F485760

General Info

Members Datasets Scaffolds Average Seq Length
921 273 921 104

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10024141|Ga0207643_100241413
Length 103
Sequence MNFTAFKARIAEAGPERRRAGRSPIELDAKMRELGASGVDATILDVSERGFMAGAEGHFDVGARVWLIFPGRRERANAVVKWTAGDRIGAEFAEPVSLEVFRG

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
159 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
183 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
184 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
185 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
189 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
244 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
247 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
248 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
249 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
250 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
251 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
252 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
253 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
254 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
255 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
258 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
261 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
262 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
263 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
264 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
265 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
266 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
267 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
268 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
272 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 3.8
Rhizosphere 95.66
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1009132 3300001976 Bacteria 1293
2 JGI24752J21851_1039449 3300001976 Bacteria 631
3 JGI24746J21847_1015818 3300001977 Bacteria 1082
4 JGI24740J21852_10004688 3300001979 Bacteria 5857
5 JGI24739J22299_10003769 3300001989 Bacteria 5785
6 JGI24743J22301_10003347 3300001991 Bacteria 2526
7 JGI24735J21928_10158471 3300002067 Bacteria 654
8 JGI24750J21931_1004215 3300002070 Bacteria 1736
9 JGI24738J21930_10008755 3300002075 Bacteria 2295
10 JGI24738J21930_10125198 3300002075 Unclassified 560
11 JGI24744J21845_10000460 3300002077 Bacteria 7184
12 JGI24744J21845_10065977 3300002077 Unclassified 661
13 JGI24033J26618_1045495 3300002155 Unclassified 620
14 JGI24034J26672_10004624 3300002239 Bacteria 1956
15 JGI24034J26672_10007772 3300002239 Bacteria 1560
16 JGI24742J22300_10032415 3300002244 Bacteria 916
17 JGI25406J46586_10069732 3300003203 Bacteria 1107
18 Ga0065714_10537038 3300005288 Bacteria 504
19 Ga0065712_10221985 3300005290 Bacteria 1038
20 Ga0065715_10000342 3300005293 Bacteria 14168
21 Ga0065715_10192805 3300005293 Unclassified 1396
22 Ga0065715_10623813 3300005293 Unclassified 694
23 Ga0065707_10021840 3300005295 Bacteria 1325
24 Ga0065707_10049454 3300005295 Unclassified 925
25 Ga0065707_10263428 3300005295 Bacteria 1091
26 Ga0070658_10009267 3300005327 Bacteria 7915
27 Ga0070658_10055284 3300005327 Bacteria 3225
28 Ga0070658_10461231 3300005327 Bacteria 1095
29 Ga0070676_10056346 3300005328 Bacteria 2322
30 Ga0070676_10057452 3300005328 Bacteria 2303
31 Ga0070676_10128949 3300005328 Bacteria 1597
32 Ga0070683_100007370 3300005329 Bacteria 9295
33 Ga0070683_100371221 3300005329 Bacteria 1363
34 Ga0070690_100189728 3300005330 Bacteria 1424
35 Ga0070670_100003949 3300005331 Bacteria 12373
36 Ga0070670_100020883 3300005331 Bacteria 5632
37 Ga0070670_100073702 3300005331 Bacteria 2932
38 Ga0070670_100091715 3300005331 Bacteria 2612
39 Ga0070670_100152470 3300005331 Bacteria 2000
40 Ga0070670_100511400 3300005331 Bacteria 1069
41 Ga0070677_10001942 3300005333 Bacteria 6555
42 Ga0070677_10004813 3300005333 Bacteria 4429
43 Ga0070677_10031326 3300005333 Bacteria 2032
44 Ga0070677_10350013 3300005333 Bacteria 765
45 Ga0070677_10377162 3300005333 Unclassified 742
46 Ga0068869_100055312 3300005334 Bacteria 2892
47 Ga0068869_100909888 3300005334 Unclassified 762
48 Ga0070666_10010746 3300005335 Bacteria 5728
49 Ga0070666_10013349 3300005335 Bacteria 5208
50 Ga0070666_10310298 3300005335 Unclassified 1124
51 Ga0070666_11457574 3300005335 Unclassified 512
52 Ga0070680_100059272 3300005336 Bacteria 3131
53 Ga0070682_100044119 3300005337 Bacteria 2760
54 Ga0070682_100222041 3300005337 Bacteria 1345
55 Ga0068868_100105547 3300005338 Bacteria 2285
56 Ga0070660_100003053 3300005339 Bacteria 11523
57 Ga0070660_100031784 3300005339 Bacteria 3967
58 Ga0070660_100164602 3300005339 Bacteria 1788
59 Ga0070660_100529424 3300005339 Unclassified 982
60 Ga0070660_100798926 3300005339 Bacteria 793
61 Ga0070689_101079868 3300005340 Unclassified 717
62 Ga0070661_100071853 3300005344 Bacteria 2546
63 Ga0070661_100179470 3300005344 Bacteria 1610
64 Ga0070661_100224617 3300005344 Bacteria 1441
65 Ga0070661_100234169 3300005344 Bacteria 1412
66 Ga0070661_100486956 3300005344 Bacteria 986
67 Ga0070692_10006534 3300005345 Bacteria 5069
68 Ga0070668_100024705 3300005347 Bacteria 4554
69 Ga0070668_100264251 3300005347 Bacteria 1432
70 Ga0070668_100305769 3300005347 Bacteria 1335
71 Ga0070668_100324496 3300005347 Bacteria 1297
72 Ga0070668_100358884 3300005347 Unclassified 1235
73 Ga0070669_100025316 3300005353 Bacteria 4261
74 Ga0070669_100060853 3300005353 Bacteria 2774
75 Ga0070669_100075630 3300005353 Bacteria 2498
76 Ga0070669_100171217 3300005353 Bacteria 1693
77 Ga0070669_100301300 3300005353 Bacteria 1289
78 Ga0070669_100773280 3300005353 Unclassified 815
79 Ga0070675_100005746 3300005354 Bacteria 9488
80 Ga0070675_100015032 3300005354 Bacteria 6114
81 Ga0070675_100017347 3300005354 Bacteria 5719
82 Ga0070675_100087324 3300005354 Unclassified 2608
83 Ga0070675_101851322 3300005354 Bacteria 557
84 Ga0070671_100007735 3300005355 Bacteria 8585
85 Ga0070671_100012010 3300005355 Bacteria 6966
86 Ga0070671_100016707 3300005355 Bacteria 5934
87 Ga0070671_100034633 3300005355 Bacteria 4181
88 Ga0070671_100193477 3300005355 Bacteria 1724
89 Ga0070671_100282010 3300005355 Bacteria 1413
90 Ga0070674_100073040 3300005356 Bacteria 2431
91 Ga0070674_100116809 3300005356 Bacteria 1969
92 Ga0070674_100546938 3300005356 Bacteria 971
93 Ga0070673_100007157 3300005364 Bacteria 7331
94 Ga0070673_100114318 3300005364 Bacteria 2243
95 Ga0070673_100181720 3300005364 Bacteria 1801
96 Ga0070673_100445345 3300005364 Bacteria 1164
97 Ga0070673_100455048 3300005364 Bacteria 1152
98 Ga0070673_100620826 3300005364 Unclassified 987
99 Ga0070673_101581450 3300005364 Bacteria 619
100 Ga0070688_100920959 3300005365 Unclassified 690
101 Ga0070688_101553968 3300005365 Bacteria 539
102 Ga0070659_100016115 3300005366 Bacteria 5608
103 Ga0070659_100083662 3300005366 Bacteria 2551
104 Ga0070659_100119374 3300005366 Bacteria 2134
105 Ga0070659_100132886 3300005366 Bacteria 2022
106 Ga0070659_100324129 3300005366 Bacteria 1288
107 Ga0070659_101034369 3300005366 Bacteria 722
108 Ga0070659_101327244 3300005366 Unclassified 638
109 Ga0070667_100003813 3300005367 Bacteria 12811
110 Ga0070667_100013452 3300005367 Bacteria 6764
111 Ga0070667_100042585 3300005367 Bacteria 3809
112 Ga0070667_100180950 3300005367 Bacteria 1864
113 Ga0070667_100295403 3300005367 Bacteria 1458
114 Ga0070667_100513443 3300005367 Bacteria 1099
115 Ga0070714_100026253 3300005435 Bacteria 4812
116 Ga0070714_100744508 3300005435 Bacteria 947
117 Ga0070713_100299850 3300005436 Bacteria 1479
118 Ga0070705_100219036 3300005440 Bacteria 1317
119 Ga0070700_100074497 3300005441 Bacteria 2175
120 Ga0070663_100077233 3300005455 Bacteria 2437
121 Ga0070663_100108180 3300005455 Bacteria 2085
122 Ga0070663_100180661 3300005455 Bacteria 1636
123 Ga0070678_100042261 3300005456 Bacteria 3239
124 Ga0070678_100136755 3300005456 Bacteria 1955
125 Ga0070678_100238688 3300005456 Bacteria 1519
126 Ga0070678_100466818 3300005456 Bacteria 1108
127 Ga0070678_100566770 3300005456 Bacteria 1010
128 Ga0070678_102182271 3300005456 Unclassified 525
129 Ga0070662_100000256 3300005457 Bacteria 31436
130 Ga0070662_100004584 3300005457 Bacteria 8750
131 Ga0070662_100041923 3300005457 Bacteria 3268
132 Ga0070662_100199220 3300005457 Bacteria 1588
133 Ga0070662_100218919 3300005457 Bacteria 1518
134 Ga0070662_100393567 3300005457 Unclassified 1142
135 Ga0070681_10020408 3300005458 Bacteria 6641
136 Ga0070681_10243452 3300005458 Bacteria 1712
137 Ga0068867_100230823 3300005459 Bacteria 1496
138 Ga0070685_10109552 3300005466 Unclassified 1699
139 Ga0070685_10256148 3300005466 Bacteria 1161
140 Ga0070679_100015769 3300005530 Bacteria 7269
141 Ga0070684_100007613 3300005535 Bacteria 8441
142 Ga0070684_100921082 3300005535 Bacteria 819
143 Ga0068853_100075317 3300005539 Bacteria 2945
144 Ga0068853_100116509 3300005539 Bacteria 2379
145 Ga0068853_100118658 3300005539 Bacteria 2357
146 Ga0068853_100325181 3300005539 Bacteria 1426
147 Ga0068853_100538912 3300005539 Bacteria 1105
148 Ga0070672_100000621 3300005543 Bacteria 20802
149 Ga0070672_100009064 3300005543 Bacteria 6843
150 Ga0070672_100032433 3300005543 Bacteria 3941
151 Ga0070672_100143380 3300005543 Bacteria 1972
152 Ga0070695_100173364 3300005545 Bacteria 1523
153 Ga0070665_100008330 3300005548 Bacteria 10484
154 Ga0070665_100032554 3300005548 Bacteria 5247
155 Ga0070665_101633204 3300005548 Unclassified 652
156 Ga0070704_100267828 3300005549 Bacteria 1410
157 Ga0068855_100305229 3300005563 Bacteria 1762
158 Ga0068855_100500959 3300005563 Bacteria 1320
159 Ga0068855_100548208 3300005563 Bacteria 1252
160 Ga0068855_101336798 3300005563 Bacteria 740
161 Ga0070664_100024096 3300005564 Bacteria 5031
162 Ga0070664_100041421 3300005564 Bacteria 3886
163 Ga0070664_100060771 3300005564 Bacteria 3219
164 Ga0070664_100156468 3300005564 Bacteria 2014
165 Ga0070664_100221600 3300005564 Bacteria 1692
166 Ga0070664_100335664 3300005564 Bacteria 1372
167 Ga0070664_101655831 3300005564 Unclassified 606
168 Ga0068857_100092398 3300005577 Bacteria 2709
169 Ga0068857_100230276 3300005577 Bacteria 1694
170 Ga0068854_100002116 3300005578 Bacteria 12177
171 Ga0068854_100013400 3300005578 Bacteria 5380
172 Ga0068854_100104529 3300005578 Bacteria 2128
173 Ga0068854_100285104 3300005578 Bacteria 1331
174 Ga0068854_100296893 3300005578 Bacteria 1306
175 Ga0068854_100916976 3300005578 Bacteria 771
176 Ga0068856_100014742 3300005614 Bacteria 7544
177 Ga0068856_100532375 3300005614 Bacteria 1196
178 Ga0068856_100596929 3300005614 Unclassified 1125
179 Ga0068856_100976185 3300005614 Bacteria 866
180 Ga0068856_101552637 3300005614 Bacteria 675
181 Ga0068852_100005093 3300005616 Bacteria 9355
182 Ga0068852_100176396 3300005616 Bacteria 2007
183 Ga0068852_100263042 3300005616 Unclassified 1657
184 Ga0068852_100296398 3300005616 Bacteria 1564
185 Ga0068852_100419073 3300005616 Bacteria 1320
186 Ga0068852_101815996 3300005616 Bacteria 632
187 Ga0068859_100000965 3300005617 Bacteria 29425
188 Ga0068859_100002392 3300005617 Bacteria 19100
189 Ga0068859_100421982 3300005617 Unclassified 1430
190 Ga0068859_100481772 3300005617 Unclassified 1336
191 Ga0068864_100001110 3300005618 Bacteria 22495
192 Ga0068864_100042715 3300005618 Bacteria 3879
193 Ga0068864_100097177 3300005618 Bacteria 2607
194 Ga0068861_100012250 3300005719 Bacteria 5980
195 Ga0068861_100040656 3300005719 Bacteria 3479
196 Ga0068861_101159756 3300005719 Bacteria 745
197 Ga0068870_10467497 3300005840 Unclassified 834
198 Ga0068870_10543471 3300005840 Unclassified 781
199 Ga0068863_100001056 3300005841 Bacteria 27521
200 Ga0068863_100022022 3300005841 Bacteria 6083
201 Ga0068863_100183835 3300005841 Bacteria 2007
202 Ga0068863_101367772 3300005841 Unclassified 715
203 Ga0068858_100003145 3300005842 Bacteria 16530
204 Ga0068858_100053942 3300005842 Bacteria 3718
205 Ga0068858_100116228 3300005842 Bacteria 2500
206 Ga0068860_100002768 3300005843 Bacteria 18241
207 Ga0068860_100033071 3300005843 Bacteria 4965
208 Ga0068860_100189793 3300005843 Bacteria 1988
209 Ga0068860_100360498 3300005843 Unclassified 1432
210 Ga0068862_100006991 3300005844 Bacteria 9367
211 Ga0068862_100083541 3300005844 Bacteria 2773
212 Ga0068862_100098570 3300005844 Bacteria 2553
213 Ga0068862_100311880 3300005844 Bacteria 1450
214 Ga0068862_100445065 3300005844 Unclassified 1220
215 Ga0068862_101273713 3300005844 Unclassified 736
216 Ga0081539_10079896 3300005985 Bacteria 1722
217 Ga0075432_10120944 3300006058 Bacteria 984
218 Ga0097621_100214655 3300006237 Bacteria 1675
219 Ga0097621_100290134 3300006237 Unclassified 1442
220 Ga0068871_100124012 3300006358 Bacteria 2185
221 Ga0068871_101288821 3300006358 Bacteria 687
222 Ga0075428_100122357 3300006844 Bacteria 2833
223 Ga0075428_101057541 3300006844 Bacteria 858
224 Ga0075434_100566715 3300006871 Bacteria 1155
