F485760
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 921 | 273 | 921 | 104 |
Family's Representative Sequence
| Representative Sequence | 3300025908|Ga0207643_10024141|Ga0207643_100241413 |
| Length | 103 |
| Sequence | MNFTAFKARIAEAGPERRRAGRSPIELDAKMRELGASGVDATILDVSERGFMAGAEGHFDVGARVWLIFPGRRERANAVVKWTAGDRIGAEFAEPVSLEVFRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 159 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 160 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 174 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 183 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 184 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 185 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 186 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 187 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 188 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 189 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 190 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 191 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 192 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 233 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 234 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 235 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 244 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 245 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 246 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 251 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 252 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 253 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 254 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 255 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 256 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 261 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 262 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 263 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 266 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 267 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 268 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 272 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 273 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 3.8 |
| Rhizosphere | 95.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1009132 | 3300001976 | Bacteria | 1293 |
| 2 | JGI24752J21851_1039449 | 3300001976 | Bacteria | 631 |
| 3 | JGI24746J21847_1015818 | 3300001977 | Bacteria | 1082 |
| 4 | JGI24740J21852_10004688 | 3300001979 | Bacteria | 5857 |
| 5 | JGI24739J22299_10003769 | 3300001989 | Bacteria | 5785 |
| 6 | JGI24743J22301_10003347 | 3300001991 | Bacteria | 2526 |
| 7 | JGI24735J21928_10158471 | 3300002067 | Bacteria | 654 |
| 8 | JGI24750J21931_1004215 | 3300002070 | Bacteria | 1736 |
| 9 | JGI24738J21930_10008755 | 3300002075 | Bacteria | 2295 |
| 10 | JGI24738J21930_10125198 | 3300002075 | Unclassified | 560 |
| 11 | JGI24744J21845_10000460 | 3300002077 | Bacteria | 7184 |
| 12 | JGI24744J21845_10065977 | 3300002077 | Unclassified | 661 |
| 13 | JGI24033J26618_1045495 | 3300002155 | Unclassified | 620 |
| 14 | JGI24034J26672_10004624 | 3300002239 | Bacteria | 1956 |
| 15 | JGI24034J26672_10007772 | 3300002239 | Bacteria | 1560 |
| 16 | JGI24742J22300_10032415 | 3300002244 | Bacteria | 916 |
| 17 | JGI25406J46586_10069732 | 3300003203 | Bacteria | 1107 |
| 18 | Ga0065714_10537038 | 3300005288 | Bacteria | 504 |
| 19 | Ga0065712_10221985 | 3300005290 | Bacteria | 1038 |
| 20 | Ga0065715_10000342 | 3300005293 | Bacteria | 14168 |
| 21 | Ga0065715_10192805 | 3300005293 | Unclassified | 1396 |
| 22 | Ga0065715_10623813 | 3300005293 | Unclassified | 694 |
| 23 | Ga0065707_10021840 | 3300005295 | Bacteria | 1325 |
| 24 | Ga0065707_10049454 | 3300005295 | Unclassified | 925 |
| 25 | Ga0065707_10263428 | 3300005295 | Bacteria | 1091 |
| 26 | Ga0070658_10009267 | 3300005327 | Bacteria | 7915 |
| 27 | Ga0070658_10055284 | 3300005327 | Bacteria | 3225 |
| 28 | Ga0070658_10461231 | 3300005327 | Bacteria | 1095 |
| 29 | Ga0070676_10056346 | 3300005328 | Bacteria | 2322 |
| 30 | Ga0070676_10057452 | 3300005328 | Bacteria | 2303 |
| 31 | Ga0070676_10128949 | 3300005328 | Bacteria | 1597 |
| 32 | Ga0070683_100007370 | 3300005329 | Bacteria | 9295 |
| 33 | Ga0070683_100371221 | 3300005329 | Bacteria | 1363 |
| 34 | Ga0070690_100189728 | 3300005330 | Bacteria | 1424 |
| 35 | Ga0070670_100003949 | 3300005331 | Bacteria | 12373 |
| 36 | Ga0070670_100020883 | 3300005331 | Bacteria | 5632 |
| 37 | Ga0070670_100073702 | 3300005331 | Bacteria | 2932 |
| 38 | Ga0070670_100091715 | 3300005331 | Bacteria | 2612 |
| 39 | Ga0070670_100152470 | 3300005331 | Bacteria | 2000 |
| 40 | Ga0070670_100511400 | 3300005331 | Bacteria | 1069 |
| 41 | Ga0070677_10001942 | 3300005333 | Bacteria | 6555 |
| 42 | Ga0070677_10004813 | 3300005333 | Bacteria | 4429 |
| 43 | Ga0070677_10031326 | 3300005333 | Bacteria | 2032 |
| 44 | Ga0070677_10350013 | 3300005333 | Bacteria | 765 |
| 45 | Ga0070677_10377162 | 3300005333 | Unclassified | 742 |
| 46 | Ga0068869_100055312 | 3300005334 | Bacteria | 2892 |
| 47 | Ga0068869_100909888 | 3300005334 | Unclassified | 762 |
| 48 | Ga0070666_10010746 | 3300005335 | Bacteria | 5728 |
| 49 | Ga0070666_10013349 | 3300005335 | Bacteria | 5208 |
| 50 | Ga0070666_10310298 | 3300005335 | Unclassified | 1124 |
| 51 | Ga0070666_11457574 | 3300005335 | Unclassified | 512 |
| 52 | Ga0070680_100059272 | 3300005336 | Bacteria | 3131 |
| 53 | Ga0070682_100044119 | 3300005337 | Bacteria | 2760 |
| 54 | Ga0070682_100222041 | 3300005337 | Bacteria | 1345 |
| 55 | Ga0068868_100105547 | 3300005338 | Bacteria | 2285 |
| 56 | Ga0070660_100003053 | 3300005339 | Bacteria | 11523 |
| 57 | Ga0070660_100031784 | 3300005339 | Bacteria | 3967 |
| 58 | Ga0070660_100164602 | 3300005339 | Bacteria | 1788 |
| 59 | Ga0070660_100529424 | 3300005339 | Unclassified | 982 |
| 60 | Ga0070660_100798926 | 3300005339 | Bacteria | 793 |
| 61 | Ga0070689_101079868 | 3300005340 | Unclassified | 717 |
| 62 | Ga0070661_100071853 | 3300005344 | Bacteria | 2546 |
| 63 | Ga0070661_100179470 | 3300005344 | Bacteria | 1610 |
| 64 | Ga0070661_100224617 | 3300005344 | Bacteria | 1441 |
| 65 | Ga0070661_100234169 | 3300005344 | Bacteria | 1412 |
| 66 | Ga0070661_100486956 | 3300005344 | Bacteria | 986 |
| 67 | Ga0070692_10006534 | 3300005345 | Bacteria | 5069 |
| 68 | Ga0070668_100024705 | 3300005347 | Bacteria | 4554 |
| 69 | Ga0070668_100264251 | 3300005347 | Bacteria | 1432 |
| 70 | Ga0070668_100305769 | 3300005347 | Bacteria | 1335 |
| 71 | Ga0070668_100324496 | 3300005347 | Bacteria | 1297 |
| 72 | Ga0070668_100358884 | 3300005347 | Unclassified | 1235 |
| 73 | Ga0070669_100025316 | 3300005353 | Bacteria | 4261 |
| 74 | Ga0070669_100060853 | 3300005353 | Bacteria | 2774 |
| 75 | Ga0070669_100075630 | 3300005353 | Bacteria | 2498 |
| 76 | Ga0070669_100171217 | 3300005353 | Bacteria | 1693 |
| 77 | Ga0070669_100301300 | 3300005353 | Bacteria | 1289 |
| 78 | Ga0070669_100773280 | 3300005353 | Unclassified | 815 |
| 79 | Ga0070675_100005746 | 3300005354 | Bacteria | 9488 |
| 80 | Ga0070675_100015032 | 3300005354 | Bacteria | 6114 |
| 81 | Ga0070675_100017347 | 3300005354 | Bacteria | 5719 |
| 82 | Ga0070675_100087324 | 3300005354 | Unclassified | 2608 |
| 83 | Ga0070675_101851322 | 3300005354 | Bacteria | 557 |
| 84 | Ga0070671_100007735 | 3300005355 | Bacteria | 8585 |
| 85 | Ga0070671_100012010 | 3300005355 | Bacteria | 6966 |
| 86 | Ga0070671_100016707 | 3300005355 | Bacteria | 5934 |
| 87 | Ga0070671_100034633 | 3300005355 | Bacteria | 4181 |
| 88 | Ga0070671_100193477 | 3300005355 | Bacteria | 1724 |
| 89 | Ga0070671_100282010 | 3300005355 | Bacteria | 1413 |
| 90 | Ga0070674_100073040 | 3300005356 | Bacteria | 2431 |
| 91 | Ga0070674_100116809 | 3300005356 | Bacteria | 1969 |
| 92 | Ga0070674_100546938 | 3300005356 | Bacteria | 971 |
| 93 | Ga0070673_100007157 | 3300005364 | Bacteria | 7331 |
| 94 | Ga0070673_100114318 | 3300005364 | Bacteria | 2243 |
| 95 | Ga0070673_100181720 | 3300005364 | Bacteria | 1801 |
| 96 | Ga0070673_100445345 | 3300005364 | Bacteria | 1164 |
| 97 | Ga0070673_100455048 | 3300005364 | Bacteria | 1152 |
| 98 | Ga0070673_100620826 | 3300005364 | Unclassified | 987 |
| 99 | Ga0070673_101581450 | 3300005364 | Bacteria | 619 |
| 100 | Ga0070688_100920959 | 3300005365 | Unclassified | 690 |
| 101 | Ga0070688_101553968 | 3300005365 | Bacteria | 539 |
| 102 | Ga0070659_100016115 | 3300005366 | Bacteria | 5608 |
| 103 | Ga0070659_100083662 | 3300005366 | Bacteria | 2551 |
| 104 | Ga0070659_100119374 | 3300005366 | Bacteria | 2134 |
| 105 | Ga0070659_100132886 | 3300005366 | Bacteria | 2022 |
| 106 | Ga0070659_100324129 | 3300005366 | Bacteria | 1288 |
| 107 | Ga0070659_101034369 | 3300005366 | Bacteria | 722 |
| 108 | Ga0070659_101327244 | 3300005366 | Unclassified | 638 |
| 109 | Ga0070667_100003813 | 3300005367 | Bacteria | 12811 |
| 110 | Ga0070667_100013452 | 3300005367 | Bacteria | 6764 |
| 111 | Ga0070667_100042585 | 3300005367 | Bacteria | 3809 |
| 112 | Ga0070667_100180950 | 3300005367 | Bacteria | 1864 |
| 113 | Ga0070667_100295403 | 3300005367 | Bacteria | 1458 |
| 114 | Ga0070667_100513443 | 3300005367 | Bacteria | 1099 |
| 115 | Ga0070714_100026253 | 3300005435 | Bacteria | 4812 |
| 116 | Ga0070714_100744508 | 3300005435 | Bacteria | 947 |
| 117 | Ga0070713_100299850 | 3300005436 | Bacteria | 1479 |
| 118 | Ga0070705_100219036 | 3300005440 | Bacteria | 1317 |
| 119 | Ga0070700_100074497 | 3300005441 | Bacteria | 2175 |
| 120 | Ga0070663_100077233 | 3300005455 | Bacteria | 2437 |
| 121 | Ga0070663_100108180 | 3300005455 | Bacteria | 2085 |
| 122 | Ga0070663_100180661 | 3300005455 | Bacteria | 1636 |
| 123 | Ga0070678_100042261 | 3300005456 | Bacteria | 3239 |
| 124 | Ga0070678_100136755 | 3300005456 | Bacteria | 1955 |
| 125 | Ga0070678_100238688 | 3300005456 | Bacteria | 1519 |
| 126 | Ga0070678_100466818 | 3300005456 | Bacteria | 1108 |
| 127 | Ga0070678_100566770 | 3300005456 | Bacteria | 1010 |
| 128 | Ga0070678_102182271 | 3300005456 | Unclassified | 525 |
| 129 | Ga0070662_100000256 | 3300005457 | Bacteria | 31436 |
| 130 | Ga0070662_100004584 | 3300005457 | Bacteria | 8750 |
| 131 | Ga0070662_100041923 | 3300005457 | Bacteria | 3268 |
| 132 | Ga0070662_100199220 | 3300005457 | Bacteria | 1588 |
| 133 | Ga0070662_100218919 | 3300005457 | Bacteria | 1518 |
| 134 | Ga0070662_100393567 | 3300005457 | Unclassified | 1142 |
| 135 | Ga0070681_10020408 | 3300005458 | Bacteria | 6641 |
| 136 | Ga0070681_10243452 | 3300005458 | Bacteria | 1712 |
| 137 | Ga0068867_100230823 | 3300005459 | Bacteria | 1496 |
| 138 | Ga0070685_10109552 | 3300005466 | Unclassified | 1699 |
| 139 | Ga0070685_10256148 | 3300005466 | Bacteria | 1161 |
| 140 | Ga0070679_100015769 | 3300005530 | Bacteria | 7269 |
| 141 | Ga0070684_100007613 | 3300005535 | Bacteria | 8441 |
| 142 | Ga0070684_100921082 | 3300005535 | Bacteria | 819 |
| 143 | Ga0068853_100075317 | 3300005539 | Bacteria | 2945 |
| 144 | Ga0068853_100116509 | 3300005539 | Bacteria | 2379 |
| 145 | Ga0068853_100118658 | 3300005539 | Bacteria | 2357 |
| 146 | Ga0068853_100325181 | 3300005539 | Bacteria | 1426 |
| 147 | Ga0068853_100538912 | 3300005539 | Bacteria | 1105 |
| 148 | Ga0070672_100000621 | 3300005543 | Bacteria | 20802 |
| 149 | Ga0070672_100009064 | 3300005543 | Bacteria | 6843 |
| 150 | Ga0070672_100032433 | 3300005543 | Bacteria | 3941 |
| 151 | Ga0070672_100143380 | 3300005543 | Bacteria | 1972 |
| 152 | Ga0070695_100173364 | 3300005545 | Bacteria | 1523 |
| 153 | Ga0070665_100008330 | 3300005548 | Bacteria | 10484 |
| 154 | Ga0070665_100032554 | 3300005548 | Bacteria | 5247 |
| 155 | Ga0070665_101633204 | 3300005548 | Unclassified | 652 |
| 156 | Ga0070704_100267828 | 3300005549 | Bacteria | 1410 |
| 157 | Ga0068855_100305229 | 3300005563 | Bacteria | 1762 |
| 158 | Ga0068855_100500959 | 3300005563 | Bacteria | 1320 |
| 159 | Ga0068855_100548208 | 3300005563 | Bacteria | 1252 |
| 160 | Ga0068855_101336798 | 3300005563 | Bacteria | 740 |
| 161 | Ga0070664_100024096 | 3300005564 | Bacteria | 5031 |
| 162 | Ga0070664_100041421 | 3300005564 | Bacteria | 3886 |
| 163 | Ga0070664_100060771 | 3300005564 | Bacteria | 3219 |
| 164 | Ga0070664_100156468 | 3300005564 | Bacteria | 2014 |
| 165 | Ga0070664_100221600 | 3300005564 | Bacteria | 1692 |
| 166 | Ga0070664_100335664 | 3300005564 | Bacteria | 1372 |
| 167 | Ga0070664_101655831 | 3300005564 | Unclassified | 606 |
| 168 | Ga0068857_100092398 | 3300005577 | Bacteria | 2709 |
| 169 | Ga0068857_100230276 | 3300005577 | Bacteria | 1694 |
| 170 | Ga0068854_100002116 | 3300005578 | Bacteria | 12177 |
| 171 | Ga0068854_100013400 | 3300005578 | Bacteria | 5380 |
| 172 | Ga0068854_100104529 | 3300005578 | Bacteria | 2128 |
| 173 | Ga0068854_100285104 | 3300005578 | Bacteria | 1331 |
| 174 | Ga0068854_100296893 | 3300005578 | Bacteria | 1306 |
| 175 | Ga0068854_100916976 | 3300005578 | Bacteria | 771 |
| 176 | Ga0068856_100014742 | 3300005614 | Bacteria | 7544 |
| 177 | Ga0068856_100532375 | 3300005614 | Bacteria | 1196 |
| 178 | Ga0068856_100596929 | 3300005614 | Unclassified | 1125 |
| 179 | Ga0068856_100976185 | 3300005614 | Bacteria | 866 |
| 180 | Ga0068856_101552637 | 3300005614 | Bacteria | 675 |
| 181 | Ga0068852_100005093 | 3300005616 | Bacteria | 9355 |
| 182 | Ga0068852_100176396 | 3300005616 | Bacteria | 2007 |
| 183 | Ga0068852_100263042 | 3300005616 | Unclassified | 1657 |
| 184 | Ga0068852_100296398 | 3300005616 | Bacteria | 1564 |
| 185 | Ga0068852_100419073 | 3300005616 | Bacteria | 1320 |
| 186 | Ga0068852_101815996 | 3300005616 | Bacteria | 632 |
| 187 | Ga0068859_100000965 | 3300005617 | Bacteria | 29425 |
| 188 | Ga0068859_100002392 | 3300005617 | Bacteria | 19100 |
| 189 | Ga0068859_100421982 | 3300005617 | Unclassified | 1430 |
| 190 | Ga0068859_100481772 | 3300005617 | Unclassified | 1336 |
| 191 | Ga0068864_100001110 | 3300005618 | Bacteria | 22495 |
| 192 | Ga0068864_100042715 | 3300005618 | Bacteria | 3879 |
| 193 | Ga0068864_100097177 | 3300005618 | Bacteria | 2607 |
| 194 | Ga0068861_100012250 | 3300005719 | Bacteria | 5980 |
| 195 | Ga0068861_100040656 | 3300005719 | Bacteria | 3479 |
| 196 | Ga0068861_101159756 | 3300005719 | Bacteria | 745 |
| 197 | Ga0068870_10467497 | 3300005840 | Unclassified | 834 |
| 198 | Ga0068870_10543471 | 3300005840 | Unclassified | 781 |
| 199 | Ga0068863_100001056 | 3300005841 | Bacteria | 27521 |
| 200 | Ga0068863_100022022 | 3300005841 | Bacteria | 6083 |
| 201 | Ga0068863_100183835 | 3300005841 | Bacteria | 2007 |
| 202 | Ga0068863_101367772 | 3300005841 | Unclassified | 715 |
| 203 | Ga0068858_100003145 | 3300005842 | Bacteria | 16530 |
| 204 | Ga0068858_100053942 | 3300005842 | Bacteria | 3718 |
| 205 | Ga0068858_100116228 | 3300005842 | Bacteria | 2500 |
| 206 | Ga0068860_100002768 | 3300005843 | Bacteria | 18241 |
| 207 | Ga0068860_100033071 | 3300005843 | Bacteria | 4965 |
| 208 | Ga0068860_100189793 | 3300005843 | Bacteria | 1988 |
| 209 | Ga0068860_100360498 | 3300005843 | Unclassified | 1432 |
| 210 | Ga0068862_100006991 | 3300005844 | Bacteria | 9367 |
| 211 | Ga0068862_100083541 | 3300005844 | Bacteria | 2773 |
| 212 | Ga0068862_100098570 | 3300005844 | Bacteria | 2553 |
| 213 | Ga0068862_100311880 | 3300005844 | Bacteria | 1450 |
| 214 | Ga0068862_100445065 | 3300005844 | Unclassified | 1220 |
| 215 | Ga0068862_101273713 | 3300005844 | Unclassified | 736 |
| 216 | Ga0081539_10079896 | 3300005985 | Bacteria | 1722 |
| 217 | Ga0075432_10120944 | 3300006058 | Bacteria | 984 |
| 218 | Ga0097621_100214655 | 3300006237 | Bacteria | 1675 |
