteria 1106
275 Ga0068865_100051366 3300006881 Bacteria 2853
276 Ga0068865_100070023 3300006881 Bacteria 2484
277 Ga0068865_100388430 3300006881 Bacteria 1140
278 Ga0068865_100395607 3300006881 Bacteria 1130
279 Ga0068865_100533938 3300006881 Bacteria 983
280 Ga0075436_100005353 3300006914 Bacteria 8832
281 Ga0097620_100013723 3300006931 Bacteria 8123
282 Ga0097620_100038638 3300006931 Bacteria 4788
283 Ga0097620_100100961 3300006931 Bacteria 2941
284 Ga0097620_100448124 3300006931 Bacteria 1387
285 Ga0097620_100561134 3300006931 Bacteria 1236
286 Ga0097620_100885388 3300006931 Bacteria 978
287 Ga0097620_101949833 3300006931 Unclassified 648
288 Ga0097620_102709940 3300006931 Unclassified 545
289 Ga0075435_100002536 3300007076 Bacteria 12156
290 Ga0075435_100529659 3300007076 Bacteria 1019
291 Ga0075435_101094501 3300007076 Bacteria 697
292 Ga0075435_101236154 3300007076 Bacteria 654
293 Ga0105251_10562522 3300009011 Bacteria 538
294 Ga0105240_10010271 3300009093 Bacteria 13180
295 Ga0105240_10131951 3300009093 Bacteria 2996
296 Ga0105240_11109644 3300009093 Bacteria 841
297 Ga0111539_10007245 3300009094 Bacteria 14211
298 Ga0111539_10154582 3300009094 Unclassified 2685
299 Ga0111539_10362882 3300009094 Bacteria 1686
300 Ga0111539_10979012 3300009094 Bacteria 983
301 Ga0111539_11396418 3300009094 Bacteria 812
302 Ga0111539_11583653 3300009094 Bacteria 760
303 Ga0111539_11618223 3300009094 Bacteria 751
304 Ga0111539_11772870 3300009094 Bacteria 716
305 Ga0105245_10120577 3300009098 Unclassified 2449
306 Ga0105245_10294042 3300009098 Bacteria 1592
307 Ga0105245_10767752 3300009098 Unclassified 1001
308 Ga0105245_12129051 3300009098 Bacteria 615
309 Ga0105247_10006247 3300009101 Bacteria 7388
310 Ga0105247_10007530 3300009101 Bacteria 6672
311 Ga0105247_11443094 3300009101 Bacteria 559
312 Ga0114129_10017413 3300009147 Bacteria 10234
313 Ga0114129_10074333 3300009147 Bacteria 4734
314 Ga0114129_11413129 3300009147 Unclassified 858
315 Ga0114129_12977031 3300009147 Bacteria 558
316 Ga0105243_10615235 3300009148 Bacteria 1048
317 Ga0105243_10719512 3300009148 Bacteria 975
318 Ga0105243_10837089 3300009148 Bacteria 910
319 Ga0105243_11465335 3300009148 Bacteria 705
320 Ga0105243_11550935 3300009148 Bacteria 687
321 Ga0105243_11761454 3300009148 Unclassified 650
322 Ga0105241_10475500 3300009174 Bacteria 1110
323 Ga0105241_10932667 3300009174 Bacteria 808
324 Ga0105241_11274040 3300009174 Bacteria 699
325 Ga0105241_11700648 3300009174 Unclassified 613
326 Ga0105242_10409402 3300009176 Bacteria 1268
327 Ga0105242_10635702 3300009176 Bacteria 1036
328 Ga0105242_12755443 3300009176 Bacteria 542
329 Ga0105248_10023438 3300009177 Bacteria 6857
330 Ga0105248_10067950 3300009177 Bacteria 4001
331 Ga0105248_10148189 3300009177 Bacteria 2648
332 Ga0105248_10318916 3300009177 Bacteria 1750
333 Ga0105248_10595154 3300009177 Bacteria 1248
334 Ga0105248_10633736 3300009177 Bacteria 1206
335 Ga0105248_10672595 3300009177 Unclassified 1168
336 Ga0105248_12696901 3300009177 Bacteria 567
337 Ga0105237_11124859 3300009545 Bacteria 792
338 Ga0105237_11899653 3300009545 Bacteria 603
339 Ga0105238_11546917 3300009551 Bacteria 693
340 Ga0105238_11582062 3300009551 Bacteria 685
341 Ga0105249_10017304 3300009553 Bacteria 6400
342 Ga0105249_10056029 3300009553 Bacteria 3609
343 Ga0105249_10067817 3300009553 Bacteria 3288
344 Ga0105249_10093169 3300009553 Bacteria 2821
345 Ga0105249_10465816 3300009553 Bacteria 1304
346 Ga0105249_10822709 3300009553 Bacteria 993
347 Ga0105249_11308769 3300009553 Bacteria 796
348 Ga0105249_11656914 3300009553 Bacteria 712
349 Ga0105249_11996021 3300009553 Bacteria 653
350 Ga0105239_10684345 3300010375 Bacteria 1172
351 Ga0105239_11781211 3300010375 Bacteria 713
352 Ga0105239_13067002 3300010375 Bacteria 544
353 Ga0105246_10400928 3300011119 Bacteria 1139
354 Ga0105246_10496090 3300011119 Bacteria 1036
355 Ga0105246_10799295 3300011119 Bacteria 837
356 Ga0105246_10966639 3300011119 Bacteria 769
357 Ga0105246_12248925 3300011119 Bacteria 532
358 Ga0157370_10500470 3300013104 Bacteria 1116
359 Ga0157370_10643158 3300013104 Bacteria 969
360 Ga0157370_11110560 3300013104 Bacteria 714
361 Ga0157370_11609672 3300013104 Bacteria 583
362 Ga0157369_10260837 3300013105 Bacteria 1807
363 Ga0157374_12577412 3300013296 Unclassified 536
364 Ga0157378_10061624 3300013297 Bacteria 3349
365 Ga0157378_10227602 3300013297 Bacteria 1775
366 Ga0157378_10348770 3300013297 Unclassified 1445
367 Ga0157378_10388241 3300013297 Bacteria 1373
368 Ga0157378_10859157 3300013297 Bacteria 936
369 Ga0163162_10244979 3300013306 Bacteria 1924
370 Ga0163162_10966898 3300013306 Bacteria 962
371 Ga0163162_11798025 3300013306 Unclassified 701
372 Ga0163162_12030981 3300013306 Bacteria 659
373 Ga0163162_12406385 3300013306 Bacteria 605
374 Ga0163162_13158034 3300013306 Unclassified 529
375 Ga0157372_10202075 3300013307 Bacteria 2302
376 Ga0157372_10528642 3300013307 Unclassified 1375
377 Ga0157372_10545333 3300013307 Bacteria 1352
378 Ga0157372_12539624 3300013307 Bacteria 588
379 Ga0157375_10025669 3300013308 Bacteria 5480
380 Ga0157375_10665724 3300013308 Bacteria 1196
381 Ga0157375_11269694 3300013308 Bacteria 865
382 Ga0157375_12031810 3300013308 Unclassified 683
383 Ga0157375_12890388 3300013308 Bacteria 574
384 Ga0157375_13070912 3300013308 Bacteria 557
385 Ga0163163_10048183 3300014325 Bacteria 4190
386 Ga0163163_10177380 3300014325 Bacteria 2178
387 Ga0163163_10219878 3300014325 Bacteria 1948
388 Ga0163163_10869085 3300014325 Bacteria 965
389 Ga0163163_11510530 3300014325 Bacteria 733
390 Ga0163163_12014476 3300014325 Bacteria 637
391 Ga0157380_10210176 3300014326 Unclassified 1733
392 Ga0157380_10379297 3300014326 Bacteria 1334
393 Ga0157380_10431191 3300014326 Bacteria 1260
394 Ga0157380_10456494 3300014326 Bacteria 1229
395 Ga0157380_11560566 3300014326 Unclassified 715
396 Ga0157380_13157866 3300014326 Bacteria 526
397 Ga0157377_10473199 3300014745 Unclassified 870
398 Ga0157377_10562265 3300014745 Bacteria 807
399 Ga0157377_10735066 3300014745 Bacteria 720
400 Ga0157377_10791306 3300014745 Bacteria 698
401 Ga0157379_10042240 3300014968 Bacteria 4070
402 Ga0157379_10095016 3300014968 Bacteria 2674
403 Ga0157379_10910878 3300014968 Unclassified 834
404 Ga0157376_10031255 3300014969 Bacteria 4261
405 Ga0157376_10093442 3300014969 Bacteria 2611
406 Ga0157376_10166944 3300014969 Bacteria 2001
407 Ga0157376_10216969 3300014969 Bacteria 1769
408 Ga0157376_10275485 3300014969 Bacteria 1582
409 Ga0157376_12110476 3300014969 Bacteria 602
410 Ga0182007_10400173 3300015262 Bacteria 523
411 Ga0163161_11272186 3300017792 Unclassified 638
412 Ga0206356_11684821 3300020070 Bacteria 1296
413 Ga0206352_11127568 3300020078 Bacteria 663
414 Ga0207697_10140356 3300025315 Unclassified 1048
415 Ga0207697_10143125 3300025315 Bacteria 1038
416 Ga0207682_10182427 3300025893 Bacteria 959