225 Ga0097620_100000965 3300006931 Bacteria 29425
226 Ga0097620_100002392 3300006931 Bacteria 19100
227 Ga0097620_100421983 3300006931 Unclassified 1430
228 Ga0097620_100481782 3300006931 Unclassified 1336
229 Ga0097620_101811394 3300006931 Unclassified 674
230 Ga0075435_100715826 3300007076 Unclassified 870
231 Ga0105250_10157958 3300009092 Bacteria 946
232 Ga0111539_10058672 3300009094 Bacteria 4565
233 Ga0114129_11445758 3300009147 Bacteria 847
234 Ga0105243_10031560 3300009148 Bacteria 4085
235 Ga0105243_10435221 3300009148 Bacteria 1227
236 Ga0105243_11640159 3300009148 Bacteria 671
237 Ga0105242_10505552 3300009176 Unclassified 1150
238 Ga0105242_10866117 3300009176 Unclassified 900
239 Ga0105248_10001320 3300009177 Bacteria 27621
240 Ga0105248_10034268 3300009177 Bacteria 5676
241 Ga0105248_10148348 3300009177 Bacteria 2646
242 Ga0105248_10178322 3300009177 Bacteria 2395
243 Ga0105249_10006738 3300009553 Bacteria 10007
244 Ga0105249_10026708 3300009553 Bacteria 5205
245 Ga0105249_13272175 3300009553 Unclassified 521
246 Ga0105239_11303652 3300010375 Bacteria 838
247 Ga0157373_10051714 3300013100 Bacteria 2925
248 Ga0157373_10075054 3300013100 Bacteria 2385
249 Ga0157373_10265257 3300013100 Bacteria 1215
250 Ga0157373_10294398 3300013100 Bacteria 1151
251 Ga0157371_10005811 3300013102 Bacteria 10323
252 Ga0157371_10014319 3300013102 Bacteria 5990
253 Ga0157371_10044524 3300013102 Bacteria 3160
254 Ga0157371_10122350 3300013102 Bacteria 1850
255 Ga0157371_10219230 3300013102 Unclassified 1366
256 Ga0157370_10043289 3300013104 Bacteria 4334
257 Ga0157370_10043428 3300013104 Bacteria 4326
258 Ga0157370_10050194 3300013104 Bacteria 3989
259 Ga0157370_10112664 3300013104 Bacteria 2542
260 Ga0157370_10577023 3300013104 Bacteria 1030
261 Ga0157374_10002253 3300013296 Bacteria 16246
262 Ga0163162_10039027 3300013306 Bacteria 4741
263 Ga0163162_10084100 3300013306 Bacteria 3257
264 Ga0163162_10182809 3300013306 Bacteria 2223
265 Ga0163162_12525842 3300013306 Unclassified 591
266 Ga0157372_10121713 3300013307 Bacteria 2998
267 Ga0157372_10136334 3300013307 Bacteria 2826
268 Ga0157372_11121862 3300013307 Bacteria 910
269 Ga0157375_10004680 3300013308 Bacteria 11902
270 Ga0157375_10006077 3300013308 Bacteria 10533
271 Ga0157375_10312902 3300013308 Bacteria 1735
272 Ga0157375_10570887 3300013308 Bacteria 1292
273 Ga0157375_11940302 3300013308 Bacteria 699
274 Ga0163163_10002706 3300014325 Bacteria 14968
275 Ga0163163_10006151 3300014325 Bacteria 10461
276 Ga0163163_10129296 3300014325 Bacteria 2565
277 Ga0157380_10001273 3300014326 Bacteria 16384
278 Ga0157380_10006494 3300014326 Bacteria 8243
279 Ga0157380_10063845 3300014326 Bacteria 2954
280 Ga0157380_10449188 3300014326 Bacteria 1237
281 Ga0157380_10970060 3300014326 Unclassified 881
282 Ga0157377_10199658 3300014745 Unclassified 1269
283 Ga0157379_10057778 3300014968 Bacteria 3467
284 Ga0163161_10005360 3300017792 Bacteria 8915
285 Ga0163161_10118313 3300017792 Bacteria 1988
286 Ga0163161_10275217 3300017792 Bacteria 1319
287 Ga0206354_11377068 3300020081 Bacteria 761
288 Ga0206353_11229904 3300020082 Bacteria 1037
289 Ga0213875_10008894 3300021388 Bacteria 5120
290 Ga0207666_1016307 3300025271 Bacteria 1064
291 Ga0207697_10000510 3300025315 Bacteria 21916
292 Ga0207697_10075935 3300025315 Unclassified 1412
293 Ga0207697_10076849 3300025315 Bacteria 1404
294 Ga0207682_10000666 3300025893 Bacteria 16058
295 Ga0207682_10001204 3300025893 Bacteria 11981
296 Ga0207682_10200028 3300025893 Bacteria 918
297 Ga0207682_10331620 3300025893 Bacteria 715
298 Ga0207688_10015967 3300025901 Bacteria 4070
299 Ga0207688_10076183 3300025901 Bacteria 1910
300 Ga0207688_10831526 3300025901 Bacteria 585
301 Ga0207680_10145261 3300025903 Unclassified 1576
302 Ga0207680_10248209 3300025903 Unclassified 1229
303 Ga0207647_10035461 3300025904 Bacteria 3179
304 Ga0207647_10087887 3300025904 Bacteria 1856
305 Ga0207645_10020395 3300025907 Bacteria 4339
306 Ga0207645_10047307 3300025907 Bacteria 2747
307 Ga0207645_10338725 3300025907 Bacteria 1005
308 Ga0207643_10015753 3300025908 Bacteria 4117
309 Ga0207643_10024141 3300025908 Bacteria 3355
310 Ga0207705_10000493 3300025909 Bacteria 33656
311 Ga0207705_10004948 3300025909 Bacteria 10002
312 Ga0207705_10070386 3300025909 Bacteria 2535
313 Ga0207705_10181581 3300025909 Bacteria 1588
314 Ga0207705_10460663 3300025909 Bacteria 986
315 Ga0207707_10077183 3300025912 Bacteria 2908
316 Ga0207707_10705885 3300025912 Bacteria 847
317 Ga0207660_10000770 3300025917 Bacteria 21320
318 Ga0207660_10183644 3300025917 Bacteria 1625
319 Ga0207657_10001607 3300025919 Bacteria 24285
320 Ga0207657_10002261 3300025919 Bacteria 20877
321 Ga0207657_10011972 3300025919 Bacteria 8582
322 Ga0207657_10067574 3300025919 Bacteria 3039
323 Ga0207657_10522752 3300025919 Unclassified 929
324 Ga0207649_10031507 3300025920 Bacteria 3152
325 Ga0207649_10082933 3300025920 Bacteria 2080
326 Ga0207649_10121521 3300025920 Bacteria 1761
327 Ga0207652_10000034 3300025921 Bacteria 138571
328 Ga0207652_10819050 3300025921 Bacteria 826
329 Ga0207652_11156691 3300025921 Bacteria 675
330 Ga0207681_10015791 3300025923 Bacteria 4713
331 Ga0207681_10075878 3300025923 Bacteria 2359
332 Ga0207681_10492547 3300025923 Bacteria 1002
333 Ga0207681_11112772 3300025923 Bacteria 663
334 Ga0207681_11559780 3300025923 Bacteria 553
335 Ga0207650_10003622 3300025925 Bacteria 10587
336 Ga0207650_10008245 3300025925 Bacteria 7113
337 Ga0207650_10060549 3300025925 Bacteria 2825
338 Ga0207650_10082656 3300025925 Bacteria 2438
339 Ga0207650_10123204 3300025925 Bacteria 2020
340 Ga0207650_10189762 3300025925 Bacteria 1641
341 Ga0207650_10469451 3300025925 Bacteria 1049
342 Ga0207659_10011166 3300025926 Bacteria 5666
343 Ga0207659_10029702 3300025926 Bacteria 3728
344 Ga0207659_10660052 3300025926 Unclassified 894
345 Ga0207664_10019856 3300025929 Bacteria 4973
346 Ga0207664_10640677 3300025929 Unclassified 955
347 Ga0207644_10020833 3300025931 Bacteria 4461
348 Ga0207644_10034953 3300025931 Bacteria 3519
349 Ga0207644_10038263 3300025931 Bacteria 3378
350 Ga0207644_10061569 3300025931 Bacteria 2719
351 Ga0207644_10134485 3300025931 Bacteria 1897
352 Ga0207644_10239464 3300025931 Bacteria 1444
353 Ga0207644_10999672 3300025931 Unclassified 702
354 Ga0207644_11365796 3300025931 Bacteria 595
355 Ga0207690_10103377 3300025932 Bacteria 2039
356 Ga0207690_10140087 3300025932 Bacteria 1781
357 Ga0207706_10000890 3300025933 Bacteria 30672
358 Ga0207706_10007819 3300025933 Bacteria 9867
359 Ga0207706_10037177 3300025933 Bacteria 4323
360 Ga0207706_10038387 3300025933 Bacteria 4249
361 Ga0207706_10059330 3300025933 Bacteria 3369
362 Ga0207706_10103441 3300025933 Bacteria 2505
363 Ga0207706_10321832 3300025933 Bacteria 1346
364 Ga0207686_10206790 3300025934 Unclassified 1409
365 Ga0207709_10025346 3300025935 Bacteria 3394
366 Ga0207669_10007915 3300025937 Bacteria 4956
367 Ga0207669_11845644 3300025937 Unclassified 516
368 Ga0207704_10671387 3300025938 Bacteria 855
369 Ga0207691_10003939 3300025940 Bacteria 14420
370 Ga0207691_10011885 3300025940 Bacteria 8355
371 Ga0207691_10122184 3300025940 Bacteria 2306
372 Ga0207691_10422081 3300025940 Bacteria 1136
373 Ga0207711_10000869 3300025941 Bacteria 29230
374 Ga0207711_10006956 3300025941 Bacteria 9493
375 Ga0207711_10014975 3300025941 Bacteria 6442
376 Ga0207711_10541176 3300025941 Bacteria 1086
377 Ga0207711_11029728 3300025941 Bacteria 763
378 Ga0207689_10033527 3300025942 Bacteria 4267
379 Ga0207661_10002726 3300025944 Bacteria 12149
380 Ga0207661_10315491 3300025944 Bacteria 1404
381 Ga0207679_10010992 3300025945 Bacteria 5841
382 Ga0207679_10025832 3300025945 Bacteria 4044
383 Ga0207679_10074289 3300025945 Bacteria 2575
384 Ga0207679_10265420 3300025945 Bacteria 1466
385 Ga0207679_10436606 3300025945 Bacteria 1158
386 Ga0207679_11282581 3300025945 Bacteria 672
387 Ga0207679_11384463 3300025945 Unclassified 645
388 Ga0207679_11467147 3300025945 Unclassified 626
389 Ga0207667_10198963 3300025949 Bacteria 2056
390 Ga0207667_10443417 3300025949 Bacteria 1320
391 Ga0207667_10503195 3300025949 Bacteria 1229
392 Ga0207651_10050366 3300025960 Bacteria 2827
393 Ga0207651_10142673 3300025960 Bacteria 1852
394 Ga0207651_10394658 3300025960 Bacteria 1175
395 Ga0207651_10679264 3300025960 Bacteria 906
396 Ga0207651_10926739 3300025960 Bacteria 776
397 Ga0207651_11041605 3300025960 Unclassified 732
398 Ga0207651_11225135 3300025960 Bacteria 674
399 Ga0207712_10019404 3300025961 Bacteria 4439
400 Ga0207712_10070813 3300025961 Bacteria 2506
401 Ga0207668_10000725 3300025972 Bacteria 20192
402 Ga0207668_10026318 3300025972 Bacteria 3776
403 Ga0207668_10083904 3300025972 Bacteria 2320
404 Ga0207668_10153088 3300025972 Bacteria 1788
405 Ga0207668_10739569 3300025972 Unclassified 867
406 Ga0207668_11080095 3300025972 Bacteria 719
407 Ga0207668_11297953 3300025972 Unclassified 655
408 Ga0207668_11630469 3300025972 Bacteria 582
409 Ga0207640_10025691 3300025981 Bacteria 3568
410 Ga0207640_10253713 3300025981 Bacteria 1367
411 Ga0207640_10365379 3300025981 Bacteria 1164
412 Ga0207640_10372653 3300025981 Bacteria 1154
413 Ga0207640_10852425 3300025981 Bacteria 793
414 Ga0207658_10007821 3300025986 Bacteria 7282
415 Ga0207658_10009361 3300025986 Bacteria 6645
416 Ga0207658_10025755 3300025986 Bacteria 4119
417 Ga0207658_10029662 3300025986 Bacteria 3866
418 Ga0207658_10096726 3300025986 Bacteria 2303
419 Ga0207677_10284952 3300026023 Bacteria 1358
420 Ga0207703_10004152 3300026035 Bacteria 11945
421 Ga0207703_10045425 3300026035 Bacteria 3533
422 Ga0207639_10116150 3300026041 Bacteria 2190
423 Ga0207639_10297016 3300026041 Bacteria 1426
424 Ga0207639_10319798 3300026041 Unclassified 1377
425 Ga0207678_10044966 3300026067 Bacteria 3818
426 Ga0207678_10117829 3300026067 Bacteria 2266
427 Ga0207678_10232981 3300026067 Bacteria 1577
428 Ga0207678_10517942 3300026067 Bacteria 1041
429 Ga0207678_10623058 3300026067 Bacteria 947
430 Ga0207678_10672488 3300026067 Bacteria 910
431 Ga0207708_10096219 3300026075 Bacteria 2288
432 Ga0207702_10025645 3300026078 Bacteria 4893
433 Ga0207702_10099610 3300026078 Bacteria 2562
434 Ga0207641_10001513 3300026088 Bacteria 22775
435 Ga0207641_10007946 3300026088 Bacteria 8794
436 Ga0207641_10204660 3300026088 Bacteria 1822
437 Ga0207648_10070738 3300026089 Bacteria 3041
438 Ga0207648_11547694 3300026089 Bacteria 623
439 Ga0207676_10006150 3300026095 Bacteria 8475
440 Ga0207676_10059721 3300026095 Bacteria 3012
441 Ga0207676_11361773 3300026095 Bacteria 705
442 Ga0207674_10003678 3300026116 Bacteria 18711
443 Ga0207675_100003414 3300026118 Bacteria 15508
444 Ga0207675_100271249 3300026118 Bacteria 1646
445 Ga0207675_101046344 3300026118 Bacteria 835
446 Ga0207683_10004970 3300026121 Bacteria 11437
447 Ga0207683_10086893 3300026121 Bacteria 2781
448 Ga0207683_10171981 3300026121 Bacteria 1962
449 Ga0207683_10205870 3300026121 Bacteria 1789
450 Ga0207683_10238638 3300026121 Bacteria 1658
451 Ga0207698_10038595 3300026142 Bacteria 3530
452 Ga0207698_10152903 3300026142 Bacteria 2006
453 Ga0207698_10237423 3300026142 Bacteria 1659
454 Ga0207698_10299379 3300026142 Bacteria 1497
455 Ga0207698_10309365 3300026142 Bacteria 1475
456 Ga0209974_10012159 3300027876 Bacteria 2881
457 Ga0209974_10111976 3300027876 Bacteria 961
458 Ga0209974_10144322 3300027876 Bacteria 856
459 Ga0207428_10412448 3300027907 Bacteria 988
460 Ga0268266_10400797 3300028379 Unclassified 1297
461 Ga0268266_10460885 3300028379 Bacteria 1209
462 Ga0268266_10479549 3300028379 Unclassified 1185
463 Ga0268266_10711599 3300028379 Unclassified 968
464 Ga0268265_10010701 3300028380 Bacteria 6193
465 Ga0268265_10045110 3300028380 Bacteria 3287
466 Ga0268265_10060746 3300028380 Bacteria 2897
467 Ga0268265_10072644 3300028380 Bacteria 2684
468 Ga0268265_10139783 3300028380 Bacteria 2026
469 Ga0268265_10309694 3300028380 Bacteria 1425
470 Ga0268265_10485968 3300028380 Unclassified 1161
471 Ga0268265_12686015 3300028380 Bacteria 503
472 Ga0268264_10005781 3300028381 Bacteria 10486
473 Ga0268264_10043533 3300028381 Bacteria 3721
474 Ga0268264_10088307 3300028381 Bacteria 2668
475 Ga0268264_10131081 3300028381 Bacteria 2222
476 Ga0316177_1184040 3300030731 Bacteria 834
477 Ga0314311_1253491 3300030733 Bacteria 586
478 Ga0316182_1097813 3300030745 Bacteria 849
479 Ga0316182_1143142 3300030745 Bacteria 1252
480 Ga0307408_100038823 3300031548 Bacteria 3361
481 Ga0307408_100059226 3300031548 Bacteria 2787
482 Ga0307408_100125428 3300031548 Bacteria 1995
483 Ga0307408_100190649 3300031548 Bacteria 1651
484 Ga0307408_100217110 3300031548 Bacteria 1558
485 Ga0307408_100259098 3300031548 Bacteria 1438
486 Ga0307408_100264595 3300031548 Bacteria 1425
487 Ga0307408_100268651 3300031548 Bacteria 1415
488 Ga0307408_100481513 3300031548 Bacteria 1083
489 Ga0307408_100631519 3300031548 Bacteria 955