| 219 | Ga0097621_100290134 | 3300006237 | Unclassified | 1442 |
| 220 | Ga0068871_100124012 | 3300006358 | Bacteria | 2185 |
| 221 | Ga0068871_101288821 | 3300006358 | Bacteria | 687 |
| 222 | Ga0075428_100122357 | 3300006844 | Bacteria | 2833 |
| 223 | Ga0075428_101057541 | 3300006844 | Bacteria | 858 |
| 224 | Ga0075434_100566715 | 3300006871 | Bacteria | 1155 |
| 225 | Ga0097620_100000965 | 3300006931 | Bacteria | 29425 |
| 226 | Ga0097620_100002392 | 3300006931 | Bacteria | 19100 |
| 227 | Ga0097620_100421983 | 3300006931 | Unclassified | 1430 |
| 228 | Ga0097620_100481782 | 3300006931 | Unclassified | 1336 |
| 229 | Ga0097620_101811394 | 3300006931 | Unclassified | 674 |
| 230 | Ga0075435_100715826 | 3300007076 | Unclassified | 870 |
| 231 | Ga0105250_10157958 | 3300009092 | Bacteria | 946 |
| 232 | Ga0111539_10058672 | 3300009094 | Bacteria | 4565 |
| 233 | Ga0114129_11445758 | 3300009147 | Bacteria | 847 |
| 234 | Ga0105243_10031560 | 3300009148 | Bacteria | 4085 |
| 235 | Ga0105243_10435221 | 3300009148 | Bacteria | 1227 |
| 236 | Ga0105243_11640159 | 3300009148 | Bacteria | 671 |
| 237 | Ga0105242_10505552 | 3300009176 | Unclassified | 1150 |
| 238 | Ga0105242_10866117 | 3300009176 | Unclassified | 900 |
| 239 | Ga0105248_10001320 | 3300009177 | Bacteria | 27621 |
| 240 | Ga0105248_10034268 | 3300009177 | Bacteria | 5676 |
| 241 | Ga0105248_10148348 | 3300009177 | Bacteria | 2646 |
| 242 | Ga0105248_10178322 | 3300009177 | Bacteria | 2395 |
| 243 | Ga0105249_10006738 | 3300009553 | Bacteria | 10007 |
| 244 | Ga0105249_10026708 | 3300009553 | Bacteria | 5205 |
| 245 | Ga0105249_13272175 | 3300009553 | Unclassified | 521 |
| 246 | Ga0105239_11303652 | 3300010375 | Bacteria | 838 |
| 247 | Ga0157373_10051714 | 3300013100 | Bacteria | 2925 |
| 248 | Ga0157373_10075054 | 3300013100 | Bacteria | 2385 |
| 249 | Ga0157373_10265257 | 3300013100 | Bacteria | 1215 |
| 250 | Ga0157373_10294398 | 3300013100 | Bacteria | 1151 |
| 251 | Ga0157371_10005811 | 3300013102 | Bacteria | 10323 |
| 252 | Ga0157371_10014319 | 3300013102 | Bacteria | 5990 |
| 253 | Ga0157371_10044524 | 3300013102 | Bacteria | 3160 |
| 254 | Ga0157371_10122350 | 3300013102 | Bacteria | 1850 |
| 255 | Ga0157371_10219230 | 3300013102 | Unclassified | 1366 |
| 256 | Ga0157370_10043289 | 3300013104 | Bacteria | 4334 |
| 257 | Ga0157370_10043428 | 3300013104 | Bacteria | 4326 |
| 258 | Ga0157370_10050194 | 3300013104 | Bacteria | 3989 |
| 259 | Ga0157370_10112664 | 3300013104 | Bacteria | 2542 |
| 260 | Ga0157370_10577023 | 3300013104 | Bacteria | 1030 |
| 261 | Ga0157374_10002253 | 3300013296 | Bacteria | 16246 |
| 262 | Ga0163162_10039027 | 3300013306 | Bacteria | 4741 |
| 263 | Ga0163162_10084100 | 3300013306 | Bacteria | 3257 |
| 264 | Ga0163162_10182809 | 3300013306 | Bacteria | 2223 |
| 265 | Ga0163162_12525842 | 3300013306 | Unclassified | 591 |
| 266 | Ga0157372_10121713 | 3300013307 | Bacteria | 2998 |
| 267 | Ga0157372_10136334 | 3300013307 | Bacteria | 2826 |
| 268 | Ga0157372_11121862 | 3300013307 | Bacteria | 910 |
| 269 | Ga0157375_10004680 | 3300013308 | Bacteria | 11902 |
| 270 | Ga0157375_10006077 | 3300013308 | Bacteria | 10533 |
| 271 | Ga0157375_10312902 | 3300013308 | Bacteria | 1735 |
| 272 | Ga0157375_10570887 | 3300013308 | Bacteria | 1292 |
| 273 | Ga0157375_11940302 | 3300013308 | Bacteria | 699 |
| 274 | Ga0163163_10002706 | 3300014325 | Bacteria | 14968 |
| 275 | Ga0163163_10006151 | 3300014325 | Bacteria | 10461 |
| 276 | Ga0163163_10129296 | 3300014325 | Bacteria | 2565 |
| 277 | Ga0157380_10001273 | 3300014326 | Bacteria | 16384 |
| 278 | Ga0157380_10006494 | 3300014326 | Bacteria | 8243 |
| 279 | Ga0157380_10063845 | 3300014326 | Bacteria | 2954 |
| 280 | Ga0157380_10449188 | 3300014326 | Bacteria | 1237 |
| 281 | Ga0157380_10970060 | 3300014326 | Unclassified | 881 |
| 282 | Ga0157377_10199658 | 3300014745 | Unclassified | 1269 |
| 283 | Ga0157379_10057778 | 3300014968 | Bacteria | 3467 |
| 284 | Ga0163161_10005360 | 3300017792 | Bacteria | 8915 |
| 285 | Ga0163161_10118313 | 3300017792 | Bacteria | 1988 |
| 286 | Ga0163161_10275217 | 3300017792 | Bacteria | 1319 |
| 287 | Ga0206354_11377068 | 3300020081 | Bacteria | 761 |
| 288 | Ga0206353_11229904 | 3300020082 | Bacteria | 1037 |
| 289 | Ga0213875_10008894 | 3300021388 | Bacteria | 5120 |
| 290 | Ga0207666_1016307 | 3300025271 | Bacteria | 1064 |
| 291 | Ga0207697_10000510 | 3300025315 | Bacteria | 21916 |
| 292 | Ga0207697_10075935 | 3300025315 | Unclassified | 1412 |
| 293 | Ga0207697_10076849 | 3300025315 | Bacteria | 1404 |
| 294 | Ga0207682_10000666 | 3300025893 | Bacteria | 16058 |
| 295 | Ga0207682_10001204 | 3300025893 | Bacteria | 11981 |
| 296 | Ga0207682_10200028 | 3300025893 | Bacteria | 918 |
| 297 | Ga0207682_10331620 | 3300025893 | Bacteria | 715 |
| 298 | Ga0207688_10015967 | 3300025901 | Bacteria | 4070 |
| 299 | Ga0207688_10076183 | 3300025901 | Bacteria | 1910 |
| 300 | Ga0207688_10831526 | 3300025901 | Bacteria | 585 |
| 301 | Ga0207680_10145261 | 3300025903 | Unclassified | 1576 |
| 302 | Ga0207680_10248209 | 3300025903 | Unclassified | 1229 |
| 303 | Ga0207647_10035461 | 3300025904 | Bacteria | 3179 |
| 304 | Ga0207647_10087887 | 3300025904 | Bacteria | 1856 |
| 305 | Ga0207645_10020395 | 3300025907 | Bacteria | 4339 |
| 306 | Ga0207645_10047307 | 3300025907 | Bacteria | 2747 |
| 307 | Ga0207645_10338725 | 3300025907 | Bacteria | 1005 |
| 308 | Ga0207643_10015753 | 3300025908 | Bacteria | 4117 |
| 309 | Ga0207643_10024141 | 3300025908 | Bacteria | 3355 |
| 310 | Ga0207705_10000493 | 3300025909 | Bacteria | 33656 |
| 311 | Ga0207705_10004948 | 3300025909 | Bacteria | 10002 |
| 312 | Ga0207705_10070386 | 3300025909 | Bacteria | 2535 |
| 313 | Ga0207705_10181581 | 3300025909 | Bacteria | 1588 |
| 314 | Ga0207705_10460663 | 3300025909 | Bacteria | 986 |
| 315 | Ga0207707_10077183 | 3300025912 | Bacteria | 2908 |
| 316 | Ga0207707_10705885 | 3300025912 | Bacteria | 847 |
| 317 | Ga0207660_10000770 | 3300025917 | Bacteria | 21320 |
| 318 | Ga0207660_10183644 | 3300025917 | Bacteria | 1625 |
| 319 | Ga0207657_10001607 | 3300025919 | Bacteria | 24285 |
| 320 | Ga0207657_10002261 | 3300025919 | Bacteria | 20877 |
| 321 | Ga0207657_10011972 | 3300025919 | Bacteria | 8582 |
| 322 | Ga0207657_10067574 | 3300025919 | Bacteria | 3039 |
| 323 | Ga0207657_10522752 | 3300025919 | Unclassified | 929 |
| 324 | Ga0207649_10031507 | 3300025920 | Bacteria | 3152 |
| 325 | Ga0207649_10082933 | 3300025920 | Bacteria | 2080 |
| 326 | Ga0207649_10121521 | 3300025920 | Bacteria | 1761 |
| 327 | Ga0207652_10000034 | 3300025921 | Bacteria | 138571 |
| 328 | Ga0207652_10819050 | 3300025921 | Bacteria | 826 |
| 329 | Ga0207652_11156691 | 3300025921 | Bacteria | 675 |
| 330 | Ga0207681_10015791 | 3300025923 | Bacteria | 4713 |
| 331 | Ga0207681_10075878 | 3300025923 | Bacteria | 2359 |
| 332 | Ga0207681_10492547 | 3300025923 | Bacteria | 1002 |
| 333 | Ga0207681_11112772 | 3300025923 | Bacteria | 663 |
| 334 | Ga0207681_11559780 | 3300025923 | Bacteria | 553 |
| 335 | Ga0207650_10003622 | 3300025925 | Bacteria | 10587 |
| 336 | Ga0207650_10008245 | 3300025925 | Bacteria | 7113 |
| 337 | Ga0207650_10060549 | 3300025925 | Bacteria | 2825 |
| 338 | Ga0207650_10082656 | 3300025925 | Bacteria | 2438 |
| 339 | Ga0207650_10123204 | 3300025925 | Bacteria | 2020 |
| 340 | Ga0207650_10189762 | 3300025925 | Bacteria | 1641 |
| 341 | Ga0207650_10469451 | 3300025925 | Bacteria | 1049 |
| 342 | Ga0207659_10011166 | 3300025926 | Bacteria | 5666 |
| 343 | Ga0207659_10029702 | 3300025926 | Bacteria | 3728 |
| 344 | Ga0207659_10660052 | 3300025926 | Unclassified | 894 |
| 345 | Ga0207664_10019856 | 3300025929 | Bacteria | 4973 |
| 346 | Ga0207664_10640677 | 3300025929 | Unclassified | 955 |
| 347 | Ga0207644_10020833 | 3300025931 | Bacteria | 4461 |
| 348 | Ga0207644_10034953 | 3300025931 | Bacteria | 3519 |
| 349 | Ga0207644_10038263 | 3300025931 | Bacteria | 3378 |
| 350 | Ga0207644_10061569 | 3300025931 | Bacteria | 2719 |
| 351 | Ga0207644_10134485 | 3300025931 | Bacteria | 1897 |
| 352 | Ga0207644_10239464 | 3300025931 | Bacteria | 1444 |
| 353 | Ga0207644_10999672 | 3300025931 | Unclassified | 702 |
| 354 | Ga0207644_11365796 | 3300025931 | Bacteria | 595 |
| 355 | Ga0207690_10103377 | 3300025932 | Bacteria | 2039 |
| 356 | Ga0207690_10140087 | 3300025932 | Bacteria | 1781 |
| 357 | Ga0207706_10000890 | 3300025933 | Bacteria | 30672 |
| 358 | Ga0207706_10007819 | 3300025933 | Bacteria | 9867 |
| 359 | Ga0207706_10037177 | 3300025933 | Bacteria | 4323 |
| 360 | Ga0207706_10038387 | 3300025933 | Bacteria | 4249 |
| 361 | Ga0207706_10059330 | 3300025933 | Bacteria | 3369 |
| 362 | Ga0207706_10103441 | 3300025933 | Bacteria | 2505 |
| 363 | Ga0207706_10321832 | 3300025933 | Bacteria | 1346 |
| 364 | Ga0207686_10206790 | 3300025934 | Unclassified | 1409 |
| 365 | Ga0207709_10025346 | 3300025935 | Bacteria | 3394 |
| 366 | Ga0207669_10007915 | 3300025937 | Bacteria | 4956 |
| 367 | Ga0207669_11845644 | 3300025937 | Unclassified | 516 |
| 368 | Ga0207704_10671387 | 3300025938 | Bacteria | 855 |
| 369 | Ga0207691_10003939 | 3300025940 | Bacteria | 14420 |
| 370 | Ga0207691_10011885 | 3300025940 | Bacteria | 8355 |
| 371 | Ga0207691_10122184 | 3300025940 | Bacteria | 2306 |
| 372 | Ga0207691_10422081 | 3300025940 | Bacteria | 1136 |
| 373 | Ga0207711_10000869 | 3300025941 | Bacteria | 29230 |
| 374 | Ga0207711_10006956 | 3300025941 | Bacteria | 9493 |
| 375 | Ga0207711_10014975 | 3300025941 | Bacteria | 6442 |
| 376 | Ga0207711_10541176 | 3300025941 | Bacteria | 1086 |
| 377 | Ga0207711_11029728 | 3300025941 | Bacteria | 763 |
| 378 | Ga0207689_10033527 | 3300025942 | Bacteria | 4267 |
| 379 | Ga0207661_10002726 | 3300025944 | Bacteria | 12149 |
| 380 | Ga0207661_10315491 | 3300025944 | Bacteria | 1404 |
| 381 | Ga0207679_10010992 | 3300025945 | Bacteria | 5841 |
| 382 | Ga0207679_10025832 | 3300025945 | Bacteria | 4044 |
| 383 | Ga0207679_10074289 | 3300025945 | Bacteria | 2575 |
| 384 | Ga0207679_10265420 | 3300025945 | Bacteria | 1466 |
| 385 | Ga0207679_10436606 | 3300025945 | Bacteria | 1158 |
| 386 | Ga0207679_11282581 | 3300025945 | Bacteria | 672 |
| 387 | Ga0207679_11384463 | 3300025945 | Unclassified | 645 |
| 388 | Ga0207679_11467147 | 3300025945 | Unclassified | 626 |
| 389 | Ga0207667_10198963 | 3300025949 | Bacteria | 2056 |
| 390 | Ga0207667_10443417 | 3300025949 | Bacteria | 1320 |
| 391 | Ga0207667_10503195 | 3300025949 | Bacteria | 1229 |
| 392 | Ga0207651_10050366 | 3300025960 | Bacteria | 2827 |
| 393 | Ga0207651_10142673 | 3300025960 | Bacteria | 1852 |
| 394 | Ga0207651_10394658 | 3300025960 | Bacteria | 1175 |
| 395 | Ga0207651_10679264 | 3300025960 | Bacteria | 906 |
| 396 | Ga0207651_10926739 | 3300025960 | Bacteria | 776 |
| 397 | Ga0207651_11041605 | 3300025960 | Unclassified | 732 |
| 398 | Ga0207651_11225135 | 3300025960 | Bacteria | 674 |
| 399 | Ga0207712_10019404 | 3300025961 | Bacteria | 4439 |
| 400 | Ga0207712_10070813 | 3300025961 | Bacteria | 2506 |
| 401 | Ga0207668_10000725 | 3300025972 | Bacteria | 20192 |
| 402 | Ga0207668_10026318 | 3300025972 | Bacteria | 3776 |
| 403 | Ga0207668_10083904 | 3300025972 | Bacteria | 2320 |
| 404 | Ga0207668_10153088 | 3300025972 | Bacteria | 1788 |
| 405 | Ga0207668_10739569 | 3300025972 | Unclassified | 867 |
| 406 | Ga0207668_11080095 | 3300025972 | Bacteria | 719 |
| 407 | Ga0207668_11297953 | 3300025972 | Unclassified | 655 |
| 408 | Ga0207668_11630469 | 3300025972 | Bacteria | 582 |
| 409 | Ga0207640_10025691 | 3300025981 | Bacteria | 3568 |
| 410 | Ga0207640_10253713 | 3300025981 | Bacteria | 1367 |
| 411 | Ga0207640_10365379 | 3300025981 | Bacteria | 1164 |
| 412 | Ga0207640_10372653 | 3300025981 | Bacteria | 1154 |
| 413 | Ga0207640_10852425 | 3300025981 | Bacteria | 793 |
| 414 | Ga0207658_10007821 | 3300025986 | Bacteria | 7282 |
| 415 | Ga0207658_10009361 | 3300025986 | Bacteria | 6645 |
| 416 | Ga0207658_10025755 | 3300025986 | Bacteria | 4119 |
| 417 | Ga0207658_10029662 | 3300025986 | Bacteria | 3866 |
| 418 | Ga0207658_10096726 | 3300025986 | Bacteria | 2303 |
| 419 | Ga0207677_10284952 | 3300026023 | Bacteria | 1358 |
| 420 | Ga0207703_10004152 | 3300026035 | Bacteria | 11945 |
| 421 | Ga0207703_10045425 | 3300026035 | Bacteria | 3533 |
| 422 | Ga0207639_10116150 | 3300026041 | Bacteria | 2190 |
| 423 | Ga0207639_10297016 | 3300026041 | Bacteria | 1426 |
| 424 | Ga0207639_10319798 | 3300026041 | Unclassified | 1377 |
| 425 | Ga0207678_10044966 | 3300026067 | Bacteria | 3818 |
| 426 | Ga0207678_10117829 | 3300026067 | Bacteria | 2266 |
| 427 | Ga0207678_10232981 | 3300026067 | Bacteria | 1577 |
| 428 | Ga0207678_10517942 | 3300026067 | Bacteria | 1041 |
| 429 | Ga0207678_10623058 | 3300026067 | Bacteria | 947 |
| 430 | Ga0207678_10672488 | 3300026067 | Bacteria | 910 |
| 431 | Ga0207708_10096219 | 3300026075 | Bacteria | 2288 |
| 432 | Ga0207702_10025645 | 3300026078 | Bacteria | 4893 |
| 433 | Ga0207702_10099610 | 3300026078 | Bacteria | 2562 |
| 434 | Ga0207641_10001513 | 3300026088 | Bacteria | 22775 |
| 435 | Ga0207641_10007946 | 3300026088 | Bacteria | 8794 |
| 436 | Ga0207641_10204660 | 3300026088 | Bacteria | 1822 |
| 437 | Ga0207648_10070738 | 3300026089 | Bacteria | 3041 |
| 438 | Ga0207648_11547694 | 3300026089 | Bacteria | 623 |
| 439 | Ga0207676_10006150 | 3300026095 | Bacteria | 8475 |
| 440 | Ga0207676_10059721 | 3300026095 | Bacteria | 3012 |
| 441 | Ga0207676_11361773 | 3300026095 | Bacteria | 705 |
| 442 | Ga0207674_10003678 | 3300026116 | Bacteria | 18711 |
| 443 | Ga0207675_100003414 | 3300026118 | Bacteria | 15508 |
| 444 | Ga0207675_100271249 | 3300026118 | Bacteria | 1646 |
| 445 | Ga0207675_101046344 | 3300026118 | Bacteria | 835 |
| 446 | Ga0207683_10004970 | 3300026121 | Bacteria | 11437 |
| 447 | Ga0207683_10086893 | 3300026121 | Bacteria | 2781 |
| 448 | Ga0207683_10171981 | 3300026121 | Bacteria | 1962 |
| 449 | Ga0207683_10205870 | 3300026121 | Bacteria | 1789 |
| 450 | Ga0207683_10238638 | 3300026121 | Bacteria | 1658 |
| 451 | Ga0207698_10038595 | 3300026142 | Bacteria | 3530 |
| 452 | Ga0207698_10152903 | 3300026142 | Bacteria | 2006 |
| 453 | Ga0207698_10237423 | 3300026142 | Bacteria | 1659 |
| 454 | Ga0207698_10299379 | 3300026142 | Bacteria | 1497 |
| 455 | Ga0207698_10309365 | 3300026142 | Bacteria | 1475 |
| 456 | Ga0209974_10012159 | 3300027876 | Bacteria | 2881 |
| 457 | Ga0209974_10111976 | 3300027876 | Bacteria | 961 |
| 458 | Ga0209974_10144322 | 3300027876 | Bacteria | 856 |
| 459 | Ga0207428_10412448 | 3300027907 | Bacteria | 988 |
| 460 | Ga0268266_10400797 | 3300028379 | Unclassified | 1297 |
| 461 | Ga0268266_10460885 | 3300028379 | Bacteria | 1209 |
| 462 | Ga0268266_10479549 | 3300028379 | Unclassified | 1185 |
| 463 | Ga0268266_10711599 | 3300028379 | Unclassified | 968 |
| 464 | Ga0268265_10010701 | 3300028380 | Bacteria | 6193 |
| 465 | Ga0268265_10045110 | 3300028380 | Bacteria | 3287 |
| 466 | Ga0268265_10060746 | 3300028380 | Bacteria | 2897 |
| 467 | Ga0268265_10072644 | 3300028380 | Bacteria | 2684 |
| 468 | Ga0268265_10139783 | 3300028380 | Bacteria | 2026 |
| 469 | Ga0268265_10309694 | 3300028380 | Bacteria | 1425 |
| 470 | Ga0268265_10485968 | 3300028380 | Unclassified | 1161 |
| 471 | Ga0268265_12686015 | 3300028380 | Bacteria | 503 |
| 472 | Ga0268264_10005781 | 3300028381 | Bacteria | 10486 |
| 473 | Ga0268264_10043533 | 3300028381 | Bacteria | 3721 |
| 474 | Ga0268264_10088307 | 3300028381 | Bacteria | 2668 |
| 475 | Ga0268264_10131081 | 3300028381 | Bacteria | 2222 |
| 476 | Ga0316177_1184040 | 3300030731 | Bacteria | 834 |
| 477 | Ga0314311_1253491 | 3300030733 | Bacteria | 586 |
| 478 | Ga0316182_1097813 | 3300030745 | Bacteria | 849 |