417 Ga0207710_10025778 3300025900 Bacteria 2539
418 Ga0207710_10065308 3300025900 Bacteria 1659
419 Ga0207688_10716241 3300025901 Unclassified 633
420 Ga0207680_10736777 3300025903 Bacteria 706
421 Ga0207699_10642918 3300025906 Bacteria 774
422 Ga0207699_11138797 3300025906 Bacteria 578
423 Ga0207645_10073112 3300025907 Bacteria 2195
424 Ga0207645_10130587 3300025907 Bacteria 1635
425 Ga0207645_10646755 3300025907 Bacteria 718
426 Ga0207643_10001472 3300025908 Bacteria 13519
427 Ga0207643_10242576 3300025908 Bacteria 1108
428 Ga0207643_10363331 3300025908 Bacteria 910
429 Ga0207684_10399871 3300025910 Bacteria 1181
430 Ga0207684_10592385 3300025910 Bacteria 947
431 Ga0207684_11342185 3300025910 Bacteria 587
432 Ga0207707_10029466 3300025912 Bacteria 4799
433 Ga0207707_10346948 3300025912 Bacteria 1279
434 Ga0207707_10443952 3300025912 Bacteria 1110
435 Ga0207707_10776805 3300025912 Unclassified 799
436 Ga0207707_10779357 3300025912 Bacteria 798
437 Ga0207707_10787653 3300025912 Bacteria 793
438 Ga0207695_10146589 3300025913 Bacteria 2304
439 Ga0207695_10708644 3300025913 Bacteria 887
440 Ga0207695_10944709 3300025913 Bacteria 742
441 Ga0207671_11604407 3300025914 Bacteria 500
442 Ga0207693_10152595 3300025915 Bacteria 1817
443 Ga0207663_10890521 3300025916 Bacteria 711
444 Ga0207663_10945314 3300025916 Bacteria 690
445 Ga0207660_10262302 3300025917 Bacteria 1367
446 Ga0207660_10543472 3300025917 Bacteria 945
447 Ga0207660_10579856 3300025917 Bacteria 913
448 Ga0207660_10826101 3300025917 Unclassified 756
449 Ga0207660_11391298 3300025917 Bacteria 569
450 Ga0207662_10064048 3300025918 Bacteria 2211
451 Ga0207662_10323266 3300025918 Unclassified 1030
452 Ga0207657_10214326 3300025919 Bacteria 1544
453 Ga0207649_10083754 3300025920 Bacteria 2071
454 Ga0207649_10420605 3300025920 Bacteria 1003
455 Ga0207649_10554750 3300025920 Bacteria 879
456 Ga0207649_10640443 3300025920 Bacteria 820
457 Ga0207649_10668955 3300025920 Bacteria 803
458 Ga0207649_10950231 3300025920 Bacteria 675
459 Ga0207649_11377915 3300025920 Bacteria 558
460 Ga0207652_10125385 3300025921 Bacteria 2287
461 Ga0207652_10309932 3300025921 Bacteria 1425
462 Ga0207652_10467031 3300025921 Bacteria 1137
463 Ga0207652_10578573 3300025921 Bacteria 1008
464 Ga0207652_10894805 3300025921 Bacteria 784
465 Ga0207646_10143216 3300025922 Bacteria 2153
466 Ga0207681_10002132 3300025923 Bacteria 12638
467 Ga0207681_11076120 3300025923 Bacteria 675
468 Ga0207694_10479138 3300025924 Bacteria 1041
469 Ga0207650_10185996 3300025925 Bacteria 1657
470 Ga0207659_10010887 3300025926 Bacteria 5728
471 Ga0207659_10061507 3300025926 Bacteria 2707
472 Ga0207659_10332232 3300025926 Bacteria 1257
473 Ga0207659_10335105 3300025926 Bacteria 1252
474 Ga0207687_10560271 3300025927 Unclassified 959
475 Ga0207700_10088769 3300025928 Unclassified 2435
476 Ga0207700_10378249 3300025928 Bacteria 1238
477 Ga0207644_10010745 3300025931 Bacteria 6038
478 Ga0207644_10210619 3300025931 Bacteria 1537
479 Ga0207644_10747782 3300025931 Unclassified 817
480 Ga0207644_11612570 3300025931 Bacteria 544
481 Ga0207690_10774859 3300025932 Unclassified 792
482 Ga0207690_10824968 3300025932 Unclassified 767
483 Ga0207706_10275139 3300025933 Bacteria 1469
484 Ga0207706_11087381 3300025933 Bacteria 669
485 Ga0207686_11052680 3300025934 Bacteria 662
486 Ga0207686_11095944 3300025934 Bacteria 649
487 Ga0207686_11382033 3300025934 Unclassified 579
488 Ga0207709_10096421 3300025935 Bacteria 1945
489 Ga0207709_10546426 3300025935 Bacteria 910
490 Ga0207670_10021958 3300025936 Bacteria 3946
491 Ga0207670_10034180 3300025936 Bacteria 3283
492 Ga0207669_10259354 3300025937 Bacteria 1299
493 Ga0207669_10284451 3300025937 Bacteria 1249
494 Ga0207669_11075925 3300025937 Unclassified 678
495 Ga0207704_10342921 3300025938 Bacteria 1160
496 Ga0207665_10153574 3300025939 Bacteria 1651
497 Ga0207665_11248299 3300025939 Bacteria 593
498 Ga0207691_10236961 3300025940 Bacteria 1578
499 Ga0207691_10399786 3300025940 Bacteria 1172
500 Ga0207691_10510588 3300025940 Bacteria 1020
501 Ga0207691_10632722 3300025940 Bacteria 905
502 Ga0207711_10003755 3300025941 Bacteria 13081
503 Ga0207711_10410089 3300025941 Bacteria 1259
504 Ga0207711_10432570 3300025941 Unclassified 1224
505 Ga0207711_10954550 3300025941 Bacteria 796
506 Ga0207711_10987010 3300025941 Bacteria 781
507 Ga0207711_11514500 3300025941 Bacteria 614
508 Ga0207689_10068090 3300025942 Bacteria 2926
509 Ga0207689_10111404 3300025942 Bacteria 2249
510 Ga0207689_10115138 3300025942 Bacteria 2210
511 Ga0207689_10141466 3300025942 Bacteria 1982
512 Ga0207689_10459693 3300025942 Unclassified 1064
513 Ga0207661_10086695 3300025944 Bacteria 2599
514 Ga0207661_10563328 3300025944 Bacteria 1044
515 Ga0207661_10595856 3300025944 Bacteria 1014
516 Ga0207679_10110327 3300025945 Bacteria 2170
517 Ga0207679_10386232 3300025945 Bacteria 1228
518 Ga0207679_11036138 3300025945 Bacteria 752
519 Ga0207679_11548914 3300025945 Bacteria 608
520 Ga0207679_12127052 3300025945 Bacteria 510
521 Ga0207667_10360945 3300025949 Bacteria 1481
522 Ga0207651_10155622 3300025960 Bacteria 1785
523 Ga0207651_10200749 3300025960 Bacteria 1598
524 Ga0207651_11036732 3300025960 Unclassified 734
525 Ga0207651_11710125 3300025960 Unclassified 566
526 Ga0207712_10049804 3300025961 Bacteria 2922
527 Ga0207712_10089022 3300025961 Bacteria 2268
528 Ga0207712_10918024 3300025961 Bacteria 774
529 Ga0207712_11323127 3300025961 Bacteria 644
530 Ga0207712_11699176 3300025961 Bacteria 566
531 Ga0207640_10719564 3300025981 Bacteria 858
532 Ga0207640_11721827 3300025981 Bacteria 566
533 Ga0207658_10083213 3300025986 Unclassified 2459
534 Ga0207658_11295765 3300025986 Bacteria 666
535 Ga0207677_10551494 3300026023 Bacteria 1005
536 Ga0207677_11138910 3300026023 Bacteria 712
537 Ga0207677_11148427 3300026023 Unclassified 710
538 Ga0207703_10004499 3300026035 Bacteria 11441
539 Ga0207703_10023320 3300026035 Bacteria 4860
540 Ga0207703_10079237 3300026035 Bacteria 2732
541 Ga0207703_10166782 3300026035 Bacteria 1933
542 Ga0207703_10185818 3300026035 Bacteria 1837
543 Ga0207703_11345250 3300026035 Bacteria 687
544 Ga0207703_11566548 3300026035 Unclassified 634
545 Ga0207639_11776808 3300026041 Bacteria 577
546 Ga0207678_10274605 3300026067 Bacteria 1446
547 Ga0207678_10983655 3300026067 Bacteria 747
548 Ga0207708_10013659 3300026075 Bacteria 6067
549 Ga0207708_10517061 3300026075 Bacteria 1002
550 Ga0207708_10827915 3300026075 Bacteria 798
551 Ga0207702_10315232 3300026078 Unclassified 1488
552 Ga0207641_10079591 3300026088 Bacteria 2841
553 Ga0207641_10184307 3300026088 Bacteria 1914
554 Ga0207641_10608416 3300026088 Bacteria 1070
555 Ga0207648_10005552 3300026089 Bacteria 12695
556 Ga0207648_10037283 3300026089 Bacteria 4282
557 Ga0207648_10619142 3300026089 Bacteria 999
558 Ga0207676_10026672 3300026095 Bacteria 4297
559 Ga0207676_10056212 3300026095 Bacteria 3093