490 Ga0307408_100647229 3300031548 Bacteria 944
491 Ga0307408_100976345 3300031548 Bacteria 779
492 Ga0307408_102447223 3300031548 Bacteria 507
493 Ga0307405_10011246 3300031731 Bacteria 4678
494 Ga0307405_10043464 3300031731 Bacteria 2741
495 Ga0307405_10083970 3300031731 Bacteria 2089
496 Ga0307405_10124597 3300031731 Bacteria 1769
497 Ga0307405_10131466 3300031731 Bacteria 1730
498 Ga0307405_10138021 3300031731 Bacteria 1695
499 Ga0307405_10138067 3300031731 Bacteria 1695
500 Ga0307405_10154540 3300031731 Bacteria 1617
501 Ga0307405_10194962 3300031731 Bacteria 1466
502 Ga0307405_10277340 3300031731 Bacteria 1260
503 Ga0307405_10279108 3300031731 Bacteria 1256
504 Ga0307405_10428309 3300031731 Unclassified 1043
505 Ga0307405_10580884 3300031731 Bacteria 911
506 Ga0307405_11175306 3300031731 Unclassified 662
507 Ga0307413_10001771 3300031824 Bacteria 8446
508 Ga0307413_10002336 3300031824 Bacteria 7697
509 Ga0307413_10008144 3300031824 Bacteria 4926
510 Ga0307413_10008954 3300031824 Bacteria 4759
511 Ga0307413_10016330 3300031824 Bacteria 3832
512 Ga0307413_10029579 3300031824 Bacteria 3067
513 Ga0307413_10033208 3300031824 Bacteria 2935
514 Ga0307413_10055905 3300031824 Bacteria 2404
515 Ga0307413_10064778 3300031824 Bacteria 2272
516 Ga0307413_10116366 3300031824 Bacteria 1801
517 Ga0307413_10136481 3300031824 Bacteria 1687
518 Ga0307413_10154946 3300031824 Bacteria 1601
519 Ga0307413_10156783 3300031824 Bacteria 1594
520 Ga0307413_10188188 3300031824 Bacteria 1479
521 Ga0307413_10203533 3300031824 Bacteria 1431
522 Ga0307413_10213513 3300031824 Bacteria 1403
523 Ga0307413_10237763 3300031824 Bacteria 1342
524 Ga0307413_10247035 3300031824 Bacteria 1321
525 Ga0307413_10258212 3300031824 Bacteria 1297
526 Ga0307413_10404179 3300031824 Unclassified 1071
527 Ga0307413_10423977 3300031824 Bacteria 1049
528 Ga0307413_10538999 3300031824 Bacteria 944
529 Ga0307413_10544462 3300031824 Bacteria 940
530 Ga0307413_10861511 3300031824 Bacteria 766
531 Ga0307413_11559135 3300031824 Bacteria 585
532 Ga0307413_11651324 3300031824 Unclassified 570
533 Ga0307413_12173076 3300031824 Bacteria 503
534 Ga0307410_10001869 3300031852 Bacteria 9823
535 Ga0307410_10021946 3300031852 Bacteria 3937
536 Ga0307410_10037798 3300031852 Bacteria 3157
537 Ga0307410_10039136 3300031852 Bacteria 3111
538 Ga0307410_10042410 3300031852 Bacteria 3007
539 Ga0307410_10054664 3300031852 Bacteria 2708
540 Ga0307410_10059083 3300031852 Bacteria 2616
541 Ga0307410_10059636 3300031852 Bacteria 2605
542 Ga0307410_10081003 3300031852 Bacteria 2279
543 Ga0307410_10082595 3300031852 Bacteria 2260
544 Ga0307410_10089222 3300031852 Bacteria 2184
545 Ga0307410_10131359 3300031852 Bacteria 1840
546 Ga0307410_10135516 3300031852 Bacteria 1814
547 Ga0307410_10160115 3300031852 Bacteria 1685
548 Ga0307410_10187073 3300031852 Bacteria 1572
549 Ga0307410_10261634 3300031852 Bacteria 1349
550 Ga0307410_10304114 3300031852 Unclassified 1259
551 Ga0307410_10323457 3300031852 Bacteria 1224
552 Ga0307410_10329220 3300031852 Bacteria 1214
553 Ga0307410_10437140 3300031852 Unclassified 1064
554 Ga0307410_10517971 3300031852 Bacteria 984
555 Ga0307410_10552959 3300031852 Bacteria 954
556 Ga0307410_10566358 3300031852 Bacteria 943
557 Ga0307410_10653028 3300031852 Bacteria 882
558 Ga0307410_11162054 3300031852 Bacteria 671
559 Ga0307406_10006455 3300031901 Bacteria 6473
560 Ga0307406_10012269 3300031901 Bacteria 4885
561 Ga0307406_10043664 3300031901 Bacteria 2804
562 Ga0307406_10055483 3300031901 Bacteria 2533
563 Ga0307406_10060567 3300031901 Bacteria 2441
564 Ga0307406_10102367 3300031901 Bacteria 1953
565 Ga0307406_10113468 3300031901 Bacteria 1870
566 Ga0307406_10140868 3300031901 Bacteria 1707
567 Ga0307406_10174190 3300031901 Bacteria 1560
568 Ga0307406_10181255 3300031901 Unclassified 1533
569 Ga0307406_10304127 3300031901 Unclassified 1226
570 Ga0307406_10306583 3300031901 Bacteria 1222
571 Ga0307406_10489556 3300031901 Unclassified 995
572 Ga0307406_10613412 3300031901 Bacteria 898
573 Ga0307406_10776530 3300031901 Bacteria 806
574 Ga0307407_10002443 3300031903 Bacteria 7273
575 Ga0307407_10012359 3300031903 Bacteria 4100
576 Ga0307407_10041126 3300031903 Bacteria 2583
577 Ga0307407_10048701 3300031903 Bacteria 2414
578 Ga0307407_10059400 3300031903 Bacteria 2227
579 Ga0307407_10078457 3300031903 Bacteria 1989
580 Ga0307407_10091386 3300031903 Unclassified 1866
581 Ga0307407_10125721 3300031903 Bacteria 1633
582 Ga0307407_10152681 3300031903 Bacteria 1502
583 Ga0307407_10317230 3300031903 Bacteria 1092
584 Ga0307407_10793923 3300031903 Bacteria 720
585 Ga0307407_10938900 3300031903 Bacteria 666
586 Ga0307407_11026549 3300031903 Unclassified 638
587 Ga0307412_10001264 3300031911 Bacteria 14180
588 Ga0307412_10033438 3300031911 Bacteria 3268
589 Ga0307412_10035218 3300031911 Bacteria 3196
590 Ga0307412_10046038 3300031911 Bacteria 2855
591 Ga0307412_10046929 3300031911 Bacteria 2833
592 Ga0307412_10049072 3300031911 Bacteria 2780
593 Ga0307412_10054484 3300031911 Bacteria 2655
594 Ga0307412_10063207 3300031911 Bacteria 2496
595 Ga0307412_10081414 3300031911 Bacteria 2239
596 Ga0307412_10110125 3300031911 Bacteria 1964
597 Ga0307412_10115219 3300031911 Bacteria 1926
598 Ga0307412_10124621 3300031911 Bacteria 1861
599 Ga0307412_10170707 3300031911 Bacteria 1626
600 Ga0307412_10190102 3300031911 Bacteria 1551
601 Ga0307412_10235997 3300031911 Bacteria 1411
602 Ga0307412_10257255 3300031911 Bacteria 1359
603 Ga0307412_10381110 3300031911 Bacteria 1142
604 Ga0307412_10397387 3300031911 Bacteria 1121
605 Ga0307412_10492759 3300031911 Bacteria 1018
606 Ga0307412_10567763 3300031911 Bacteria 955
607 Ga0307412_10794928 3300031911 Bacteria 821
608 Ga0307412_11482037 3300031911 Unclassified 616
609 Ga0307409_100013167 3300031995 Bacteria 5309
610 Ga0307409_100023744 3300031995 Bacteria 4258
611 Ga0307409_100047278 3300031995 Bacteria 3264
612 Ga0307409_100068164 3300031995 Bacteria 2813
613 Ga0307409_100083371 3300031995 Bacteria 2592
614 Ga0307409_100113150 3300031995 Bacteria 2280
615 Ga0307409_100118372 3300031995 Bacteria 2237
616 Ga0307409_100139974 3300031995 Bacteria 2083
617 Ga0307409_100215569 3300031995 Bacteria 1729
618 Ga0307409_100234174 3300031995 Bacteria 1667
619 Ga0307409_100260127 3300031995 Bacteria 1592
620 Ga0307409_100266826 3300031995 Bacteria 1574
621 Ga0307409_100355106 3300031995 Bacteria 1384
622 Ga0307409_100365798 3300031995 Unclassified 1366
623 Ga0307409_100388225 3300031995 Bacteria 1329
624 Ga0307409_100457334 3300031995 Bacteria 1233
625 Ga0307409_100467714 3300031995 Unclassified 1220
626 Ga0307409_100589590 3300031995 Bacteria 1097
627 Ga0307409_100679104 3300031995 Bacteria 1027
628 Ga0307409_100746069 3300031995 Bacteria 982
629 Ga0307409_100768581 3300031995 Unclassified 968
630 Ga0307409_101030005 3300031995 Bacteria 842
631 Ga0307409_101076553 3300031995 Bacteria 824
632 Ga0307409_101951770 3300031995 Bacteria 616
633 Ga0307416_100004713 3300032002 Bacteria 8265
634 Ga0307416_100007264 3300032002 Bacteria 7022
635 Ga0307416_100021040 3300032002 Bacteria 4672
636 Ga0307416_100024485 3300032002 Bacteria 4408
637 Ga0307416_100026809 3300032002 Bacteria 4253
638 Ga0307416_100055032 3300032002 Bacteria 3201
639 Ga0307416_100132600 3300032002 Bacteria 2246
640 Ga0307416_100140905 3300032002 Bacteria 2191
641 Ga0307416_100218482 3300032002 Bacteria 1825
642 Ga0307416_100235767 3300032002 Bacteria 1768
643 Ga0307416_100275975 3300032002 Bacteria 1654
644 Ga0307416_100305517 3300032002 Bacteria 1584
645 Ga0307416_100515801 3300032002 Bacteria 1262
646 Ga0307416_100561132 3300032002 Bacteria 1216
647 Ga0307416_100564115 3300032002 Bacteria 1214
648 Ga0307416_100583852 3300032002 Bacteria 1195
649 Ga0307416_100798976 3300032002 Bacteria 1039
650 Ga0307416_100895853 3300032002 Bacteria 987
651 Ga0307416_101589657 3300032002 Unclassified 759
652 Ga0307414_10008846 3300032004 Bacteria 5745
653 Ga0307414_10023731 3300032004 Bacteria 3896
654 Ga0307414_10034489 3300032004 Bacteria 3356
655 Ga0307414_10039269 3300032004 Bacteria 3187
656 Ga0307414_10039374 3300032004 Bacteria 3183
657 Ga0307414_10043181 3300032004 Bacteria 3069
658 Ga0307414_10043610 3300032004 Bacteria 3057
659 Ga0307414_10058070 3300032004 Bacteria 2724
660 Ga0307414_10063874 3300032004 Bacteria 2618
661 Ga0307414_10067561 3300032004 Bacteria 2561
662 Ga0307414_10069348 3300032004 Bacteria 2534
663 Ga0307414_10069486 3300032004 Bacteria 2532
664 Ga0307414_10081161 3300032004 Bacteria 2374
665 Ga0307414_10092871 3300032004 Bacteria 2248
666 Ga0307414_10095382 3300032004 Bacteria 2223
667 Ga0307414_10099355 3300032004 Bacteria 2186
668 Ga0307414_10105829 3300032004 Bacteria 2128
669 Ga0307414_10107610 3300032004 Bacteria 2113
670 Ga0307414_10109688 3300032004 Bacteria 2097
671 Ga0307414_10161041 3300032004 Bacteria 1782
672 Ga0307414_10167023 3300032004 Bacteria 1755
673 Ga0307414_10179950 3300032004 Unclassified 1699
674 Ga0307414_10189864 3300032004 Bacteria 1661
675 Ga0307414_10197111 3300032004 Bacteria 1635
676 Ga0307414_10362071 3300032004 Unclassified 1248
677 Ga0307414_10473557 3300032004 Bacteria 1103
678 Ga0307414_10512165 3300032004 Bacteria 1063
679 Ga0307414_10577268 3300032004 Bacteria 1005
680 Ga0307414_10659307 3300032004 Bacteria 944
681 Ga0307414_10681532 3300032004 Bacteria 929
682 Ga0307414_10819584 3300032004 Unclassified 849
683 Ga0307414_10929000 3300032004 Bacteria 798
684 Ga0307414_10977525 3300032004 Bacteria 778
685 Ga0307414_11099521 3300032004 Bacteria 734
686 Ga0307411_10003128 3300032005 Bacteria 7586
687 Ga0307411_10007716 3300032005 Bacteria 5511
688 Ga0307411_10014210 3300032005 Bacteria 4422
689 Ga0307411_10015709 3300032005 Bacteria 4262
690 Ga0307411_10023981 3300032005 Bacteria 3627
691 Ga0307411_10026202 3300032005 Bacteria 3507
692 Ga0307411_10029200 3300032005 Bacteria 3363
693 Ga0307411_10035169 3300032005 Bacteria 3125
694 Ga0307411_10059754 3300032005 Bacteria 2528
695 Ga0307411_10076983 3300032005 Bacteria 2282
696 Ga0307411_10081890 3300032005 Bacteria 2224
697 Ga0307411_10087115 3300032005 Bacteria 2168
698 Ga0307411_10091067 3300032005 Bacteria 2129
699 Ga0307411_10099636 3300032005 Bacteria 2051
700 Ga0307411_10114562 3300032005 Bacteria 1937
701 Ga0307411_10161717 3300032005 Bacteria 1678
702 Ga0307411_10190232 3300032005 Bacteria 1566
703 Ga0307411_10211211 3300032005 Bacteria 1499
704 Ga0307411_10234869 3300032005 Bacteria 1431
705 Ga0307411_10305059 3300032005 Bacteria 1278
706 Ga0307411_10525097 3300032005 Bacteria 1005
707 Ga0307411_10596970 3300032005 Unclassified 949
708 Ga0307411_10611810 3300032005 Unclassified 938
709 Ga0307411_10909103 3300032005 Bacteria 782
710 Ga0307411_11721950 3300032005 Unclassified 580
711 Ga0307411_11980540 3300032005 Bacteria 543
712 Ga0307411_12178113 3300032005 Bacteria 519
713 Ga0307415_100027025 3300032126 Bacteria 3629
714 Ga0307415_100029268 3300032126 Bacteria 3518
715 Ga0307415_100050228 3300032126 Bacteria 2825
716 Ga0307415_100195207 3300032126 Bacteria 1601
717 Ga0307415_100210971 3300032126 Bacteria 1549
718 Ga0307415_100227176 3300032126 Bacteria 1501
719 Ga0307415_100238773 3300032126 Bacteria 1468
720 Ga0307415_100244659 3300032126 Bacteria 1453
721 Ga0307415_100305524 3300032126 Bacteria 1320
722 Ga0307415_100357526 3300032126 Bacteria 1232
723 Ga0307415_100376777 3300032126 Bacteria 1203
724 Ga0307415_100704389 3300032126 Bacteria 911
725 Ga0307415_100989581 3300032126 Unclassified 781
726 Ga0307415_101080233 3300032126 Unclassified 750
727 Ga0307415_101624476 3300032126 Bacteria 621
728 Ga0373938_0205045 3300034957 Unclassified 548
729 Ga0373960_0199482 3300035121 Bacteria 707
730 Ga0373943_0792496 3300035170 Unclassified 564
731 Ga0395899_0118334 3300037312 Unclassified 1900
732 Ga0395899_0123842 3300037312 Bacteria 1849
733 Ga0395899_0173196 3300037312 Bacteria 1518
734 Ga0395899_0537020 3300037312 Bacteria 753
735 Ga0395899_0840777 3300037312 Unclassified 564
736 Ga0395899_0897136 3300037312 Unclassified 541
737 Ga0395900_0001132 3300037418 Bacteria 33674
738 Ga0395900_0056659 3300037418 Bacteria 4034
739 Ga0395900_0103583 3300037418 Bacteria 2923
740 Ga0395900_0156847 3300037418 Bacteria 2324
741 Ga0395900_0252925 3300037418 Bacteria 1762
742 Ga0395900_0508368 3300037418 Bacteria 1154
743 Ga0395900_0527695 3300037418 Bacteria 1128
744 Ga0395900_0752849 3300037418 Bacteria 904
745 Ga0395900_0989934 3300037418 Unclassified 761
746 Ga0395898_0046699 3300037466 Bacteria 4253
747 Ga0395898_0208888 3300037466 Bacteria 1862
748 Ga0395898_0708496 3300037466 Bacteria 948
749 Ga0395898_1592676 3300037466 Bacteria 577
750 Ga0395898_1849846 3300037466 Unclassified 524
751 Ga0395905_0000083 3300037471 Bacteria 158407
752 Ga0395905_0003608 3300037471 Bacteria 16456
753 Ga0395905_0080602 3300037471 Bacteria 3050
754 Ga0395905_0108260 3300037471 Bacteria 2609
755 Ga0395905_0119078 3300037471 Bacteria 2482