| 479 | Ga0316182_1143142 | 3300030745 | Bacteria | 1252 |
| 480 | Ga0307408_100038823 | 3300031548 | Bacteria | 3361 |
| 481 | Ga0307408_100059226 | 3300031548 | Bacteria | 2787 |
| 482 | Ga0307408_100125428 | 3300031548 | Bacteria | 1995 |
| 483 | Ga0307408_100190649 | 3300031548 | Bacteria | 1651 |
| 484 | Ga0307408_100217110 | 3300031548 | Bacteria | 1558 |
| 485 | Ga0307408_100259098 | 3300031548 | Bacteria | 1438 |
| 486 | Ga0307408_100264595 | 3300031548 | Bacteria | 1425 |
| 487 | Ga0307408_100268651 | 3300031548 | Bacteria | 1415 |
| 488 | Ga0307408_100481513 | 3300031548 | Bacteria | 1083 |
| 489 | Ga0307408_100631519 | 3300031548 | Bacteria | 955 |
| 490 | Ga0307408_100647229 | 3300031548 | Bacteria | 944 |
| 491 | Ga0307408_100976345 | 3300031548 | Bacteria | 779 |
| 492 | Ga0307408_102447223 | 3300031548 | Bacteria | 507 |
| 493 | Ga0307405_10011246 | 3300031731 | Bacteria | 4678 |
| 494 | Ga0307405_10043464 | 3300031731 | Bacteria | 2741 |
| 495 | Ga0307405_10083970 | 3300031731 | Bacteria | 2089 |
| 496 | Ga0307405_10124597 | 3300031731 | Bacteria | 1769 |
| 497 | Ga0307405_10131466 | 3300031731 | Bacteria | 1730 |
| 498 | Ga0307405_10138021 | 3300031731 | Bacteria | 1695 |
| 499 | Ga0307405_10138067 | 3300031731 | Bacteria | 1695 |
| 500 | Ga0307405_10154540 | 3300031731 | Bacteria | 1617 |
| 501 | Ga0307405_10194962 | 3300031731 | Bacteria | 1466 |
| 502 | Ga0307405_10277340 | 3300031731 | Bacteria | 1260 |
| 503 | Ga0307405_10279108 | 3300031731 | Bacteria | 1256 |
| 504 | Ga0307405_10428309 | 3300031731 | Unclassified | 1043 |
| 505 | Ga0307405_10580884 | 3300031731 | Bacteria | 911 |
| 506 | Ga0307405_11175306 | 3300031731 | Unclassified | 662 |
| 507 | Ga0307413_10001771 | 3300031824 | Bacteria | 8446 |
| 508 | Ga0307413_10002336 | 3300031824 | Bacteria | 7697 |
| 509 | Ga0307413_10008144 | 3300031824 | Bacteria | 4926 |
| 510 | Ga0307413_10008954 | 3300031824 | Bacteria | 4759 |
| 511 | Ga0307413_10016330 | 3300031824 | Bacteria | 3832 |
| 512 | Ga0307413_10029579 | 3300031824 | Bacteria | 3067 |
| 513 | Ga0307413_10033208 | 3300031824 | Bacteria | 2935 |
| 514 | Ga0307413_10055905 | 3300031824 | Bacteria | 2404 |
| 515 | Ga0307413_10064778 | 3300031824 | Bacteria | 2272 |
| 516 | Ga0307413_10116366 | 3300031824 | Bacteria | 1801 |
| 517 | Ga0307413_10136481 | 3300031824 | Bacteria | 1687 |
| 518 | Ga0307413_10154946 | 3300031824 | Bacteria | 1601 |
| 519 | Ga0307413_10156783 | 3300031824 | Bacteria | 1594 |
| 520 | Ga0307413_10188188 | 3300031824 | Bacteria | 1479 |
| 521 | Ga0307413_10203533 | 3300031824 | Bacteria | 1431 |
| 522 | Ga0307413_10213513 | 3300031824 | Bacteria | 1403 |
| 523 | Ga0307413_10237763 | 3300031824 | Bacteria | 1342 |
| 524 | Ga0307413_10247035 | 3300031824 | Bacteria | 1321 |
| 525 | Ga0307413_10258212 | 3300031824 | Bacteria | 1297 |
| 526 | Ga0307413_10404179 | 3300031824 | Unclassified | 1071 |
| 527 | Ga0307413_10423977 | 3300031824 | Bacteria | 1049 |
| 528 | Ga0307413_10538999 | 3300031824 | Bacteria | 944 |
| 529 | Ga0307413_10544462 | 3300031824 | Bacteria | 940 |
| 530 | Ga0307413_10861511 | 3300031824 | Bacteria | 766 |
| 531 | Ga0307413_11559135 | 3300031824 | Bacteria | 585 |
| 532 | Ga0307413_11651324 | 3300031824 | Unclassified | 570 |
| 533 | Ga0307413_12173076 | 3300031824 | Bacteria | 503 |
| 534 | Ga0307410_10001869 | 3300031852 | Bacteria | 9823 |
| 535 | Ga0307410_10021946 | 3300031852 | Bacteria | 3937 |
| 536 | Ga0307410_10037798 | 3300031852 | Bacteria | 3157 |
| 537 | Ga0307410_10039136 | 3300031852 | Bacteria | 3111 |
| 538 | Ga0307410_10042410 | 3300031852 | Bacteria | 3007 |
| 539 | Ga0307410_10054664 | 3300031852 | Bacteria | 2708 |
| 540 | Ga0307410_10059083 | 3300031852 | Bacteria | 2616 |
| 541 | Ga0307410_10059636 | 3300031852 | Bacteria | 2605 |
| 542 | Ga0307410_10081003 | 3300031852 | Bacteria | 2279 |
| 543 | Ga0307410_10082595 | 3300031852 | Bacteria | 2260 |
| 544 | Ga0307410_10089222 | 3300031852 | Bacteria | 2184 |
| 545 | Ga0307410_10131359 | 3300031852 | Bacteria | 1840 |
| 546 | Ga0307410_10135516 | 3300031852 | Bacteria | 1814 |
| 547 | Ga0307410_10160115 | 3300031852 | Bacteria | 1685 |
| 548 | Ga0307410_10187073 | 3300031852 | Bacteria | 1572 |
| 549 | Ga0307410_10261634 | 3300031852 | Bacteria | 1349 |
| 550 | Ga0307410_10304114 | 3300031852 | Unclassified | 1259 |
| 551 | Ga0307410_10323457 | 3300031852 | Bacteria | 1224 |
| 552 | Ga0307410_10329220 | 3300031852 | Bacteria | 1214 |
| 553 | Ga0307410_10437140 | 3300031852 | Unclassified | 1064 |
| 554 | Ga0307410_10517971 | 3300031852 | Bacteria | 984 |
| 555 | Ga0307410_10552959 | 3300031852 | Bacteria | 954 |
| 556 | Ga0307410_10566358 | 3300031852 | Bacteria | 943 |
| 557 | Ga0307410_10653028 | 3300031852 | Bacteria | 882 |
| 558 | Ga0307410_11162054 | 3300031852 | Bacteria | 671 |
| 559 | Ga0307406_10006455 | 3300031901 | Bacteria | 6473 |
| 560 | Ga0307406_10012269 | 3300031901 | Bacteria | 4885 |
| 561 | Ga0307406_10043664 | 3300031901 | Bacteria | 2804 |
| 562 | Ga0307406_10055483 | 3300031901 | Bacteria | 2533 |
| 563 | Ga0307406_10060567 | 3300031901 | Bacteria | 2441 |
| 564 | Ga0307406_10102367 | 3300031901 | Bacteria | 1953 |
| 565 | Ga0307406_10113468 | 3300031901 | Bacteria | 1870 |
| 566 | Ga0307406_10140868 | 3300031901 | Bacteria | 1707 |
| 567 | Ga0307406_10174190 | 3300031901 | Bacteria | 1560 |
| 568 | Ga0307406_10181255 | 3300031901 | Unclassified | 1533 |
| 569 | Ga0307406_10304127 | 3300031901 | Unclassified | 1226 |
| 570 | Ga0307406_10306583 | 3300031901 | Bacteria | 1222 |
| 571 | Ga0307406_10489556 | 3300031901 | Unclassified | 995 |
| 572 | Ga0307406_10613412 | 3300031901 | Bacteria | 898 |
| 573 | Ga0307406_10776530 | 3300031901 | Bacteria | 806 |
| 574 | Ga0307407_10002443 | 3300031903 | Bacteria | 7273 |
| 575 | Ga0307407_10012359 | 3300031903 | Bacteria | 4100 |
| 576 | Ga0307407_10041126 | 3300031903 | Bacteria | 2583 |
| 577 | Ga0307407_10048701 | 3300031903 | Bacteria | 2414 |
| 578 | Ga0307407_10059400 | 3300031903 | Bacteria | 2227 |
| 579 | Ga0307407_10078457 | 3300031903 | Bacteria | 1989 |
| 580 | Ga0307407_10091386 | 3300031903 | Unclassified | 1866 |
| 581 | Ga0307407_10125721 | 3300031903 | Bacteria | 1633 |
| 582 | Ga0307407_10152681 | 3300031903 | Bacteria | 1502 |
| 583 | Ga0307407_10317230 | 3300031903 | Bacteria | 1092 |
| 584 | Ga0307407_10793923 | 3300031903 | Bacteria | 720 |
| 585 | Ga0307407_10938900 | 3300031903 | Bacteria | 666 |
| 586 | Ga0307407_11026549 | 3300031903 | Unclassified | 638 |
| 587 | Ga0307412_10001264 | 3300031911 | Bacteria | 14180 |
| 588 | Ga0307412_10033438 | 3300031911 | Bacteria | 3268 |
| 589 | Ga0307412_10035218 | 3300031911 | Bacteria | 3196 |
| 590 | Ga0307412_10046038 | 3300031911 | Bacteria | 2855 |
| 591 | Ga0307412_10046929 | 3300031911 | Bacteria | 2833 |
| 592 | Ga0307412_10049072 | 3300031911 | Bacteria | 2780 |
| 593 | Ga0307412_10054484 | 3300031911 | Bacteria | 2655 |
| 594 | Ga0307412_10063207 | 3300031911 | Bacteria | 2496 |
| 595 | Ga0307412_10081414 | 3300031911 | Bacteria | 2239 |
| 596 | Ga0307412_10110125 | 3300031911 | Bacteria | 1964 |
| 597 | Ga0307412_10115219 | 3300031911 | Bacteria | 1926 |
| 598 | Ga0307412_10124621 | 3300031911 | Bacteria | 1861 |
| 599 | Ga0307412_10170707 | 3300031911 | Bacteria | 1626 |
| 600 | Ga0307412_10190102 | 3300031911 | Bacteria | 1551 |
| 601 | Ga0307412_10235997 | 3300031911 | Bacteria | 1411 |
| 602 | Ga0307412_10257255 | 3300031911 | Bacteria | 1359 |
| 603 | Ga0307412_10381110 | 3300031911 | Bacteria | 1142 |
| 604 | Ga0307412_10397387 | 3300031911 | Bacteria | 1121 |
| 605 | Ga0307412_10492759 | 3300031911 | Bacteria | 1018 |
| 606 | Ga0307412_10567763 | 3300031911 | Bacteria | 955 |
| 607 | Ga0307412_10794928 | 3300031911 | Bacteria | 821 |
| 608 | Ga0307412_11482037 | 3300031911 | Unclassified | 616 |
| 609 | Ga0307409_100013167 | 3300031995 | Bacteria | 5309 |
| 610 | Ga0307409_100023744 | 3300031995 | Bacteria | 4258 |
| 611 | Ga0307409_100047278 | 3300031995 | Bacteria | 3264 |
| 612 | Ga0307409_100068164 | 3300031995 | Bacteria | 2813 |
| 613 | Ga0307409_100083371 | 3300031995 | Bacteria | 2592 |
| 614 | Ga0307409_100113150 | 3300031995 | Bacteria | 2280 |
| 615 | Ga0307409_100118372 | 3300031995 | Bacteria | 2237 |
| 616 | Ga0307409_100139974 | 3300031995 | Bacteria | 2083 |
| 617 | Ga0307409_100215569 | 3300031995 | Bacteria | 1729 |
| 618 | Ga0307409_100234174 | 3300031995 | Bacteria | 1667 |
| 619 | Ga0307409_100260127 | 3300031995 | Bacteria | 1592 |
| 620 | Ga0307409_100266826 | 3300031995 | Bacteria | 1574 |
| 621 | Ga0307409_100355106 | 3300031995 | Bacteria | 1384 |
| 622 | Ga0307409_100365798 | 3300031995 | Unclassified | 1366 |
| 623 | Ga0307409_100388225 | 3300031995 | Bacteria | 1329 |
| 624 | Ga0307409_100457334 | 3300031995 | Bacteria | 1233 |
| 625 | Ga0307409_100467714 | 3300031995 | Unclassified | 1220 |
| 626 | Ga0307409_100589590 | 3300031995 | Bacteria | 1097 |
| 627 | Ga0307409_100679104 | 3300031995 | Bacteria | 1027 |
| 628 | Ga0307409_100746069 | 3300031995 | Bacteria | 982 |
| 629 | Ga0307409_100768581 | 3300031995 | Unclassified | 968 |
| 630 | Ga0307409_101030005 | 3300031995 | Bacteria | 842 |
| 631 | Ga0307409_101076553 | 3300031995 | Bacteria | 824 |
| 632 | Ga0307409_101951770 | 3300031995 | Bacteria | 616 |
| 633 | Ga0307416_100004713 | 3300032002 | Bacteria | 8265 |
| 634 | Ga0307416_100007264 | 3300032002 | Bacteria | 7022 |
| 635 | Ga0307416_100021040 | 3300032002 | Bacteria | 4672 |
| 636 | Ga0307416_100024485 | 3300032002 | Bacteria | 4408 |
| 637 | Ga0307416_100026809 | 3300032002 | Bacteria | 4253 |
| 638 | Ga0307416_100055032 | 3300032002 | Bacteria | 3201 |
| 639 | Ga0307416_100132600 | 3300032002 | Bacteria | 2246 |
| 640 | Ga0307416_100140905 | 3300032002 | Bacteria | 2191 |
| 641 | Ga0307416_100218482 | 3300032002 | Bacteria | 1825 |
| 642 | Ga0307416_100235767 | 3300032002 | Bacteria | 1768 |
| 643 | Ga0307416_100275975 | 3300032002 | Bacteria | 1654 |
| 644 | Ga0307416_100305517 | 3300032002 | Bacteria | 1584 |
| 645 | Ga0307416_100515801 | 3300032002 | Bacteria | 1262 |
| 646 | Ga0307416_100561132 | 3300032002 | Bacteria | 1216 |
| 647 | Ga0307416_100564115 | 3300032002 | Bacteria | 1214 |
| 648 | Ga0307416_100583852 | 3300032002 | Bacteria | 1195 |
| 649 | Ga0307416_100798976 | 3300032002 | Bacteria | 1039 |
| 650 | Ga0307416_100895853 | 3300032002 | Bacteria | 987 |
| 651 | Ga0307416_101589657 | 3300032002 | Unclassified | 759 |
| 652 | Ga0307414_10008846 | 3300032004 | Bacteria | 5745 |
| 653 | Ga0307414_10023731 | 3300032004 | Bacteria | 3896 |
| 654 | Ga0307414_10034489 | 3300032004 | Bacteria | 3356 |
| 655 | Ga0307414_10039269 | 3300032004 | Bacteria | 3187 |
| 656 | Ga0307414_10039374 | 3300032004 | Bacteria | 3183 |
| 657 | Ga0307414_10043181 | 3300032004 | Bacteria | 3069 |
| 658 | Ga0307414_10043610 | 3300032004 | Bacteria | 3057 |
| 659 | Ga0307414_10058070 | 3300032004 | Bacteria | 2724 |
| 660 | Ga0307414_10063874 | 3300032004 | Bacteria | 2618 |
| 661 | Ga0307414_10067561 | 3300032004 | Bacteria | 2561 |
| 662 | Ga0307414_10069348 | 3300032004 | Bacteria | 2534 |
| 663 | Ga0307414_10069486 | 3300032004 | Bacteria | 2532 |
| 664 | Ga0307414_10081161 | 3300032004 | Bacteria | 2374 |
| 665 | Ga0307414_10092871 | 3300032004 | Bacteria | 2248 |
| 666 | Ga0307414_10095382 | 3300032004 | Bacteria | 2223 |
| 667 | Ga0307414_10099355 | 3300032004 | Bacteria | 2186 |
| 668 | Ga0307414_10105829 | 3300032004 | Bacteria | 2128 |
| 669 | Ga0307414_10107610 | 3300032004 | Bacteria | 2113 |
| 670 | Ga0307414_10109688 | 3300032004 | Bacteria | 2097 |
| 671 | Ga0307414_10161041 | 3300032004 | Bacteria | 1782 |
| 672 | Ga0307414_10167023 | 3300032004 | Bacteria | 1755 |
| 673 | Ga0307414_10179950 | 3300032004 | Unclassified | 1699 |
| 674 | Ga0307414_10189864 | 3300032004 | Bacteria | 1661 |
| 675 | Ga0307414_10197111 | 3300032004 | Bacteria | 1635 |
| 676 | Ga0307414_10362071 | 3300032004 | Unclassified | 1248 |
| 677 | Ga0307414_10473557 | 3300032004 | Bacteria | 1103 |
| 678 | Ga0307414_10512165 | 3300032004 | Bacteria | 1063 |
| 679 | Ga0307414_10577268 | 3300032004 | Bacteria | 1005 |
| 680 | Ga0307414_10659307 | 3300032004 | Bacteria | 944 |
| 681 | Ga0307414_10681532 | 3300032004 | Bacteria | 929 |
| 682 | Ga0307414_10819584 | 3300032004 | Unclassified | 849 |
| 683 | Ga0307414_10929000 | 3300032004 | Bacteria | 798 |
| 684 | Ga0307414_10977525 | 3300032004 | Bacteria | 778 |
| 685 | Ga0307414_11099521 | 3300032004 | Bacteria | 734 |
| 686 | Ga0307411_10003128 | 3300032005 | Bacteria | 7586 |
| 687 | Ga0307411_10007716 | 3300032005 | Bacteria | 5511 |
| 688 | Ga0307411_10014210 | 3300032005 | Bacteria | 4422 |
| 689 | Ga0307411_10015709 | 3300032005 | Bacteria | 4262 |
| 690 | Ga0307411_10023981 | 3300032005 | Bacteria | 3627 |
| 691 | Ga0307411_10026202 | 3300032005 | Bacteria | 3507 |
| 692 | Ga0307411_10029200 | 3300032005 | Bacteria | 3363 |
| 693 | Ga0307411_10035169 | 3300032005 | Bacteria | 3125 |
| 694 | Ga0307411_10059754 | 3300032005 | Bacteria | 2528 |
| 695 | Ga0307411_10076983 | 3300032005 | Bacteria | 2282 |
| 696 | Ga0307411_10081890 | 3300032005 | Bacteria | 2224 |
| 697 | Ga0307411_10087115 | 3300032005 | Bacteria | 2168 |
| 698 | Ga0307411_10091067 | 3300032005 | Bacteria | 2129 |
| 699 | Ga0307411_10099636 | 3300032005 | Bacteria | 2051 |
| 700 | Ga0307411_10114562 | 3300032005 | Bacteria | 1937 |
| 701 | Ga0307411_10161717 | 3300032005 | Bacteria | 1678 |
| 702 | Ga0307411_10190232 | 3300032005 | Bacteria | 1566 |
| 703 | Ga0307411_10211211 | 3300032005 | Bacteria | 1499 |
| 704 | Ga0307411_10234869 | 3300032005 | Bacteria | 1431 |
| 705 | Ga0307411_10305059 | 3300032005 | Bacteria | 1278 |
| 706 | Ga0307411_10525097 | 3300032005 | Bacteria | 1005 |
| 707 | Ga0307411_10596970 | 3300032005 | Unclassified | 949 |
| 708 | Ga0307411_10611810 | 3300032005 | Unclassified | 938 |
| 709 | Ga0307411_10909103 | 3300032005 | Bacteria | 782 |
| 710 | Ga0307411_11721950 | 3300032005 | Unclassified | 580 |
| 711 | Ga0307411_11980540 | 3300032005 | Bacteria | 543 |
| 712 | Ga0307411_12178113 | 3300032005 | Bacteria | 519 |
| 713 | Ga0307415_100027025 | 3300032126 | Bacteria | 3629 |
| 714 | Ga0307415_100029268 | 3300032126 | Bacteria | 3518 |
| 715 | Ga0307415_100050228 | 3300032126 | Bacteria | 2825 |
| 716 | Ga0307415_100195207 | 3300032126 | Bacteria | 1601 |
| 717 | Ga0307415_100210971 | 3300032126 | Bacteria | 1549 |
| 718 | Ga0307415_100227176 | 3300032126 | Bacteria | 1501 |
| 719 | Ga0307415_100238773 | 3300032126 | Bacteria | 1468 |
| 720 | Ga0307415_100244659 | 3300032126 | Bacteria | 1453 |
| 721 | Ga0307415_100305524 | 3300032126 | Bacteria | 1320 |
| 722 | Ga0307415_100357526 | 3300032126 | Bacteria | 1232 |
| 723 | Ga0307415_100376777 | 3300032126 | Bacteria | 1203 |
| 724 | Ga0307415_100704389 | 3300032126 | Bacteria | 911 |
| 725 | Ga0307415_100989581 | 3300032126 | Unclassified | 781 |
| 726 | Ga0307415_101080233 | 3300032126 | Unclassified | 750 |
| 727 | Ga0307415_101624476 | 3300032126 | Bacteria | 621 |
| 728 | Ga0373938_0205045 | 3300034957 | Unclassified | 548 |
| 729 | Ga0373960_0199482 | 3300035121 | Bacteria | 707 |
| 730 | Ga0373943_0792496 | 3300035170 | Unclassified | 564 |
| 731 | Ga0395899_0118334 | 3300037312 | Unclassified | 1900 |
| 732 | Ga0395899_0123842 | 3300037312 | Bacteria | 1849 |
| 733 | Ga0395899_0173196 | 3300037312 | Bacteria | 1518 |
| 734 | Ga0395899_0537020 | 3300037312 | Bacteria | 753 |
| 735 | Ga0395899_0840777 | 3300037312 | Unclassified | 564 |
| 736 | Ga0395899_0897136 | 3300037312 | Unclassified | 541 |
| 737 | Ga0395900_0001132 | 3300037418 | Bacteria | 33674 |