560 Ga0207676_10323040 3300026095 Bacteria 1417
561 Ga0207674_10023602 3300026116 Bacteria 6585
562 Ga0207674_10252411 3300026116 Bacteria 1711
563 Ga0207674_10339788 3300026116 Bacteria 1452
564 Ga0207674_11409893 3300026116 Bacteria 666
565 Ga0207675_100012108 3300026118 Bacteria 8058
566 Ga0207675_100107546 3300026118 Unclassified 2630
567 Ga0207675_100217484 3300026118 Unclassified 1840
568 Ga0207675_100638044 3300026118 Bacteria 1070
569 Ga0207675_101035831 3300026118 Bacteria 840
570 Ga0207683_10048063 3300026121 Bacteria 3737
571 Ga0207683_10324559 3300026121 Bacteria 1410
572 Ga0207683_10452875 3300026121 Bacteria 1183
573 Ga0209967_1083147 3300027364 Bacteria 503
574 Ga0209981_1061507 3300027378 Bacteria 575
575 Ga0209999_1081470 3300027543 Bacteria 624
576 Ga0209971_1016628 3300027682 Bacteria 1744
577 Ga0209971_1130503 3300027682 Bacteria 619
578 Ga0209971_1133519 3300027682 Bacteria 611
579 Ga0209974_10187264 3300027876 Bacteria 760
580 Ga0207428_10000270 3300027907 Bacteria 69948
581 Ga0207428_10018473 3300027907 Bacteria 5954
582 Ga0207428_10474510 3300027907 Bacteria 910
583 Ga0207428_10807294 3300027907 Bacteria 666
584 Ga0268266_11381767 3300028379 Bacteria 680
585 Ga0268266_11894114 3300028379 Bacteria 570
586 Ga0268265_10000768 3300028380 Bacteria 31006
587 Ga0268265_10086723 3300028380 Bacteria 2489
588 Ga0268265_10162924 3300028380 Unclassified 1897
589 Ga0268265_10377786 3300028380 Bacteria 1302
590 Ga0268265_10464695 3300028380 Bacteria 1185
591 Ga0268265_12562233 3300028380 Bacteria 516
592 Ga0268264_10012986 3300028381 Bacteria 6847
593 Ga0268264_10678352 3300028381 Bacteria 1022
594 Ga0268264_10731086 3300028381 Bacteria 985
595 Ga0268264_10736833 3300028381 Unclassified 981
596 Ga0268264_11034458 3300028381 Bacteria 828
597 Ga0268264_11276039 3300028381 Unclassified 744
598 Ga0265332_10011278 3300031238 Bacteria 3975
599 Ga0265331_10135915 3300031250 Bacteria 1119
600 Ga0265316_10585985 3300031344 Bacteria 792
601 Ga0307408_100127349 3300031548 Bacteria 1982
602 Ga0307408_100391971 3300031548 Bacteria 1190
603 Ga0307408_100438559 3300031548 Bacteria 1130
604 Ga0307408_100528862 3300031548 Bacteria 1037
605 Ga0265314_10032573 3300031711 Bacteria 3833
606 Ga0265314_10115944 3300031711 Bacteria 1694
607 Ga0265342_10715931 3300031712 Bacteria 500
608 Ga0307405_10048323 3300031731 Bacteria 2623
609 Ga0307405_10339198 3300031731 Bacteria 1155
610 Ga0307413_10934751 3300031824 Bacteria 739
611 Ga0307406_10611534 3300031901 Bacteria 900
612 Ga0307406_11555268 3300031901 Bacteria 583
613 Ga0307407_10026082 3300031903 Bacteria 3090
614 Ga0307407_11408069 3300031903 Bacteria 549
615 Ga0307412_10237235 3300031911 Bacteria 1408
616 Ga0307409_100314270 3300031995 Bacteria 1463
617 Ga0307409_100342041 3300031995 Bacteria 1408
618 Ga0307409_100485407 3300031995 Bacteria 1200
619 Ga0307409_101583046 3300031995 Bacteria 683
620 Ga0307409_101769374 3300031995 Bacteria 647
621 Ga0307416_100033478 3300032002 Bacteria 3896
622 Ga0307416_100041795 3300032002 Bacteria 3573
623 Ga0307416_100286313 3300032002 Bacteria 1628
624 Ga0307416_100515591 3300032002 Bacteria 1263
625 Ga0307416_100579544 3300032002 Bacteria 1199
626 Ga0307416_102893001 3300032002 Bacteria 574
627 Ga0307414_10406563 3300032004 Bacteria 1184
628 Ga0307411_10008141 3300032005 Bacteria 5409
629 Ga0307411_10056943 3300032005 Bacteria 2579
630 Ga0307411_10663829 3300032005 Bacteria 904
631 Ga0307411_10882542 3300032005 Bacteria 793
632 Ga0307415_101471865 3300032126 Bacteria 651
633 Ga0373938_0254503 3300034957 Unclassified 503
634 Ga0373934_0232936 3300035086 Bacteria 760
635 Ga0373934_0339257 3300035086 Bacteria 625
636 Ga0373944_0019154 3300035089 Bacteria 1962
637 Ga0373944_0197300 3300035089 Bacteria 727
638 Ga0373949_0145543 3300035090 Unclassified 682
639 Ga0373952_0121088 3300035092 Bacteria 710
640 Ga0373923_0071308 3300035111 Bacteria 1492
641 Ga0373923_0071794 3300035111 Bacteria 1488
642 Ga0373923_0165713 3300035111 Bacteria 1010
643 Ga0373939_0432580 3300035114 Bacteria 551
644 Ga0373945_0388815 3300035116 Bacteria 610
645 Ga0373957_0216166 3300035120 Bacteria 802
646 Ga0373943_0002060 3300035170 Bacteria 9126
647 Ga0373943_0074453 3300035170 Bacteria 1727
648 Ga0373946_0052615 3300035171 Bacteria 1708
649 Ga0373946_0752039 3300035171 Bacteria 512
650 Ga0373955_0025745 3300035172 Bacteria 3024
651 Ga0373955_0849979 3300035172 Bacteria 561
652 Ga0373924_0061301 3300035410 Bacteria 1574
653 Ga0373924_0326752 3300035410 Unclassified 682
654 Ga0373931_0114227 3300035691 Bacteria 1536
655 Ga0373935_0031568 3300035692 Bacteria 3288
656 Ga0373935_0187728 3300035692 Bacteria 1422
657 Ga0373935_1273925 3300035692 Bacteria 549
658 Ga0373933_0130884 3300035724 Bacteria 1578
659 Ga0373933_0157692 3300035724 Bacteria 1440
660 Ga0373933_0287497 3300035724 Bacteria 1063
661 Ga0373947_0567984 3300035725 Bacteria 773
662 Ga0373947_1177998 3300035725 Bacteria 522
663 Ga0373937_0005339 3300036401 Bacteria 10984
664 Ga0373937_0184980 3300036401 Bacteria 1957
665 Ga0373937_0879082 3300036401 Bacteria 845
666 Ga0373937_1524045 3300036401 Bacteria 616
667 Ga0316584_0776980 3300036712 Bacteria 652
668 Ga0373925_0018283 3300037068 Bacteria 5094
669 Ga0373925_0272376 3300037068 Bacteria 1362
670 Ga0373925_1744196 3300037068 Bacteria 508
671 Ga0395905_1003327 3300037471 Bacteria 738
672 Ga0395901_0914130 3300038443 Bacteria 859
673 Ga0436365_1076714 3300039437 Bacteria 525
674 Ga0436363_1715776 3300039450 Bacteria 1296
675 Ga0439439_0110902 3300041406 Bacteria 760
676 Ga0439439_0188883 3300041406 Bacteria 596
677 Ga0439461_0015824 3300041410 Bacteria 1449
678 Ga0439431_0019362 3300041997 Bacteria 1618
679 Ga0439433_0063386 3300041999 Bacteria 884
680 Ga0439433_0131948 3300041999 Bacteria 635
681 Ga0439441_143064 3300042001 Bacteria 560
682 Ga0439442_111084 3300042002 Bacteria 597
683 Ga0439445_0071207 3300042004 Bacteria 962
684 Ga0439457_154071 3300042014 Unclassified 554
685 Ga0439462_0095891 3300042015 Bacteria 815
686 Ga0450913_035738 3300042117 Bacteria 504
687 Ga0450914_007175 3300042118 Bacteria 999
688 Ga0450919_015554 3300042121 Bacteria 859
689 Ga0450923_132438 3300042125 Bacteria 594
690 Ga0450923_176242 3300042125 Bacteria 525
691 Ga0450899_043125 3300042135 Bacteria 567
692 Ga0439446_0076259 3300042156 Bacteria 1032
693 Ga0439446_0302559 3300042156 Bacteria 562
694 Ga0439434_0346904 3300042435 Bacteria 518
695 Ga0439435_0021236 3300042436 Bacteria 1683
696 Ga0439460_0201751 3300042461 Unclassified 678
697 Ga0450916_002417 3300042530 Bacteria 1980
698 Ga0466963_0093661 3300044694 Bacteria 2048
699 Ga0466957_0566308 3300044842 Bacteria 793
700 Ga0466957_1389636 3300044842 Bacteria 511
701 Ga0451576_0381988 3300045051 Bacteria 1476
702 Ga0451576_0658830 3300045051 Bacteria 1100
703 Ga0466958_0543473 3300045836 Unclassified 755
704 Ga0466967_0292170 3300045976 Bacteria 1566