756 Ga0395905_0182685 3300037471 Unclassified 1969
757 Ga0395905_0226094 3300037471 Bacteria 1750
758 Ga0395905_0230543 3300037471 Bacteria 1732
759 Ga0395905_0673695 3300037471 Bacteria 937
760 Ga0395905_0954486 3300037471 Unclassified 760
761 Ga0395905_1026122 3300037471 Bacteria 728
762 Ga0395905_1737935 3300037471 Unclassified 529
763 Ga0436364_1020203 3300037853 Bacteria 7500
764 Ga0395901_0000369 3300038443 Bacteria 54034
765 Ga0395901_0080396 3300038443 Bacteria 3403
766 Ga0395901_0088534 3300038443 Bacteria 3238
767 Ga0395901_0191467 3300038443 Bacteria 2145
768 Ga0395901_0225414 3300038443 Bacteria 1958
769 Ga0395901_0231731 3300038443 Bacteria 1928
770 Ga0395901_0234727 3300038443 Unclassified 1914
771 Ga0395901_0302693 3300038443 Bacteria 1657
772 Ga0395901_0573130 3300038443 Bacteria 1141
773 Ga0395901_0651132 3300038443 Bacteria 1057
774 Ga0395901_1221537 3300038443 Bacteria 716
775 Ga0395901_1710002 3300038443 Bacteria 580
776 Ga0439436_0081773 3300041404 Bacteria 899
777 Ga0439438_118197 3300041405 Bacteria 638
778 Ga0439447_114011 3300041407 Bacteria 620
779 Ga0451841_0144706 3300041498 Unclassified 824
780 Ga0451853_0382471 3300041512 Bacteria 713
781 Ga0439445_0026926 3300042004 Bacteria 1474
782 Ga0439462_0058168 3300042015 Bacteria 1045
783 Ga0450912_037797 3300042116 Bacteria 517
784 Ga0439434_0029600 3300042435 Bacteria 1660
785 Ga0439435_0211751 3300042436 Unclassified 642
786 Ga0466972_0130273 3300044658 Bacteria 1185
787 Ga0466966_0192681 3300044684 Bacteria 1235
788 Ga0466961_0237162 3300044693 Bacteria 1122
789 Ga0466963_0006272 3300044694 Bacteria 7029
790 Ga0453684_2029335 3300044712 Bacteria 579
791 Ga0466971_0159667 3300044719 Bacteria 1055
792 Ga0466970_0127220 3300044765 Bacteria 1398
793 Ga0466960_0214776 3300044901 Bacteria 1056
794 Ga0466959_0078568 3300045049 Bacteria 2380
795 Ga0466958_0222681 3300045836 Bacteria 1204
796 Ga0466967_0047665 3300045976 Bacteria 3736
797 Ga0466967_0159637 3300045976 Unclassified 2115
798 Ga0466967_0833352 3300045976 Bacteria 916
799 Ga0466967_1150171 3300045976 Bacteria 773
800 Ga0495584_0104676 3300046491 Bacteria 1431
801 Ga0495596_0207705 3300046500 Unclassified 761
802 Ga0495663_0004305 3300046525 Bacteria 4011
803 Ga0495663_0030028 3300046525 Unclassified 1608
804 Ga0495663_0045789 3300046525 Bacteria 1342
805 Ga0495663_0153945 3300046525 Unclassified 786
806 Ga0495642_0021249 3300046528 Bacteria 2552
807 Ga0495598_0021423 3300046537 Bacteria 1719
808 Ga0495598_0457120 3300046537 Bacteria 506
809 Ga0495621_0000378 3300046539 Bacteria 10888
810 Ga0495621_0002551 3300046539 Bacteria 4911
811 Ga0495621_0003388 3300046539 Bacteria 4399
812 Ga0495621_0013290 3300046539 Bacteria 2583
813 Ga0495621_0233188 3300046539 Bacteria 748
814 Ga0495597_0390565 3300046542 Unclassified 530
815 Ga0495633_0017067 3300046558 Bacteria 3722
816 Ga0495633_0138241 3300046558 Bacteria 1127
817 Ga0495633_0368472 3300046558 Bacteria 650
818 Ga0495656_0305153 3300046615 Bacteria 817
819 Ga0495668_0257962 3300046616 Bacteria 954
820 Ga0495625_0534496 3300046660 Unclassified 712
821 Ga0495625_0848094 3300046660 Bacteria 528
822 Ga0495659_0017251 3300046664 Bacteria 2390
823 Ga0495659_0019471 3300046664 Bacteria 2272
824 Ga0495659_0129766 3300046664 Unclassified 999
825 Ga0495588_0245969 3300046674 Bacteria 943
826 Ga0495669_0049962 3300046684 Bacteria 1874
827 Ga0495669_0057106 3300046684 Bacteria 1761
828 Ga0495669_0071091 3300046684 Unclassified 1586
829 Ga0495669_0233233 3300046684 Bacteria 883
830 Ga0495670_0010033 3300046691 Bacteria 4658
831 Ga0495670_0045338 3300046691 Bacteria 2195
832 Ga0495670_0054949 3300046691 Bacteria 1996
833 Ga0495670_0150255 3300046691 Bacteria 1221
834 Ga0495670_0319206 3300046691 Bacteria 834
835 Ga0495670_0797146 3300046691 Unclassified 515
836 Ga0495589_0442956 3300046794 Bacteria 595
837 Ga0495636_0041912 3300047318 Bacteria 1901
838 Ga0495636_0177745 3300047318 Unclassified 965
839 Ga0495677_0096931 3300047445 Unclassified 1114
840 Ga0495677_0141768 3300047445 Bacteria 923
841 Ga0495677_0176316 3300047445 Bacteria 828
842 Ga0495615_0184803 3300048090 Bacteria 637
843 Ga0496100_0069097 3300048903 Bacteria 2351
844 Ga0496101_0073916 3300048904 Unclassified 2505
845 Ga0496101_0119799 3300048904 Bacteria 1989
846 Ga0496102_0185976 3300048905 Unclassified 1958
847 Ga0496102_0272185 3300048905 Bacteria 1597
848 Ga0496103_0087942 3300048906 Bacteria 1959
849 Ga0496103_0145336 3300048906 Bacteria 1518
850 Ga0496103_0195568 3300048906 Bacteria 1300
851 Ga0496104_0750197 3300048907 Bacteria 883
852 Ga0496106_0520708 3300048909 Bacteria 955
853 Ga0496106_1488525 3300048909 Bacteria 521
854 Ga0496107_0025326 3300048910 Bacteria 4201
855 Ga0496107_0131917 3300048910 Bacteria 1844
856 Ga0496108_0007546 3300048911 Bacteria 8816
857 Ga0496108_0074691 3300048911 Bacteria 2863
858 Ga0496109_0020109 3300048912 Bacteria 5897
859 Ga0496109_0029055 3300048912 Bacteria 4949
860 Ga0496109_0092265 3300048912 Bacteria 2801
861 Ga0496109_0187450 3300048912 Bacteria 1944
862 Ga0496109_0490912 3300048912 Bacteria 1159
863 Ga0496110_0095971 3300048913 Bacteria 2656
864 Ga0496110_0365307 3300048913 Unclassified 1315
865 Ga0496110_0470993 3300048913 Unclassified 1144
866 Ga0496111_0002376 3300048914 Bacteria 11340
867 Ga0496111_0095725 3300048914 Bacteria 2179
868 Ga0496111_0267821 3300048914 Bacteria 1267
869 Ga0496112_0046681 3300048915 Bacteria 4249
870 Ga0496112_0076358 3300048915 Bacteria 3313
871 Ga0496113_0065535 3300048916 Bacteria 2749
872 Ga0496113_0481567 3300048916 Unclassified 997
873 Ga0496113_0669144 3300048916 Bacteria 830
874 Ga0496113_0683396 3300048916 Bacteria 820
875 Ga0496114_0022507 3300048917 Bacteria 5137
876 Ga0496114_0030533 3300048917 Bacteria 4434
877 Ga0496115_0432729 3300048918 Bacteria 1065
878 Ga0501298_067568 3300049521 Bacteria 767
879 Ga0501034_0859330 3300049571 Bacteria 797
880 Ga0501047_0793032 3300049581 Bacteria 762
881 Ga0501067_0042413 3300049583 Bacteria 2526
882 Ga0501073_0277463 3300049589 Bacteria 1156
883 Ga0501074_0097531 3300049590 Unclassified 2104
884 Ga0501209_185246 3300049656 Unclassified 637
885 Ga0501211_036345 3300049658 Bacteria 573
886 Ga0501217_178090 3300049661 Bacteria 651
887 Ga0501223_130012 3300049663 Bacteria 537
888 Ga0501227_051465 3300049665 Bacteria 1040
889 Ga0501233_050244 3300049668 Bacteria 1008
890 Ga0501235_006983 3300049669 Bacteria 2456
891 Ga0501242_068610 3300049674 Bacteria 552
892 Ga0501243_028456 3300049675 Bacteria 946
893 Ga0501243_048190 3300049675 Bacteria 763
894 Ga0501247_034044 3300049677 Bacteria 707
895 Ga0501250_007031 3300049680 Bacteria 1205
896 Ga0501257_029067 3300049686 Bacteria 1328
897 Ga0501221_167455 3300049704 Bacteria 593
898 Ga0501225_0094367 3300049705 Unclassified 869
899 Ga0501234_103784 3300049707 Unclassified 519
900 Ga0501245_091241 3300049708 Bacteria 604
901 Ga0501080_0096808 3300049742 Bacteria 2740
902 Ga0501263_015365 3300049760 Bacteria 988
903 Ga0501265_107782 3300049762 Bacteria 517
904 Ga0501267_003212 3300049764 Bacteria 1483
905 Ga0501267_010056 3300049764 Bacteria 951
906 Ga0501268_001442 3300049765 Bacteria 2970
907 Ga0501268_004932 3300049765 Bacteria 1900
908 Ga0501268_008485 3300049765 Bacteria 1558
909 Ga0501268_010277 3300049765 Bacteria 1455
910 Ga0501270_042257 3300049767 Bacteria 798
911 Ga0501270_073948 3300049767 Unclassified 665
912 Ga0501272_007155 3300049769 Bacteria 1204
913 Ga0501273_072515 3300049770 Bacteria 561
914 Ga0501283_034441 3300049779 Bacteria 860
915 Ga0501212_018679 3300049851 Bacteria 1058
916 nmdc:mga08y16_199835_c1 3300050511 Bacteria 2071
917 nmdc:mga08y16_93718_c1 3300050511 Bacteria 3128
918 nmdc:mga0n895_602073_c1 3300050512 Bacteria 1101
919 Ga0500658_0000036 3300053134 Bacteria 85304
920 Ga0590075_175145 3300059424 Bacteria 567
921 Ga0466962_0032304 3300061719 Bacteria 2506

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001976 JGI24752J21851_1039449 JGI24752J21851_10394491 98
2 3300001989 JGI24739J22299_10003769 JGI24739J22299_100037697 98
3 3300001991 JGI24743J22301_10003347 JGI24743J22301_100033473 98
4 3300002067 JGI24735J21928_10158471 JGI24735J21928_101584711 98
5 3300002075 JGI24738J21930_10008755 JGI24738J21930_100087551 98
6 3300002077 JGI24744J21845_10000460 JGI24744J21845_100004606 98
7 3300005327 Ga0070658_10055284 Ga0070658_100552844 98
8 3300005328 Ga0070676_10128949 Ga0070676_101289493 98
9 3300005329 Ga0070683_100371221 Ga0070683_1003712212 98
10 3300005331 Ga0070670_100003949 Ga0070670_1000039498 98
11 3300005331 Ga0070670_100152470 Ga0070670_1001524703 98
12 3300005333 Ga0070677_10350013 Ga0070677_103500132 98
13 3300005333 Ga0070677_10377162 Ga0070677_103771622 98
14 3300005334 Ga0068869_100055312 Ga0068869_1000553123 98
15 3300005335 Ga0070666_10010746 Ga0070666_100107463 98
16 3300005336 Ga0070680_100059272 Ga0070680_1000592724 98
17 3300005337 Ga0070682_100044119 Ga0070682_1000441194 98
18 3300005339 Ga0070660_100164602 Ga0070660_1001646021 98
19 3300005344 Ga0070661_100224617 Ga0070661_1002246171 98
20 3300005347 Ga0070668_100305769 Ga0070668_1003057692 98
21 3300005353 Ga0070669_100060853 Ga0070669_1000608534 98
22 3300005354 Ga0070675_100087324 Ga0070675_1000873241 98
23 3300005354 Ga0070675_101851322 Ga0070675_1018513221 98
24 3300005355 Ga0070671_100016707 Ga0070671_1000167077 98
25 3300005355 Ga0070671_100034633 Ga0070671_1000346334 98
26 3300005364 Ga0070673_100114318 Ga0070673_1001143183 98
27 3300005366 Ga0070659_100016115 Ga0070659_1000161153 98
28 3300005367 Ga0070667_100003813 Ga0070667_1000038137 98
29 3300005367 Ga0070667_100042585 Ga0070667_1000425852 98
30 3300005367 Ga0070667_100513443 Ga0070667_1005134433 98
31 3300005435 Ga0070714_100026253 Ga0070714_1000262533 98
32 3300005435 Ga0070714_100744508 Ga0070714_1007445082 98
33 3300005436 Ga0070713_100299850 Ga0070713_1002998502 98
34 3300005455 Ga0070663_100077233 Ga0070663_1000772332 98
35 3300005456 Ga0070678_100136755 Ga0070678_1001367551 98
36 3300005456 Ga0070678_100466818 Ga0070678_1004668182 98
37 3300005456 Ga0070678_102182271 Ga0070678_1021822711 98
38 3300005457 Ga0070662_100041923 Ga0070662_1000419233 98
39 3300005535 Ga0070684_100921082 Ga0070684_1009210822 98
40 3300005539 Ga0068853_100116509 Ga0068853_1001165093 98
41 3300005539 Ga0068853_100538912 Ga0068853_1005389121 98
42 3300005543 Ga0070672_100032433 Ga0070672_1000324331 98
43 3300005548 Ga0070665_100008330 Ga0070665_1000083307 98
44 3300005563 Ga0068855_100500959 Ga0068855_1005009593 98
45 3300005563 Ga0068855_100548208 Ga0068855_1005482082 98
46 3300005564 Ga0070664_100041421 Ga0070664_1000414216 98
47 3300005564 Ga0070664_100335664 Ga0070664_1003356641 98
48 3300005577 Ga0068857_100230276 Ga0068857_1002302763 98
49 3300005578 Ga0068854_100002116 Ga0068854_10000211610 98
50 3300005578 Ga0068854_100916976 Ga0068854_1009169762 98
51 3300005614 Ga0068856_100976185 Ga0068856_1009761852 98
52 3300005616 Ga0068852_100005093 Ga0068852_1000050934 98
53 3300005616 Ga0068852_100263042 Ga0068852_1002630422 98
54 3300005617 Ga0068859_100002392 Ga0068859_1000023924 98
55 3300005618 Ga0068864_100001110 Ga0068864_10000111022 98
56 3300005841 Ga0068863_100001056 Ga0068863_1000010564 98
57 3300005842 Ga0068858_100003145 Ga0068858_10000314519 98
58 3300005842 Ga0068858_100053942 Ga0068858_1000539423 98
59 3300005843 Ga0068860_100002768 Ga0068860_1000027684 98
60 3300005843 Ga0068860_100189793 Ga0068860_1001897932 98
61 3300005844 Ga0068862_100098570 Ga0068862_1000985703 98
62 3300005844 Ga0068862_101273713 Ga0068862_1012737132 98
63 3300006237 Ga0097621_100290134 Ga0097621_1002901342 98
64 3300006931 Ga0097620_100002392 Ga0097620_1000023924 98
65 3300006931 Ga0097620_101811394 Ga0097620_1018113942 98
66 3300009177 Ga0105248_10001320 Ga0105248_1000132031 98
67 3300009553 Ga0105249_10026708 Ga0105249_100267086 98
68 3300010375 Ga0105239_11303652 Ga0105239_113036522 98
69 3300013100 Ga0157373_10265257 Ga0157373_102652572 98
70 3300013102 Ga0157371_10014319 Ga0157371_100143197 98
71 3300013102 Ga0157371_10122350 Ga0157371_101223503 98
72 3300013104 Ga0157370_10050194 Ga0157370_100501945 98
73 3300013306 Ga0163162_10182809 Ga0163162_101828092 98
74 3300013307 Ga0157372_10121713 Ga0157372_101217133 98
75 3300013308 Ga0157375_10312902 Ga0157375_103129023 98
76 3300014325 Ga0163163_10006151 Ga0163163_1000615112 98
77 3300014968 Ga0157379_10057778 Ga0157379_100577783 98
78 3300025893 Ga0207682_10200028 Ga0207682_102000282 98
79 3300025904 Ga0207647_10035461 Ga0207647_100354613 98
80 3300025907 Ga0207645_10338725 Ga0207645_103387251 98
81 3300025908 Ga0207643_10024141 Ga0207643_100241413 98
82 3300025909 Ga0207705_10181581 Ga0207705_101815813 98
83 3300025909 Ga0207705_10460663 Ga0207705_104606632 98
84 3300025919 Ga0207657_10011972 Ga0207657_1001197210 98
85 3300025920 Ga0207649_10031507 Ga0207649_100315074 98
86 3300025921 Ga0207652_11156691 Ga0207652_111566911 98