| 738 | Ga0395900_0056659 | 3300037418 | Bacteria | 4034 |
| 739 | Ga0395900_0103583 | 3300037418 | Bacteria | 2923 |
| 740 | Ga0395900_0156847 | 3300037418 | Bacteria | 2324 |
| 741 | Ga0395900_0252925 | 3300037418 | Bacteria | 1762 |
| 742 | Ga0395900_0508368 | 3300037418 | Bacteria | 1154 |
| 743 | Ga0395900_0527695 | 3300037418 | Bacteria | 1128 |
| 744 | Ga0395900_0752849 | 3300037418 | Bacteria | 904 |
| 745 | Ga0395900_0989934 | 3300037418 | Unclassified | 761 |
| 746 | Ga0395898_0046699 | 3300037466 | Bacteria | 4253 |
| 747 | Ga0395898_0208888 | 3300037466 | Bacteria | 1862 |
| 748 | Ga0395898_0708496 | 3300037466 | Bacteria | 948 |
| 749 | Ga0395898_1592676 | 3300037466 | Bacteria | 577 |
| 750 | Ga0395898_1849846 | 3300037466 | Unclassified | 524 |
| 751 | Ga0395905_0000083 | 3300037471 | Bacteria | 158407 |
| 752 | Ga0395905_0003608 | 3300037471 | Bacteria | 16456 |
| 753 | Ga0395905_0080602 | 3300037471 | Bacteria | 3050 |
| 754 | Ga0395905_0108260 | 3300037471 | Bacteria | 2609 |
| 755 | Ga0395905_0119078 | 3300037471 | Bacteria | 2482 |
| 756 | Ga0395905_0182685 | 3300037471 | Unclassified | 1969 |
| 757 | Ga0395905_0226094 | 3300037471 | Bacteria | 1750 |
| 758 | Ga0395905_0230543 | 3300037471 | Bacteria | 1732 |
| 759 | Ga0395905_0673695 | 3300037471 | Bacteria | 937 |
| 760 | Ga0395905_0954486 | 3300037471 | Unclassified | 760 |
| 761 | Ga0395905_1026122 | 3300037471 | Bacteria | 728 |
| 762 | Ga0395905_1737935 | 3300037471 | Unclassified | 529 |
| 763 | Ga0436364_1020203 | 3300037853 | Bacteria | 7500 |
| 764 | Ga0395901_0000369 | 3300038443 | Bacteria | 54034 |
| 765 | Ga0395901_0080396 | 3300038443 | Bacteria | 3403 |
| 766 | Ga0395901_0088534 | 3300038443 | Bacteria | 3238 |
| 767 | Ga0395901_0191467 | 3300038443 | Bacteria | 2145 |
| 768 | Ga0395901_0225414 | 3300038443 | Bacteria | 1958 |
| 769 | Ga0395901_0231731 | 3300038443 | Bacteria | 1928 |
| 770 | Ga0395901_0234727 | 3300038443 | Unclassified | 1914 |
| 771 | Ga0395901_0302693 | 3300038443 | Bacteria | 1657 |
| 772 | Ga0395901_0573130 | 3300038443 | Bacteria | 1141 |
| 773 | Ga0395901_0651132 | 3300038443 | Bacteria | 1057 |
| 774 | Ga0395901_1221537 | 3300038443 | Bacteria | 716 |
| 775 | Ga0395901_1710002 | 3300038443 | Bacteria | 580 |
| 776 | Ga0439436_0081773 | 3300041404 | Bacteria | 899 |
| 777 | Ga0439438_118197 | 3300041405 | Bacteria | 638 |
| 778 | Ga0439447_114011 | 3300041407 | Bacteria | 620 |
| 779 | Ga0451841_0144706 | 3300041498 | Unclassified | 824 |
| 780 | Ga0451853_0382471 | 3300041512 | Bacteria | 713 |
| 781 | Ga0439445_0026926 | 3300042004 | Bacteria | 1474 |
| 782 | Ga0439462_0058168 | 3300042015 | Bacteria | 1045 |
| 783 | Ga0450912_037797 | 3300042116 | Bacteria | 517 |
| 784 | Ga0439434_0029600 | 3300042435 | Bacteria | 1660 |
| 785 | Ga0439435_0211751 | 3300042436 | Unclassified | 642 |
| 786 | Ga0466972_0130273 | 3300044658 | Bacteria | 1185 |
| 787 | Ga0466966_0192681 | 3300044684 | Bacteria | 1235 |
| 788 | Ga0466961_0237162 | 3300044693 | Bacteria | 1122 |
| 789 | Ga0466963_0006272 | 3300044694 | Bacteria | 7029 |
| 790 | Ga0453684_2029335 | 3300044712 | Bacteria | 579 |
| 791 | Ga0466971_0159667 | 3300044719 | Bacteria | 1055 |
| 792 | Ga0466970_0127220 | 3300044765 | Bacteria | 1398 |
| 793 | Ga0466960_0214776 | 3300044901 | Bacteria | 1056 |
| 794 | Ga0466959_0078568 | 3300045049 | Bacteria | 2380 |
| 795 | Ga0466958_0222681 | 3300045836 | Bacteria | 1204 |
| 796 | Ga0466967_0047665 | 3300045976 | Bacteria | 3736 |
| 797 | Ga0466967_0159637 | 3300045976 | Unclassified | 2115 |
| 798 | Ga0466967_0833352 | 3300045976 | Bacteria | 916 |
| 799 | Ga0466967_1150171 | 3300045976 | Bacteria | 773 |
| 800 | Ga0495584_0104676 | 3300046491 | Bacteria | 1431 |
| 801 | Ga0495596_0207705 | 3300046500 | Unclassified | 761 |
| 802 | Ga0495663_0004305 | 3300046525 | Bacteria | 4011 |
| 803 | Ga0495663_0030028 | 3300046525 | Unclassified | 1608 |
| 804 | Ga0495663_0045789 | 3300046525 | Bacteria | 1342 |
| 805 | Ga0495663_0153945 | 3300046525 | Unclassified | 786 |
| 806 | Ga0495642_0021249 | 3300046528 | Bacteria | 2552 |
| 807 | Ga0495598_0021423 | 3300046537 | Bacteria | 1719 |
| 808 | Ga0495598_0457120 | 3300046537 | Bacteria | 506 |
| 809 | Ga0495621_0000378 | 3300046539 | Bacteria | 10888 |
| 810 | Ga0495621_0002551 | 3300046539 | Bacteria | 4911 |
| 811 | Ga0495621_0003388 | 3300046539 | Bacteria | 4399 |
| 812 | Ga0495621_0013290 | 3300046539 | Bacteria | 2583 |
| 813 | Ga0495621_0233188 | 3300046539 | Bacteria | 748 |
| 814 | Ga0495597_0390565 | 3300046542 | Unclassified | 530 |
| 815 | Ga0495633_0017067 | 3300046558 | Bacteria | 3722 |
| 816 | Ga0495633_0138241 | 3300046558 | Bacteria | 1127 |
| 817 | Ga0495633_0368472 | 3300046558 | Bacteria | 650 |
| 818 | Ga0495656_0305153 | 3300046615 | Bacteria | 817 |
| 819 | Ga0495668_0257962 | 3300046616 | Bacteria | 954 |
| 820 | Ga0495625_0534496 | 3300046660 | Unclassified | 712 |
| 821 | Ga0495625_0848094 | 3300046660 | Bacteria | 528 |
| 822 | Ga0495659_0017251 | 3300046664 | Bacteria | 2390 |
| 823 | Ga0495659_0019471 | 3300046664 | Bacteria | 2272 |
| 824 | Ga0495659_0129766 | 3300046664 | Unclassified | 999 |
| 825 | Ga0495588_0245969 | 3300046674 | Bacteria | 943 |
| 826 | Ga0495669_0049962 | 3300046684 | Bacteria | 1874 |
| 827 | Ga0495669_0057106 | 3300046684 | Bacteria | 1761 |
| 828 | Ga0495669_0071091 | 3300046684 | Unclassified | 1586 |
| 829 | Ga0495669_0233233 | 3300046684 | Bacteria | 883 |
| 830 | Ga0495670_0010033 | 3300046691 | Bacteria | 4658 |
| 831 | Ga0495670_0045338 | 3300046691 | Bacteria | 2195 |
| 832 | Ga0495670_0054949 | 3300046691 | Bacteria | 1996 |
| 833 | Ga0495670_0150255 | 3300046691 | Bacteria | 1221 |
| 834 | Ga0495670_0319206 | 3300046691 | Bacteria | 834 |
| 835 | Ga0495670_0797146 | 3300046691 | Unclassified | 515 |
| 836 | Ga0495589_0442956 | 3300046794 | Bacteria | 595 |
| 837 | Ga0495636_0041912 | 3300047318 | Bacteria | 1901 |
| 838 | Ga0495636_0177745 | 3300047318 | Unclassified | 965 |
| 839 | Ga0495677_0096931 | 3300047445 | Unclassified | 1114 |
| 840 | Ga0495677_0141768 | 3300047445 | Bacteria | 923 |
| 841 | Ga0495677_0176316 | 3300047445 | Bacteria | 828 |
| 842 | Ga0495615_0184803 | 3300048090 | Bacteria | 637 |
| 843 | Ga0496100_0069097 | 3300048903 | Bacteria | 2351 |
| 844 | Ga0496101_0073916 | 3300048904 | Unclassified | 2505 |
| 845 | Ga0496101_0119799 | 3300048904 | Bacteria | 1989 |
| 846 | Ga0496102_0185976 | 3300048905 | Unclassified | 1958 |
| 847 | Ga0496102_0272185 | 3300048905 | Bacteria | 1597 |
| 848 | Ga0496103_0087942 | 3300048906 | Bacteria | 1959 |
| 849 | Ga0496103_0145336 | 3300048906 | Bacteria | 1518 |
| 850 | Ga0496103_0195568 | 3300048906 | Bacteria | 1300 |
| 851 | Ga0496104_0750197 | 3300048907 | Bacteria | 883 |
| 852 | Ga0496106_0520708 | 3300048909 | Bacteria | 955 |
| 853 | Ga0496106_1488525 | 3300048909 | Bacteria | 521 |
| 854 | Ga0496107_0025326 | 3300048910 | Bacteria | 4201 |
| 855 | Ga0496107_0131917 | 3300048910 | Bacteria | 1844 |
| 856 | Ga0496108_0007546 | 3300048911 | Bacteria | 8816 |
| 857 | Ga0496108_0074691 | 3300048911 | Bacteria | 2863 |
| 858 | Ga0496109_0020109 | 3300048912 | Bacteria | 5897 |
| 859 | Ga0496109_0029055 | 3300048912 | Bacteria | 4949 |
| 860 | Ga0496109_0092265 | 3300048912 | Bacteria | 2801 |
| 861 | Ga0496109_0187450 | 3300048912 | Bacteria | 1944 |
| 862 | Ga0496109_0490912 | 3300048912 | Bacteria | 1159 |
| 863 | Ga0496110_0095971 | 3300048913 | Bacteria | 2656 |
| 864 | Ga0496110_0365307 | 3300048913 | Unclassified | 1315 |
| 865 | Ga0496110_0470993 | 3300048913 | Unclassified | 1144 |
| 866 | Ga0496111_0002376 | 3300048914 | Bacteria | 11340 |
| 867 | Ga0496111_0095725 | 3300048914 | Bacteria | 2179 |
| 868 | Ga0496111_0267821 | 3300048914 | Bacteria | 1267 |
| 869 | Ga0496112_0046681 | 3300048915 | Bacteria | 4249 |
| 870 | Ga0496112_0076358 | 3300048915 | Bacteria | 3313 |
| 871 | Ga0496113_0065535 | 3300048916 | Bacteria | 2749 |
| 872 | Ga0496113_0481567 | 3300048916 | Unclassified | 997 |
| 873 | Ga0496113_0669144 | 3300048916 | Bacteria | 830 |
| 874 | Ga0496113_0683396 | 3300048916 | Bacteria | 820 |
| 875 | Ga0496114_0022507 | 3300048917 | Bacteria | 5137 |
| 876 | Ga0496114_0030533 | 3300048917 | Bacteria | 4434 |
| 877 | Ga0496115_0432729 | 3300048918 | Bacteria | 1065 |
| 878 | Ga0501298_067568 | 3300049521 | Bacteria | 767 |
| 879 | Ga0501034_0859330 | 3300049571 | Bacteria | 797 |
| 880 | Ga0501047_0793032 | 3300049581 | Bacteria | 762 |
| 881 | Ga0501067_0042413 | 3300049583 | Bacteria | 2526 |
| 882 | Ga0501073_0277463 | 3300049589 | Bacteria | 1156 |
| 883 | Ga0501074_0097531 | 3300049590 | Unclassified | 2104 |
| 884 | Ga0501209_185246 | 3300049656 | Unclassified | 637 |
| 885 | Ga0501211_036345 | 3300049658 | Bacteria | 573 |
| 886 | Ga0501217_178090 | 3300049661 | Bacteria | 651 |
| 887 | Ga0501223_130012 | 3300049663 | Bacteria | 537 |
| 888 | Ga0501227_051465 | 3300049665 | Bacteria | 1040 |
| 889 | Ga0501233_050244 | 3300049668 | Bacteria | 1008 |
| 890 | Ga0501235_006983 | 3300049669 | Bacteria | 2456 |
| 891 | Ga0501242_068610 | 3300049674 | Bacteria | 552 |
| 892 | Ga0501243_028456 | 3300049675 | Bacteria | 946 |
| 893 | Ga0501243_048190 | 3300049675 | Bacteria | 763 |
| 894 | Ga0501247_034044 | 3300049677 | Bacteria | 707 |
| 895 | Ga0501250_007031 | 3300049680 | Bacteria | 1205 |
| 896 | Ga0501257_029067 | 3300049686 | Bacteria | 1328 |
| 897 | Ga0501221_167455 | 3300049704 | Bacteria | 593 |
| 898 | Ga0501225_0094367 | 3300049705 | Unclassified | 869 |
| 899 | Ga0501234_103784 | 3300049707 | Unclassified | 519 |
| 900 | Ga0501245_091241 | 3300049708 | Bacteria | 604 |
| 901 | Ga0501080_0096808 | 3300049742 | Bacteria | 2740 |
| 902 | Ga0501263_015365 | 3300049760 | Bacteria | 988 |
| 903 | Ga0501265_107782 | 3300049762 | Bacteria | 517 |
| 904 | Ga0501267_003212 | 3300049764 | Bacteria | 1483 |
| 905 | Ga0501267_010056 | 3300049764 | Bacteria | 951 |
| 906 | Ga0501268_001442 | 3300049765 | Bacteria | 2970 |
| 907 | Ga0501268_004932 | 3300049765 | Bacteria | 1900 |
| 908 | Ga0501268_008485 | 3300049765 | Bacteria | 1558 |
| 909 | Ga0501268_010277 | 3300049765 | Bacteria | 1455 |
| 910 | Ga0501270_042257 | 3300049767 | Bacteria | 798 |
| 911 | Ga0501270_073948 | 3300049767 | Unclassified | 665 |
| 912 | Ga0501272_007155 | 3300049769 | Bacteria | 1204 |
| 913 | Ga0501273_072515 | 3300049770 | Bacteria | 561 |
| 914 | Ga0501283_034441 | 3300049779 | Bacteria | 860 |
| 915 | Ga0501212_018679 | 3300049851 | Bacteria | 1058 |
| 916 | nmdc:mga08y16_199835_c1 | 3300050511 | Bacteria | 2071 |
| 917 | nmdc:mga08y16_93718_c1 | 3300050511 | Bacteria | 3128 |
| 918 | nmdc:mga0n895_602073_c1 | 3300050512 | Bacteria | 1101 |
| 919 | Ga0500658_0000036 | 3300053134 | Bacteria | 85304 |
| 920 | Ga0590075_175145 | 3300059424 | Bacteria | 567 |
| 921 | Ga0466962_0032304 | 3300061719 | Bacteria | 2506 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001976 | JGI24752J21851_1039449 | JGI24752J21851_10394491 | 98 |
| 2 | 3300001989 | JGI24739J22299_10003769 | JGI24739J22299_100037697 | 98 |
| 3 | 3300001991 | JGI24743J22301_10003347 | JGI24743J22301_100033473 | 98 |
| 4 | 3300002067 | JGI24735J21928_10158471 | JGI24735J21928_101584711 | 98 |
| 5 | 3300002075 | JGI24738J21930_10008755 | JGI24738J21930_100087551 | 98 |
| 6 | 3300002077 | JGI24744J21845_10000460 | JGI24744J21845_100004606 | 98 |
| 7 | 3300005327 | Ga0070658_10055284 | Ga0070658_100552844 | 98 |
| 8 | 3300005328 | Ga0070676_10128949 | Ga0070676_101289493 | 98 |
| 9 | 3300005329 | Ga0070683_100371221 | Ga0070683_1003712212 | 98 |
| 10 | 3300005331 | Ga0070670_100003949 | Ga0070670_1000039498 | 98 |
| 11 | 3300005331 | Ga0070670_100152470 | Ga0070670_1001524703 | 98 |
| 12 | 3300005333 | Ga0070677_10350013 | Ga0070677_103500132 | 98 |
| 13 | 3300005333 | Ga0070677_10377162 | Ga0070677_103771622 | 98 |
| 14 | 3300005334 | Ga0068869_100055312 | Ga0068869_1000553123 | 98 |
| 15 | 3300005335 | Ga0070666_10010746 | Ga0070666_100107463 | 98 |
| 16 | 3300005336 | Ga0070680_100059272 | Ga0070680_1000592724 | 98 |
| 17 | 3300005337 | Ga0070682_100044119 | Ga0070682_1000441194 | 98 |
| 18 | 3300005339 | Ga0070660_100164602 | Ga0070660_1001646021 | 98 |
| 19 | 3300005344 | Ga0070661_100224617 | Ga0070661_1002246171 | 98 |
| 20 | 3300005347 | Ga0070668_100305769 | Ga0070668_1003057692 | 98 |
| 21 | 3300005353 | Ga0070669_100060853 | Ga0070669_1000608534 | 98 |
| 22 | 3300005354 | Ga0070675_100087324 | Ga0070675_1000873241 | 98 |
| 23 | 3300005354 | Ga0070675_101851322 | Ga0070675_1018513221 | 98 |
| 24 | 3300005355 | Ga0070671_100016707 | Ga0070671_1000167077 | 98 |
| 25 | 3300005355 | Ga0070671_100034633 | Ga0070671_1000346334 | 98 |
| 26 | 3300005364 | Ga0070673_100114318 | Ga0070673_1001143183 | 98 |
| 27 | 3300005366 | Ga0070659_100016115 | Ga0070659_1000161153 | 98 |
| 28 | 3300005367 | Ga0070667_100003813 | Ga0070667_1000038137 | 98 |
| 29 | 3300005367 | Ga0070667_100042585 | Ga0070667_1000425852 | 98 |
| 30 | 3300005367 | Ga0070667_100513443 | Ga0070667_1005134433 | 98 |
| 31 | 3300005435 | Ga0070714_100026253 | Ga0070714_1000262533 | 98 |
| 32 | 3300005435 | Ga0070714_100744508 | Ga0070714_1007445082 | 98 |
| 33 | 3300005436 | Ga0070713_100299850 | Ga0070713_1002998502 | 98 |
| 34 | 3300005455 | Ga0070663_100077233 | Ga0070663_1000772332 | 98 |
| 35 | 3300005456 | Ga0070678_100136755 | Ga0070678_1001367551 | 98 |
| 36 | 3300005456 | Ga0070678_100466818 | Ga0070678_1004668182 | 98 |
| 37 | 3300005456 | Ga0070678_102182271 | Ga0070678_1021822711 | 98 |
| 38 | 3300005457 | Ga0070662_100041923 | Ga0070662_1000419233 | 98 |
| 39 | 3300005535 | Ga0070684_100921082 | Ga0070684_1009210822 | 98 |
| 40 | 3300005539 | Ga0068853_100116509 | Ga0068853_1001165093 | 98 |
| 41 | 3300005539 | Ga0068853_100538912 | Ga0068853_1005389121 | 98 |
| 42 | 3300005543 | Ga0070672_100032433 | Ga0070672_1000324331 | 98 |
| 43 | 3300005548 | Ga0070665_100008330 | Ga0070665_1000083307 | 98 |
| 44 | 3300005563 | Ga0068855_100500959 | Ga0068855_1005009593 | 98 |
| 45 | 3300005563 | Ga0068855_100548208 | Ga0068855_1005482082 | 98 |
| 46 | 3300005564 | Ga0070664_100041421 | Ga0070664_1000414216 | 98 |
| 47 | 3300005564 | Ga0070664_100335664 | Ga0070664_1003356641 | 98 |
| 48 | 3300005577 | Ga0068857_100230276 | Ga0068857_1002302763 | 98 |
| 49 | 3300005578 | Ga0068854_100002116 | Ga0068854_10000211610 | 98 |
| 50 | 3300005578 | Ga0068854_100916976 | Ga0068854_1009169762 | 98 |
| 51 | 3300005614 | Ga0068856_100976185 | Ga0068856_1009761852 | 98 |
| 52 | 3300005616 | Ga0068852_100005093 | Ga0068852_1000050934 | 98 |
| 53 | 3300005616 | Ga0068852_100263042 | Ga0068852_1002630422 | 98 |
| 54 | 3300005617 | Ga0068859_100002392 | Ga0068859_1000023924 | 98 |
| 55 | 3300005618 | Ga0068864_100001110 | Ga0068864_10000111022 | 98 |
| 56 | 3300005841 | Ga0068863_100001056 | Ga0068863_1000010564 | 98 |
| 57 | 3300005842 | Ga0068858_100003145 | Ga0068858_10000314519 | 98 |
| 58 | 3300005842 | Ga0068858_100053942 | Ga0068858_1000539423 | 98 |
| 59 | 3300005843 | Ga0068860_100002768 | Ga0068860_1000027684 | 98 |
| 60 | 3300005843 | Ga0068860_100189793 | Ga0068860_1001897932 | 98 |
| 61 | 3300005844 | Ga0068862_100098570 | Ga0068862_1000985703 | 98 |
| 62 | 3300005844 | Ga0068862_101273713 | Ga0068862_1012737132 | 98 |
| 63 | 3300006237 | Ga0097621_100290134 | Ga0097621_1002901342 | 98 |
| 64 | 3300006931 | Ga0097620_100002392 | Ga0097620_1000023924 | 98 |
| 65 | 3300006931 | Ga0097620_101811394 | Ga0097620_1018113942 | 98 |
| 66 | 3300009177 | Ga0105248_10001320 | Ga0105248_1000132031 | 98 |
| 67 | 3300009553 | Ga0105249_10026708 | Ga0105249_100267086 | 98 |
| 68 | 3300010375 | Ga0105239_11303652 | Ga0105239_113036522 | 98 |