705 Ga0466967_0376346 3300045976 Bacteria 1378
706 Ga0495629_0131662 3300046459 Bacteria 1742
707 Ga0495653_0301137 3300046463 Bacteria 1046
708 Ga0495580_0014982 3300046472 Bacteria 5868
709 Ga0495580_0233519 3300046472 Bacteria 1262
710 Ga0495580_0544117 3300046472 Bacteria 772
711 Ga0495582_0070934 3300046473 Bacteria 1928
712 Ga0495582_0220090 3300046473 Bacteria 1086
713 Ga0495582_0296641 3300046473 Unclassified 929
714 Ga0495639_0272830 3300046475 Bacteria 839
715 Ga0495664_0859427 3300046477 Bacteria 532
716 Ga0495584_0241666 3300046491 Bacteria 918
717 Ga0495607_0557617 3300046501 Unclassified 502
718 Ga0495608_0012299 3300046511 Bacteria 5945
719 Ga0495618_0802628 3300046514 Bacteria 548
720 Ga0495628_0228239 3300046516 Bacteria 1396
721 Ga0495630_0009754 3300046517 Bacteria 6908
722 Ga0495644_0418528 3300046523 Bacteria 531
723 Ga0495663_0147208 3300046525 Unclassified 802
724 Ga0495663_0246035 3300046525 Bacteria 634
725 Ga0495642_0109405 3300046528 Bacteria 1181
726 Ga0495652_0920323 3300046529 Bacteria 576
727 Ga0495665_0200783 3300046531 Bacteria 1034
728 Ga0495640_0104848 3300046533 Bacteria 1853
729 Ga0495586_0229978 3300046535 Bacteria 1055
730 Ga0495587_0530135 3300046536 Bacteria 650
731 Ga0495598_0059059 3300046537 Bacteria 1178
732 Ga0495598_0379106 3300046537 Bacteria 549
733 Ga0495621_0021363 3300046539 Bacteria 2133
734 Ga0495645_0020969 3300046543 Bacteria 4722
735 Ga0495645_0120683 3300046543 Bacteria 1846
736 Ga0495667_0062310 3300046559 Bacteria 2444
737 Ga0495634_0036345 3300046642 Bacteria 3369
738 Ga0495634_0677071 3300046642 Bacteria 594
739 Ga0495659_0003619 3300046664 Bacteria 4916
740 Ga0495659_0005514 3300046664 Bacteria 3980
741 Ga0495659_0025516 3300046664 Unclassified 2024
742 Ga0495659_0166724 3300046664 Bacteria 892
743 Ga0495599_0073197 3300046678 Bacteria 2139
744 Ga0495623_0191271 3300046679 Unclassified 1182
745 Ga0495647_0035811 3300046681 Bacteria 1866
746 Ga0495658_0610340 3300046683 Bacteria 699
747 Ga0495658_0762113 3300046683 Unclassified 620
748 Ga0495669_0015946 3300046684 Bacteria 3217
749 Ga0495669_0021709 3300046684 Bacteria 2789
750 Ga0495669_0063803 3300046684 Bacteria 1671
751 Ga0495669_0273000 3300046684 Bacteria 813
752 Ga0495613_0025297 3300046689 Bacteria 4423
753 Ga0495613_0137695 3300046689 Bacteria 1746
754 Ga0495613_0211045 3300046689 Bacteria 1366
755 Ga0495670_0137215 3300046691 Bacteria 1277
756 Ga0495600_0905161 3300046809 Bacteria 520
757 Ga0495581_0755397 3300047315 Unclassified 559
758 Ga0495604_0017956 3300047317 Bacteria 5661
759 Ga0495636_0087571 3300047318 Bacteria 1348
760 Ga0495674_0067648 3300047319 Bacteria 3094
761 Ga0495674_0586113 3300047319 Bacteria 885
762 Ga0495676_0600377 3300047321 Bacteria 717
763 Ga0495684_0000708 3300047471 Bacteria 26781
764 Ga0496100_0590391 3300048903 Bacteria 862
765 Ga0496101_0014794 3300048904 Bacteria 5248
766 Ga0496101_0684025 3300048904 Bacteria 810
767 Ga0496102_0205105 3300048905 Bacteria 1859
768 Ga0496102_1439463 3300048905 Bacteria 608
769 Ga0496103_0730173 3300048906 Bacteria 627
770 Ga0496104_0067171 3300048907 Bacteria 3406
771 Ga0496104_0220225 3300048907 Bacteria 1810
772 Ga0496104_0310696 3300048907 Bacteria 1489
773 Ga0496104_1783911 3300048907 Bacteria 517
774 Ga0496105_0136508 3300048908 Bacteria 2021
775 Ga0496105_0340425 3300048908 Bacteria 1199
776 Ga0496105_0858082 3300048908 Unclassified 687
777 Ga0496105_0939709 3300048908 Bacteria 650
778 Ga0496106_0058855 3300048909 Bacteria 2910
779 Ga0496106_1180491 3300048909 Bacteria 597
780 Ga0496107_0044924 3300048910 Bacteria 3177
781 Ga0496107_1360245 3300048910 Bacteria 506
782 Ga0496108_0031357 3300048911 Bacteria 4410
783 Ga0496108_0691113 3300048911 Bacteria 885
784 Ga0496109_0305994 3300048912 Bacteria 1499
785 Ga0496109_1533222 3300048912 Bacteria 601
786 Ga0496111_1275914 3300048914 Bacteria 518
787 Ga0496112_0005771 3300048915 Bacteria 10767
788 Ga0496112_0723249 3300048915 Bacteria 923
789 Ga0496113_0034682 3300048916 Bacteria 3684
790 Ga0496113_0887772 3300048916 Bacteria 706
791 Ga0496114_0001773 3300048917 Bacteria 16367
792 Ga0496114_0086978 3300048917 Bacteria 2649
793 Ga0496114_0413880 3300048917 Bacteria 1194
794 Ga0496114_0430864 3300048917 Bacteria 1168
795 Ga0496115_0275417 3300048918 Bacteria 1382
796 Ga0501298_071887 3300049521 Bacteria 748
797 Ga0501303_022616 3300049526 Bacteria 681
798 Ga0501031_0120728 3300049568 Unclassified 1712
799 Ga0501031_0525262 3300049568 Bacteria 763
800 Ga0501034_0487037 3300049571 Bacteria 1148
801 Ga0501036_0177439 3300049572 Unclassified 1794
802 Ga0501036_0482882 3300049572 Bacteria 1031
803 Ga0501039_0279900 3300049575 Bacteria 1311
804 Ga0501039_0695082 3300049575 Unclassified 795
805 Ga0501039_0899423 3300049575 Bacteria 689
806 Ga0501040_0043348 3300049576 Bacteria 3067
807 Ga0501040_0380840 3300049576 Bacteria 1012
808 Ga0501041_0046435 3300049577 Bacteria 2642
809 Ga0501041_0796915 3300049577 Bacteria 606
810 Ga0501042_0074328 3300049578 Bacteria 2432
811 Ga0501042_0104830 3300049578 Unclassified 2034
812 Ga0501042_1454194 3300049578 Bacteria 500
813 Ga0501046_1274834 3300049580 Bacteria 503
814 Ga0501048_0730559 3300049582 Unclassified 711
815 Ga0501067_0086263 3300049583 Bacteria 1742
816 Ga0501067_0192042 3300049583 Bacteria 1137
817 Ga0501067_0313009 3300049583 Bacteria 874
818 Ga0501068_1002203 3300049584 Bacteria 551
819 Ga0501069_0130467 3300049585 Bacteria 1439
820 Ga0501069_0233051 3300049585 Bacteria 1072
821 Ga0501069_0409556 3300049585 Bacteria 803
822 Ga0501070_0498156 3300049586 Bacteria 979
823 Ga0501070_1400895 3300049586 Bacteria 531
824 Ga0501071_0049858 3300049587 Bacteria 3015
825 Ga0501071_1006618 3300049587 Bacteria 644
826 Ga0501072_0118355 3300049588 Bacteria 2111
827 Ga0501072_0643458 3300049588 Bacteria 835
828 Ga0501072_1351393 3300049588 Bacteria 552
829 Ga0501073_0311908 3300049589 Bacteria 1085
830 Ga0501073_0703349 3300049589 Bacteria 697
831 Ga0501075_0029589 3300049591 Bacteria 4051
832 Ga0501075_0509269 3300049591 Bacteria 918
833 Ga0501075_0863273 3300049591 Unclassified 688
834 Ga0501075_0900418 3300049591 Bacteria 673
835 Ga0501076_0020674 3300049592 Bacteria 5041
836 Ga0501076_0038819 3300049592 Bacteria 3738
837 Ga0501077_0158033 3300049593 Bacteria 1439
838 Ga0501077_0492697 3300049593 Bacteria 786
839 Ga0501202_104148 3300049652 Bacteria 695
840 Ga0501202_117112 3300049652 Bacteria 666
841 Ga0501217_136063 3300049661 Bacteria 724
842 Ga0501223_110949 3300049663 Bacteria 573
843 Ga0501233_177282 3300049668 Bacteria 609
844 Ga0501235_060937 3300049669 Bacteria 884
845 Ga0501235_067194 3300049669 Bacteria 845
846 Ga0501246_028413 3300049676 Bacteria 617
847 Ga0501250_093545 3300049680 Bacteria 527
848 Ga0501253_132174 3300049683 Bacteria 614
849 Ga0501257_252883 3300049686 Bacteria 523
850 Ga0501225_0323059 3300049705 Bacteria 528
851 Ga0501079_0170236 3300049741 Bacteria 1698