87 3300025923 Ga0207681_10075878 Ga0207681_100758783 98
88 3300025923 Ga0207681_11112772 Ga0207681_111127721 98
89 3300025925 Ga0207650_10123204 Ga0207650_101232043 98
90 3300025925 Ga0207650_10189762 Ga0207650_101897623 98
91 3300025929 Ga0207664_10019856 Ga0207664_100198563 98
92 3300025929 Ga0207664_10640677 Ga0207664_106406773 98
93 3300025931 Ga0207644_10034953 Ga0207644_100349533 98
94 3300025931 Ga0207644_10134485 Ga0207644_101344852 98
95 3300025933 Ga0207706_10037177 Ga0207706_100371773 98
96 3300025938 Ga0207704_10671387 Ga0207704_106713872 98
97 3300025940 Ga0207691_10422081 Ga0207691_104220813 98
98 3300025941 Ga0207711_10000869 Ga0207711_1000086928 98
99 3300025941 Ga0207711_11029728 Ga0207711_110297281 98
100 3300025942 Ga0207689_10033527 Ga0207689_100335272 98
101 3300025944 Ga0207661_10315491 Ga0207661_103154912 98
102 3300025945 Ga0207679_10010992 Ga0207679_100109924 98
103 3300025949 Ga0207667_10443417 Ga0207667_104434172 98
104 3300025949 Ga0207667_10503195 Ga0207667_105031952 98
105 3300025960 Ga0207651_10142673 Ga0207651_101426733 98
106 3300025961 Ga0207712_10070813 Ga0207712_100708133 98
107 3300025972 Ga0207668_10026318 Ga0207668_100263184 98
108 3300025981 Ga0207640_10365379 Ga0207640_103653791 98
109 3300025986 Ga0207658_10009361 Ga0207658_100093617 98
110 3300025986 Ga0207658_10029662 Ga0207658_100296623 98
111 3300025986 Ga0207658_10096726 Ga0207658_100967263 98
112 3300026023 Ga0207677_10284952 Ga0207677_102849522 98
113 3300026035 Ga0207703_10004152 Ga0207703_1000415214 98
114 3300026041 Ga0207639_10297016 Ga0207639_102970162 98
115 3300026067 Ga0207678_10044966 Ga0207678_100449665 98
116 3300026067 Ga0207678_10672488 Ga0207678_106724881 98
117 3300026088 Ga0207641_10001513 Ga0207641_100015134 98
118 3300026095 Ga0207676_10006150 Ga0207676_100061502 98
119 3300026116 Ga0207674_10003678 Ga0207674_100036788 98
120 3300026121 Ga0207683_10171981 Ga0207683_101719813 98
121 3300026121 Ga0207683_10205870 Ga0207683_102058703 98
122 3300026121 Ga0207683_10238638 Ga0207683_102386383 98
123 3300026142 Ga0207698_10038595 Ga0207698_100385954 98
124 3300028379 Ga0268266_10460885 Ga0268266_104608852 98
125 3300028380 Ga0268265_10010701 Ga0268265_100107018 98
126 3300028380 Ga0268265_10072644 Ga0268265_100726444 98
127 3300028380 Ga0268265_12686015 Ga0268265_126860151 98
128 3300028381 Ga0268264_10005781 Ga0268264_100057814 98
129 3300028381 Ga0268264_10043533 Ga0268264_100435331 98
130 3300031548 Ga0307408_102447223 Ga0307408_1024472231 98
131 3300031824 Ga0307413_10258212 Ga0307413_102582123 98
132 3300031852 Ga0307410_10054664 Ga0307410_100546643 98
133 3300031852 Ga0307410_10089222 Ga0307410_100892222 98
134 3300031852 Ga0307410_10329220 Ga0307410_103292201 98
135 3300031903 Ga0307407_10938900 Ga0307407_109389002 98
136 3300031903 Ga0307407_11026549 Ga0307407_110265492 98
137 3300031911 Ga0307412_10381110 Ga0307412_103811102 98
138 3300031995 Ga0307409_100589590 Ga0307409_1005895902 98
139 3300031995 Ga0307409_101030005 Ga0307409_1010300052 98
140 3300032002 Ga0307416_100895853 Ga0307416_1008958533 98
141 3300032004 Ga0307414_10167023 Ga0307414_101670232 98
142 3300032005 Ga0307411_10003128 Ga0307411_100031287 98
143 3300032005 Ga0307411_10087115 Ga0307411_100871153 98
144 3300032126 Ga0307415_100210971 Ga0307415_1002109713 98
145 3300032126 Ga0307415_100357526 Ga0307415_1003575261 98
146 3300035170 Ga0373943_0792496 Ga0373943_0792496_185_499 98
147 3300037312 Ga0395899_0123842 Ga0395899_0123842_298_627 98
148 3300037312 Ga0395899_0173196 Ga0395899_0173196_19_348 98
149 3300037418 Ga0395900_0156847 Ga0395900_0156847_133_462 98
150 3300037418 Ga0395900_0252925 Ga0395900_0252925_969_1298 98
151 3300037418 Ga0395900_0508368 Ga0395900_0508368_780_1094 98
152 3300037466 Ga0395898_1592676 Ga0395898_1592676_24_353 98
153 3300037471 Ga0395905_0003608 Ga0395905_0003608_15936_16265 98
154 3300037471 Ga0395905_0226094 Ga0395905_0226094_1272_1601 98
155 3300037471 Ga0395905_1737935 Ga0395905_1737935_173_487 98
156 3300038443 Ga0395901_0088534 Ga0395901_0088534_1009_1338 98
157 3300038443 Ga0395901_0225414 Ga0395901_0225414_1513_1827 98
158 3300038443 Ga0395901_0651132 Ga0395901_0651132_647_961 98
159 3300038443 Ga0395901_1221537 Ga0395901_1221537_24_353 98
160 3300038443 Ga0395901_1710002 Ga0395901_1710002_14_343 98
161 3300044694 Ga0466963_0006272 Ga0466963_0006272_614_928 98
162 3300044901 Ga0466960_0214776 Ga0466960_0214776_384_698 98
163 3300045049 Ga0466959_0078568 Ga0466959_0078568_2020_2346 98
164 3300045976 Ga0466967_0047665 Ga0466967_0047665_154_468 98
165 3300045976 Ga0466967_0159637 Ga0466967_0159637_846_1160 98
166 3300045976 Ga0466967_0833352 Ga0466967_0833352_460_774 98
167 3300045976 Ga0466967_1150171 Ga0466967_1150171_412_726 98
168 3300046616 Ga0495668_0257962 Ga0495668_0257962_109_426 98
169 3300046660 Ga0495625_0848094 Ga0495625_0848094_17_331 98
170 3300046684 Ga0495669_0057106 Ga0495669_0057106_606_923 98
171 3300046684 Ga0495669_0233233 Ga0495669_0233233_537_854 98
172 3300046794 Ga0495589_0442956 Ga0495589_0442956_192_509 98
173 3300048909 Ga0496106_0520708 Ga0496106_0520708_378_707 98
174 3300048910 Ga0496107_0131917 Ga0496107_0131917_1230_1553 98
175 3300048912 Ga0496109_0029055 Ga0496109_0029055_4383_4712 98
176 3300048913 Ga0496110_0365307 Ga0496110_0365307_397_702 98
177 3300048914 Ga0496111_0267821 Ga0496111_0267821_276_581 98
178 3300048915 Ga0496112_0046681 Ga0496112_0046681_1939_2268 98
179 3300048916 Ga0496113_0683396 Ga0496113_0683396_29_358 98
180 3300048918 Ga0496115_0432729 Ga0496115_0432729_84_398 98
181 3300049571 Ga0501034_0859330 Ga0501034_0859330_432_746 98
182 3300049581 Ga0501047_0793032 Ga0501047_0793032_128_442 98
183 3300049583 Ga0501067_0042413 Ga0501067_0042413_1336_1665 98
184 3300049589 Ga0501073_0277463 Ga0501073_0277463_488_802 98
185 3300049590 Ga0501074_0097531 Ga0501074_0097531_780_1094 98
186 3300049742 Ga0501080_0096808 Ga0501080_0096808_1276_1590 98
187 3300053134 Ga0500658_0000036 Ga0500658_0000036_43566_43883 98
188 3300002239 JGI24034J26672_10007772 JGI24034J26672_100077723 99
189 3300005331 Ga0070670_100073702 Ga0070670_1000737022 99
190 3300005335 Ga0070666_10013349 Ga0070666_100133494 99
191 3300005337 Ga0070682_100222041 Ga0070682_1002220412 99
192 3300005338 Ga0068868_100105547 Ga0068868_1001055474 99
193 3300005339 Ga0070660_100529424 Ga0070660_1005294242 99
194 3300005339 Ga0070660_100798926 Ga0070660_1007989262 99
195 3300005344 Ga0070661_100071853 Ga0070661_1000718533 99
196 3300005344 Ga0070661_100179470 Ga0070661_1001794703 99
197 3300005347 Ga0070668_100358884 Ga0070668_1003588842 99
198 3300005353 Ga0070669_100171217 Ga0070669_1001712173 99
199 3300005353 Ga0070669_100301300 Ga0070669_1003013002 99
200 3300005354 Ga0070675_100005746 Ga0070675_1000057466 99
201 3300005355 Ga0070671_100007735 Ga0070671_10000773511 99
202 3300005356 Ga0070674_100116809 Ga0070674_1001168093 99
203 3300005356 Ga0070674_100546938 Ga0070674_1005469381 99
204 3300005364 Ga0070673_100007157 Ga0070673_1000071576 99
205 3300005364 Ga0070673_100181720 Ga0070673_1001817201 99
206 3300005364 Ga0070673_100445345 Ga0070673_1004453451 99
207 3300005365 Ga0070688_100920959 Ga0070688_1009209592 99
208 3300005365 Ga0070688_101553968 Ga0070688_1015539681 99
209 3300005366 Ga0070659_100324129 Ga0070659_1003241293 99
210 3300005366 Ga0070659_101034369 Ga0070659_1010343692 99
211 3300005366 Ga0070659_101327244 Ga0070659_1013272441 99
212 3300005367 Ga0070667_100013452 Ga0070667_1000134522 99
213 3300005367 Ga0070667_100180950 Ga0070667_1001809503 99
214 3300005456 Ga0070678_100042261 Ga0070678_1000422613 99
215 3300005457 Ga0070662_100004584 Ga0070662_1000045844 99
216 3300005457 Ga0070662_100218919 Ga0070662_1002189194 99
217 3300005466 Ga0070685_10109552 Ga0070685_101095523 99
218 3300005539 Ga0068853_100075317 Ga0068853_1000753173 99
219 3300005539 Ga0068853_100118658 Ga0068853_1001186583 99
220 3300005543 Ga0070672_100009064 Ga0070672_1000090644 99
221 3300005543 Ga0070672_100143380 Ga0070672_1001433803 99
222 3300005548 Ga0070665_100032554 Ga0070665_1000325545 99
223 3300005563 Ga0068855_101336798 Ga0068855_1013367982 99
224 3300005564 Ga0070664_100024096 Ga0070664_1000240964 99
225 3300005564 Ga0070664_100156468 Ga0070664_1001564683 99
226 3300005564 Ga0070664_100221600 Ga0070664_1002216003 99
227 3300005577 Ga0068857_100092398 Ga0068857_1000923984 99
228 3300005578 Ga0068854_100013400 Ga0068854_1000134006 99
229 3300005614 Ga0068856_100532375 Ga0068856_1005323753 99
230 3300005614 Ga0068856_101552637 Ga0068856_1015526372 99
231 3300005616 Ga0068852_100176396 Ga0068852_1001763963 99
232 3300005616 Ga0068852_100296398 Ga0068852_1002963982 99
233 3300005616 Ga0068852_100419073 Ga0068852_1004190732 99
234 3300005616 Ga0068852_101815996 Ga0068852_1018159961 99
235 3300005617 Ga0068859_100421982 Ga0068859_1004219822 99
236 3300005617 Ga0068859_100481772 Ga0068859_1004817722 99
237 3300005618 Ga0068864_100042715 Ga0068864_1000427153 99
238 3300005719 Ga0068861_100040656 Ga0068861_1000406563 99
239 3300005840 Ga0068870_10467497 Ga0068870_104674972 99
240 3300005841 Ga0068863_100022022 Ga0068863_1000220227 99
241 3300005841 Ga0068863_100183835 Ga0068863_1001838353 99
242 3300005842 Ga0068858_100116228 Ga0068858_1001162282 99
243 3300005843 Ga0068860_100360498 Ga0068860_1003604983 99
244 3300006237 Ga0097621_100214655 Ga0097621_1002146553 99
245 3300006358 Ga0068871_100124012 Ga0068871_1001240124 99
246 3300006358 Ga0068871_101288821 Ga0068871_1012888211 99
247 3300006931 Ga0097620_100421983 Ga0097620_1004219832 99
248 3300006931 Ga0097620_100481782 Ga0097620_1004817822 99
249 3300009148 Ga0105243_11640159 Ga0105243_116401592 99
250 3300009176 Ga0105242_10505552 Ga0105242_105055522 99
251 3300009177 Ga0105248_10034268 Ga0105248_100342687 99
252 3300009177 Ga0105248_10148348 Ga0105248_101483484 99
253 3300009177 Ga0105248_10178322 Ga0105248_101783223 99
254 3300009553 Ga0105249_13272175 Ga0105249_132721751 99
255 3300013100 Ga0157373_10075054 Ga0157373_100750542 99
256 3300013102 Ga0157371_10044524 Ga0157371_100445243 99
257 3300013102 Ga0157371_10219230 Ga0157371_102192301 99
258 3300013104 Ga0157370_10043428 Ga0157370_100434283 99
259 3300013296 Ga0157374_10002253 Ga0157374_1000225314 99
260 3300013306 Ga0163162_10039027 Ga0163162_100390275 99
261 3300013306 Ga0163162_10084100 Ga0163162_100841003 99
262 3300013307 Ga0157372_10136334 Ga0157372_101363343 99
263 3300013308 Ga0157375_10004680 Ga0157375_1000468012 99
264 3300013308 Ga0157375_10006077 Ga0157375_100060774 99
265 3300014325 Ga0163163_10002706 Ga0163163_1000270612 99
266 3300014325 Ga0163163_10129296 Ga0163163_101292963 99
267 3300017792 Ga0163161_10005360 Ga0163161_100053605 99
268 3300020081 Ga0206354_11377068 Ga0206354_113770681 99
269 3300020082 Ga0206353_11229904 Ga0206353_112299042 99
270 3300025315 Ga0207697_10075935 Ga0207697_100759353 99
271 3300025315 Ga0207697_10076849 Ga0207697_100768492 99
272 3300025903 Ga0207680_10145261 Ga0207680_101452613 99
273 3300025909 Ga0207705_10070386 Ga0207705_100703862 99
274 3300025917 Ga0207660_10183644 Ga0207660_101836443 99
275 3300025919 Ga0207657_10067574 Ga0207657_100675743 99
276 3300025919 Ga0207657_10522752 Ga0207657_105227522 99
277 3300025920 Ga0207649_10082933 Ga0207649_100829333 99
278 3300025920 Ga0207649_10121521 Ga0207649_101215213 99
279 3300025923 Ga0207681_11559780 Ga0207681_115597802 99
280 3300025925 Ga0207650_10082656 Ga0207650_100826562 99
281 3300025926 Ga0207659_10011166 Ga0207659_100111664 99
282 3300025931 Ga0207644_10020833 Ga0207644_100208334 99
283 3300025931 Ga0207644_10038263 Ga0207644_100382633 99
284 3300025932 Ga0207690_10140087 Ga0207690_101400871 99
285 3300025933 Ga0207706_10007819 Ga0207706_100078197 99
286 3300025933 Ga0207706_10038387 Ga0207706_100383873 99
287 3300025933 Ga0207706_10059330 Ga0207706_100593303 99
288 3300025934 Ga0207686_10206790 Ga0207686_102067902 99
289 3300025937 Ga0207669_11845644 Ga0207669_118456441 99
290 3300025940 Ga0207691_10011885 Ga0207691_100118854 99
291 3300025940 Ga0207691_10122184 Ga0207691_101221843 99
292 3300025941 Ga0207711_10006956 Ga0207711_100069567 99
293 3300025941 Ga0207711_10014975 Ga0207711_100149754 99
294 3300025941 Ga0207711_10541176 Ga0207711_105411763 99
295 3300025945 Ga0207679_10074289 Ga0207679_100742893 99
296 3300025945 Ga0207679_10265420 Ga0207679_102654201 99
297 3300025945 Ga0207679_11282581 Ga0207679_112825812 99
298 3300025945 Ga0207679_11384463 Ga0207679_113844632 99
299 3300025960 Ga0207651_10050366 Ga0207651_100503663 99
300 3300025960 Ga0207651_10926739 Ga0207651_109267391 99
301 3300025960 Ga0207651_11041605 Ga0207651_110416051 99
302 3300025972 Ga0207668_10739569 Ga0207668_107395693 99
303 3300025981 Ga0207640_10372653 Ga0207640_103726533 99
304 3300025986 Ga0207658_10007821 Ga0207658_100078217 99
305 3300026035 Ga0207703_10045425 Ga0207703_100454253 99