| 69 | 3300013100 | Ga0157373_10265257 | Ga0157373_102652572 | 98 |
| 70 | 3300013102 | Ga0157371_10014319 | Ga0157371_100143197 | 98 |
| 71 | 3300013102 | Ga0157371_10122350 | Ga0157371_101223503 | 98 |
| 72 | 3300013104 | Ga0157370_10050194 | Ga0157370_100501945 | 98 |
| 73 | 3300013306 | Ga0163162_10182809 | Ga0163162_101828092 | 98 |
| 74 | 3300013307 | Ga0157372_10121713 | Ga0157372_101217133 | 98 |
| 75 | 3300013308 | Ga0157375_10312902 | Ga0157375_103129023 | 98 |
| 76 | 3300014325 | Ga0163163_10006151 | Ga0163163_1000615112 | 98 |
| 77 | 3300014968 | Ga0157379_10057778 | Ga0157379_100577783 | 98 |
| 78 | 3300025893 | Ga0207682_10200028 | Ga0207682_102000282 | 98 |
| 79 | 3300025904 | Ga0207647_10035461 | Ga0207647_100354613 | 98 |
| 80 | 3300025907 | Ga0207645_10338725 | Ga0207645_103387251 | 98 |
| 81 | 3300025908 | Ga0207643_10024141 | Ga0207643_100241413 | 98 |
| 82 | 3300025909 | Ga0207705_10181581 | Ga0207705_101815813 | 98 |
| 83 | 3300025909 | Ga0207705_10460663 | Ga0207705_104606632 | 98 |
| 84 | 3300025919 | Ga0207657_10011972 | Ga0207657_1001197210 | 98 |
| 85 | 3300025920 | Ga0207649_10031507 | Ga0207649_100315074 | 98 |
| 86 | 3300025921 | Ga0207652_11156691 | Ga0207652_111566911 | 98 |
| 87 | 3300025923 | Ga0207681_10075878 | Ga0207681_100758783 | 98 |
| 88 | 3300025923 | Ga0207681_11112772 | Ga0207681_111127721 | 98 |
| 89 | 3300025925 | Ga0207650_10123204 | Ga0207650_101232043 | 98 |
| 90 | 3300025925 | Ga0207650_10189762 | Ga0207650_101897623 | 98 |
| 91 | 3300025929 | Ga0207664_10019856 | Ga0207664_100198563 | 98 |
| 92 | 3300025929 | Ga0207664_10640677 | Ga0207664_106406773 | 98 |
| 93 | 3300025931 | Ga0207644_10034953 | Ga0207644_100349533 | 98 |
| 94 | 3300025931 | Ga0207644_10134485 | Ga0207644_101344852 | 98 |
| 95 | 3300025933 | Ga0207706_10037177 | Ga0207706_100371773 | 98 |
| 96 | 3300025938 | Ga0207704_10671387 | Ga0207704_106713872 | 98 |
| 97 | 3300025940 | Ga0207691_10422081 | Ga0207691_104220813 | 98 |
| 98 | 3300025941 | Ga0207711_10000869 | Ga0207711_1000086928 | 98 |
| 99 | 3300025941 | Ga0207711_11029728 | Ga0207711_110297281 | 98 |
| 100 | 3300025942 | Ga0207689_10033527 | Ga0207689_100335272 | 98 |
| 101 | 3300025944 | Ga0207661_10315491 | Ga0207661_103154912 | 98 |
| 102 | 3300025945 | Ga0207679_10010992 | Ga0207679_100109924 | 98 |
| 103 | 3300025949 | Ga0207667_10443417 | Ga0207667_104434172 | 98 |
| 104 | 3300025949 | Ga0207667_10503195 | Ga0207667_105031952 | 98 |
| 105 | 3300025960 | Ga0207651_10142673 | Ga0207651_101426733 | 98 |
| 106 | 3300025961 | Ga0207712_10070813 | Ga0207712_100708133 | 98 |
| 107 | 3300025972 | Ga0207668_10026318 | Ga0207668_100263184 | 98 |
| 108 | 3300025981 | Ga0207640_10365379 | Ga0207640_103653791 | 98 |
| 109 | 3300025986 | Ga0207658_10009361 | Ga0207658_100093617 | 98 |
| 110 | 3300025986 | Ga0207658_10029662 | Ga0207658_100296623 | 98 |
| 111 | 3300025986 | Ga0207658_10096726 | Ga0207658_100967263 | 98 |
| 112 | 3300026023 | Ga0207677_10284952 | Ga0207677_102849522 | 98 |
| 113 | 3300026035 | Ga0207703_10004152 | Ga0207703_1000415214 | 98 |
| 114 | 3300026041 | Ga0207639_10297016 | Ga0207639_102970162 | 98 |
| 115 | 3300026067 | Ga0207678_10044966 | Ga0207678_100449665 | 98 |
| 116 | 3300026067 | Ga0207678_10672488 | Ga0207678_106724881 | 98 |
| 117 | 3300026088 | Ga0207641_10001513 | Ga0207641_100015134 | 98 |
| 118 | 3300026095 | Ga0207676_10006150 | Ga0207676_100061502 | 98 |
| 119 | 3300026116 | Ga0207674_10003678 | Ga0207674_100036788 | 98 |
| 120 | 3300026121 | Ga0207683_10171981 | Ga0207683_101719813 | 98 |
| 121 | 3300026121 | Ga0207683_10205870 | Ga0207683_102058703 | 98 |
| 122 | 3300026121 | Ga0207683_10238638 | Ga0207683_102386383 | 98 |
| 123 | 3300026142 | Ga0207698_10038595 | Ga0207698_100385954 | 98 |
| 124 | 3300028379 | Ga0268266_10460885 | Ga0268266_104608852 | 98 |
| 125 | 3300028380 | Ga0268265_10010701 | Ga0268265_100107018 | 98 |
| 126 | 3300028380 | Ga0268265_10072644 | Ga0268265_100726444 | 98 |
| 127 | 3300028380 | Ga0268265_12686015 | Ga0268265_126860151 | 98 |
| 128 | 3300028381 | Ga0268264_10005781 | Ga0268264_100057814 | 98 |
| 129 | 3300028381 | Ga0268264_10043533 | Ga0268264_100435331 | 98 |
| 130 | 3300031548 | Ga0307408_102447223 | Ga0307408_1024472231 | 98 |
| 131 | 3300031824 | Ga0307413_10258212 | Ga0307413_102582123 | 98 |
| 132 | 3300031852 | Ga0307410_10054664 | Ga0307410_100546643 | 98 |
| 133 | 3300031852 | Ga0307410_10089222 | Ga0307410_100892222 | 98 |
| 134 | 3300031852 | Ga0307410_10329220 | Ga0307410_103292201 | 98 |
| 135 | 3300031903 | Ga0307407_10938900 | Ga0307407_109389002 | 98 |
| 136 | 3300031903 | Ga0307407_11026549 | Ga0307407_110265492 | 98 |
| 137 | 3300031911 | Ga0307412_10381110 | Ga0307412_103811102 | 98 |
| 138 | 3300031995 | Ga0307409_100589590 | Ga0307409_1005895902 | 98 |
| 139 | 3300031995 | Ga0307409_101030005 | Ga0307409_1010300052 | 98 |
| 140 | 3300032002 | Ga0307416_100895853 | Ga0307416_1008958533 | 98 |
| 141 | 3300032004 | Ga0307414_10167023 | Ga0307414_101670232 | 98 |
| 142 | 3300032005 | Ga0307411_10003128 | Ga0307411_100031287 | 98 |
| 143 | 3300032005 | Ga0307411_10087115 | Ga0307411_100871153 | 98 |
| 144 | 3300032126 | Ga0307415_100210971 | Ga0307415_1002109713 | 98 |
| 145 | 3300032126 | Ga0307415_100357526 | Ga0307415_1003575261 | 98 |
| 146 | 3300035170 | Ga0373943_0792496 | Ga0373943_0792496_185_499 | 98 |
| 147 | 3300037312 | Ga0395899_0123842 | Ga0395899_0123842_298_627 | 98 |
| 148 | 3300037312 | Ga0395899_0173196 | Ga0395899_0173196_19_348 | 98 |
| 149 | 3300037418 | Ga0395900_0156847 | Ga0395900_0156847_133_462 | 98 |
| 150 | 3300037418 | Ga0395900_0252925 | Ga0395900_0252925_969_1298 | 98 |
| 151 | 3300037418 | Ga0395900_0508368 | Ga0395900_0508368_780_1094 | 98 |
| 152 | 3300037466 | Ga0395898_1592676 | Ga0395898_1592676_24_353 | 98 |
| 153 | 3300037471 | Ga0395905_0003608 | Ga0395905_0003608_15936_16265 | 98 |
| 154 | 3300037471 | Ga0395905_0226094 | Ga0395905_0226094_1272_1601 | 98 |
| 155 | 3300037471 | Ga0395905_1737935 | Ga0395905_1737935_173_487 | 98 |
| 156 | 3300038443 | Ga0395901_0088534 | Ga0395901_0088534_1009_1338 | 98 |
| 157 | 3300038443 | Ga0395901_0225414 | Ga0395901_0225414_1513_1827 | 98 |
| 158 | 3300038443 | Ga0395901_0651132 | Ga0395901_0651132_647_961 | 98 |
| 159 | 3300038443 | Ga0395901_1221537 | Ga0395901_1221537_24_353 | 98 |
| 160 | 3300038443 | Ga0395901_1710002 | Ga0395901_1710002_14_343 | 98 |
| 161 | 3300044694 | Ga0466963_0006272 | Ga0466963_0006272_614_928 | 98 |
| 162 | 3300044901 | Ga0466960_0214776 | Ga0466960_0214776_384_698 | 98 |
| 163 | 3300045049 | Ga0466959_0078568 | Ga0466959_0078568_2020_2346 | 98 |
| 164 | 3300045976 | Ga0466967_0047665 | Ga0466967_0047665_154_468 | 98 |
| 165 | 3300045976 | Ga0466967_0159637 | Ga0466967_0159637_846_1160 | 98 |
| 166 | 3300045976 | Ga0466967_0833352 | Ga0466967_0833352_460_774 | 98 |
| 167 | 3300045976 | Ga0466967_1150171 | Ga0466967_1150171_412_726 | 98 |
| 168 | 3300046616 | Ga0495668_0257962 | Ga0495668_0257962_109_426 | 98 |
| 169 | 3300046660 | Ga0495625_0848094 | Ga0495625_0848094_17_331 | 98 |
| 170 | 3300046684 | Ga0495669_0057106 | Ga0495669_0057106_606_923 | 98 |
| 171 | 3300046684 | Ga0495669_0233233 | Ga0495669_0233233_537_854 | 98 |
| 172 | 3300046794 | Ga0495589_0442956 | Ga0495589_0442956_192_509 | 98 |
| 173 | 3300048909 | Ga0496106_0520708 | Ga0496106_0520708_378_707 | 98 |
| 174 | 3300048910 | Ga0496107_0131917 | Ga0496107_0131917_1230_1553 | 98 |
| 175 | 3300048912 | Ga0496109_0029055 | Ga0496109_0029055_4383_4712 | 98 |
| 176 | 3300048913 | Ga0496110_0365307 | Ga0496110_0365307_397_702 | 98 |
| 177 | 3300048914 | Ga0496111_0267821 | Ga0496111_0267821_276_581 | 98 |
| 178 | 3300048915 | Ga0496112_0046681 | Ga0496112_0046681_1939_2268 | 98 |
| 179 | 3300048916 | Ga0496113_0683396 | Ga0496113_0683396_29_358 | 98 |
| 180 | 3300048918 | Ga0496115_0432729 | Ga0496115_0432729_84_398 | 98 |
| 181 | 3300049571 | Ga0501034_0859330 | Ga0501034_0859330_432_746 | 98 |
| 182 | 3300049581 | Ga0501047_0793032 | Ga0501047_0793032_128_442 | 98 |
| 183 | 3300049583 | Ga0501067_0042413 | Ga0501067_0042413_1336_1665 | 98 |
| 184 | 3300049589 | Ga0501073_0277463 | Ga0501073_0277463_488_802 | 98 |
| 185 | 3300049590 | Ga0501074_0097531 | Ga0501074_0097531_780_1094 | 98 |
| 186 | 3300049742 | Ga0501080_0096808 | Ga0501080_0096808_1276_1590 | 98 |
| 187 | 3300053134 | Ga0500658_0000036 | Ga0500658_0000036_43566_43883 | 98 |
| 188 | 3300002239 | JGI24034J26672_10007772 | JGI24034J26672_100077723 | 99 |
| 189 | 3300005331 | Ga0070670_100073702 | Ga0070670_1000737022 | 99 |
| 190 | 3300005335 | Ga0070666_10013349 | Ga0070666_100133494 | 99 |
| 191 | 3300005337 | Ga0070682_100222041 | Ga0070682_1002220412 | 99 |
| 192 | 3300005338 | Ga0068868_100105547 | Ga0068868_1001055474 | 99 |
| 193 | 3300005339 | Ga0070660_100529424 | Ga0070660_1005294242 | 99 |
| 194 | 3300005339 | Ga0070660_100798926 | Ga0070660_1007989262 | 99 |
| 195 | 3300005344 | Ga0070661_100071853 | Ga0070661_1000718533 | 99 |
| 196 | 3300005344 | Ga0070661_100179470 | Ga0070661_1001794703 | 99 |
| 197 | 3300005347 | Ga0070668_100358884 | Ga0070668_1003588842 | 99 |
| 198 | 3300005353 | Ga0070669_100171217 | Ga0070669_1001712173 | 99 |
| 199 | 3300005353 | Ga0070669_100301300 | Ga0070669_1003013002 | 99 |
| 200 | 3300005354 | Ga0070675_100005746 | Ga0070675_1000057466 | 99 |
| 201 | 3300005355 | Ga0070671_100007735 | Ga0070671_10000773511 | 99 |
| 202 | 3300005356 | Ga0070674_100116809 | Ga0070674_1001168093 | 99 |
| 203 | 3300005356 | Ga0070674_100546938 | Ga0070674_1005469381 | 99 |
| 204 | 3300005364 | Ga0070673_100007157 | Ga0070673_1000071576 | 99 |
| 205 | 3300005364 | Ga0070673_100181720 | Ga0070673_1001817201 | 99 |
| 206 | 3300005364 | Ga0070673_100445345 | Ga0070673_1004453451 | 99 |
| 207 | 3300005365 | Ga0070688_100920959 | Ga0070688_1009209592 | 99 |
| 208 | 3300005365 | Ga0070688_101553968 | Ga0070688_1015539681 | 99 |
| 209 | 3300005366 | Ga0070659_100324129 | Ga0070659_1003241293 | 99 |
| 210 | 3300005366 | Ga0070659_101034369 | Ga0070659_1010343692 | 99 |
| 211 | 3300005366 | Ga0070659_101327244 | Ga0070659_1013272441 | 99 |
| 212 | 3300005367 | Ga0070667_100013452 | Ga0070667_1000134522 | 99 |
| 213 | 3300005367 | Ga0070667_100180950 | Ga0070667_1001809503 | 99 |
| 214 | 3300005456 | Ga0070678_100042261 | Ga0070678_1000422613 | 99 |
| 215 | 3300005457 | Ga0070662_100004584 | Ga0070662_1000045844 | 99 |
| 216 | 3300005457 | Ga0070662_100218919 | Ga0070662_1002189194 | 99 |
| 217 | 3300005466 | Ga0070685_10109552 | Ga0070685_101095523 | 99 |
| 218 | 3300005539 | Ga0068853_100075317 | Ga0068853_1000753173 | 99 |
| 219 | 3300005539 | Ga0068853_100118658 | Ga0068853_1001186583 | 99 |
| 220 | 3300005543 | Ga0070672_100009064 | Ga0070672_1000090644 | 99 |
| 221 | 3300005543 | Ga0070672_100143380 | Ga0070672_1001433803 | 99 |
| 222 | 3300005548 | Ga0070665_100032554 | Ga0070665_1000325545 | 99 |
| 223 | 3300005563 | Ga0068855_101336798 | Ga0068855_1013367982 | 99 |
| 224 | 3300005564 | Ga0070664_100024096 | Ga0070664_1000240964 | 99 |
| 225 | 3300005564 | Ga0070664_100156468 | Ga0070664_1001564683 | 99 |
| 226 | 3300005564 | Ga0070664_100221600 | Ga0070664_1002216003 | 99 |
| 227 | 3300005577 | Ga0068857_100092398 | Ga0068857_1000923984 | 99 |
| 228 | 3300005578 | Ga0068854_100013400 | Ga0068854_1000134006 | 99 |
| 229 | 3300005614 | Ga0068856_100532375 | Ga0068856_1005323753 | 99 |
| 230 | 3300005614 | Ga0068856_101552637 | Ga0068856_1015526372 | 99 |
| 231 | 3300005616 | Ga0068852_100176396 | Ga0068852_1001763963 | 99 |
| 232 | 3300005616 | Ga0068852_100296398 | Ga0068852_1002963982 | 99 |
| 233 | 3300005616 | Ga0068852_100419073 | Ga0068852_1004190732 | 99 |
| 234 | 3300005616 | Ga0068852_101815996 | Ga0068852_1018159961 | 99 |
| 235 | 3300005617 | Ga0068859_100421982 | Ga0068859_1004219822 | 99 |
| 236 | 3300005617 | Ga0068859_100481772 | Ga0068859_1004817722 | 99 |
| 237 | 3300005618 | Ga0068864_100042715 | Ga0068864_1000427153 | 99 |
| 238 | 3300005719 | Ga0068861_100040656 | Ga0068861_1000406563 | 99 |
| 239 | 3300005840 | Ga0068870_10467497 | Ga0068870_104674972 | 99 |
| 240 | 3300005841 | Ga0068863_100022022 | Ga0068863_1000220227 | 99 |
| 241 | 3300005841 | Ga0068863_100183835 | Ga0068863_1001838353 | 99 |
| 242 | 3300005842 | Ga0068858_100116228 | Ga0068858_1001162282 | 99 |
| 243 | 3300005843 | Ga0068860_100360498 | Ga0068860_1003604983 | 99 |
| 244 | 3300006237 | Ga0097621_100214655 | Ga0097621_1002146553 | 99 |
| 245 | 3300006358 | Ga0068871_100124012 | Ga0068871_1001240124 | 99 |
| 246 | 3300006358 | Ga0068871_101288821 | Ga0068871_1012888211 | 99 |
| 247 | 3300006931 | Ga0097620_100421983 | Ga0097620_1004219832 | 99 |
| 248 | 3300006931 | Ga0097620_100481782 | Ga0097620_1004817822 | 99 |
| 249 | 3300009148 | Ga0105243_11640159 | Ga0105243_116401592 | 99 |
| 250 | 3300009176 | Ga0105242_10505552 | Ga0105242_105055522 | 99 |
| 251 | 3300009177 | Ga0105248_10034268 | Ga0105248_100342687 | 99 |
| 252 | 3300009177 | Ga0105248_10148348 | Ga0105248_101483484 | 99 |
| 253 | 3300009177 | Ga0105248_10178322 | Ga0105248_101783223 | 99 |
| 254 | 3300009553 | Ga0105249_13272175 | Ga0105249_132721751 | 99 |
| 255 | 3300013100 | Ga0157373_10075054 | Ga0157373_100750542 | 99 |
| 256 | 3300013102 | Ga0157371_10044524 | Ga0157371_100445243 | 99 |
| 257 | 3300013102 | Ga0157371_10219230 | Ga0157371_102192301 | 99 |
| 258 | 3300013104 | Ga0157370_10043428 | Ga0157370_100434283 | 99 |
| 259 | 3300013296 | Ga0157374_10002253 | Ga0157374_1000225314 | 99 |
| 260 | 3300013306 | Ga0163162_10039027 | Ga0163162_100390275 | 99 |
| 261 | 3300013306 | Ga0163162_10084100 | Ga0163162_100841003 | 99 |
| 262 | 3300013307 | Ga0157372_10136334 | Ga0157372_101363343 | 99 |
| 263 | 3300013308 | Ga0157375_10004680 | Ga0157375_1000468012 | 99 |
| 264 | 3300013308 | Ga0157375_10006077 | Ga0157375_100060774 | 99 |
| 265 | 3300014325 | Ga0163163_10002706 | Ga0163163_1000270612 | 99 |
| 266 | 3300014325 | Ga0163163_10129296 | Ga0163163_101292963 | 99 |
| 267 | 3300017792 | Ga0163161_10005360 | Ga0163161_100053605 | 99 |
| 268 | 3300020081 | Ga0206354_11377068 | Ga0206354_113770681 | 99 |
| 269 | 3300020082 | Ga0206353_11229904 | Ga0206353_112299042 | 99 |
| 270 | 3300025315 | Ga0207697_10075935 | Ga0207697_100759353 | 99 |
| 271 | 3300025315 | Ga0207697_10076849 | Ga0207697_100768492 | 99 |
| 272 | 3300025903 | Ga0207680_10145261 | Ga0207680_101452613 | 99 |
| 273 | 3300025909 | Ga0207705_10070386 | Ga0207705_100703862 | 99 |
| 274 | 3300025917 | Ga0207660_10183644 | Ga0207660_101836443 | 99 |
| 275 | 3300025919 | Ga0207657_10067574 | Ga0207657_100675743 | 99 |
| 276 | 3300025919 | Ga0207657_10522752 | Ga0207657_105227522 | 99 |
| 277 | 3300025920 | Ga0207649_10082933 | Ga0207649_100829333 | 99 |
| 278 | 3300025920 | Ga0207649_10121521 | Ga0207649_101215213 | 99 |
| 279 | 3300025923 | Ga0207681_11559780 | Ga0207681_115597802 | 99 |
| 280 | 3300025925 | Ga0207650_10082656 | Ga0207650_100826562 | 99 |
| 281 | 3300025926 | Ga0207659_10011166 | Ga0207659_100111664 | 99 |
| 282 | 3300025931 | Ga0207644_10020833 | Ga0207644_100208334 | 99 |
| 283 | 3300025931 | Ga0207644_10038263 | Ga0207644_100382633 | 99 |
| 284 | 3300025932 | Ga0207690_10140087 | Ga0207690_101400871 | 99 |
| 285 | 3300025933 | Ga0207706_10007819 | Ga0207706_100078197 | 99 |
| 286 | 3300025933 | Ga0207706_10038387 | Ga0207706_100383873 | 99 |
| 287 | 3300025933 | Ga0207706_10059330 | Ga0207706_100593303 | 99 |
| 288 | 3300025934 | Ga0207686_10206790 | Ga0207686_102067902 | 99 |
| 289 | 3300025937 | Ga0207669_11845644 | Ga0207669_118456441 | 99 |
| 290 | 3300025940 | Ga0207691_10011885 | Ga0207691_100118854 | 99 |