852 Ga0501079_0585385 3300049741 Unclassified 878
853 Ga0501080_0191594 3300049742 Bacteria 1879
854 Ga0501080_0277467 3300049742 Bacteria 1524
855 Ga0501080_1190980 3300049742 Bacteria 655
856 Ga0501080_1301288 3300049742 Bacteria 622
857 Ga0501081_0475537 3300049743 Bacteria 930
858 Ga0501081_0843471 3300049743 Bacteria 690
859 Ga0501083_0109139 3300049744 Bacteria 1820
860 Ga0501083_1025336 3300049744 Bacteria 537
861 Ga0501267_052310 3300049764 Bacteria 535
862 Ga0501045_0206518 3300049824 Bacteria 1463
863 Ga0501045_0458655 3300049824 Bacteria 947
864 Ga0501045_0708319 3300049824 Bacteria 743
865 nmdc:mga0yw44_77085_c1 3300050492 Bacteria 2082
866 nmdc:mga05p37_159134_c1 3300050507 Bacteria 2759
867 nmdc:mga05p37_2145374_c1 3300050507 Bacteria 521
868 nmdc:mga05p37_508498_c1 3300050507 Bacteria 1381
869 nmdc:mga05p37_731263_c1 3300050507 Unclassified 1094
870 nmdc:mga09592_132098_c1 3300050508 Bacteria 2149
871 nmdc:mga09592_47340_c1 3300050508 Bacteria 3624
872 nmdc:mga09592_689945_c1 3300050508 Unclassified 870
873 nmdc:mga0qj67_196749_c1 3300050509 Bacteria 1638
874 nmdc:mga0qj67_542498_c1 3300050509 Bacteria 933
875 nmdc:mga0qj67_79293_c1 3300050509 Bacteria 2630
876 nmdc:mga06r32_1300979_c1 3300050510 Bacteria 671
877 nmdc:mga06r32_1399123_c1 3300050510 Bacteria 641
878 nmdc:mga06r32_206418_c1 3300050510 Bacteria 1953
879 nmdc:mga06r32_230014_c1 3300050510 Bacteria 1842
880 nmdc:mga08y16_122055_c1 3300050511 Bacteria 2711
881 nmdc:mga08y16_178072_c1 3300050511 Bacteria 2208
882 nmdc:mga08y16_2530_c1 3300050511 Bacteria 18798
883 nmdc:mga08y16_30182_c1 3300050511 Bacteria 5707
884 nmdc:mga08y16_739192_c1 3300050511 Bacteria 981
885 nmdc:mga08y16_9801_c1 3300050511 Bacteria 10055
886 nmdc:mga0n895_163840_c1 3300050512 Bacteria 2255
887 nmdc:mga0n895_334464_c1 3300050512 Bacteria 1534
888 nmdc:mga0n895_3772_c1 3300050512 Bacteria 12268
889 nmdc:mga0n895_680843_c1 3300050512 Bacteria 1025
890 nmdc:mga0n895_707235_c1 3300050512 Bacteria 1003
891 nmdc:mga0n895_763846_c1 3300050512 Unclassified 959
892 nmdc:mga0rr50_131756_c1 3300050513 Bacteria 2002
893 nmdc:mga0rr50_27027_c1 3300050513 Bacteria 4013
894 nmdc:mga0rr50_360517_c1 3300050513 Bacteria 1223
895 nmdc:mga0rr50_524535_c1 3300050513 Bacteria 1008
896 nmdc:mga08x19_1249187_c1 3300050514 Unclassified 526
897 nmdc:mga0a205_1114263_c1 3300050515 Bacteria 637
898 nmdc:mga0a205_1215953_c1 3300050515 Unclassified 601
899 nmdc:mga0a205_14855_c1 3300050515 Bacteria 7267
900 nmdc:mga0a205_22196_c1 3300050515 Bacteria 6008
901 nmdc:mga0a205_710391_c1 3300050515 Bacteria 855
902 nmdc:mga0a205_815370_c1 3300050515 Bacteria 781
903 Ga0495601_0039829 3300053077 Bacteria 2943
904 Ga0495601_0233612 3300053077 Bacteria 1201
905 Ga0495612_0344317 3300053078 Bacteria 673
906 Ga0495595_0019085 3300053084 Bacteria 2971
907 Ga0495619_0015556 3300053085 Bacteria 4814
908 Ga0495619_0077072 3300053085 Bacteria 2239
909 Ga0501084_0097597 3300054114 Bacteria 2467
910 Ga0501084_0238430 3300054114 Bacteria 1535
911 Ga0501084_0689364 3300054114 Bacteria 862
912 Ga0501084_1122914 3300054114 Bacteria 660
913 Ga0587070_189482 3300059491 Bacteria 540
914 Ga0587091_064317 3300059511 Bacteria 787
915 Ga0587128_103075 3300059630 Bacteria 600
916 Ga0501082_0278086 3300060353 Bacteria 1457
917 Ga0501082_0502961 3300060353 Bacteria 1059
918 Ga0501082_0836031 3300060353 Bacteria 805
919 Ga0530510_0297596 3300061734 Unclassified 1207
920 Ga0530510_0303673 3300061734 Bacteria 1195
921 Ga0530510_0459447 3300061734 Bacteria 963
922 Ga0530510_0644811 3300061734 Bacteria 806
923 Ga0530510_1328528 3300061734 Bacteria 551
924 Ga0496108_0393467
925 JGI24737J22298_10160877
926 JGI24742J22300_10067528
927 Ga0058863_11942793
928 Ga0058861_11514866
929 Ga0058862_12227631
930 Ga0065714_10123868
931 Ga0065704_10006424
932 Ga0065704_10209307
933 Ga0065704_10288932
934 Ga0065704_10304264
935 Ga0065704_10397950
936 Ga0065704_10744257
937 Ga0065712_10032912
938 Ga0065712_10085353
939 Ga0065712_10091049
940 Ga0065712_10461986
941 Ga0065715_10000908
942 Ga0065715_10027509
943 Ga0065715_10036259
944 Ga0065715_10223050
945 Ga0065715_10224866
946 Ga0065715_10603148
947 Ga0065715_10915665
948 Ga0065707_10105001
949 Ga0065707_10203694
950 Ga0065707_10329184
951 Ga0065707_10701550
952 Ga0070676_10189530
953 Ga0070676_10255356
954 Ga0070683_100553375
955 Ga0070683_100658116
956 Ga0070683_100840049
957 Ga0070683_101652648
958 Ga0070690_100134887
959 Ga0070670_100031373
960 Ga0070670_100376385
961 Ga0070670_101075449
962 Ga0070670_102113895
963 Ga0070677_10297758
964 Ga0068869_100128890
965 Ga0068869_100342135
966 Ga0070666_10636188
967 Ga0070680_100528123
968 Ga0070680_101014220
969 Ga0068868_100644371
970 Ga0068868_100787238
971 Ga0070660_100243468
972 Ga0070689_100036559
973 Ga0070689_100752539
974 Ga0070689_100960214
975 Ga0070687_100022360
976 Ga0070661_100115308
977 Ga0070661_100230363
978 Ga0070661_100348071
979 Ga0070661_101055155
980 Ga0070661_101618286
981 Ga0070661_101949239
982 Ga0070692_10061365
983 Ga0070692_10510166
984 Ga0070692_10766598
985 Ga0070668_100071055
986 Ga0070668_101587567
987 Ga0070669_100008493
988 Ga0070669_100328715
989 Ga0070669_100754139
990 Ga0070669_101527425
991 Ga0070675_100027450
992 Ga0070675_100318945
993 Ga0070675_100424898
994 Ga0070675_102069838
995 Ga0070671_100003405
996 Ga0070671_100615431
997 Ga0070671_100809673
998 Ga0070671_101707890
999 Ga0070674_101088203
1000 Ga0070673_100383281
1001 Ga0070673_100695243
1002 Ga0070673_100756642
1003 Ga0070673_102405969
1004 Ga0070688_100364126
1005 Ga0070688_100409694
1006 Ga0070688_101438411
1007 Ga0070659_100211419
1008 Ga0070659_100663451
1009 Ga0070667_100109311
1010 Ga0070667_100832312
1011 Ga0070667_101338788
1012 Ga0070667_101644953
1013 Ga0070667_102205397
1014 Ga0070667_102272337
1015 Ga0070709_10729783
1016 Ga0070713_100106743
1017 Ga0070701_10015529
1018 Ga0070701_10016127
1019 Ga0070701_10124474
1020 Ga0070711_100107282
1021 Ga0070705_100015397
1022 Ga0070705_100370335
1023 Ga0070700_100074264
1024 Ga0070700_100424142
1025 Ga0070700_102009479
1026 Ga0070694_100173371
1027 Ga0070694_100216452
1028 Ga0070708_100015138
1029 Ga0070708_101213001
1030 Ga0070663_100654084
1031 Ga0070678_100289962
1032 Ga0070678_100445022
1033 Ga0070678_100462006
1034 Ga0070678_100907267
1035 Ga0070662_100033724
1036 Ga0070681_10106447
1037 Ga0070681_10795138
1038 Ga0070681_10803848
1039 Ga0070681_10893077
1040 Ga0070681_10953870
1041 Ga0068867_100043229
1042 Ga0068867_100044922
1043 Ga0068867_100320176
1044 Ga0068867_101485849
1045 Ga0070685_10116049
1046 Ga0070685_10289430
1047 Ga0070706_100194698
1048 Ga0070706_101207617
1049 Ga0070706_101818069
1050 Ga0070698_100170183
1051 Ga0070698_100188747
1052 Ga0070698_101703859
1053 Ga0070698_102112437
1054 Ga0070699_100014913
1055 Ga0070699_100228534
1056 Ga0070699_100523696
1057 Ga0070699_101905045
1058 Ga0070679_100110730