306 3300026041 Ga0207639_10116150 Ga0207639_101161502 99
307 3300026041 Ga0207639_10319798 Ga0207639_103197983 99
308 3300026078 Ga0207702_10099610 Ga0207702_100996103 99
309 3300026088 Ga0207641_10007946 Ga0207641_100079464 99
310 3300026088 Ga0207641_10204660 Ga0207641_102046601 99
311 3300026095 Ga0207676_10059721 Ga0207676_100597212 99
312 3300026118 Ga0207675_100271249 Ga0207675_1002712493 99
313 3300026121 Ga0207683_10004970 Ga0207683_100049707 99
314 3300026142 Ga0207698_10152903 Ga0207698_101529033 99
315 3300026142 Ga0207698_10299379 Ga0207698_102993792 99
316 3300026142 Ga0207698_10309365 Ga0207698_103093653 99
317 3300028379 Ga0268266_10479549 Ga0268266_104795493 99
318 3300028381 Ga0268264_10088307 Ga0268264_100883073 99
319 3300030731 Ga0316177_1184040 Ga0316177_11840402 99
320 3300030733 Ga0314311_1253491 Ga0314311_12534912 99
321 3300030745 Ga0316182_1143142 Ga0316182_11431422 99
322 3300031548 Ga0307408_100976345 Ga0307408_1009763452 99
323 3300031731 Ga0307405_10131466 Ga0307405_101314662 99
324 3300031731 Ga0307405_10277340 Ga0307405_102773402 99
325 3300031824 Ga0307413_10404179 Ga0307413_104041792 99
326 3300031824 Ga0307413_11559135 Ga0307413_115591351 99
327 3300031852 Ga0307410_10037798 Ga0307410_100377984 99
328 3300031901 Ga0307406_10140868 Ga0307406_101408682 99
329 3300031903 Ga0307407_10048701 Ga0307407_100487013 99
330 3300031911 Ga0307412_10124621 Ga0307412_101246213 99
331 3300031911 Ga0307412_10257255 Ga0307412_102572552 99
332 3300031995 Ga0307409_100047278 Ga0307409_1000472784 99
333 3300032002 Ga0307416_100004713 Ga0307416_1000047134 99
334 3300032002 Ga0307416_100235767 Ga0307416_1002357673 99
335 3300032004 Ga0307414_10023731 Ga0307414_100237313 99
336 3300032005 Ga0307411_10081890 Ga0307411_100818903 99
337 3300032126 Ga0307415_100227176 Ga0307415_1002271763 99
338 3300032126 Ga0307415_100376777 Ga0307415_1003767772 99
339 3300035121 Ga0373960_0199482 Ga0373960_0199482_149_466 99
340 3300037312 Ga0395899_0897136 Ga0395899_0897136_98_412 99
341 3300037418 Ga0395900_0527695 Ga0395900_0527695_519_836 99
342 3300037466 Ga0395898_0046699 Ga0395898_0046699_2188_2505 99
343 3300037471 Ga0395905_0080602 Ga0395905_0080602_1334_1651 99
344 3300037471 Ga0395905_0108260 Ga0395905_0108260_880_1191 99
345 3300038443 Ga0395901_0080396 Ga0395901_0080396_1414_1725 99
346 3300041498 Ga0451841_0144706 Ga0451841_0144706_434_733 99
347 3300044658 Ga0466972_0130273 Ga0466972_0130273_210_527 99
348 3300044684 Ga0466966_0192681 Ga0466966_0192681_112_429 99
349 3300044693 Ga0466961_0237162 Ga0466961_0237162_228_545 99
350 3300044719 Ga0466971_0159667 Ga0466971_0159667_704_1015 99
351 3300044765 Ga0466970_0127220 Ga0466970_0127220_538_855 99
352 3300045836 Ga0466958_0222681 Ga0466958_0222681_218_529 99
353 3300046525 Ga0495663_0045789 Ga0495663_0045789_86_409 99
354 3300046537 Ga0495598_0457120 Ga0495598_0457120_180_491 99
355 3300046674 Ga0495588_0245969 Ga0495588_0245969_576_875 99
356 3300048903 Ga0496100_0069097 Ga0496100_0069097_1551_1868 99
357 3300048904 Ga0496101_0073916 Ga0496101_0073916_597_914 99
358 3300048904 Ga0496101_0119799 Ga0496101_0119799_90_389 99
359 3300048905 Ga0496102_0185976 Ga0496102_0185976_976_1293 99
360 3300048906 Ga0496103_0145336 Ga0496103_0145336_1074_1391 99
361 3300048909 Ga0496106_1488525 Ga0496106_1488525_211_510 99
362 3300048910 Ga0496107_0025326 Ga0496107_0025326_1532_1831 99
363 3300048911 Ga0496108_0007546 Ga0496108_0007546_1645_1962 99
364 3300048911 Ga0496108_0074691 Ga0496108_0074691_2103_2402 99
365 3300048912 Ga0496109_0020109 Ga0496109_0020109_3681_3998 99
366 3300048912 Ga0496109_0092265 Ga0496109_0092265_707_1006 99
367 3300048913 Ga0496110_0095971 Ga0496110_0095971_35_352 99
368 3300048913 Ga0496110_0470993 Ga0496110_0470993_416_715 99
369 3300048914 Ga0496111_0002376 Ga0496111_0002376_9878_10195 99
370 3300048914 Ga0496111_0095725 Ga0496111_0095725_1511_1810 99
371 3300048915 Ga0496112_0076358 Ga0496112_0076358_783_1100 99
372 3300048916 Ga0496113_0065535 Ga0496113_0065535_913_1230 99
373 3300048916 Ga0496113_0481567 Ga0496113_0481567_392_691 99
374 3300048917 Ga0496114_0022507 Ga0496114_0022507_2824_3123 99
375 3300048917 Ga0496114_0030533 Ga0496114_0030533_3549_3866 99
376 3300049663 Ga0501223_130012 Ga0501223_130012_11_310 99
377 3300049764 Ga0501267_010056 Ga0501267_010056_406_717 99
378 3300049765 Ga0501268_001442 Ga0501268_001442_1835_2146 99
379 3300049851 Ga0501212_018679 Ga0501212_018679_198_497 99
380 3300061719 Ga0466962_0032304 Ga0466962_0032304_607_918 99
381 3300001976 JGI24752J21851_1009132 JGI24752J21851_10091322 100
382 3300001977 JGI24746J21847_1015818 JGI24746J21847_10158182 100
383 3300001979 JGI24740J21852_10004688 JGI24740J21852_100046884 100
384 3300002070 JGI24750J21931_1004215 JGI24750J21931_10042153 100
385 3300002075 JGI24738J21930_10125198 JGI24738J21930_101251982 100
386 3300002077 JGI24744J21845_10065977 JGI24744J21845_100659772 100
387 3300002155 JGI24033J26618_1045495 JGI24033J26618_10454952 100
388 3300002239 JGI24034J26672_10004624 JGI24034J26672_100046242 100
389 3300002244 JGI24742J22300_10032415 JGI24742J22300_100324152 100
390 3300003203 JGI25406J46586_10069732 JGI25406J46586_100697323 100
391 3300005288 Ga0065714_10537038 Ga0065714_105370381 100
392 3300005290 Ga0065712_10221985 Ga0065712_102219851 100
393 3300005293 Ga0065715_10000342 Ga0065715_100003427 100
394 3300005293 Ga0065715_10192805 Ga0065715_101928052 100
395 3300005293 Ga0065715_10623813 Ga0065715_106238131 100
396 3300005295 Ga0065707_10021840 Ga0065707_100218402 100
397 3300005295 Ga0065707_10049454 Ga0065707_100494542 100
398 3300005295 Ga0065707_10263428 Ga0065707_102634283 100
399 3300005327 Ga0070658_10009267 Ga0070658_100092676 100
400 3300005327 Ga0070658_10461231 Ga0070658_104612313 100
401 3300005328 Ga0070676_10056346 Ga0070676_100563462 100
402 3300005328 Ga0070676_10057452 Ga0070676_100574523 100
403 3300005329 Ga0070683_100007370 Ga0070683_1000073703 100
404 3300005330 Ga0070690_100189728 Ga0070690_1001897283 100
405 3300005331 Ga0070670_100020883 Ga0070670_1000208837 100
406 3300005331 Ga0070670_100091715 Ga0070670_1000917152 100
407 3300005331 Ga0070670_100511400 Ga0070670_1005114002 100
408 3300005333 Ga0070677_10001942 Ga0070677_100019422 100
409 3300005333 Ga0070677_10004813 Ga0070677_100048135 100
410 3300005333 Ga0070677_10031326 Ga0070677_100313264 100
411 3300005334 Ga0068869_100909888 Ga0068869_1009098882 100
412 3300005335 Ga0070666_10310298 Ga0070666_103102982 100
413 3300005335 Ga0070666_11457574 Ga0070666_114575742 100
414 3300005339 Ga0070660_100003053 Ga0070660_10000305311 100
415 3300005339 Ga0070660_100031784 Ga0070660_1000317845 100
416 3300005340 Ga0070689_101079868 Ga0070689_1010798682 100
417 3300005344 Ga0070661_100234169 Ga0070661_1002341692 100
418 3300005344 Ga0070661_100486956 Ga0070661_1004869562 100
419 3300005345 Ga0070692_10006534 Ga0070692_100065341 100
420 3300005347 Ga0070668_100024705 Ga0070668_1000247055 100
421 3300005347 Ga0070668_100264251 Ga0070668_1002642511 100
422 3300005347 Ga0070668_100324496 Ga0070668_1003244963 100
423 3300005353 Ga0070669_100025316 Ga0070669_1000253163 100
424 3300005353 Ga0070669_100075630 Ga0070669_1000756304 100
425 3300005353 Ga0070669_100773280 Ga0070669_1007732802 100
426 3300005354 Ga0070675_100015032 Ga0070675_1000150324 100
427 3300005354 Ga0070675_100017347 Ga0070675_1000173478 100
428 3300005355 Ga0070671_100012010 Ga0070671_1000120102 100
429 3300005355 Ga0070671_100193477 Ga0070671_1001934772 100
430 3300005355 Ga0070671_100282010 Ga0070671_1002820103 100
431 3300005356 Ga0070674_100073040 Ga0070674_1000730403 100
432 3300005364 Ga0070673_100455048 Ga0070673_1004550482 100
433 3300005364 Ga0070673_100620826 Ga0070673_1006208262 100
434 3300005364 Ga0070673_101581450 Ga0070673_1015814502 100
435 3300005366 Ga0070659_100083662 Ga0070659_1000836624 100
436 3300005366 Ga0070659_100119374 Ga0070659_1001193741 100
437 3300005366 Ga0070659_100132886 Ga0070659_1001328862 100
438 3300005367 Ga0070667_100295403 Ga0070667_1002954032 100
439 3300005440 Ga0070705_100219036 Ga0070705_1002190362 100
440 3300005441 Ga0070700_100074497 Ga0070700_1000744973 100
441 3300005455 Ga0070663_100108180 Ga0070663_1001081802 100
442 3300005455 Ga0070663_100180661 Ga0070663_1001806611 100
443 3300005456 Ga0070678_100238688 Ga0070678_1002386883 100
444 3300005456 Ga0070678_100566770 Ga0070678_1005667702 100
445 3300005457 Ga0070662_100000256 Ga0070662_10000025622 100
446 3300005457 Ga0070662_100199220 Ga0070662_1001992203 100
447 3300005457 Ga0070662_100393567 Ga0070662_1003935673 100
448 3300005458 Ga0070681_10020408 Ga0070681_100204083 100
449 3300005458 Ga0070681_10243452 Ga0070681_102434523 100
450 3300005459 Ga0068867_100230823 Ga0068867_1002308232 100
451 3300005466 Ga0070685_10256148 Ga0070685_102561482 100
452 3300005530 Ga0070679_100015769 Ga0070679_1000157691 100
453 3300005535 Ga0070684_100007613 Ga0070684_10000761310 100
454 3300005539 Ga0068853_100325181 Ga0068853_1003251813 100
455 3300005543 Ga0070672_100000621 Ga0070672_1000006217 100
456 3300005545 Ga0070695_100173364 Ga0070695_1001733643 100
457 3300005548 Ga0070665_101633204 Ga0070665_1016332042 100
458 3300005549 Ga0070704_100267828 Ga0070704_1002678283 100
459 3300005563 Ga0068855_100305229 Ga0068855_1003052293 100
460 3300005564 Ga0070664_100060771 Ga0070664_1000607715 100
461 3300005564 Ga0070664_101655831 Ga0070664_1016558312 100
462 3300005578 Ga0068854_100104529 Ga0068854_1001045293 100
463 3300005578 Ga0068854_100285104 Ga0068854_1002851042 100
464 3300005578 Ga0068854_100296893 Ga0068854_1002968932 100
465 3300005614 Ga0068856_100014742 Ga0068856_1000147429 100
466 3300005614 Ga0068856_100596929 Ga0068856_1005969292 100
467 3300005617 Ga0068859_100000965 Ga0068859_10000096513 100
468 3300005618 Ga0068864_100097177 Ga0068864_1000971774 100
469 3300005719 Ga0068861_100012250 Ga0068861_1000122508 100
470 3300005719 Ga0068861_101159756 Ga0068861_1011597562 100
471 3300005840 Ga0068870_10543471 Ga0068870_105434711 100
472 3300005841 Ga0068863_101367772 Ga0068863_1013677722 100
473 3300005843 Ga0068860_100033071 Ga0068860_1000330714 100
474 3300005844 Ga0068862_100006991 Ga0068862_1000069917 100
475 3300005844 Ga0068862_100083541 Ga0068862_1000835414 100
476 3300005844 Ga0068862_100311880 Ga0068862_1003118802 100
477 3300005844 Ga0068862_100445065 Ga0068862_1004450652 100
478 3300005985 Ga0081539_10079896 Ga0081539_100798963 100
479 3300006058 Ga0075432_10120944 Ga0075432_101209441 100
480 3300006844 Ga0075428_100122357 Ga0075428_1001223573 100
481 3300006844 Ga0075428_101057541 Ga0075428_1010575412 100
482 3300006871 Ga0075434_100566715 Ga0075434_1005667152 100
483 3300006931 Ga0097620_100000965 Ga0097620_10000096513 100
484 3300007076 Ga0075435_100715826 Ga0075435_1007158262 100
485 3300009092 Ga0105250_10157958 Ga0105250_101579581 100
486 3300009094 Ga0111539_10058672 Ga0111539_100586726 100
487 3300009147 Ga0114129_11445758 Ga0114129_114457581 100
488 3300009148 Ga0105243_10031560 Ga0105243_100315603 100
489 3300009148 Ga0105243_10435221 Ga0105243_104352213 100
490 3300009176 Ga0105242_10866117 Ga0105242_108661172 100
491 3300009553 Ga0105249_10006738 Ga0105249_100067387 100
492 3300013100 Ga0157373_10051714 Ga0157373_100517143 100
493 3300013100 Ga0157373_10294398 Ga0157373_102943982 100
494 3300013102 Ga0157371_10005811 Ga0157371_1000581110 100
495 3300013104 Ga0157370_10043289 Ga0157370_100432895 100
496 3300013104 Ga0157370_10112664 Ga0157370_101126644 100
497 3300013104 Ga0157370_10577023 Ga0157370_105770232 100
498 3300013306 Ga0163162_12525842 Ga0163162_125258422 100
499 3300013307 Ga0157372_11121862 Ga0157372_111218621 100
500 3300013308 Ga0157375_10570887 Ga0157375_105708873 100
501 3300013308 Ga0157375_11940302 Ga0157375_119403022 100
502 3300014326 Ga0157380_10001273 Ga0157380_1000127316 100
503 3300014326 Ga0157380_10006494 Ga0157380_100064947 100
504 3300014326 Ga0157380_10063845 Ga0157380_100638453 100
505 3300014326 Ga0157380_10449188 Ga0157380_104491883 100
506 3300014326 Ga0157380_10970060 Ga0157380_109700602 100
507 3300014745 Ga0157377_10199658 Ga0157377_101996583 100
508 3300017792 Ga0163161_10118313 Ga0163161_101183133 100
509 3300017792 Ga0163161_10275217 Ga0163161_102752172 100
510 3300021388 Ga0213875_10008894 Ga0213875_100088943 100
511 3300025271 Ga0207666_1016307 Ga0207666_10163072 100
512 3300025315 Ga0207697_10000510 Ga0207697_1000051016 100
513 3300025893 Ga0207682_10000666 Ga0207682_1000066613 100
514 3300025893 Ga0207682_10001204 Ga0207682_100012049 100
515 3300025893 Ga0207682_10331620 Ga0207682_103316201 100
516 3300025901 Ga0207688_10015967 Ga0207688_100159672 100
517 3300025901 Ga0207688_10076183 Ga0207688_100761833 100
518 3300025901 Ga0207688_10831526 Ga0207688_108315261 100
519 3300025903 Ga0207680_10248209 Ga0207680_102482092 100
520 3300025904 Ga0207647_10087887 Ga0207647_100878873 100