| 291 | 3300025940 | Ga0207691_10122184 | Ga0207691_101221843 | 99 |
| 292 | 3300025941 | Ga0207711_10006956 | Ga0207711_100069567 | 99 |
| 293 | 3300025941 | Ga0207711_10014975 | Ga0207711_100149754 | 99 |
| 294 | 3300025941 | Ga0207711_10541176 | Ga0207711_105411763 | 99 |
| 295 | 3300025945 | Ga0207679_10074289 | Ga0207679_100742893 | 99 |
| 296 | 3300025945 | Ga0207679_10265420 | Ga0207679_102654201 | 99 |
| 297 | 3300025945 | Ga0207679_11282581 | Ga0207679_112825812 | 99 |
| 298 | 3300025945 | Ga0207679_11384463 | Ga0207679_113844632 | 99 |
| 299 | 3300025960 | Ga0207651_10050366 | Ga0207651_100503663 | 99 |
| 300 | 3300025960 | Ga0207651_10926739 | Ga0207651_109267391 | 99 |
| 301 | 3300025960 | Ga0207651_11041605 | Ga0207651_110416051 | 99 |
| 302 | 3300025972 | Ga0207668_10739569 | Ga0207668_107395693 | 99 |
| 303 | 3300025981 | Ga0207640_10372653 | Ga0207640_103726533 | 99 |
| 304 | 3300025986 | Ga0207658_10007821 | Ga0207658_100078217 | 99 |
| 305 | 3300026035 | Ga0207703_10045425 | Ga0207703_100454253 | 99 |
| 306 | 3300026041 | Ga0207639_10116150 | Ga0207639_101161502 | 99 |
| 307 | 3300026041 | Ga0207639_10319798 | Ga0207639_103197983 | 99 |
| 308 | 3300026078 | Ga0207702_10099610 | Ga0207702_100996103 | 99 |
| 309 | 3300026088 | Ga0207641_10007946 | Ga0207641_100079464 | 99 |
| 310 | 3300026088 | Ga0207641_10204660 | Ga0207641_102046601 | 99 |
| 311 | 3300026095 | Ga0207676_10059721 | Ga0207676_100597212 | 99 |
| 312 | 3300026118 | Ga0207675_100271249 | Ga0207675_1002712493 | 99 |
| 313 | 3300026121 | Ga0207683_10004970 | Ga0207683_100049707 | 99 |
| 314 | 3300026142 | Ga0207698_10152903 | Ga0207698_101529033 | 99 |
| 315 | 3300026142 | Ga0207698_10299379 | Ga0207698_102993792 | 99 |
| 316 | 3300026142 | Ga0207698_10309365 | Ga0207698_103093653 | 99 |
| 317 | 3300028379 | Ga0268266_10479549 | Ga0268266_104795493 | 99 |
| 318 | 3300028381 | Ga0268264_10088307 | Ga0268264_100883073 | 99 |
| 319 | 3300030731 | Ga0316177_1184040 | Ga0316177_11840402 | 99 |
| 320 | 3300030733 | Ga0314311_1253491 | Ga0314311_12534912 | 99 |
| 321 | 3300030745 | Ga0316182_1143142 | Ga0316182_11431422 | 99 |
| 322 | 3300031548 | Ga0307408_100976345 | Ga0307408_1009763452 | 99 |
| 323 | 3300031731 | Ga0307405_10131466 | Ga0307405_101314662 | 99 |
| 324 | 3300031731 | Ga0307405_10277340 | Ga0307405_102773402 | 99 |
| 325 | 3300031824 | Ga0307413_10404179 | Ga0307413_104041792 | 99 |
| 326 | 3300031824 | Ga0307413_11559135 | Ga0307413_115591351 | 99 |
| 327 | 3300031852 | Ga0307410_10037798 | Ga0307410_100377984 | 99 |
| 328 | 3300031901 | Ga0307406_10140868 | Ga0307406_101408682 | 99 |
| 329 | 3300031903 | Ga0307407_10048701 | Ga0307407_100487013 | 99 |
| 330 | 3300031911 | Ga0307412_10124621 | Ga0307412_101246213 | 99 |
| 331 | 3300031911 | Ga0307412_10257255 | Ga0307412_102572552 | 99 |
| 332 | 3300031995 | Ga0307409_100047278 | Ga0307409_1000472784 | 99 |
| 333 | 3300032002 | Ga0307416_100004713 | Ga0307416_1000047134 | 99 |
| 334 | 3300032002 | Ga0307416_100235767 | Ga0307416_1002357673 | 99 |
| 335 | 3300032004 | Ga0307414_10023731 | Ga0307414_100237313 | 99 |
| 336 | 3300032005 | Ga0307411_10081890 | Ga0307411_100818903 | 99 |
| 337 | 3300032126 | Ga0307415_100227176 | Ga0307415_1002271763 | 99 |
| 338 | 3300032126 | Ga0307415_100376777 | Ga0307415_1003767772 | 99 |
| 339 | 3300035121 | Ga0373960_0199482 | Ga0373960_0199482_149_466 | 99 |
| 340 | 3300037312 | Ga0395899_0897136 | Ga0395899_0897136_98_412 | 99 |
| 341 | 3300037418 | Ga0395900_0527695 | Ga0395900_0527695_519_836 | 99 |
| 342 | 3300037466 | Ga0395898_0046699 | Ga0395898_0046699_2188_2505 | 99 |
| 343 | 3300037471 | Ga0395905_0080602 | Ga0395905_0080602_1334_1651 | 99 |
| 344 | 3300037471 | Ga0395905_0108260 | Ga0395905_0108260_880_1191 | 99 |
| 345 | 3300038443 | Ga0395901_0080396 | Ga0395901_0080396_1414_1725 | 99 |
| 346 | 3300041498 | Ga0451841_0144706 | Ga0451841_0144706_434_733 | 99 |
| 347 | 3300044658 | Ga0466972_0130273 | Ga0466972_0130273_210_527 | 99 |
| 348 | 3300044684 | Ga0466966_0192681 | Ga0466966_0192681_112_429 | 99 |
| 349 | 3300044693 | Ga0466961_0237162 | Ga0466961_0237162_228_545 | 99 |
| 350 | 3300044719 | Ga0466971_0159667 | Ga0466971_0159667_704_1015 | 99 |
| 351 | 3300044765 | Ga0466970_0127220 | Ga0466970_0127220_538_855 | 99 |
| 352 | 3300045836 | Ga0466958_0222681 | Ga0466958_0222681_218_529 | 99 |
| 353 | 3300046525 | Ga0495663_0045789 | Ga0495663_0045789_86_409 | 99 |
| 354 | 3300046537 | Ga0495598_0457120 | Ga0495598_0457120_180_491 | 99 |
| 355 | 3300046674 | Ga0495588_0245969 | Ga0495588_0245969_576_875 | 99 |
| 356 | 3300048903 | Ga0496100_0069097 | Ga0496100_0069097_1551_1868 | 99 |
| 357 | 3300048904 | Ga0496101_0073916 | Ga0496101_0073916_597_914 | 99 |
| 358 | 3300048904 | Ga0496101_0119799 | Ga0496101_0119799_90_389 | 99 |
| 359 | 3300048905 | Ga0496102_0185976 | Ga0496102_0185976_976_1293 | 99 |
| 360 | 3300048906 | Ga0496103_0145336 | Ga0496103_0145336_1074_1391 | 99 |
| 361 | 3300048909 | Ga0496106_1488525 | Ga0496106_1488525_211_510 | 99 |
| 362 | 3300048910 | Ga0496107_0025326 | Ga0496107_0025326_1532_1831 | 99 |
| 363 | 3300048911 | Ga0496108_0007546 | Ga0496108_0007546_1645_1962 | 99 |
| 364 | 3300048911 | Ga0496108_0074691 | Ga0496108_0074691_2103_2402 | 99 |
| 365 | 3300048912 | Ga0496109_0020109 | Ga0496109_0020109_3681_3998 | 99 |
| 366 | 3300048912 | Ga0496109_0092265 | Ga0496109_0092265_707_1006 | 99 |
| 367 | 3300048913 | Ga0496110_0095971 | Ga0496110_0095971_35_352 | 99 |
| 368 | 3300048913 | Ga0496110_0470993 | Ga0496110_0470993_416_715 | 99 |
| 369 | 3300048914 | Ga0496111_0002376 | Ga0496111_0002376_9878_10195 | 99 |
| 370 | 3300048914 | Ga0496111_0095725 | Ga0496111_0095725_1511_1810 | 99 |
| 371 | 3300048915 | Ga0496112_0076358 | Ga0496112_0076358_783_1100 | 99 |
| 372 | 3300048916 | Ga0496113_0065535 | Ga0496113_0065535_913_1230 | 99 |
| 373 | 3300048916 | Ga0496113_0481567 | Ga0496113_0481567_392_691 | 99 |
| 374 | 3300048917 | Ga0496114_0022507 | Ga0496114_0022507_2824_3123 | 99 |
| 375 | 3300048917 | Ga0496114_0030533 | Ga0496114_0030533_3549_3866 | 99 |
| 376 | 3300049663 | Ga0501223_130012 | Ga0501223_130012_11_310 | 99 |
| 377 | 3300049764 | Ga0501267_010056 | Ga0501267_010056_406_717 | 99 |
| 378 | 3300049765 | Ga0501268_001442 | Ga0501268_001442_1835_2146 | 99 |
| 379 | 3300049851 | Ga0501212_018679 | Ga0501212_018679_198_497 | 99 |
| 380 | 3300061719 | Ga0466962_0032304 | Ga0466962_0032304_607_918 | 99 |
| 381 | 3300001976 | JGI24752J21851_1009132 | JGI24752J21851_10091322 | 100 |
| 382 | 3300001977 | JGI24746J21847_1015818 | JGI24746J21847_10158182 | 100 |
| 383 | 3300001979 | JGI24740J21852_10004688 | JGI24740J21852_100046884 | 100 |
| 384 | 3300002070 | JGI24750J21931_1004215 | JGI24750J21931_10042153 | 100 |
| 385 | 3300002075 | JGI24738J21930_10125198 | JGI24738J21930_101251982 | 100 |
| 386 | 3300002077 | JGI24744J21845_10065977 | JGI24744J21845_100659772 | 100 |
| 387 | 3300002155 | JGI24033J26618_1045495 | JGI24033J26618_10454952 | 100 |
| 388 | 3300002239 | JGI24034J26672_10004624 | JGI24034J26672_100046242 | 100 |
| 389 | 3300002244 | JGI24742J22300_10032415 | JGI24742J22300_100324152 | 100 |
| 390 | 3300003203 | JGI25406J46586_10069732 | JGI25406J46586_100697323 | 100 |
| 391 | 3300005288 | Ga0065714_10537038 | Ga0065714_105370381 | 100 |
| 392 | 3300005290 | Ga0065712_10221985 | Ga0065712_102219851 | 100 |
| 393 | 3300005293 | Ga0065715_10000342 | Ga0065715_100003427 | 100 |
| 394 | 3300005293 | Ga0065715_10192805 | Ga0065715_101928052 | 100 |
| 395 | 3300005293 | Ga0065715_10623813 | Ga0065715_106238131 | 100 |
| 396 | 3300005295 | Ga0065707_10021840 | Ga0065707_100218402 | 100 |
| 397 | 3300005295 | Ga0065707_10049454 | Ga0065707_100494542 | 100 |
| 398 | 3300005295 | Ga0065707_10263428 | Ga0065707_102634283 | 100 |
| 399 | 3300005327 | Ga0070658_10009267 | Ga0070658_100092676 | 100 |
| 400 | 3300005327 | Ga0070658_10461231 | Ga0070658_104612313 | 100 |
| 401 | 3300005328 | Ga0070676_10056346 | Ga0070676_100563462 | 100 |
| 402 | 3300005328 | Ga0070676_10057452 | Ga0070676_100574523 | 100 |
| 403 | 3300005329 | Ga0070683_100007370 | Ga0070683_1000073703 | 100 |
| 404 | 3300005330 | Ga0070690_100189728 | Ga0070690_1001897283 | 100 |
| 405 | 3300005331 | Ga0070670_100020883 | Ga0070670_1000208837 | 100 |
| 406 | 3300005331 | Ga0070670_100091715 | Ga0070670_1000917152 | 100 |
| 407 | 3300005331 | Ga0070670_100511400 | Ga0070670_1005114002 | 100 |
| 408 | 3300005333 | Ga0070677_10001942 | Ga0070677_100019422 | 100 |
| 409 | 3300005333 | Ga0070677_10004813 | Ga0070677_100048135 | 100 |
| 410 | 3300005333 | Ga0070677_10031326 | Ga0070677_100313264 | 100 |
| 411 | 3300005334 | Ga0068869_100909888 | Ga0068869_1009098882 | 100 |
| 412 | 3300005335 | Ga0070666_10310298 | Ga0070666_103102982 | 100 |
| 413 | 3300005335 | Ga0070666_11457574 | Ga0070666_114575742 | 100 |
| 414 | 3300005339 | Ga0070660_100003053 | Ga0070660_10000305311 | 100 |
| 415 | 3300005339 | Ga0070660_100031784 | Ga0070660_1000317845 | 100 |
| 416 | 3300005340 | Ga0070689_101079868 | Ga0070689_1010798682 | 100 |
| 417 | 3300005344 | Ga0070661_100234169 | Ga0070661_1002341692 | 100 |
| 418 | 3300005344 | Ga0070661_100486956 | Ga0070661_1004869562 | 100 |
| 419 | 3300005345 | Ga0070692_10006534 | Ga0070692_100065341 | 100 |
| 420 | 3300005347 | Ga0070668_100024705 | Ga0070668_1000247055 | 100 |
| 421 | 3300005347 | Ga0070668_100264251 | Ga0070668_1002642511 | 100 |
| 422 | 3300005347 | Ga0070668_100324496 | Ga0070668_1003244963 | 100 |
| 423 | 3300005353 | Ga0070669_100025316 | Ga0070669_1000253163 | 100 |
| 424 | 3300005353 | Ga0070669_100075630 | Ga0070669_1000756304 | 100 |
| 425 | 3300005353 | Ga0070669_100773280 | Ga0070669_1007732802 | 100 |
| 426 | 3300005354 | Ga0070675_100015032 | Ga0070675_1000150324 | 100 |
| 427 | 3300005354 | Ga0070675_100017347 | Ga0070675_1000173478 | 100 |
| 428 | 3300005355 | Ga0070671_100012010 | Ga0070671_1000120102 | 100 |
| 429 | 3300005355 | Ga0070671_100193477 | Ga0070671_1001934772 | 100 |
| 430 | 3300005355 | Ga0070671_100282010 | Ga0070671_1002820103 | 100 |
| 431 | 3300005356 | Ga0070674_100073040 | Ga0070674_1000730403 | 100 |
| 432 | 3300005364 | Ga0070673_100455048 | Ga0070673_1004550482 | 100 |
| 433 | 3300005364 | Ga0070673_100620826 | Ga0070673_1006208262 | 100 |
| 434 | 3300005364 | Ga0070673_101581450 | Ga0070673_1015814502 | 100 |
| 435 | 3300005366 | Ga0070659_100083662 | Ga0070659_1000836624 | 100 |
| 436 | 3300005366 | Ga0070659_100119374 | Ga0070659_1001193741 | 100 |
| 437 | 3300005366 | Ga0070659_100132886 | Ga0070659_1001328862 | 100 |
| 438 | 3300005367 | Ga0070667_100295403 | Ga0070667_1002954032 | 100 |
| 439 | 3300005440 | Ga0070705_100219036 | Ga0070705_1002190362 | 100 |
| 440 | 3300005441 | Ga0070700_100074497 | Ga0070700_1000744973 | 100 |
| 441 | 3300005455 | Ga0070663_100108180 | Ga0070663_1001081802 | 100 |
| 442 | 3300005455 | Ga0070663_100180661 | Ga0070663_1001806611 | 100 |
| 443 | 3300005456 | Ga0070678_100238688 | Ga0070678_1002386883 | 100 |
| 444 | 3300005456 | Ga0070678_100566770 | Ga0070678_1005667702 | 100 |
| 445 | 3300005457 | Ga0070662_100000256 | Ga0070662_10000025622 | 100 |
| 446 | 3300005457 | Ga0070662_100199220 | Ga0070662_1001992203 | 100 |
| 447 | 3300005457 | Ga0070662_100393567 | Ga0070662_1003935673 | 100 |
| 448 | 3300005458 | Ga0070681_10020408 | Ga0070681_100204083 | 100 |
| 449 | 3300005458 | Ga0070681_10243452 | Ga0070681_102434523 | 100 |
| 450 | 3300005459 | Ga0068867_100230823 | Ga0068867_1002308232 | 100 |
| 451 | 3300005466 | Ga0070685_10256148 | Ga0070685_102561482 | 100 |
| 452 | 3300005530 | Ga0070679_100015769 | Ga0070679_1000157691 | 100 |
| 453 | 3300005535 | Ga0070684_100007613 | Ga0070684_10000761310 | 100 |
| 454 | 3300005539 | Ga0068853_100325181 | Ga0068853_1003251813 | 100 |
| 455 | 3300005543 | Ga0070672_100000621 | Ga0070672_1000006217 | 100 |
| 456 | 3300005545 | Ga0070695_100173364 | Ga0070695_1001733643 | 100 |
| 457 | 3300005548 | Ga0070665_101633204 | Ga0070665_1016332042 | 100 |
| 458 | 3300005549 | Ga0070704_100267828 | Ga0070704_1002678283 | 100 |
| 459 | 3300005563 | Ga0068855_100305229 | Ga0068855_1003052293 | 100 |
| 460 | 3300005564 | Ga0070664_100060771 | Ga0070664_1000607715 | 100 |
| 461 | 3300005564 | Ga0070664_101655831 | Ga0070664_1016558312 | 100 |
| 462 | 3300005578 | Ga0068854_100104529 | Ga0068854_1001045293 | 100 |
| 463 | 3300005578 | Ga0068854_100285104 | Ga0068854_1002851042 | 100 |
| 464 | 3300005578 | Ga0068854_100296893 | Ga0068854_1002968932 | 100 |
| 465 | 3300005614 | Ga0068856_100014742 | Ga0068856_1000147429 | 100 |
| 466 | 3300005614 | Ga0068856_100596929 | Ga0068856_1005969292 | 100 |
| 467 | 3300005617 | Ga0068859_100000965 | Ga0068859_10000096513 | 100 |
| 468 | 3300005618 | Ga0068864_100097177 | Ga0068864_1000971774 | 100 |
| 469 | 3300005719 | Ga0068861_100012250 | Ga0068861_1000122508 | 100 |
| 470 | 3300005719 | Ga0068861_101159756 | Ga0068861_1011597562 | 100 |
| 471 | 3300005840 | Ga0068870_10543471 | Ga0068870_105434711 | 100 |
| 472 | 3300005841 | Ga0068863_101367772 | Ga0068863_1013677722 | 100 |
| 473 | 3300005843 | Ga0068860_100033071 | Ga0068860_1000330714 | 100 |
| 474 | 3300005844 | Ga0068862_100006991 | Ga0068862_1000069917 | 100 |
| 475 | 3300005844 | Ga0068862_100083541 | Ga0068862_1000835414 | 100 |
| 476 | 3300005844 | Ga0068862_100311880 | Ga0068862_1003118802 | 100 |
| 477 | 3300005844 | Ga0068862_100445065 | Ga0068862_1004450652 | 100 |
| 478 | 3300005985 | Ga0081539_10079896 | Ga0081539_100798963 | 100 |
| 479 | 3300006058 | Ga0075432_10120944 | Ga0075432_101209441 | 100 |
| 480 | 3300006844 | Ga0075428_100122357 | Ga0075428_1001223573 | 100 |
| 481 | 3300006844 | Ga0075428_101057541 | Ga0075428_1010575412 | 100 |
| 482 | 3300006871 | Ga0075434_100566715 | Ga0075434_1005667152 | 100 |
| 483 | 3300006931 | Ga0097620_100000965 | Ga0097620_10000096513 | 100 |
| 484 | 3300007076 | Ga0075435_100715826 | Ga0075435_1007158262 | 100 |
| 485 | 3300009092 | Ga0105250_10157958 | Ga0105250_101579581 | 100 |
| 486 | 3300009094 | Ga0111539_10058672 | Ga0111539_100586726 | 100 |
| 487 | 3300009147 | Ga0114129_11445758 | Ga0114129_114457581 | 100 |
| 488 | 3300009148 | Ga0105243_10031560 | Ga0105243_100315603 | 100 |
| 489 | 3300009148 | Ga0105243_10435221 | Ga0105243_104352213 | 100 |
| 490 | 3300009176 | Ga0105242_10866117 | Ga0105242_108661172 | 100 |
| 491 | 3300009553 | Ga0105249_10006738 | Ga0105249_100067387 | 100 |
| 492 | 3300013100 | Ga0157373_10051714 | Ga0157373_100517143 | 100 |
| 493 | 3300013100 | Ga0157373_10294398 | Ga0157373_102943982 | 100 |
| 494 | 3300013102 | Ga0157371_10005811 | Ga0157371_1000581110 | 100 |
| 495 | 3300013104 | Ga0157370_10043289 | Ga0157370_100432895 | 100 |
| 496 | 3300013104 | Ga0157370_10112664 | Ga0157370_101126644 | 100 |
| 497 | 3300013104 | Ga0157370_10577023 | Ga0157370_105770232 | 100 |
| 498 | 3300013306 | Ga0163162_12525842 | Ga0163162_125258422 | 100 |
| 499 | 3300013307 | Ga0157372_11121862 | Ga0157372_111218621 | 100 |
| 500 | 3300013308 | Ga0157375_10570887 | Ga0157375_105708873 | 100 |
| 501 | 3300013308 | Ga0157375_11940302 | Ga0157375_119403022 | 100 |
| 502 | 3300014326 | Ga0157380_10001273 | Ga0157380_1000127316 | 100 |
| 503 | 3300014326 | Ga0157380_10006494 | Ga0157380_100064947 | 100 |
| 504 | 3300014326 | Ga0157380_10063845 | Ga0157380_100638453 | 100 |
| 505 | 3300014326 | Ga0157380_10449188 | Ga0157380_104491883 | 100 |
| 506 | 3300014326 | Ga0157380_10970060 | Ga0157380_109700602 | 100 |
| 507 | 3300014745 | Ga0157377_10199658 | Ga0157377_101996583 | 100 |
| 508 | 3300017792 | Ga0163161_10118313 | Ga0163161_101183133 | 100 |
| 509 | 3300017792 | Ga0163161_10275217 | Ga0163161_102752172 | 100 |