1059 Ga0070679_100344593
1060 Ga0070679_100359394
1061 Ga0070679_100490162
1062 Ga0070684_100220424
1063 Ga0070684_100332838
1064 Ga0070684_100378937
1065 Ga0070684_100986119
1066 Ga0070684_101522259
1067 Ga0070684_102205226
1068 Ga0070684_102226308
1069 Ga0070697_100411175
1070 Ga0068853_101695186
1071 Ga0068853_102205070
1072 Ga0070672_100065956
1073 Ga0070672_100241641
1074 Ga0070672_100558951
1075 Ga0070672_100677547
1076 Ga0070672_100841352
1077 Ga0070686_100107007
1078 Ga0070686_100584798
1079 Ga0070686_100836416
1080 Ga0070695_101020221
1081 Ga0070695_101326621
1082 Ga0070696_100028389
1083 Ga0070696_100700065
1084 Ga0070665_100086227
1085 Ga0070665_100164579
1086 Ga0070704_100005985
1087 Ga0070704_100175678
1088 Ga0070704_102040122
1089 Ga0070704_102077365
1090 Ga0068855_100379781
1091 Ga0070664_100218447
1092 Ga0070664_100365578
1093 Ga0070664_100468997
1094 Ga0070664_100627941
1095 Ga0070664_100663487
1096 Ga0070664_100787355
1097 Ga0070664_102164126
1098 Ga0068857_100039935
1099 Ga0068857_102126192
1100 Ga0068854_100357206
1101 Ga0068854_100546338
1102 Ga0068856_100258074
1103 Ga0068856_100494467
1104 Ga0070702_100183372
1105 Ga0070702_100535123
1106 Ga0070702_100870396
1107 Ga0068852_101155942
1108 Ga0068859_100013724
1109 Ga0068859_100038639
1110 Ga0068859_100100963
1111 Ga0068859_100448131
1112 Ga0068859_100561173
1113 Ga0068859_100885404
1114 Ga0068859_101949873
1115 Ga0068859_102708972
1116 Ga0068864_100026452
1117 Ga0068864_100058932
1118 Ga0068864_100130358
1119 Ga0068866_10293908
1120 Ga0068866_10379916
1121 Ga0068861_100006122
1122 Ga0068861_100187875
1123 Ga0068861_100203112
1124 Ga0068861_100735992
1125 Ga0068861_100939294
1126 Ga0068861_101575118
1127 Ga0068870_10000530
1128 Ga0068870_10246266
1129 Ga0068870_10365319
1130 Ga0068870_10384969
1131 Ga0068863_100073304
1132 Ga0068863_100291250
1133 Ga0068863_100715731
1134 Ga0068863_101107131
1135 Ga0068858_100110447
1136 Ga0068858_100381503
1137 Ga0068858_100463014
1138 Ga0068858_100641635
1139 Ga0068858_100796527
1140 Ga0068860_100030802
1141 Ga0068860_100108983
1142 Ga0068860_100152807
1143 Ga0068860_100277219
1144 Ga0068860_100382285
1145 Ga0068860_100791011
1146 Ga0068860_101726907
1147 Ga0068862_100001873
1148 Ga0068862_100171255
1149 Ga0068862_100285930
1150 Ga0068862_101091786
1151 Ga0068862_102376614
1152 Ga0081455_10253638
1153 Ga0081539_10000010
1154 Ga0070717_10219643
1155 Ga0075365_10019585
1156 Ga0075432_10332771
1157 Ga0070715_10301871
1158 Ga0070715_10503771
1159 Ga0070716_100435505
1160 Ga0070716_101279630
1161 Ga0070712_100226358
1162 Ga0097621_100066438
1163 Ga0097621_100076644
1164 Ga0097621_100111462
1165 Ga0097621_100139568
1166 Ga0097621_100179772
1167 Ga0097621_100728164
1168 Ga0097621_100874488
1169 Ga0097621_100936684
1170 Ga0068871_100059820
1171 Ga0068871_100099305
1172 Ga0068871_100121883
1173 Ga0068871_100180486
1174 Ga0068871_100199704
1175 Ga0075428_100063659
1176 Ga0075428_100445114
1177 Ga0075428_100454744
1178 Ga0075428_101734263
1179 Ga0075428_102202373
1180 Ga0075428_102262932
1181 Ga0075430_100072094
1182 Ga0075430_100117699
1183 Ga0075430_100225365
1184 Ga0075430_101322164
1185 Ga0075431_100015224
1186 Ga0075431_100034839
1187 Ga0075431_100043753
1188 Ga0075433_10005599
1189 Ga0075433_11347663
1190 Ga0075434_100004883
1191 Ga0075434_100068741
1192 Ga0075434_100203542
1193 Ga0075434_101066003
1194 Ga0075429_100053157
1195 Ga0075429_100073740
1196 Ga0075429_100243933
1197 Ga0075429_100466376
1198 Ga0068865_100051366
1199 Ga0068865_100070023
1200 Ga0068865_100388430
1201 Ga0068865_100395607
1202 Ga0068865_100533938
1203 Ga0075436_100005353
1204 Ga0097620_100013723
1205 Ga0097620_100038638
1206 Ga0097620_100100961
1207 Ga0097620_100448124
1208 Ga0097620_100561134
1209 Ga0097620_100885388
1210 Ga0097620_101949833
1211 Ga0097620_102709940
1212 Ga0075435_100002536
1213 Ga0075435_100529659
1214 Ga0075435_101094501
1215 Ga0075435_101236154
1216 Ga0105251_10562522
1217 Ga0105240_10010271
1218 Ga0105240_10131951
1219 Ga0105240_11109644
1220 Ga0111539_10007245
1221 Ga0111539_10154582
1222 Ga0111539_10362882
1223 Ga0111539_10979012
1224 Ga0111539_11396418
1225 Ga0111539_11583653
1226 Ga0111539_11618223
1227 Ga0111539_11772870
1228 Ga0105245_10120577
1229 Ga0105245_10294042
1230 Ga0105245_10767752
1231 Ga0105245_12129051
1232 Ga0105247_10006247
1233 Ga0105247_10007530
1234 Ga0105247_11443094
1235 Ga0114129_10017413
1236 Ga0114129_10074333
1237 Ga0114129_11413129
1238 Ga0114129_12977031
1239 Ga0105243_10615235
1240 Ga0105243_10719512
1241 Ga0105243_10837089
1242 Ga0105243_11465335
1243 Ga0105243_11550935
1244 Ga0105243_11761454
1245 Ga0105241_10475500
1246 Ga0105241_10932667
1247 Ga0105241_11274040
1248 Ga0105241_11700648
1249 Ga0105242_10409402
1250 Ga0105242_10635702
1251 Ga0105242_12755443
1252 Ga0105248_10023438
1253 Ga0105248_10067950
1254 Ga0105248_10148189
1255 Ga0105248_10318916
1256 Ga0105248_10595154
1257 Ga0105248_10633736
1258 Ga0105248_10672595
1259 Ga0105248_12696901
1260 Ga0105237_11124859
1261 Ga0105237_11899653
1262 Ga0105238_11546917
1263 Ga0105238_11582062
1264 Ga0105249_10017304
1265 Ga0105249_10056029
1266 Ga0105249_10067817
1267 Ga0105249_10093169
1268 Ga0105249_10465816
1269 Ga0105249_10822709
1270 Ga0105249_11308769
1271 Ga0105249_11656914
1272 Ga0105249_11996021
1273 Ga0105239_10684345
1274 Ga0105239_11781211
1275 Ga0105239_13067002
1276 Ga0105246_10400928
1277 Ga0105246_10496090
1278 Ga0105246_10799295
1279 Ga0105246_10966639
1280 Ga0105246_12248925
1281 Ga0157370_10500470
1282 Ga0157370_10643158
1283 Ga0157370_11110560
1284 Ga0157370_11609672
1285 Ga0157369_10260837
1286 Ga0157374_12577412
1287 Ga0157378_10061624
1288 Ga0157378_10227602
1289 Ga0157378_10348770
1290 Ga0157378_10388241
1291 Ga0157378_10859157
1292 Ga0163162_10244979
1293 Ga0163162_10966898
1294 Ga0163162_11798025
1295 Ga0163162_12030981
1296 Ga0163162_12406385
1297 Ga0163162_13158034
1298 Ga0157372_10202075
1299 Ga0157372_10528642
1300 Ga0157372_10545333
1301 Ga0157372_12539624
1302 Ga0157375_10025669
1303 Ga0157375_10665724
1304 Ga0157375_11269694
1305 Ga0157375_12031810
1306 Ga0157375_12890388
1307 Ga0157375_13070912
1308 Ga0163163_10048183
1309 Ga0163163_10177380
1310 Ga0163163_10219878
1311 Ga0163163_10869085
1312 Ga0163163_11510530
1313 Ga0163163_12014476
1314 Ga0157380_10210176
1315 Ga0157380_10379297
1316 Ga0157380_10431191
1317 Ga0157380_10456494
1318 Ga0157380_11560566
1319 Ga0157380_13157866
1320 Ga0157377_10473199
1321 Ga0157377_10562265
1322 Ga0157377_10735066
1323 Ga0157377_10791306
1324 Ga0157379_10042240
1325 Ga0157379_10095016
1326 Ga0157379_10910878
1327 Ga0157376_10031255
1328 Ga0157376_10093442
1329 Ga0157376_10166944
1330 Ga0157376_10216969
1331 Ga0157376_10275485
1332 Ga0157376_12110476
1333 Ga0182007_10400173
1334 Ga0163161_11272186
1335 Ga0206356_11684821
1336 Ga0206352_11127568
1337 Ga0207697_10140356
1338 Ga0207697_10143125
1339 Ga0207682_10182427