521 3300025907 Ga0207645_10020395 Ga0207645_100203954 100
522 3300025907 Ga0207645_10047307 Ga0207645_100473073 100
523 3300025908 Ga0207643_10015753 Ga0207643_100157534 100
524 3300025909 Ga0207705_10000493 Ga0207705_1000049312 100
525 3300025909 Ga0207705_10004948 Ga0207705_1000494812 100
526 3300025912 Ga0207707_10077183 Ga0207707_100771834 100
527 3300025912 Ga0207707_10705885 Ga0207707_107058852 100
528 3300025917 Ga0207660_10000770 Ga0207660_100007704 100
529 3300025919 Ga0207657_10001607 Ga0207657_1000160712 100
530 3300025919 Ga0207657_10002261 Ga0207657_100022616 100
531 3300025921 Ga0207652_10000034 Ga0207652_10000034124 100
532 3300025921 Ga0207652_10819050 Ga0207652_108190501 100
533 3300025923 Ga0207681_10015791 Ga0207681_100157915 100
534 3300025923 Ga0207681_10492547 Ga0207681_104925472 100
535 3300025925 Ga0207650_10003622 Ga0207650_100036227 100
536 3300025925 Ga0207650_10008245 Ga0207650_100082457 100
537 3300025925 Ga0207650_10060549 Ga0207650_100605492 100
538 3300025925 Ga0207650_10469451 Ga0207650_104694512 100
539 3300025926 Ga0207659_10029702 Ga0207659_100297025 100
540 3300025926 Ga0207659_10660052 Ga0207659_106600522 100
541 3300025931 Ga0207644_10061569 Ga0207644_100615693 100
542 3300025931 Ga0207644_10239464 Ga0207644_102394641 100
543 3300025931 Ga0207644_10999672 Ga0207644_109996722 100
544 3300025931 Ga0207644_11365796 Ga0207644_113657962 100
545 3300025932 Ga0207690_10103377 Ga0207690_101033772 100
546 3300025933 Ga0207706_10000890 Ga0207706_1000089023 100
547 3300025933 Ga0207706_10103441 Ga0207706_101034413 100
548 3300025933 Ga0207706_10321832 Ga0207706_103218322 100
549 3300025935 Ga0207709_10025346 Ga0207709_100253462 100
550 3300025937 Ga0207669_10007915 Ga0207669_100079153 100
551 3300025940 Ga0207691_10003939 Ga0207691_1000393912 100
552 3300025944 Ga0207661_10002726 Ga0207661_1000272612 100
553 3300025945 Ga0207679_10025832 Ga0207679_100258324 100
554 3300025945 Ga0207679_10436606 Ga0207679_104366061 100
555 3300025945 Ga0207679_11467147 Ga0207679_114671472 100
556 3300025949 Ga0207667_10198963 Ga0207667_101989633 100
557 3300025960 Ga0207651_10394658 Ga0207651_103946582 100
558 3300025960 Ga0207651_10679264 Ga0207651_106792642 100
559 3300025960 Ga0207651_11225135 Ga0207651_112251351 100
560 3300025961 Ga0207712_10019404 Ga0207712_100194044 100
561 3300025972 Ga0207668_10000725 Ga0207668_100007254 100
562 3300025972 Ga0207668_10083904 Ga0207668_100839042 100
563 3300025972 Ga0207668_10153088 Ga0207668_101530882 100
564 3300025972 Ga0207668_11080095 Ga0207668_110800952 100
565 3300025972 Ga0207668_11297953 Ga0207668_112979532 100
566 3300025972 Ga0207668_11630469 Ga0207668_116304692 100
567 3300025981 Ga0207640_10025691 Ga0207640_100256914 100
568 3300025981 Ga0207640_10253713 Ga0207640_102537132 100
569 3300025981 Ga0207640_10852425 Ga0207640_108524252 100
570 3300025986 Ga0207658_10025755 Ga0207658_100257554 100
571 3300026067 Ga0207678_10117829 Ga0207678_101178292 100
572 3300026067 Ga0207678_10232981 Ga0207678_102329811 100
573 3300026067 Ga0207678_10517942 Ga0207678_105179421 100
574 3300026067 Ga0207678_10623058 Ga0207678_106230582 100
575 3300026075 Ga0207708_10096219 Ga0207708_100962192 100
576 3300026078 Ga0207702_10025645 Ga0207702_100256453 100
577 3300026089 Ga0207648_10070738 Ga0207648_100707383 100
578 3300026089 Ga0207648_11547694 Ga0207648_115476941 100
579 3300026095 Ga0207676_11361773 Ga0207676_113617732 100
580 3300026118 Ga0207675_100003414 Ga0207675_1000034146 100
581 3300026118 Ga0207675_101046344 Ga0207675_1010463442 100
582 3300026121 Ga0207683_10086893 Ga0207683_100868934 100
583 3300026142 Ga0207698_10237423 Ga0207698_102374233 100
584 3300027876 Ga0209974_10012159 Ga0209974_100121593 100
585 3300027876 Ga0209974_10111976 Ga0209974_101119762 100
586 3300027876 Ga0209974_10144322 Ga0209974_101443222 100
587 3300027907 Ga0207428_10412448 Ga0207428_104124481 100
588 3300028379 Ga0268266_10400797 Ga0268266_104007973 100
589 3300028379 Ga0268266_10711599 Ga0268266_107115992 100
590 3300028380 Ga0268265_10045110 Ga0268265_100451104 100
591 3300028380 Ga0268265_10060746 Ga0268265_100607464 100
592 3300028380 Ga0268265_10139783 Ga0268265_101397832 100
593 3300028380 Ga0268265_10309694 Ga0268265_103096942 100
594 3300028380 Ga0268265_10485968 Ga0268265_104859682 100
595 3300028381 Ga0268264_10131081 Ga0268264_101310813 100
596 3300030745 Ga0316182_1097813 Ga0316182_10978132 100
597 3300031548 Ga0307408_100038823 Ga0307408_1000388232 100
598 3300031548 Ga0307408_100059226 Ga0307408_1000592263 100
599 3300031548 Ga0307408_100125428 Ga0307408_1001254282 100
600 3300031548 Ga0307408_100190649 Ga0307408_1001906493 100
601 3300031548 Ga0307408_100217110 Ga0307408_1002171103 100
602 3300031548 Ga0307408_100259098 Ga0307408_1002590982 100
603 3300031548 Ga0307408_100264595 Ga0307408_1002645952 100
604 3300031548 Ga0307408_100268651 Ga0307408_1002686512 100
605 3300031548 Ga0307408_100481513 Ga0307408_1004815132 100
606 3300031548 Ga0307408_100631519 Ga0307408_1006315191 100
607 3300031548 Ga0307408_100647229 Ga0307408_1006472292 100
608 3300031731 Ga0307405_10011246 Ga0307405_100112464 100
609 3300031731 Ga0307405_10043464 Ga0307405_100434643 100
610 3300031731 Ga0307405_10083970 Ga0307405_100839702 100
611 3300031731 Ga0307405_10124597 Ga0307405_101245973 100
612 3300031731 Ga0307405_10138021 Ga0307405_101380212 100
613 3300031731 Ga0307405_10138067 Ga0307405_101380671 100
614 3300031731 Ga0307405_10154540 Ga0307405_101545402 100
615 3300031731 Ga0307405_10194962 Ga0307405_101949623 100
616 3300031731 Ga0307405_10279108 Ga0307405_102791081 100
617 3300031731 Ga0307405_10428309 Ga0307405_104283092 100
618 3300031731 Ga0307405_10580884 Ga0307405_105808841 100
619 3300031731 Ga0307405_11175306 Ga0307405_111753062 100
620 3300031824 Ga0307413_10001771 Ga0307413_100017712 100
621 3300031824 Ga0307413_10002336 Ga0307413_100023368 100
622 3300031824 Ga0307413_10008144 Ga0307413_100081443 100
623 3300031824 Ga0307413_10008954 Ga0307413_100089544 100
624 3300031824 Ga0307413_10016330 Ga0307413_100163302 100
625 3300031824 Ga0307413_10029579 Ga0307413_100295792 100
626 3300031824 Ga0307413_10033208 Ga0307413_100332084 100
627 3300031824 Ga0307413_10055905 Ga0307413_100559053 100
628 3300031824 Ga0307413_10064778 Ga0307413_100647784 100
629 3300031824 Ga0307413_10116366 Ga0307413_101163663 100
630 3300031824 Ga0307413_10136481 Ga0307413_101364813 100
631 3300031824 Ga0307413_10154946 Ga0307413_101549463 100
632 3300031824 Ga0307413_10156783 Ga0307413_101567833 100
633 3300031824 Ga0307413_10188188 Ga0307413_101881881 100
634 3300031824 Ga0307413_10203533 Ga0307413_102035333 100
635 3300031824 Ga0307413_10213513 Ga0307413_102135132 100
636 3300031824 Ga0307413_10237763 Ga0307413_102377633 100
637 3300031824 Ga0307413_10247035 Ga0307413_102470353 100
638 3300031824 Ga0307413_10423977 Ga0307413_104239772 100
639 3300031824 Ga0307413_10538999 Ga0307413_105389991 100
640 3300031824 Ga0307413_10544462 Ga0307413_105444622 100
641 3300031824 Ga0307413_10861511 Ga0307413_108615112 100
642 3300031824 Ga0307413_11651324 Ga0307413_116513242 100
643 3300031824 Ga0307413_12173076 Ga0307413_121730762 100
644 3300031852 Ga0307410_10001869 Ga0307410_1000186913 100
645 3300031852 Ga0307410_10021946 Ga0307410_100219465 100
646 3300031852 Ga0307410_10039136 Ga0307410_100391364 100
647 3300031852 Ga0307410_10042410 Ga0307410_100424104 100
648 3300031852 Ga0307410_10059083 Ga0307410_100590834 100
649 3300031852 Ga0307410_10059636 Ga0307410_100596364 100
650 3300031852 Ga0307410_10081003 Ga0307410_100810033 100
651 3300031852 Ga0307410_10082595 Ga0307410_100825953 100
652 3300031852 Ga0307410_10131359 Ga0307410_101313593 100
653 3300031852 Ga0307410_10135516 Ga0307410_101355162 100
654 3300031852 Ga0307410_10160115 Ga0307410_101601152 100
655 3300031852 Ga0307410_10187073 Ga0307410_101870732 100
656 3300031852 Ga0307410_10261634 Ga0307410_102616343 100
657 3300031852 Ga0307410_10304114 Ga0307410_103041143 100
658 3300031852 Ga0307410_10323457 Ga0307410_103234572 100
659 3300031852 Ga0307410_10437140 Ga0307410_104371402 100
660 3300031852 Ga0307410_10517971 Ga0307410_105179712 100
661 3300031852 Ga0307410_10552959 Ga0307410_105529593 100
662 3300031852 Ga0307410_10566358 Ga0307410_105663583 100
663 3300031852 Ga0307410_10653028 Ga0307410_106530282 100
664 3300031852 Ga0307410_11162054 Ga0307410_111620542 100
665 3300031901 Ga0307406_10006455 Ga0307406_100064557 100
666 3300031901 Ga0307406_10012269 Ga0307406_100122694 100
667 3300031901 Ga0307406_10043664 Ga0307406_100436643 100
668 3300031901 Ga0307406_10055483 Ga0307406_100554832 100
669 3300031901 Ga0307406_10060567 Ga0307406_100605673 100
670 3300031901 Ga0307406_10102367 Ga0307406_101023673 100
671 3300031901 Ga0307406_10113468 Ga0307406_101134682 100
672 3300031901 Ga0307406_10174190 Ga0307406_101741903 100
673 3300031901 Ga0307406_10181255 Ga0307406_101812552 100
674 3300031901 Ga0307406_10304127 Ga0307406_103041271 100
675 3300031901 Ga0307406_10306583 Ga0307406_103065833 100
676 3300031901 Ga0307406_10489556 Ga0307406_104895561 100
677 3300031901 Ga0307406_10613412 Ga0307406_106134122 100
678 3300031901 Ga0307406_10776530 Ga0307406_107765302 100
679 3300031903 Ga0307407_10002443 Ga0307407_100024439 100
680 3300031903 Ga0307407_10012359 Ga0307407_100123594 100
681 3300031903 Ga0307407_10041126 Ga0307407_100411262 100
682 3300031903 Ga0307407_10059400 Ga0307407_100594002 100
683 3300031903 Ga0307407_10078457 Ga0307407_100784573 100
684 3300031903 Ga0307407_10091386 Ga0307407_100913863 100
685 3300031903 Ga0307407_10125721 Ga0307407_101257212 100
686 3300031903 Ga0307407_10152681 Ga0307407_101526813 100
687 3300031903 Ga0307407_10317230 Ga0307407_103172301 100
688 3300031903 Ga0307407_10793923 Ga0307407_107939231 100
689 3300031911 Ga0307412_10001264 Ga0307412_1000126414 100
690 3300031911 Ga0307412_10033438 Ga0307412_100334381 100
691 3300031911 Ga0307412_10035218 Ga0307412_100352184 100
692 3300031911 Ga0307412_10046038 Ga0307412_100460384 100
693 3300031911 Ga0307412_10046929 Ga0307412_100469294 100
694 3300031911 Ga0307412_10049072 Ga0307412_100490721 100
695 3300031911 Ga0307412_10054484 Ga0307412_100544844 100
696 3300031911 Ga0307412_10063207 Ga0307412_100632074 100
697 3300031911 Ga0307412_10081414 Ga0307412_100814143 100
698 3300031911 Ga0307412_10110125 Ga0307412_101101251 100
699 3300031911 Ga0307412_10115219 Ga0307412_101152192 100
700 3300031911 Ga0307412_10170707 Ga0307412_101707072 100
701 3300031911 Ga0307412_10190102 Ga0307412_101901023 100
702 3300031911 Ga0307412_10235997 Ga0307412_102359973 100
703 3300031911 Ga0307412_10397387 Ga0307412_103973872 100
704 3300031911 Ga0307412_10492759 Ga0307412_104927592 100
705 3300031911 Ga0307412_10567763 Ga0307412_105677632 100
706 3300031911 Ga0307412_10794928 Ga0307412_107949282 100
707 3300031911 Ga0307412_11482037 Ga0307412_114820372 100
708 3300031995 Ga0307409_100013167 Ga0307409_1000131677 100
709 3300031995 Ga0307409_100023744 Ga0307409_1000237445 100
710 3300031995 Ga0307409_100068164 Ga0307409_1000681643 100
711 3300031995 Ga0307409_100083371 Ga0307409_1000833712 100
712 3300031995 Ga0307409_100113150 Ga0307409_1001131503 100
713 3300031995 Ga0307409_100118372 Ga0307409_1001183723 100
714 3300031995 Ga0307409_100139974 Ga0307409_1001399743 100
715 3300031995 Ga0307409_100215569 Ga0307409_1002155691 100
716 3300031995 Ga0307409_100234174 Ga0307409_1002341743 100
717 3300031995 Ga0307409_100260127 Ga0307409_1002601273 100
718 3300031995 Ga0307409_100266826 Ga0307409_1002668263 100
719 3300031995 Ga0307409_100355106 Ga0307409_1003551061 100
720 3300031995 Ga0307409_100365798 Ga0307409_1003657982 100
721 3300031995 Ga0307409_100388225 Ga0307409_1003882253 100
722 3300031995 Ga0307409_100457334 Ga0307409_1004573342 100
723 3300031995 Ga0307409_100467714 Ga0307409_1004677142 100
724 3300031995 Ga0307409_100679104 Ga0307409_1006791041 100
725 3300031995 Ga0307409_100746069 Ga0307409_1007460692 100
726 3300031995 Ga0307409_100768581 Ga0307409_1007685812 100
727 3300031995 Ga0307409_101076553 Ga0307409_1010765532 100
728 3300031995 Ga0307409_101951770 Ga0307409_1019517702 100
729 3300032002 Ga0307416_100007264 Ga0307416_1000072644 100
730 3300032002 Ga0307416_100021040 Ga0307416_1000210404 100
731 3300032002 Ga0307416_100024485 Ga0307416_1000244851 100
732 3300032002 Ga0307416_100026809 Ga0307416_1000268091 100
733 3300032002 Ga0307416_100055032 Ga0307416_1000550322 100
734 3300032002 Ga0307416_100132600 Ga0307416_1001326003 100
735 3300032002 Ga0307416_100140905 Ga0307416_1001409053 100
736 3300032002 Ga0307416_100218482 Ga0307416_1002184822 100
737 3300032002 Ga0307416_100275975 Ga0307416_1002759752 100
738 3300032002 Ga0307416_100305517 Ga0307416_1003055172 100
739 3300032002 Ga0307416_100515801 Ga0307416_1005158012 100
740 3300032002 Ga0307416_100561132 Ga0307416_1005611322 100