| 510 | 3300021388 | Ga0213875_10008894 | Ga0213875_100088943 | 100 |
| 511 | 3300025271 | Ga0207666_1016307 | Ga0207666_10163072 | 100 |
| 512 | 3300025315 | Ga0207697_10000510 | Ga0207697_1000051016 | 100 |
| 513 | 3300025893 | Ga0207682_10000666 | Ga0207682_1000066613 | 100 |
| 514 | 3300025893 | Ga0207682_10001204 | Ga0207682_100012049 | 100 |
| 515 | 3300025893 | Ga0207682_10331620 | Ga0207682_103316201 | 100 |
| 516 | 3300025901 | Ga0207688_10015967 | Ga0207688_100159672 | 100 |
| 517 | 3300025901 | Ga0207688_10076183 | Ga0207688_100761833 | 100 |
| 518 | 3300025901 | Ga0207688_10831526 | Ga0207688_108315261 | 100 |
| 519 | 3300025903 | Ga0207680_10248209 | Ga0207680_102482092 | 100 |
| 520 | 3300025904 | Ga0207647_10087887 | Ga0207647_100878873 | 100 |
| 521 | 3300025907 | Ga0207645_10020395 | Ga0207645_100203954 | 100 |
| 522 | 3300025907 | Ga0207645_10047307 | Ga0207645_100473073 | 100 |
| 523 | 3300025908 | Ga0207643_10015753 | Ga0207643_100157534 | 100 |
| 524 | 3300025909 | Ga0207705_10000493 | Ga0207705_1000049312 | 100 |
| 525 | 3300025909 | Ga0207705_10004948 | Ga0207705_1000494812 | 100 |
| 526 | 3300025912 | Ga0207707_10077183 | Ga0207707_100771834 | 100 |
| 527 | 3300025912 | Ga0207707_10705885 | Ga0207707_107058852 | 100 |
| 528 | 3300025917 | Ga0207660_10000770 | Ga0207660_100007704 | 100 |
| 529 | 3300025919 | Ga0207657_10001607 | Ga0207657_1000160712 | 100 |
| 530 | 3300025919 | Ga0207657_10002261 | Ga0207657_100022616 | 100 |
| 531 | 3300025921 | Ga0207652_10000034 | Ga0207652_10000034124 | 100 |
| 532 | 3300025921 | Ga0207652_10819050 | Ga0207652_108190501 | 100 |
| 533 | 3300025923 | Ga0207681_10015791 | Ga0207681_100157915 | 100 |
| 534 | 3300025923 | Ga0207681_10492547 | Ga0207681_104925472 | 100 |
| 535 | 3300025925 | Ga0207650_10003622 | Ga0207650_100036227 | 100 |
| 536 | 3300025925 | Ga0207650_10008245 | Ga0207650_100082457 | 100 |
| 537 | 3300025925 | Ga0207650_10060549 | Ga0207650_100605492 | 100 |
| 538 | 3300025925 | Ga0207650_10469451 | Ga0207650_104694512 | 100 |
| 539 | 3300025926 | Ga0207659_10029702 | Ga0207659_100297025 | 100 |
| 540 | 3300025926 | Ga0207659_10660052 | Ga0207659_106600522 | 100 |
| 541 | 3300025931 | Ga0207644_10061569 | Ga0207644_100615693 | 100 |
| 542 | 3300025931 | Ga0207644_10239464 | Ga0207644_102394641 | 100 |
| 543 | 3300025931 | Ga0207644_10999672 | Ga0207644_109996722 | 100 |
| 544 | 3300025931 | Ga0207644_11365796 | Ga0207644_113657962 | 100 |
| 545 | 3300025932 | Ga0207690_10103377 | Ga0207690_101033772 | 100 |
| 546 | 3300025933 | Ga0207706_10000890 | Ga0207706_1000089023 | 100 |
| 547 | 3300025933 | Ga0207706_10103441 | Ga0207706_101034413 | 100 |
| 548 | 3300025933 | Ga0207706_10321832 | Ga0207706_103218322 | 100 |
| 549 | 3300025935 | Ga0207709_10025346 | Ga0207709_100253462 | 100 |
| 550 | 3300025937 | Ga0207669_10007915 | Ga0207669_100079153 | 100 |
| 551 | 3300025940 | Ga0207691_10003939 | Ga0207691_1000393912 | 100 |
| 552 | 3300025944 | Ga0207661_10002726 | Ga0207661_1000272612 | 100 |
| 553 | 3300025945 | Ga0207679_10025832 | Ga0207679_100258324 | 100 |
| 554 | 3300025945 | Ga0207679_10436606 | Ga0207679_104366061 | 100 |
| 555 | 3300025945 | Ga0207679_11467147 | Ga0207679_114671472 | 100 |
| 556 | 3300025949 | Ga0207667_10198963 | Ga0207667_101989633 | 100 |
| 557 | 3300025960 | Ga0207651_10394658 | Ga0207651_103946582 | 100 |
| 558 | 3300025960 | Ga0207651_10679264 | Ga0207651_106792642 | 100 |
| 559 | 3300025960 | Ga0207651_11225135 | Ga0207651_112251351 | 100 |
| 560 | 3300025961 | Ga0207712_10019404 | Ga0207712_100194044 | 100 |
| 561 | 3300025972 | Ga0207668_10000725 | Ga0207668_100007254 | 100 |
| 562 | 3300025972 | Ga0207668_10083904 | Ga0207668_100839042 | 100 |
| 563 | 3300025972 | Ga0207668_10153088 | Ga0207668_101530882 | 100 |
| 564 | 3300025972 | Ga0207668_11080095 | Ga0207668_110800952 | 100 |
| 565 | 3300025972 | Ga0207668_11297953 | Ga0207668_112979532 | 100 |
| 566 | 3300025972 | Ga0207668_11630469 | Ga0207668_116304692 | 100 |
| 567 | 3300025981 | Ga0207640_10025691 | Ga0207640_100256914 | 100 |
| 568 | 3300025981 | Ga0207640_10253713 | Ga0207640_102537132 | 100 |
| 569 | 3300025981 | Ga0207640_10852425 | Ga0207640_108524252 | 100 |
| 570 | 3300025986 | Ga0207658_10025755 | Ga0207658_100257554 | 100 |
| 571 | 3300026067 | Ga0207678_10117829 | Ga0207678_101178292 | 100 |
| 572 | 3300026067 | Ga0207678_10232981 | Ga0207678_102329811 | 100 |
| 573 | 3300026067 | Ga0207678_10517942 | Ga0207678_105179421 | 100 |
| 574 | 3300026067 | Ga0207678_10623058 | Ga0207678_106230582 | 100 |
| 575 | 3300026075 | Ga0207708_10096219 | Ga0207708_100962192 | 100 |
| 576 | 3300026078 | Ga0207702_10025645 | Ga0207702_100256453 | 100 |
| 577 | 3300026089 | Ga0207648_10070738 | Ga0207648_100707383 | 100 |
| 578 | 3300026089 | Ga0207648_11547694 | Ga0207648_115476941 | 100 |
| 579 | 3300026095 | Ga0207676_11361773 | Ga0207676_113617732 | 100 |
| 580 | 3300026118 | Ga0207675_100003414 | Ga0207675_1000034146 | 100 |
| 581 | 3300026118 | Ga0207675_101046344 | Ga0207675_1010463442 | 100 |
| 582 | 3300026121 | Ga0207683_10086893 | Ga0207683_100868934 | 100 |
| 583 | 3300026142 | Ga0207698_10237423 | Ga0207698_102374233 | 100 |
| 584 | 3300027876 | Ga0209974_10012159 | Ga0209974_100121593 | 100 |
| 585 | 3300027876 | Ga0209974_10111976 | Ga0209974_101119762 | 100 |
| 586 | 3300027876 | Ga0209974_10144322 | Ga0209974_101443222 | 100 |
| 587 | 3300027907 | Ga0207428_10412448 | Ga0207428_104124481 | 100 |
| 588 | 3300028379 | Ga0268266_10400797 | Ga0268266_104007973 | 100 |
| 589 | 3300028379 | Ga0268266_10711599 | Ga0268266_107115992 | 100 |
| 590 | 3300028380 | Ga0268265_10045110 | Ga0268265_100451104 | 100 |
| 591 | 3300028380 | Ga0268265_10060746 | Ga0268265_100607464 | 100 |
| 592 | 3300028380 | Ga0268265_10139783 | Ga0268265_101397832 | 100 |
| 593 | 3300028380 | Ga0268265_10309694 | Ga0268265_103096942 | 100 |
| 594 | 3300028380 | Ga0268265_10485968 | Ga0268265_104859682 | 100 |
| 595 | 3300028381 | Ga0268264_10131081 | Ga0268264_101310813 | 100 |
| 596 | 3300030745 | Ga0316182_1097813 | Ga0316182_10978132 | 100 |
| 597 | 3300031548 | Ga0307408_100038823 | Ga0307408_1000388232 | 100 |
| 598 | 3300031548 | Ga0307408_100059226 | Ga0307408_1000592263 | 100 |
| 599 | 3300031548 | Ga0307408_100125428 | Ga0307408_1001254282 | 100 |
| 600 | 3300031548 | Ga0307408_100190649 | Ga0307408_1001906493 | 100 |
| 601 | 3300031548 | Ga0307408_100217110 | Ga0307408_1002171103 | 100 |
| 602 | 3300031548 | Ga0307408_100259098 | Ga0307408_1002590982 | 100 |
| 603 | 3300031548 | Ga0307408_100264595 | Ga0307408_1002645952 | 100 |
| 604 | 3300031548 | Ga0307408_100268651 | Ga0307408_1002686512 | 100 |
| 605 | 3300031548 | Ga0307408_100481513 | Ga0307408_1004815132 | 100 |
| 606 | 3300031548 | Ga0307408_100631519 | Ga0307408_1006315191 | 100 |
| 607 | 3300031548 | Ga0307408_100647229 | Ga0307408_1006472292 | 100 |
| 608 | 3300031731 | Ga0307405_10011246 | Ga0307405_100112464 | 100 |
| 609 | 3300031731 | Ga0307405_10043464 | Ga0307405_100434643 | 100 |
| 610 | 3300031731 | Ga0307405_10083970 | Ga0307405_100839702 | 100 |
| 611 | 3300031731 | Ga0307405_10124597 | Ga0307405_101245973 | 100 |
| 612 | 3300031731 | Ga0307405_10138021 | Ga0307405_101380212 | 100 |
| 613 | 3300031731 | Ga0307405_10138067 | Ga0307405_101380671 | 100 |
| 614 | 3300031731 | Ga0307405_10154540 | Ga0307405_101545402 | 100 |
| 615 | 3300031731 | Ga0307405_10194962 | Ga0307405_101949623 | 100 |
| 616 | 3300031731 | Ga0307405_10279108 | Ga0307405_102791081 | 100 |
| 617 | 3300031731 | Ga0307405_10428309 | Ga0307405_104283092 | 100 |
| 618 | 3300031731 | Ga0307405_10580884 | Ga0307405_105808841 | 100 |
| 619 | 3300031731 | Ga0307405_11175306 | Ga0307405_111753062 | 100 |
| 620 | 3300031824 | Ga0307413_10001771 | Ga0307413_100017712 | 100 |
| 621 | 3300031824 | Ga0307413_10002336 | Ga0307413_100023368 | 100 |
| 622 | 3300031824 | Ga0307413_10008144 | Ga0307413_100081443 | 100 |
| 623 | 3300031824 | Ga0307413_10008954 | Ga0307413_100089544 | 100 |
| 624 | 3300031824 | Ga0307413_10016330 | Ga0307413_100163302 | 100 |
| 625 | 3300031824 | Ga0307413_10029579 | Ga0307413_100295792 | 100 |
| 626 | 3300031824 | Ga0307413_10033208 | Ga0307413_100332084 | 100 |
| 627 | 3300031824 | Ga0307413_10055905 | Ga0307413_100559053 | 100 |
| 628 | 3300031824 | Ga0307413_10064778 | Ga0307413_100647784 | 100 |
| 629 | 3300031824 | Ga0307413_10116366 | Ga0307413_101163663 | 100 |
| 630 | 3300031824 | Ga0307413_10136481 | Ga0307413_101364813 | 100 |
| 631 | 3300031824 | Ga0307413_10154946 | Ga0307413_101549463 | 100 |
| 632 | 3300031824 | Ga0307413_10156783 | Ga0307413_101567833 | 100 |
| 633 | 3300031824 | Ga0307413_10188188 | Ga0307413_101881881 | 100 |
| 634 | 3300031824 | Ga0307413_10203533 | Ga0307413_102035333 | 100 |
| 635 | 3300031824 | Ga0307413_10213513 | Ga0307413_102135132 | 100 |
| 636 | 3300031824 | Ga0307413_10237763 | Ga0307413_102377633 | 100 |
| 637 | 3300031824 | Ga0307413_10247035 | Ga0307413_102470353 | 100 |
| 638 | 3300031824 | Ga0307413_10423977 | Ga0307413_104239772 | 100 |
| 639 | 3300031824 | Ga0307413_10538999 | Ga0307413_105389991 | 100 |
| 640 | 3300031824 | Ga0307413_10544462 | Ga0307413_105444622 | 100 |
| 641 | 3300031824 | Ga0307413_10861511 | Ga0307413_108615112 | 100 |
| 642 | 3300031824 | Ga0307413_11651324 | Ga0307413_116513242 | 100 |
| 643 | 3300031824 | Ga0307413_12173076 | Ga0307413_121730762 | 100 |
| 644 | 3300031852 | Ga0307410_10001869 | Ga0307410_1000186913 | 100 |
| 645 | 3300031852 | Ga0307410_10021946 | Ga0307410_100219465 | 100 |
| 646 | 3300031852 | Ga0307410_10039136 | Ga0307410_100391364 | 100 |
| 647 | 3300031852 | Ga0307410_10042410 | Ga0307410_100424104 | 100 |
| 648 | 3300031852 | Ga0307410_10059083 | Ga0307410_100590834 | 100 |
| 649 | 3300031852 | Ga0307410_10059636 | Ga0307410_100596364 | 100 |
| 650 | 3300031852 | Ga0307410_10081003 | Ga0307410_100810033 | 100 |
| 651 | 3300031852 | Ga0307410_10082595 | Ga0307410_100825953 | 100 |
| 652 | 3300031852 | Ga0307410_10131359 | Ga0307410_101313593 | 100 |
| 653 | 3300031852 | Ga0307410_10135516 | Ga0307410_101355162 | 100 |
| 654 | 3300031852 | Ga0307410_10160115 | Ga0307410_101601152 | 100 |
| 655 | 3300031852 | Ga0307410_10187073 | Ga0307410_101870732 | 100 |
| 656 | 3300031852 | Ga0307410_10261634 | Ga0307410_102616343 | 100 |
| 657 | 3300031852 | Ga0307410_10304114 | Ga0307410_103041143 | 100 |
| 658 | 3300031852 | Ga0307410_10323457 | Ga0307410_103234572 | 100 |
| 659 | 3300031852 | Ga0307410_10437140 | Ga0307410_104371402 | 100 |
| 660 | 3300031852 | Ga0307410_10517971 | Ga0307410_105179712 | 100 |
| 661 | 3300031852 | Ga0307410_10552959 | Ga0307410_105529593 | 100 |
| 662 | 3300031852 | Ga0307410_10566358 | Ga0307410_105663583 | 100 |
| 663 | 3300031852 | Ga0307410_10653028 | Ga0307410_106530282 | 100 |
| 664 | 3300031852 | Ga0307410_11162054 | Ga0307410_111620542 | 100 |
| 665 | 3300031901 | Ga0307406_10006455 | Ga0307406_100064557 | 100 |
| 666 | 3300031901 | Ga0307406_10012269 | Ga0307406_100122694 | 100 |
| 667 | 3300031901 | Ga0307406_10043664 | Ga0307406_100436643 | 100 |
| 668 | 3300031901 | Ga0307406_10055483 | Ga0307406_100554832 | 100 |
| 669 | 3300031901 | Ga0307406_10060567 | Ga0307406_100605673 | 100 |
| 670 | 3300031901 | Ga0307406_10102367 | Ga0307406_101023673 | 100 |
| 671 | 3300031901 | Ga0307406_10113468 | Ga0307406_101134682 | 100 |
| 672 | 3300031901 | Ga0307406_10174190 | Ga0307406_101741903 | 100 |
| 673 | 3300031901 | Ga0307406_10181255 | Ga0307406_101812552 | 100 |
| 674 | 3300031901 | Ga0307406_10304127 | Ga0307406_103041271 | 100 |
| 675 | 3300031901 | Ga0307406_10306583 | Ga0307406_103065833 | 100 |
| 676 | 3300031901 | Ga0307406_10489556 | Ga0307406_104895561 | 100 |
| 677 | 3300031901 | Ga0307406_10613412 | Ga0307406_106134122 | 100 |
| 678 | 3300031901 | Ga0307406_10776530 | Ga0307406_107765302 | 100 |
| 679 | 3300031903 | Ga0307407_10002443 | Ga0307407_100024439 | 100 |
| 680 | 3300031903 | Ga0307407_10012359 | Ga0307407_100123594 | 100 |
| 681 | 3300031903 | Ga0307407_10041126 | Ga0307407_100411262 | 100 |
| 682 | 3300031903 | Ga0307407_10059400 | Ga0307407_100594002 | 100 |
| 683 | 3300031903 | Ga0307407_10078457 | Ga0307407_100784573 | 100 |
| 684 | 3300031903 | Ga0307407_10091386 | Ga0307407_100913863 | 100 |
| 685 | 3300031903 | Ga0307407_10125721 | Ga0307407_101257212 | 100 |
| 686 | 3300031903 | Ga0307407_10152681 | Ga0307407_101526813 | 100 |
| 687 | 3300031903 | Ga0307407_10317230 | Ga0307407_103172301 | 100 |
| 688 | 3300031903 | Ga0307407_10793923 | Ga0307407_107939231 | 100 |
| 689 | 3300031911 | Ga0307412_10001264 | Ga0307412_1000126414 | 100 |
| 690 | 3300031911 | Ga0307412_10033438 | Ga0307412_100334381 | 100 |
| 691 | 3300031911 | Ga0307412_10035218 | Ga0307412_100352184 | 100 |
| 692 | 3300031911 | Ga0307412_10046038 | Ga0307412_100460384 | 100 |
| 693 | 3300031911 | Ga0307412_10046929 | Ga0307412_100469294 | 100 |
| 694 | 3300031911 | Ga0307412_10049072 | Ga0307412_100490721 | 100 |
| 695 | 3300031911 | Ga0307412_10054484 | Ga0307412_100544844 | 100 |
| 696 | 3300031911 | Ga0307412_10063207 | Ga0307412_100632074 | 100 |
| 697 | 3300031911 | Ga0307412_10081414 | Ga0307412_100814143 | 100 |
| 698 | 3300031911 | Ga0307412_10110125 | Ga0307412_101101251 | 100 |
| 699 | 3300031911 | Ga0307412_10115219 | Ga0307412_101152192 | 100 |
| 700 | 3300031911 | Ga0307412_10170707 | Ga0307412_101707072 | 100 |
| 701 | 3300031911 | Ga0307412_10190102 | Ga0307412_101901023 | 100 |
| 702 | 3300031911 | Ga0307412_10235997 | Ga0307412_102359973 | 100 |
| 703 | 3300031911 | Ga0307412_10397387 | Ga0307412_103973872 | 100 |
| 704 | 3300031911 | Ga0307412_10492759 | Ga0307412_104927592 | 100 |
| 705 | 3300031911 | Ga0307412_10567763 | Ga0307412_105677632 | 100 |
| 706 | 3300031911 | Ga0307412_10794928 | Ga0307412_107949282 | 100 |
| 707 | 3300031911 | Ga0307412_11482037 | Ga0307412_114820372 | 100 |
| 708 | 3300031995 | Ga0307409_100013167 | Ga0307409_1000131677 | 100 |
| 709 | 3300031995 | Ga0307409_100023744 | Ga0307409_1000237445 | 100 |
| 710 | 3300031995 | Ga0307409_100068164 | Ga0307409_1000681643 | 100 |
| 711 | 3300031995 | Ga0307409_100083371 | Ga0307409_1000833712 | 100 |
| 712 | 3300031995 | Ga0307409_100113150 | Ga0307409_1001131503 | 100 |
| 713 | 3300031995 | Ga0307409_100118372 | Ga0307409_1001183723 | 100 |
| 714 | 3300031995 | Ga0307409_100139974 | Ga0307409_1001399743 | 100 |
| 715 | 3300031995 | Ga0307409_100215569 | Ga0307409_1002155691 | 100 |
| 716 | 3300031995 | Ga0307409_100234174 | Ga0307409_1002341743 | 100 |
| 717 | 3300031995 | Ga0307409_100260127 | Ga0307409_1002601273 | 100 |
| 718 | 3300031995 | Ga0307409_100266826 | Ga0307409_1002668263 | 100 |
| 719 | 3300031995 | Ga0307409_100355106 | Ga0307409_1003551061 | 100 |
| 720 | 3300031995 | Ga0307409_100365798 | Ga0307409_1003657982 | 100 |
| 721 | 3300031995 | Ga0307409_100388225 | Ga0307409_1003882253 | 100 |
| 722 | 3300031995 | Ga0307409_100457334 | Ga0307409_1004573342 | 100 |
| 723 | 3300031995 | Ga0307409_100467714 | Ga0307409_1004677142 | 100 |
| 724 | 3300031995 | Ga0307409_100679104 | Ga0307409_1006791041 | 100 |
| 725 | 3300031995 | Ga0307409_100746069 | Ga0307409_1007460692 | 100 |
| 726 | 3300031995 | Ga0307409_100768581 | Ga0307409_1007685812 | 100 |
| 727 | 3300031995 | Ga0307409_101076553 | Ga0307409_1010765532 | 100 |
| 728 | 3300031995 | Ga0307409_101951770 | Ga0307409_1019517702 | 100 |
| 729 | 3300032002 | Ga0307416_100007264 | Ga0307416_1000072644 | 100 |
| 730 | 3300032002 | Ga0307416_100021040 | Ga0307416_1000210404 | 100 |
| 731 | 3300032002 | Ga0307416_100024485 | Ga0307416_1000244851 | 100 |
| 732 | 3300032002 | Ga0307416_100026809 | Ga0307416_1000268091 | 100 |