1340 Ga0207710_10025778
1341 Ga0207710_10065308
1342 Ga0207688_10716241
1343 Ga0207680_10736777
1344 Ga0207699_10642918
1345 Ga0207699_11138797
1346 Ga0207645_10073112
1347 Ga0207645_10130587
1348 Ga0207645_10646755
1349 Ga0207643_10001472
1350 Ga0207643_10242576
1351 Ga0207643_10363331
1352 Ga0207684_10399871
1353 Ga0207684_10592385
1354 Ga0207684_11342185
1355 Ga0207707_10029466
1356 Ga0207707_10346948
1357 Ga0207707_10443952
1358 Ga0207707_10776805
1359 Ga0207707_10779357
1360 Ga0207707_10787653
1361 Ga0207695_10146589
1362 Ga0207695_10708644
1363 Ga0207695_10944709
1364 Ga0207671_11604407
1365 Ga0207693_10152595
1366 Ga0207663_10890521
1367 Ga0207663_10945314
1368 Ga0207660_10262302
1369 Ga0207660_10543472
1370 Ga0207660_10579856
1371 Ga0207660_10826101
1372 Ga0207660_11391298
1373 Ga0207662_10064048
1374 Ga0207662_10323266
1375 Ga0207657_10214326
1376 Ga0207649_10083754
1377 Ga0207649_10420605
1378 Ga0207649_10554750
1379 Ga0207649_10640443
1380 Ga0207649_10668955
1381 Ga0207649_10950231
1382 Ga0207649_11377915
1383 Ga0207652_10125385
1384 Ga0207652_10309932
1385 Ga0207652_10467031
1386 Ga0207652_10578573
1387 Ga0207652_10894805
1388 Ga0207646_10143216
1389 Ga0207681_10002132
1390 Ga0207681_11076120
1391 Ga0207694_10479138
1392 Ga0207650_10185996
1393 Ga0207659_10010887
1394 Ga0207659_10061507
1395 Ga0207659_10332232
1396 Ga0207659_10335105
1397 Ga0207687_10560271
1398 Ga0207700_10088769
1399 Ga0207700_10378249
1400 Ga0207644_10010745
1401 Ga0207644_10210619
1402 Ga0207644_10747782
1403 Ga0207644_11612570
1404 Ga0207690_10774859
1405 Ga0207690_10824968
1406 Ga0207706_10275139
1407 Ga0207706_11087381
1408 Ga0207686_11052680
1409 Ga0207686_11095944
1410 Ga0207686_11382033
1411 Ga0207709_10096421
1412 Ga0207709_10546426
1413 Ga0207670_10021958
1414 Ga0207670_10034180
1415 Ga0207669_10259354
1416 Ga0207669_10284451
1417 Ga0207669_11075925
1418 Ga0207704_10342921
1419 Ga0207665_10153574
1420 Ga0207665_11248299
1421 Ga0207691_10236961
1422 Ga0207691_10399786
1423 Ga0207691_10510588
1424 Ga0207691_10632722
1425 Ga0207711_10003755
1426 Ga0207711_10410089
1427 Ga0207711_10432570
1428 Ga0207711_10954550
1429 Ga0207711_10987010
1430 Ga0207711_11514500
1431 Ga0207689_10068090
1432 Ga0207689_10111404
1433 Ga0207689_10115138
1434 Ga0207689_10141466
1435 Ga0207689_10459693
1436 Ga0207661_10086695
1437 Ga0207661_10563328
1438 Ga0207661_10595856
1439 Ga0207679_10110327
1440 Ga0207679_10386232
1441 Ga0207679_11036138
1442 Ga0207679_11548914
1443 Ga0207679_12127052
1444 Ga0207667_10360945
1445 Ga0207651_10155622
1446 Ga0207651_10200749
1447 Ga0207651_11036732
1448 Ga0207651_11710125
1449 Ga0207712_10049804
1450 Ga0207712_10089022
1451 Ga0207712_10918024
1452 Ga0207712_11323127
1453 Ga0207712_11699176
1454 Ga0207640_10719564
1455 Ga0207640_11721827
1456 Ga0207658_10083213
1457 Ga0207658_11295765
1458 Ga0207677_10551494
1459 Ga0207677_11138910
1460 Ga0207677_11148427
1461 Ga0207703_10004499
1462 Ga0207703_10023320
1463 Ga0207703_10079237
1464 Ga0207703_10166782
1465 Ga0207703_10185818
1466 Ga0207703_11345250
1467 Ga0207703_11566548
1468 Ga0207639_11776808
1469 Ga0207678_10274605
1470 Ga0207678_10983655
1471 Ga0207708_10013659
1472 Ga0207708_10517061
1473 Ga0207708_10827915
1474 Ga0207702_10315232
1475 Ga0207641_10079591
1476 Ga0207641_10184307
1477 Ga0207641_10608416
1478 Ga0207648_10005552
1479 Ga0207648_10037283
1480 Ga0207648_10619142
1481 Ga0207676_10026672
1482 Ga0207676_10056212
1483 Ga0207676_10323040
1484 Ga0207674_10023602
1485 Ga0207674_10252411
1486 Ga0207674_10339788
1487 Ga0207674_11409893
1488 Ga0207675_100012108
1489 Ga0207675_100107546
1490 Ga0207675_100217484
1491 Ga0207675_100638044
1492 Ga0207675_101035831
1493 Ga0207683_10048063
1494 Ga0207683_10324559
1495 Ga0207683_10452875
1496 Ga0209967_1083147
1497 Ga0209981_1061507
1498 Ga0209999_1081470
1499 Ga0209971_1016628
1500 Ga0209971_1130503
1501 Ga0209971_1133519
1502 Ga0209974_10187264
1503 Ga0207428_10000270
1504 Ga0207428_10018473
1505 Ga0207428_10474510
1506 Ga0207428_10807294
1507 Ga0268266_11381767
1508 Ga0268266_11894114
1509 Ga0268265_10000768
1510 Ga0268265_10086723
1511 Ga0268265_10162924
1512 Ga0268265_10377786
1513 Ga0268265_10464695
1514 Ga0268265_12562233
1515 Ga0268264_10012986
1516 Ga0268264_10678352
1517 Ga0268264_10731086
1518 Ga0268264_10736833
1519 Ga0268264_11034458
1520 Ga0268264_11276039
1521 Ga0265332_10011278
1522 Ga0265331_10135915
1523 Ga0265316_10585985
1524 Ga0307408_100127349
1525 Ga0307408_100391971
1526 Ga0307408_100438559
1527 Ga0307408_100528862
1528 Ga0265314_10032573
1529 Ga0265314_10115944
1530 Ga0265342_10715931
1531 Ga0307405_10048323
1532 Ga0307405_10339198
1533 Ga0307413_10934751
1534 Ga0307406_10611534
1535 Ga0307406_11555268
1536 Ga0307407_10026082
1537 Ga0307407_11408069
1538 Ga0307412_10237235
1539 Ga0307409_100314270
1540 Ga0307409_100342041
1541 Ga0307409_100485407
1542 Ga0307409_101583046
1543 Ga0307409_101769374
1544 Ga0307416_100033478
1545 Ga0307416_100041795
1546 Ga0307416_100286313
1547 Ga0307416_100515591
1548 Ga0307416_100579544
1549 Ga0307416_102893001
1550 Ga0307414_10406563
1551 Ga0307411_10008141
1552 Ga0307411_10056943
1553 Ga0307411_10663829
1554 Ga0307411_10882542
1555 Ga0307415_101471865
1556 Ga0373938_0254503
1557 Ga0373934_0232936
1558 Ga0373934_0339257
1559 Ga0373944_0019154
1560 Ga0373944_0197300
1561 Ga0373949_0145543
1562 Ga0373952_0121088
1563 Ga0373923_0071308
1564 Ga0373923_0071794
1565 Ga0373923_0165713
1566 Ga0373939_0432580
1567 Ga0373945_0388815
1568 Ga0373957_0216166
1569 Ga0373943_0002060
1570 Ga0373943_0074453
1571 Ga0373946_0052615
1572 Ga0373946_0752039
1573 Ga0373955_0025745
1574 Ga0373955_0849979
1575 Ga0373924_0061301
1576 Ga0373924_0326752
1577 Ga0373931_0114227
1578 Ga0373935_0031568
1579 Ga0373935_0187728
1580 Ga0373935_1273925
1581 Ga0373933_0130884
1582 Ga0373933_0157692
1583 Ga0373933_0287497
1584 Ga0373947_0567984
1585 Ga0373947_1177998
1586 Ga0373937_0005339
1587 Ga0373937_0184980
1588 Ga0373937_0879082
1589 Ga0373937_1524045
1590 Ga0316584_0776980
1591 Ga0373925_0018283
1592 Ga0373925_0272376
1593 Ga0373925_1744196
1594 Ga0395905_1003327
1595 Ga0395901_0914130
1596 Ga0436365_1076714
1597 Ga0436363_1715776
1598 Ga0439439_0110902
1599 Ga0439439_0188883
1600 Ga0439461_0015824
1601 Ga0439431_0019362
1602 Ga0439433_0063386
1603 Ga0439433_0131948
1604 Ga0439441_143064
1605 Ga0439442_111084
1606 Ga0439445_0071207
1607 Ga0439457_154071
1608 Ga0439462_0095891
1609 Ga0450913_035738
1610 Ga0450914_007175
1611 Ga0450919_015554
1612 Ga0450923_132438
1613 Ga0450923_176242
1614 Ga0450899_043125
1615 Ga0439446_0076259
1616 Ga0439446_0302559
1617 Ga0439434_0346904
1618 Ga0439435_0021236
1619 Ga0439460_0201751
1620 Ga0450916_002417
1621 Ga0466963_0093661
1622 Ga0466957_0566308
1623 Ga0466957_1389636
1624 Ga0451576_0381988
1625 Ga0451576_0658830
1626 Ga0466958_0543473
1627 Ga0466967_0292170
1628 Ga0466967_0376346
1629 Ga0495629_0131662
1630 Ga0495653_0301137
1631 Ga0495580_0014982
1632 Ga0495580_0233519
1633 Ga0495580_0544117
1634 Ga0495582_0070934
1635 Ga0495582_0220090
1636 Ga0495582_0296641
1637 Ga0495639_0272830
1638 Ga0495664_0859427
1639 Ga0495584_0241666
1640 Ga0495607_0557617
1641 Ga0495608_0012299
1642 Ga0495618_0802628
1643 Ga0495628_0228239
1644 Ga0495630_0009754
1645 Ga0495644_0418528
1646 Ga0495663_0147208
1647 Ga0495663_0246035
1648 Ga0495642_0109405
1649 Ga0495652_0920323
1650 Ga0495665_0200783
1651 Ga0495640_0104848
1652 Ga0495586_0229978
1653 Ga0495587_0530135
1654 Ga0495598_0059059
1655 Ga0495598_0379106
1656 Ga0495621_0021363
1657 Ga0495645_0020969
1658 Ga0495645_0120683
1659 Ga0495667_0062310
1660 Ga0495634_0036345
1661 Ga0495634_0677071
1662 Ga0495659_0003619
1663 Ga0495659_0005514
1664 Ga0495659_0025516
1665 Ga0495659_0166724
1666 Ga0495599_0073197
1667 Ga0495623_0191271
1668 Ga0495647_0035811
1669 Ga0495658_0610340
1670 Ga0495658_0762113
1671 Ga0495669_0015946
1672 Ga0495669_0021709
1673 Ga0495669_0063803
1674 Ga0495669_0273000
1675 Ga0495613_0025297
1676 Ga0495613_0137695
1677 Ga0495613_0211045
1678 Ga0495670_0137215
1679 Ga0495600_0905161
1680 Ga0495581_0755397
1681 Ga0495604_0017956
1682 Ga0495636_0087571
1683 Ga0495674_0067648
1684 Ga0495674_0586113
1685 Ga0495676_0600377
1686 Ga0495684_0000708
1687 Ga0496100_0590391
1688 Ga0496101_0014794
1689 Ga0496101_0684025
1690 Ga0496102_0205105
1691 Ga0496102_1439463
1692 Ga0496103_0730173
1693 Ga0496104_0067171
1694 Ga0496104_0220225
1695 Ga0496104_0310696
1696 Ga0496104_1783911
1697 Ga0496105_0136508
1698 Ga0496105_0340425
1699 Ga0496105_0858082
1700 Ga0496105_0939709
1701 Ga0496106_0058855
1702 Ga0496106_1180491
1703 Ga0496107_0044924
1704 Ga0496107_1360245
1705 Ga0496108_0031357
1706 Ga0496108_0691113
1707 Ga0496109_0305994
1708 Ga0496109_1533222
1709 Ga0496111_1275914
1710 Ga0496112_0005771
1711 Ga0496112_0723249
1712 Ga0496113_0034682
1713 Ga0496113_0887772
1714 Ga0496114_0001773
1715 Ga0496114_0086978
1716 Ga0496114_0413880
1717 Ga0496114_0430864
1718 Ga0496115_0275417
1719 Ga0501298_071887
1720 Ga0501303_022616
1721 Ga0501031_0120728
1722 Ga0501031_0525262
1723 Ga0501034_0487037
1724 Ga0501036_0177439
1725 Ga0501036_0482882
1726 Ga0501039_0279900
1727 Ga0501039_0695082
1728 Ga0501039_0899423
1729 Ga0501040_0043348
1730 Ga0501040_0380840
1731 Ga0501041_0046435
1732 Ga0501041_0796915
1733 Ga0501042_0074328
1734 Ga0501042_0104830
1735 Ga0501042_1454194
1736 Ga0501046_1274834
1737 Ga0501048_0730559
1738 Ga0501067_0086263
1739 Ga0501067_0192042
1740 Ga0501067_0313009
1741 Ga0501068_1002203
1742 Ga0501069_0130467
1743 Ga0501069_0233051
1744 Ga0501069_0409556
1745 Ga0501070_0498156
1746 Ga0501070_1400895
1747 Ga0501071_0049858
1748 Ga0501071_1006618
1749 Ga0501072_0118355
1750 Ga0501072_0643458
1751 Ga0501072_1351393
1752 Ga0501073_0311908
1753 Ga0501073_0703349
1754 Ga0501075_0029589
1755 Ga0501075_0509269
1756 Ga0501075_0863273
1757 Ga0501075_0900418
1758 Ga0501076_0020674
1759 Ga0501076_0038819
1760 Ga0501077_0158033
1761 Ga0501077_0492697
1762 Ga0501202_104148
1763 Ga0501202_117112
1764 Ga0501217_136063
1765 Ga0501223_110949
1766 Ga0501233_177282
1767 Ga0501235_060937
1768 Ga0501235_067194
1769 Ga0501246_028413
1770 Ga0501250_093545
1771 Ga0501253_132174
1772 Ga0501257_252883
1773 Ga0501225_0323059
1774 Ga0501079_0170236
1775 Ga0501079_0585385
1776 Ga0501080_0191594
1777 Ga0501080_0277467
1778 Ga0501080_1190980
1779 Ga0501080_1301288
1780 Ga0501081_0475537
1781 Ga0501081_0843471
1782 Ga0501083_0109139
1783 Ga0501083_1025336
1784 Ga0501267_052310
1785 Ga0501045_0206518
1786 Ga0501045_0458655
1787 Ga0501045_0708319
1788 nmdc:mga0yw44_77085_c1
1789 nmdc:mga05p37_159134_c1
1790 nmdc:mga05p37_2145374_c1
1791 nmdc:mga05p37_508498_c1
1792 nmdc:mga05p37_731263_c1
1793 nmdc:mga09592_132098_c1
1794 nmdc:mga09592_47340_c1
1795 nmdc:mga09592_689945_c1
1796 nmdc:mga0qj67_196749_c1
1797 nmdc:mga0qj67_542498_c1
1798 nmdc:mga0qj67_79293_c1
1799 nmdc:mga06r32_1300979_c1
1800 nmdc:mga06r32_1399123_c1
1801 nmdc:mga06r32_206418_c1
1802 nmdc:mga06r32_230014_c1
1803 nmdc:mga08y16_122055_c1
1804 nmdc:mga08y16_178072_c1
1805 nmdc:mga08y16_2530_c1
1806 nmdc:mga08y16_30182_c1
1807 nmdc:mga08y16_739192_c1
1808 nmdc:mga08y16_9801_c1
1809 nmdc:mga0n895_163840_c1
1810 nmdc:mga0n895_334464_c1
1811 nmdc:mga0n895_3772_c1
1812 nmdc:mga0n895_680843_c1
1813 nmdc:mga0n895_707235_c1
1814 nmdc:mga0n895_763846_c1
1815 nmdc:mga0rr50_131756_c1
1816 nmdc:mga0rr50_27027_c1
1817 nmdc:mga0rr50_360517_c1
1818 nmdc:mga0rr50_524535_c1
1819 nmdc:mga08x19_1249187_c1
1820 nmdc:mga0a205_1114263_c1
1821 nmdc:mga0a205_1215953_c1
1822 nmdc:mga0a205_14855_c1
1823 nmdc:mga0a205_22196_c1
1824 nmdc:mga0a205_710391_c1
1825 nmdc:mga0a205_815370_c1
1826 Ga0495601_0039829
1827 Ga0495601_0233612
1828 Ga0495612_0344317
1829 Ga0495595_0019085
1830 Ga0495619_0015556
1831 Ga0495619_0077072
1832 Ga0501084_0097597
1833 Ga0501084_0238430
1834 Ga0501084_0689364
1835 Ga0501084_1122914
1836 Ga0587070_189482
1837 Ga0587091_064317
1838 Ga0587128_103075
1839 Ga0501082_0278086
1840 Ga0501082_0502961
1841 Ga0501082_0836031
1842 Ga0530510_0297596
1843 Ga0530510_0303673
1844 Ga0530510_0459447
1845 Ga0530510_0644811
1846 Ga0530510_1328528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

22

109

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4llr-assembly1.cif.gz_E tryparedoxin peroxidase (txnpx) from trypanosoma cruzi in the reduced state 0.9267 29 45
2yjh-assembly1.cif.gz_A-2 thiol peroxidase from yersinia psuedotuberculosis, inactive mutant c61s 0.8164 29 45
7bid-assembly1.cif.gz_A crystal structure of v31wrap-t, a 7-bladed designer protein 0.7674 14 45
3bvt-assembly1.cif.gz_A golgi mannosidase ii d204a catalytic nucleophile mutant complex with methyl (alpha-d-mannopyranosyl)-(1->3)-s-alpha-d-mannopyranoside 0.7344 18 47
7nyq-assembly1.cif.gz_A crystal structure of the mei-p26 nhl domain 0.7327 18 47
ID Description Score Start End Superfamily
af_Q9VII8_88_347_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8938 19 42 2.130.10.10
af_I1LY15_249_372_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8783 19 45 2.40.128.630
af_Q8L4M1_148_366_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8743 19 45 2.130.10.10
af_Q99M63_392_513_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8296 28 45 2.40.128.630
af_Q54RP0_292_455_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8292 18 45 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2U7PH61-F1-model_v4 Nucleoid-associated protein 0.8949 3 85 GO:0003677
AF-A0A5N9B5C7-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.8936 3 85 GO:0003677
AF-A0A7V6UCI0-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.8181 2 87 GO:0003677
AF-A0A5N9B5C7-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.7971 3 85 GO:0003677
AF-A0A2U7PH61-F1-model_v4 Nucleoid-associated protein 0.7959 3 85 GO:0003677

Map