741 3300032002 Ga0307416_100564115 Ga0307416_1005641152 100
742 3300032002 Ga0307416_100583852 Ga0307416_1005838522 100
743 3300032002 Ga0307416_100798976 Ga0307416_1007989762 100
744 3300032002 Ga0307416_101589657 Ga0307416_1015896572 100
745 3300032004 Ga0307414_10008846 Ga0307414_100088463 100
746 3300032004 Ga0307414_10034489 Ga0307414_100344893 100
747 3300032004 Ga0307414_10039269 Ga0307414_100392692 100
748 3300032004 Ga0307414_10039374 Ga0307414_100393742 100
749 3300032004 Ga0307414_10043181 Ga0307414_100431814 100
750 3300032004 Ga0307414_10043610 Ga0307414_100436104 100
751 3300032004 Ga0307414_10058070 Ga0307414_100580704 100
752 3300032004 Ga0307414_10063874 Ga0307414_100638742 100
753 3300032004 Ga0307414_10067561 Ga0307414_100675613 100
754 3300032004 Ga0307414_10069348 Ga0307414_100693484 100
755 3300032004 Ga0307414_10069486 Ga0307414_100694863 100
756 3300032004 Ga0307414_10081161 Ga0307414_100811613 100
757 3300032004 Ga0307414_10092871 Ga0307414_100928712 100
758 3300032004 Ga0307414_10095382 Ga0307414_100953823 100
759 3300032004 Ga0307414_10099355 Ga0307414_100993553 100
760 3300032004 Ga0307414_10105829 Ga0307414_101058293 100
761 3300032004 Ga0307414_10107610 Ga0307414_101076104 100
762 3300032004 Ga0307414_10109688 Ga0307414_101096883 100
763 3300032004 Ga0307414_10161041 Ga0307414_101610412 100
764 3300032004 Ga0307414_10179950 Ga0307414_101799502 100
765 3300032004 Ga0307414_10189864 Ga0307414_101898643 100
766 3300032004 Ga0307414_10197111 Ga0307414_101971112 100
767 3300032004 Ga0307414_10362071 Ga0307414_103620713 100
768 3300032004 Ga0307414_10473557 Ga0307414_104735572 100
769 3300032004 Ga0307414_10512165 Ga0307414_105121652 100
770 3300032004 Ga0307414_10577268 Ga0307414_105772682 100
771 3300032004 Ga0307414_10659307 Ga0307414_106593071 100
772 3300032004 Ga0307414_10681532 Ga0307414_106815322 100
773 3300032004 Ga0307414_10819584 Ga0307414_108195842 100
774 3300032004 Ga0307414_10929000 Ga0307414_109290001 100
775 3300032004 Ga0307414_10977525 Ga0307414_109775252 100
776 3300032004 Ga0307414_11099521 Ga0307414_110995212 100
777 3300032005 Ga0307411_10007716 Ga0307411_100077167 100
778 3300032005 Ga0307411_10014210 Ga0307411_100142104 100
779 3300032005 Ga0307411_10015709 Ga0307411_100157096 100
780 3300032005 Ga0307411_10023981 Ga0307411_100239813 100
781 3300032005 Ga0307411_10026202 Ga0307411_100262025 100
782 3300032005 Ga0307411_10029200 Ga0307411_100292004 100
783 3300032005 Ga0307411_10035169 Ga0307411_100351693 100
784 3300032005 Ga0307411_10059754 Ga0307411_100597542 100
785 3300032005 Ga0307411_10076983 Ga0307411_100769831 100
786 3300032005 Ga0307411_10091067 Ga0307411_100910671 100
787 3300032005 Ga0307411_10099636 Ga0307411_100996362 100
788 3300032005 Ga0307411_10114562 Ga0307411_101145622 100
789 3300032005 Ga0307411_10161717 Ga0307411_101617173 100
790 3300032005 Ga0307411_10190232 Ga0307411_101902322 100
791 3300032005 Ga0307411_10211211 Ga0307411_102112113 100
792 3300032005 Ga0307411_10234869 Ga0307411_102348693 100
793 3300032005 Ga0307411_10305059 Ga0307411_103050592 100
794 3300032005 Ga0307411_10525097 Ga0307411_105250972 100
795 3300032005 Ga0307411_10596970 Ga0307411_105969702 100
796 3300032005 Ga0307411_10611810 Ga0307411_106118102 100
797 3300032005 Ga0307411_10909103 Ga0307411_109091032 100
798 3300032005 Ga0307411_11721950 Ga0307411_117219502 100
799 3300032005 Ga0307411_11980540 Ga0307411_119805401 100
800 3300032005 Ga0307411_12178113 Ga0307411_121781132 100
801 3300032126 Ga0307415_100027025 Ga0307415_1000270253 100
802 3300032126 Ga0307415_100029268 Ga0307415_1000292682 100
803 3300032126 Ga0307415_100050228 Ga0307415_1000502283 100
804 3300032126 Ga0307415_100195207 Ga0307415_1001952073 100
805 3300032126 Ga0307415_100238773 Ga0307415_1002387733 100
806 3300032126 Ga0307415_100244659 Ga0307415_1002446593 100
807 3300032126 Ga0307415_100305524 Ga0307415_1003055242 100
808 3300032126 Ga0307415_100704389 Ga0307415_1007043892 100
809 3300032126 Ga0307415_100989581 Ga0307415_1009895812 100
810 3300032126 Ga0307415_101080233 Ga0307415_1010802332 100
811 3300032126 Ga0307415_101624476 Ga0307415_1016244762 100
812 3300034957 Ga0373938_0205045 Ga0373938_0205045_40_342 100
813 3300037312 Ga0395899_0118334 Ga0395899_0118334_851_1168 100
814 3300037312 Ga0395899_0537020 Ga0395899_0537020_356_676 100
815 3300037312 Ga0395899_0840777 Ga0395899_0840777_94_411 100
816 3300037418 Ga0395900_0001132 Ga0395900_0001132_20182_20496 100
817 3300037418 Ga0395900_0056659 Ga0395900_0056659_3029_3334 100
818 3300037418 Ga0395900_0103583 Ga0395900_0103583_59_364 100
819 3300037418 Ga0395900_0752849 Ga0395900_0752849_149_466 100
820 3300037418 Ga0395900_0989934 Ga0395900_0989934_198_515 100
821 3300037466 Ga0395898_0208888 Ga0395898_0208888_1098_1418 100
822 3300037466 Ga0395898_0708496 Ga0395898_0708496_279_596 100
823 3300037466 Ga0395898_1849846 Ga0395898_1849846_102_416 100
824 3300037471 Ga0395905_0000083 Ga0395905_0000083_39845_40159 100
825 3300037471 Ga0395905_0119078 Ga0395905_0119078_757_1071 100
826 3300037471 Ga0395905_0182685 Ga0395905_0182685_537_854 100
827 3300037471 Ga0395905_0230543 Ga0395905_0230543_1196_1522 100
828 3300037471 Ga0395905_0673695 Ga0395905_0673695_52_369 100
829 3300037471 Ga0395905_0954486 Ga0395905_0954486_92_397 100
830 3300037471 Ga0395905_1026122 Ga0395905_1026122_13_339 100
831 3300037853 Ga0436364_1020203 Ga0436364_1020203_2282_2605 100
832 3300038443 Ga0395901_0000369 Ga0395901_0000369_2989_3303 100
833 3300038443 Ga0395901_0191467 Ga0395901_0191467_283_600 100
834 3300038443 Ga0395901_0231731 Ga0395901_0231731_1307_1612 100
835 3300038443 Ga0395901_0234727 Ga0395901_0234727_824_1141 100
836 3300038443 Ga0395901_0302693 Ga0395901_0302693_1098_1418 100
837 3300038443 Ga0395901_0573130 Ga0395901_0573130_417_734 100
838 3300041404 Ga0439436_0081773 Ga0439436_0081773_41_358 100
839 3300041405 Ga0439438_118197 Ga0439438_118197_263_580 100
840 3300041407 Ga0439447_114011 Ga0439447_114011_138_455 100
841 3300041512 Ga0451853_0382471 Ga0451853_0382471_346_660 100
842 3300042004 Ga0439445_0026926 Ga0439445_0026926_133_453 100
843 3300042015 Ga0439462_0058168 Ga0439462_0058168_201_518 100
844 3300042116 Ga0450912_037797 Ga0450912_037797_47_349 100
845 3300042435 Ga0439434_0029600 Ga0439434_0029600_1246_1563 100
846 3300042436 Ga0439435_0211751 Ga0439435_0211751_47_367 100
847 3300044712 Ga0453684_2029335 Ga0453684_2029335_29_355 100
848 3300046491 Ga0495584_0104676 Ga0495584_0104676_1081_1401 100
849 3300046500 Ga0495596_0207705 Ga0495596_0207705_237_539 100
850 3300046525 Ga0495663_0004305 Ga0495663_0004305_3265_3567 100
851 3300046525 Ga0495663_0030028 Ga0495663_0030028_323_643 100
852 3300046525 Ga0495663_0153945 Ga0495663_0153945_384_710 100
853 3300046528 Ga0495642_0021249 Ga0495642_0021249_2080_2400 100
854 3300046537 Ga0495598_0021423 Ga0495598_0021423_51_365 100
855 3300046539 Ga0495621_0000378 Ga0495621_0000378_8847_9161 100
856 3300046539 Ga0495621_0002551 Ga0495621_0002551_273_575 100
857 3300046539 Ga0495621_0003388 Ga0495621_0003388_1888_2190 100
858 3300046539 Ga0495621_0013290 Ga0495621_0013290_157_471 100
859 3300046539 Ga0495621_0233188 Ga0495621_0233188_196_516 100
860 3300046542 Ga0495597_0390565 Ga0495597_0390565_118_444 100
861 3300046558 Ga0495633_0017067 Ga0495633_0017067_1488_1802 100
862 3300046558 Ga0495633_0138241 Ga0495633_0138241_540_860 100
863 3300046558 Ga0495633_0368472 Ga0495633_0368472_190_504 100
864 3300046615 Ga0495656_0305153 Ga0495656_0305153_482_796 100
865 3300046660 Ga0495625_0534496 Ga0495625_0534496_255_557 100
866 3300046664 Ga0495659_0017251 Ga0495659_0017251_856_1176 100
867 3300046664 Ga0495659_0019471 Ga0495659_0019471_436_750 100
868 3300046664 Ga0495659_0129766 Ga0495659_0129766_653_955 100
869 3300046684 Ga0495669_0049962 Ga0495669_0049962_255_569 100
870 3300046684 Ga0495669_0071091 Ga0495669_0071091_208_528 100
871 3300046691 Ga0495670_0010033 Ga0495670_0010033_1592_1894 100
872 3300046691 Ga0495670_0045338 Ga0495670_0045338_631_945 100
873 3300046691 Ga0495670_0054949 Ga0495670_0054949_1023_1337 100
874 3300046691 Ga0495670_0150255 Ga0495670_0150255_161_475 100
875 3300046691 Ga0495670_0319206 Ga0495670_0319206_177_497 100
876 3300046691 Ga0495670_0797146 Ga0495670_0797146_155_475 100
877 3300047318 Ga0495636_0041912 Ga0495636_0041912_345_659 100
878 3300047318 Ga0495636_0177745 Ga0495636_0177745_622_942 100
879 3300047445 Ga0495677_0096931 Ga0495677_0096931_485_799 100
880 3300047445 Ga0495677_0141768 Ga0495677_0141768_65_367 100
881 3300047445 Ga0495677_0176316 Ga0495677_0176316_480_800 100
882 3300048090 Ga0495615_0184803 Ga0495615_0184803_74_376 100
883 3300048905 Ga0496102_0272185 Ga0496102_0272185_218_544 100
884 3300048906 Ga0496103_0087942 Ga0496103_0087942_73_438 100
885 3300048906 Ga0496103_0195568 Ga0496103_0195568_398_724 100
886 3300048907 Ga0496104_0750197 Ga0496104_0750197_99_425 100
887 3300048912 Ga0496109_0187450 Ga0496109_0187450_1343_1645 100
888 3300048912 Ga0496109_0490912 Ga0496109_0490912_319_645 100
889 3300048916 Ga0496113_0669144 Ga0496113_0669144_442_768 100
890 3300049521 Ga0501298_067568 Ga0501298_067568_75_389 100
891 3300049656 Ga0501209_185246 Ga0501209_185246_232_552 100
892 3300049658 Ga0501211_036345 Ga0501211_036345_204_518 100
893 3300049661 Ga0501217_178090 Ga0501217_178090_211_525 100
894 3300049665 Ga0501227_051465 Ga0501227_051465_670_984 100
895 3300049668 Ga0501233_050244 Ga0501233_050244_234_548 100
896 3300049669 Ga0501235_006983 Ga0501235_006983_1859_2173 100
897 3300049674 Ga0501242_068610 Ga0501242_068610_88_408 100
898 3300049675 Ga0501243_028456 Ga0501243_028456_595_909 100
899 3300049675 Ga0501243_048190 Ga0501243_048190_56_376 100
900 3300049677 Ga0501247_034044 Ga0501247_034044_207_527 100
901 3300049680 Ga0501250_007031 Ga0501250_007031_342_662 100
902 3300049686 Ga0501257_029067 Ga0501257_029067_250_564 100
903 3300049704 Ga0501221_167455 Ga0501221_167455_191_505 100
904 3300049705 Ga0501225_0094367 Ga0501225_0094367_210_527 100
905 3300049707 Ga0501234_103784 Ga0501234_103784_124_441 100
906 3300049708 Ga0501245_091241 Ga0501245_091241_163_477 100
907 3300049760 Ga0501263_015365 Ga0501263_015365_87_401 100
908 3300049762 Ga0501265_107782 Ga0501265_107782_65_385 100
909 3300049764 Ga0501267_003212 Ga0501267_003212_627_941 100
910 3300049765 Ga0501268_004932 Ga0501268_004932_273_593 100
911 3300049765 Ga0501268_008485 Ga0501268_008485_588_902 100
912 3300049765 Ga0501268_010277 Ga0501268_010277_305_625 100
913 3300049767 Ga0501270_042257 Ga0501270_042257_437_751 100
914 3300049767 Ga0501270_073948 Ga0501270_073948_167_487 100
915 3300049769 Ga0501272_007155 Ga0501272_007155_424_738 100
916 3300049770 Ga0501273_072515 Ga0501273_072515_215_529 100
917 3300049779 Ga0501283_034441 Ga0501283_034441_468_782 100
918 3300050511 nmdc:mga08y16_199835_c1 nmdc:mga08y16_199835_c1_649_963 100
919 3300050511 nmdc:mga08y16_93718_c1 nmdc:mga08y16_93718_c1_2136_2438 100
920 3300050512 nmdc:mga0n895_602073_c1 nmdc:mga0n895_602073_c1_664_966 100
921 3300059424 Ga0590075_175145 Ga0590075_175145_211_540 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

16

102

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kyg-assembly1.cif.gz_B crystal structure of vca0042 (l135r) complexed with c-di-gmp 0.8764 15 89
8igv-assembly1.cif.gz_E hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp-pi)1cat(adp)2cat,2non-cat 0.8581 41 89
8igv-assembly1.cif.gz_D hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp-pi)1cat(adp)2cat,2non-cat 0.8516 41 89
8igw-assembly1.cif.gz_D hexameric ring complex of engineered v1-atpase bound to 4 adps: a3(de)3_(adp)3cat,1non-cat, hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp)3cat,2non-cat 0.8458 41 95
8igu-assembly1.cif.gz_E hexameric ring complex of engineered v1-atpase: a3(de)3_empty 0.8455 41 89
ID Description Score Start End Superfamily
3kygA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8892 20 89 2.40.10.220
af_A0A1D6GI91_64_262_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8688 57 92 3.40.1280.10
af_Q57670_3_72_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8469 39 95 2.40.30.20
5kndD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8398 41 89 3.40.50.12240
5o95A01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.839 57 93 2.40.240.20
ID Description Score Start End GO Terms
AF-A0A0P6VRS3-F1-model_v4 Chemotaxis protein 0.9482 18 96 GO:0004888
GO:0006935
GO:0007165
GO:0016020
GO:0035438
AF-A0A0T2QDW6-F1-model_v4 PilZ domain-containing protein 0.9477 14 96 GO:0035438
AF-A0A1E4JCB8-F1-model_v4 PilZ domain-containing protein 0.947 20 98 GO:0035438
AF-A0A1W9HN28-F1-model_v4 PilZ domain-containing protein 0.947 18 98 GO:0035438
AF-A0A318B6W0-F1-model_v4 deleted 0.9468 20 94

Feature Viewer

pLDDT pTM Quality
72.74 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map