| 733 | 3300032002 | Ga0307416_100055032 | Ga0307416_1000550322 | 100 |
| 734 | 3300032002 | Ga0307416_100132600 | Ga0307416_1001326003 | 100 |
| 735 | 3300032002 | Ga0307416_100140905 | Ga0307416_1001409053 | 100 |
| 736 | 3300032002 | Ga0307416_100218482 | Ga0307416_1002184822 | 100 |
| 737 | 3300032002 | Ga0307416_100275975 | Ga0307416_1002759752 | 100 |
| 738 | 3300032002 | Ga0307416_100305517 | Ga0307416_1003055172 | 100 |
| 739 | 3300032002 | Ga0307416_100515801 | Ga0307416_1005158012 | 100 |
| 740 | 3300032002 | Ga0307416_100561132 | Ga0307416_1005611322 | 100 |
| 741 | 3300032002 | Ga0307416_100564115 | Ga0307416_1005641152 | 100 |
| 742 | 3300032002 | Ga0307416_100583852 | Ga0307416_1005838522 | 100 |
| 743 | 3300032002 | Ga0307416_100798976 | Ga0307416_1007989762 | 100 |
| 744 | 3300032002 | Ga0307416_101589657 | Ga0307416_1015896572 | 100 |
| 745 | 3300032004 | Ga0307414_10008846 | Ga0307414_100088463 | 100 |
| 746 | 3300032004 | Ga0307414_10034489 | Ga0307414_100344893 | 100 |
| 747 | 3300032004 | Ga0307414_10039269 | Ga0307414_100392692 | 100 |
| 748 | 3300032004 | Ga0307414_10039374 | Ga0307414_100393742 | 100 |
| 749 | 3300032004 | Ga0307414_10043181 | Ga0307414_100431814 | 100 |
| 750 | 3300032004 | Ga0307414_10043610 | Ga0307414_100436104 | 100 |
| 751 | 3300032004 | Ga0307414_10058070 | Ga0307414_100580704 | 100 |
| 752 | 3300032004 | Ga0307414_10063874 | Ga0307414_100638742 | 100 |
| 753 | 3300032004 | Ga0307414_10067561 | Ga0307414_100675613 | 100 |
| 754 | 3300032004 | Ga0307414_10069348 | Ga0307414_100693484 | 100 |
| 755 | 3300032004 | Ga0307414_10069486 | Ga0307414_100694863 | 100 |
| 756 | 3300032004 | Ga0307414_10081161 | Ga0307414_100811613 | 100 |
| 757 | 3300032004 | Ga0307414_10092871 | Ga0307414_100928712 | 100 |
| 758 | 3300032004 | Ga0307414_10095382 | Ga0307414_100953823 | 100 |
| 759 | 3300032004 | Ga0307414_10099355 | Ga0307414_100993553 | 100 |
| 760 | 3300032004 | Ga0307414_10105829 | Ga0307414_101058293 | 100 |
| 761 | 3300032004 | Ga0307414_10107610 | Ga0307414_101076104 | 100 |
| 762 | 3300032004 | Ga0307414_10109688 | Ga0307414_101096883 | 100 |
| 763 | 3300032004 | Ga0307414_10161041 | Ga0307414_101610412 | 100 |
| 764 | 3300032004 | Ga0307414_10179950 | Ga0307414_101799502 | 100 |
| 765 | 3300032004 | Ga0307414_10189864 | Ga0307414_101898643 | 100 |
| 766 | 3300032004 | Ga0307414_10197111 | Ga0307414_101971112 | 100 |
| 767 | 3300032004 | Ga0307414_10362071 | Ga0307414_103620713 | 100 |
| 768 | 3300032004 | Ga0307414_10473557 | Ga0307414_104735572 | 100 |
| 769 | 3300032004 | Ga0307414_10512165 | Ga0307414_105121652 | 100 |
| 770 | 3300032004 | Ga0307414_10577268 | Ga0307414_105772682 | 100 |
| 771 | 3300032004 | Ga0307414_10659307 | Ga0307414_106593071 | 100 |
| 772 | 3300032004 | Ga0307414_10681532 | Ga0307414_106815322 | 100 |
| 773 | 3300032004 | Ga0307414_10819584 | Ga0307414_108195842 | 100 |
| 774 | 3300032004 | Ga0307414_10929000 | Ga0307414_109290001 | 100 |
| 775 | 3300032004 | Ga0307414_10977525 | Ga0307414_109775252 | 100 |
| 776 | 3300032004 | Ga0307414_11099521 | Ga0307414_110995212 | 100 |
| 777 | 3300032005 | Ga0307411_10007716 | Ga0307411_100077167 | 100 |
| 778 | 3300032005 | Ga0307411_10014210 | Ga0307411_100142104 | 100 |
| 779 | 3300032005 | Ga0307411_10015709 | Ga0307411_100157096 | 100 |
| 780 | 3300032005 | Ga0307411_10023981 | Ga0307411_100239813 | 100 |
| 781 | 3300032005 | Ga0307411_10026202 | Ga0307411_100262025 | 100 |
| 782 | 3300032005 | Ga0307411_10029200 | Ga0307411_100292004 | 100 |
| 783 | 3300032005 | Ga0307411_10035169 | Ga0307411_100351693 | 100 |
| 784 | 3300032005 | Ga0307411_10059754 | Ga0307411_100597542 | 100 |
| 785 | 3300032005 | Ga0307411_10076983 | Ga0307411_100769831 | 100 |
| 786 | 3300032005 | Ga0307411_10091067 | Ga0307411_100910671 | 100 |
| 787 | 3300032005 | Ga0307411_10099636 | Ga0307411_100996362 | 100 |
| 788 | 3300032005 | Ga0307411_10114562 | Ga0307411_101145622 | 100 |
| 789 | 3300032005 | Ga0307411_10161717 | Ga0307411_101617173 | 100 |
| 790 | 3300032005 | Ga0307411_10190232 | Ga0307411_101902322 | 100 |
| 791 | 3300032005 | Ga0307411_10211211 | Ga0307411_102112113 | 100 |
| 792 | 3300032005 | Ga0307411_10234869 | Ga0307411_102348693 | 100 |
| 793 | 3300032005 | Ga0307411_10305059 | Ga0307411_103050592 | 100 |
| 794 | 3300032005 | Ga0307411_10525097 | Ga0307411_105250972 | 100 |
| 795 | 3300032005 | Ga0307411_10596970 | Ga0307411_105969702 | 100 |
| 796 | 3300032005 | Ga0307411_10611810 | Ga0307411_106118102 | 100 |
| 797 | 3300032005 | Ga0307411_10909103 | Ga0307411_109091032 | 100 |
| 798 | 3300032005 | Ga0307411_11721950 | Ga0307411_117219502 | 100 |
| 799 | 3300032005 | Ga0307411_11980540 | Ga0307411_119805401 | 100 |
| 800 | 3300032005 | Ga0307411_12178113 | Ga0307411_121781132 | 100 |
| 801 | 3300032126 | Ga0307415_100027025 | Ga0307415_1000270253 | 100 |
| 802 | 3300032126 | Ga0307415_100029268 | Ga0307415_1000292682 | 100 |
| 803 | 3300032126 | Ga0307415_100050228 | Ga0307415_1000502283 | 100 |
| 804 | 3300032126 | Ga0307415_100195207 | Ga0307415_1001952073 | 100 |
| 805 | 3300032126 | Ga0307415_100238773 | Ga0307415_1002387733 | 100 |
| 806 | 3300032126 | Ga0307415_100244659 | Ga0307415_1002446593 | 100 |
| 807 | 3300032126 | Ga0307415_100305524 | Ga0307415_1003055242 | 100 |
| 808 | 3300032126 | Ga0307415_100704389 | Ga0307415_1007043892 | 100 |
| 809 | 3300032126 | Ga0307415_100989581 | Ga0307415_1009895812 | 100 |
| 810 | 3300032126 | Ga0307415_101080233 | Ga0307415_1010802332 | 100 |
| 811 | 3300032126 | Ga0307415_101624476 | Ga0307415_1016244762 | 100 |
| 812 | 3300034957 | Ga0373938_0205045 | Ga0373938_0205045_40_342 | 100 |
| 813 | 3300037312 | Ga0395899_0118334 | Ga0395899_0118334_851_1168 | 100 |
| 814 | 3300037312 | Ga0395899_0537020 | Ga0395899_0537020_356_676 | 100 |
| 815 | 3300037312 | Ga0395899_0840777 | Ga0395899_0840777_94_411 | 100 |
| 816 | 3300037418 | Ga0395900_0001132 | Ga0395900_0001132_20182_20496 | 100 |
| 817 | 3300037418 | Ga0395900_0056659 | Ga0395900_0056659_3029_3334 | 100 |
| 818 | 3300037418 | Ga0395900_0103583 | Ga0395900_0103583_59_364 | 100 |
| 819 | 3300037418 | Ga0395900_0752849 | Ga0395900_0752849_149_466 | 100 |
| 820 | 3300037418 | Ga0395900_0989934 | Ga0395900_0989934_198_515 | 100 |
| 821 | 3300037466 | Ga0395898_0208888 | Ga0395898_0208888_1098_1418 | 100 |
| 822 | 3300037466 | Ga0395898_0708496 | Ga0395898_0708496_279_596 | 100 |
| 823 | 3300037466 | Ga0395898_1849846 | Ga0395898_1849846_102_416 | 100 |
| 824 | 3300037471 | Ga0395905_0000083 | Ga0395905_0000083_39845_40159 | 100 |
| 825 | 3300037471 | Ga0395905_0119078 | Ga0395905_0119078_757_1071 | 100 |
| 826 | 3300037471 | Ga0395905_0182685 | Ga0395905_0182685_537_854 | 100 |
| 827 | 3300037471 | Ga0395905_0230543 | Ga0395905_0230543_1196_1522 | 100 |
| 828 | 3300037471 | Ga0395905_0673695 | Ga0395905_0673695_52_369 | 100 |
| 829 | 3300037471 | Ga0395905_0954486 | Ga0395905_0954486_92_397 | 100 |
| 830 | 3300037471 | Ga0395905_1026122 | Ga0395905_1026122_13_339 | 100 |
| 831 | 3300037853 | Ga0436364_1020203 | Ga0436364_1020203_2282_2605 | 100 |
| 832 | 3300038443 | Ga0395901_0000369 | Ga0395901_0000369_2989_3303 | 100 |
| 833 | 3300038443 | Ga0395901_0191467 | Ga0395901_0191467_283_600 | 100 |
| 834 | 3300038443 | Ga0395901_0231731 | Ga0395901_0231731_1307_1612 | 100 |
| 835 | 3300038443 | Ga0395901_0234727 | Ga0395901_0234727_824_1141 | 100 |
| 836 | 3300038443 | Ga0395901_0302693 | Ga0395901_0302693_1098_1418 | 100 |
| 837 | 3300038443 | Ga0395901_0573130 | Ga0395901_0573130_417_734 | 100 |
| 838 | 3300041404 | Ga0439436_0081773 | Ga0439436_0081773_41_358 | 100 |
| 839 | 3300041405 | Ga0439438_118197 | Ga0439438_118197_263_580 | 100 |
| 840 | 3300041407 | Ga0439447_114011 | Ga0439447_114011_138_455 | 100 |
| 841 | 3300041512 | Ga0451853_0382471 | Ga0451853_0382471_346_660 | 100 |
| 842 | 3300042004 | Ga0439445_0026926 | Ga0439445_0026926_133_453 | 100 |
| 843 | 3300042015 | Ga0439462_0058168 | Ga0439462_0058168_201_518 | 100 |
| 844 | 3300042116 | Ga0450912_037797 | Ga0450912_037797_47_349 | 100 |
| 845 | 3300042435 | Ga0439434_0029600 | Ga0439434_0029600_1246_1563 | 100 |
| 846 | 3300042436 | Ga0439435_0211751 | Ga0439435_0211751_47_367 | 100 |
| 847 | 3300044712 | Ga0453684_2029335 | Ga0453684_2029335_29_355 | 100 |
| 848 | 3300046491 | Ga0495584_0104676 | Ga0495584_0104676_1081_1401 | 100 |
| 849 | 3300046500 | Ga0495596_0207705 | Ga0495596_0207705_237_539 | 100 |
| 850 | 3300046525 | Ga0495663_0004305 | Ga0495663_0004305_3265_3567 | 100 |
| 851 | 3300046525 | Ga0495663_0030028 | Ga0495663_0030028_323_643 | 100 |
| 852 | 3300046525 | Ga0495663_0153945 | Ga0495663_0153945_384_710 | 100 |
| 853 | 3300046528 | Ga0495642_0021249 | Ga0495642_0021249_2080_2400 | 100 |
| 854 | 3300046537 | Ga0495598_0021423 | Ga0495598_0021423_51_365 | 100 |
| 855 | 3300046539 | Ga0495621_0000378 | Ga0495621_0000378_8847_9161 | 100 |
| 856 | 3300046539 | Ga0495621_0002551 | Ga0495621_0002551_273_575 | 100 |
| 857 | 3300046539 | Ga0495621_0003388 | Ga0495621_0003388_1888_2190 | 100 |
| 858 | 3300046539 | Ga0495621_0013290 | Ga0495621_0013290_157_471 | 100 |
| 859 | 3300046539 | Ga0495621_0233188 | Ga0495621_0233188_196_516 | 100 |
| 860 | 3300046542 | Ga0495597_0390565 | Ga0495597_0390565_118_444 | 100 |
| 861 | 3300046558 | Ga0495633_0017067 | Ga0495633_0017067_1488_1802 | 100 |
| 862 | 3300046558 | Ga0495633_0138241 | Ga0495633_0138241_540_860 | 100 |
| 863 | 3300046558 | Ga0495633_0368472 | Ga0495633_0368472_190_504 | 100 |
| 864 | 3300046615 | Ga0495656_0305153 | Ga0495656_0305153_482_796 | 100 |
| 865 | 3300046660 | Ga0495625_0534496 | Ga0495625_0534496_255_557 | 100 |
| 866 | 3300046664 | Ga0495659_0017251 | Ga0495659_0017251_856_1176 | 100 |
| 867 | 3300046664 | Ga0495659_0019471 | Ga0495659_0019471_436_750 | 100 |
| 868 | 3300046664 | Ga0495659_0129766 | Ga0495659_0129766_653_955 | 100 |
| 869 | 3300046684 | Ga0495669_0049962 | Ga0495669_0049962_255_569 | 100 |
| 870 | 3300046684 | Ga0495669_0071091 | Ga0495669_0071091_208_528 | 100 |
| 871 | 3300046691 | Ga0495670_0010033 | Ga0495670_0010033_1592_1894 | 100 |
| 872 | 3300046691 | Ga0495670_0045338 | Ga0495670_0045338_631_945 | 100 |
| 873 | 3300046691 | Ga0495670_0054949 | Ga0495670_0054949_1023_1337 | 100 |
| 874 | 3300046691 | Ga0495670_0150255 | Ga0495670_0150255_161_475 | 100 |
| 875 | 3300046691 | Ga0495670_0319206 | Ga0495670_0319206_177_497 | 100 |
| 876 | 3300046691 | Ga0495670_0797146 | Ga0495670_0797146_155_475 | 100 |
| 877 | 3300047318 | Ga0495636_0041912 | Ga0495636_0041912_345_659 | 100 |
| 878 | 3300047318 | Ga0495636_0177745 | Ga0495636_0177745_622_942 | 100 |
| 879 | 3300047445 | Ga0495677_0096931 | Ga0495677_0096931_485_799 | 100 |
| 880 | 3300047445 | Ga0495677_0141768 | Ga0495677_0141768_65_367 | 100 |
| 881 | 3300047445 | Ga0495677_0176316 | Ga0495677_0176316_480_800 | 100 |
| 882 | 3300048090 | Ga0495615_0184803 | Ga0495615_0184803_74_376 | 100 |
| 883 | 3300048905 | Ga0496102_0272185 | Ga0496102_0272185_218_544 | 100 |
| 884 | 3300048906 | Ga0496103_0087942 | Ga0496103_0087942_73_438 | 100 |
| 885 | 3300048906 | Ga0496103_0195568 | Ga0496103_0195568_398_724 | 100 |
| 886 | 3300048907 | Ga0496104_0750197 | Ga0496104_0750197_99_425 | 100 |
| 887 | 3300048912 | Ga0496109_0187450 | Ga0496109_0187450_1343_1645 | 100 |
| 888 | 3300048912 | Ga0496109_0490912 | Ga0496109_0490912_319_645 | 100 |
| 889 | 3300048916 | Ga0496113_0669144 | Ga0496113_0669144_442_768 | 100 |
| 890 | 3300049521 | Ga0501298_067568 | Ga0501298_067568_75_389 | 100 |
| 891 | 3300049656 | Ga0501209_185246 | Ga0501209_185246_232_552 | 100 |
| 892 | 3300049658 | Ga0501211_036345 | Ga0501211_036345_204_518 | 100 |
| 893 | 3300049661 | Ga0501217_178090 | Ga0501217_178090_211_525 | 100 |
| 894 | 3300049665 | Ga0501227_051465 | Ga0501227_051465_670_984 | 100 |
| 895 | 3300049668 | Ga0501233_050244 | Ga0501233_050244_234_548 | 100 |
| 896 | 3300049669 | Ga0501235_006983 | Ga0501235_006983_1859_2173 | 100 |
| 897 | 3300049674 | Ga0501242_068610 | Ga0501242_068610_88_408 | 100 |
| 898 | 3300049675 | Ga0501243_028456 | Ga0501243_028456_595_909 | 100 |
| 899 | 3300049675 | Ga0501243_048190 | Ga0501243_048190_56_376 | 100 |
| 900 | 3300049677 | Ga0501247_034044 | Ga0501247_034044_207_527 | 100 |
| 901 | 3300049680 | Ga0501250_007031 | Ga0501250_007031_342_662 | 100 |
| 902 | 3300049686 | Ga0501257_029067 | Ga0501257_029067_250_564 | 100 |
| 903 | 3300049704 | Ga0501221_167455 | Ga0501221_167455_191_505 | 100 |
| 904 | 3300049705 | Ga0501225_0094367 | Ga0501225_0094367_210_527 | 100 |
| 905 | 3300049707 | Ga0501234_103784 | Ga0501234_103784_124_441 | 100 |
| 906 | 3300049708 | Ga0501245_091241 | Ga0501245_091241_163_477 | 100 |
| 907 | 3300049760 | Ga0501263_015365 | Ga0501263_015365_87_401 | 100 |
| 908 | 3300049762 | Ga0501265_107782 | Ga0501265_107782_65_385 | 100 |
| 909 | 3300049764 | Ga0501267_003212 | Ga0501267_003212_627_941 | 100 |
| 910 | 3300049765 | Ga0501268_004932 | Ga0501268_004932_273_593 | 100 |
| 911 | 3300049765 | Ga0501268_008485 | Ga0501268_008485_588_902 | 100 |
| 912 | 3300049765 | Ga0501268_010277 | Ga0501268_010277_305_625 | 100 |
| 913 | 3300049767 | Ga0501270_042257 | Ga0501270_042257_437_751 | 100 |
| 914 | 3300049767 | Ga0501270_073948 | Ga0501270_073948_167_487 | 100 |
| 915 | 3300049769 | Ga0501272_007155 | Ga0501272_007155_424_738 | 100 |
| 916 | 3300049770 | Ga0501273_072515 | Ga0501273_072515_215_529 | 100 |
| 917 | 3300049779 | Ga0501283_034441 | Ga0501283_034441_468_782 | 100 |
| 918 | 3300050511 | nmdc:mga08y16_199835_c1 | nmdc:mga08y16_199835_c1_649_963 | 100 |
| 919 | 3300050511 | nmdc:mga08y16_93718_c1 | nmdc:mga08y16_93718_c1_2136_2438 | 100 |
| 920 | 3300050512 | nmdc:mga0n895_602073_c1 | nmdc:mga0n895_602073_c1_664_966 | 100 |
| 921 | 3300059424 | Ga0590075_175145 | Ga0590075_175145_211_540 | 100 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kyg-assembly1.cif.gz_B | crystal structure of vca0042 (l135r) complexed with c-di-gmp | 0.8764 | 15 | 89 |
| 8igv-assembly1.cif.gz_E | hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp-pi)1cat(adp)2cat,2non-cat | 0.8581 | 41 | 89 |
| 8igv-assembly1.cif.gz_D | hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp-pi)1cat(adp)2cat,2non-cat | 0.8516 | 41 | 89 |
| 8igw-assembly1.cif.gz_D | hexameric ring complex of engineered v1-atpase bound to 4 adps: a3(de)3_(adp)3cat,1non-cat, hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp)3cat,2non-cat | 0.8458 | 41 | 95 |
| 8igu-assembly1.cif.gz_E | hexameric ring complex of engineered v1-atpase: a3(de)3_empty | 0.8455 | 41 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3kygA02 | Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains | 0.8892 | 20 | 89 | 2.40.10.220 |
| af_A0A1D6GI91_64_262_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8688 | 57 | 92 | 3.40.1280.10 |
| af_Q57670_3_72_2.40.30.20 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.8469 | 39 | 95 | 2.40.30.20 |
| 5kndD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8398 | 41 | 89 | 3.40.50.12240 |
| 5o95A01 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 | 0.839 | 57 | 93 | 2.40.240.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P6VRS3-F1-model_v4 | Chemotaxis protein | 0.9482 | 18 | 96 |
GO:0004888
GO:0006935 GO:0007165 GO:0016020 GO:0035438 |
| AF-A0A0T2QDW6-F1-model_v4 | PilZ domain-containing protein | 0.9477 | 14 | 96 |
GO:0035438
|
| AF-A0A1E4JCB8-F1-model_v4 | PilZ domain-containing protein | 0.947 | 20 | 98 |
GO:0035438
|
| AF-A0A1W9HN28-F1-model_v4 | PilZ domain-containing protein | 0.947 | 18 | 98 |
GO:0035438
|
| AF-A0A318B6W0-F1-model_v4 | deleted | 0.9468 | 20 | 94 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar