F485756
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 921 | 564 | 726 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10074179|Ga0081455_100741792 |
| Length | 292 |
| Sequence | MPRVAFIGLGRMGHGMAGRYLDAGFSVQVWNRSQKKADDLIARGAEWGSSPMRAAEDADAVVTMVADDEASREVWLGEKGVLASWQPDRIAIECSTVSYDHARDLGRKLGWRRISYIDCPVTGLPDAAASGKLTLLVGADAADLERARPFLEPLGTIRHFGPVGSGTIYKLINNLMGAIQIAGLAEGLAIAEQAGLDMNLVLEAIQSGVTASPQVLRHSKRMVARDFAGATFTAALRHKDAAYAVALADSLLADKPLVGRAAVEAYARAKAVIPDDDEGKMIEIVSRPKGRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 14 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 15 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 22 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 23 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 24 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 25 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 26 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 27 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 28 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 29 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 30 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 31 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 32 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 33 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 34 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 35 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 36 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 37 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 38 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 39 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 40 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 41 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 42 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 43 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 44 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 45 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 46 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 47 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 48 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 49 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 50 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 51 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 52 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 53 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 54 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 55 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 56 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 57 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 58 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 59 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 60 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 61 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 62 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 63 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 64 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 65 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 66 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 67 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 68 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 69 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 70 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 71 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 72 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 73 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 74 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 75 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 76 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 77 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 78 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 79 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 80 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 81 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 82 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 83 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 84 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 85 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 86 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 87 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 88 | 2906610324 | |||
| 89 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 90 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 91 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 92 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 93 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 94 | 2922368715 | |||
| 95 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 96 | 2922425934 | |||
| 97 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 98 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 99 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 100 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 101 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 102 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 103 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 104 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 105 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 106 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 107 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 108 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 109 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 110 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 111 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 112 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 113 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 114 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 115 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 116 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 117 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 118 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 119 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 120 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 121 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 122 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 123 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 124 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 125 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 126 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 127 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 128 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 129 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 130 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 131 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 132 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 133 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 134 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 135 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 136 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 137 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 138 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 139 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 140 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 141 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 142 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 143 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 144 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 145 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 146 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 147 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 148 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 149 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 150 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 151 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 152 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 153 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 154 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 155 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 156 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 157 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 158 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 159 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 160 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 161 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 162 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 163 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 164 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 165 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 166 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 167 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 168 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 169 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 170 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 171 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 172 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 174 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 175 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 176 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 177 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 178 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 179 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 184 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 186 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 188 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 194 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 195 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 196 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 197 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 198 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 199 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 200 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 203 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 204 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 205 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 206 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 208 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 209 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 210 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 211 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 212 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 213 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 214 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 215 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 216 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 217 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 218 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 220 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 221 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 222 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 225 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 227 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 228 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 230 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 231 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 232 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 252 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 253 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 254 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 255 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 256 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 262 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 264 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 308 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 309 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 310 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 311 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 316 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 317 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 318 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 319 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 320 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 321 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 322 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 323 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 324 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 325 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 326 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 327 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 328 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 329 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 330 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 331 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 332 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 333 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 334 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 335 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 336 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 337 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 338 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 339 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 340 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 341 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 342 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 343 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 344 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 345 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 346 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 347 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 348 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 349 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 350 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 351 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 352 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 353 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 354 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 355 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 356 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 357 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 358 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 359 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 360 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 361 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 362 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 363 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 364 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 365 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 366 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 367 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 368 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 369 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 370 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 371 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 372 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 373 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 374 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 375 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 376 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 377 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 378 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 379 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 452 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 453 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 454 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 455 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 456 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 457 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 458 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 459 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 460 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 461 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 462 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 463 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 464 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 465 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 466 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 467 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 468 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 469 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 470 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 471 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 472 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 473 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 474 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 475 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 476 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 484 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 485 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 486 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 489 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 495 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 496 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 497 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 498 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 499 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 500 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 502 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 503 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 504 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 505 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 506 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 507 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 508 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 509 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 510 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 511 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 512 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 513 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 514 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 515 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 516 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 517 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 518 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 519 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 520 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 521 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 523 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 524 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 525 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 526 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 527 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 529 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 530 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 531 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 533 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 534 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 535 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 536 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 537 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 538 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 539 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 540 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 541 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 542 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 543 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 544 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 545 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 546 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 547 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 548 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 549 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 550 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 551 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 552 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 553 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 554 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 555 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 556 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 557 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 558 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 559 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 560 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 561 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 562 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 563 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 564 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.98 |
| Metatranscriptomes | 0.11 |
| Isolates | 20.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.6 |
| Nodule | 16.72 |
| Rhizoplane | 5.75 |
| Rhizosphere | 51.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10001975 | 3300003215 | Bacteria | 12154 |
| 2 | JGI25153J46596_10008298 | 3300003215 | Bacteria | 4985 |
| 3 | JGI25153J46596_10015626 | 3300003215 | Bacteria | 3082 |
| 4 | rootH2_10092826 | 3300003320 | Bacteria | 32546 |
| 5 | JGI25160J50197_1025735 | 3300003354 | Bacteria | 1638 |
| 6 | Ga0055526_1027575 | 3300003771 | Bacteria | 1751 |
| 7 | Ga0065165_1001744 | 3300005262 | Bacteria | 21697 |
| 8 | Ga0065165_1003890 | 3300005262 | Bacteria | 9887 |
| 9 | Ga0065165_1007122 | 3300005262 | Bacteria | 5608 |
| 10 | Ga0070658_10103432 | 3300005327 | Bacteria | 2355 |
| 11 | Ga0070690_100351692 | 3300005330 | Bacteria | 1070 |
| 12 | Ga0068869_100111434 | 3300005334 | Bacteria | 2082 |
| 13 | Ga0070680_100095596 | 3300005336 | Bacteria | 2463 |
| 14 | Ga0070682_100143586 | 3300005337 | Bacteria | 1630 |
| 15 | Ga0070682_100299733 | 3300005337 | Bacteria | 1179 |
| 16 | Ga0070691_10174307 | 3300005341 | Bacteria | 1116 |
| 17 | Ga0070687_100104898 | 3300005343 | Bacteria | 1590 |
| 18 | Ga0070661_100130283 | 3300005344 | Bacteria | 1888 |
| 19 | Ga0070668_100017635 | 3300005347 | Bacteria | 5353 |
| 20 | Ga0070668_100129208 | 3300005347 | Bacteria | 2026 |
| 21 | Ga0070668_100228406 | 3300005347 | Bacteria | 1537 |
| 22 | Ga0070668_100266390 | 3300005347 | Bacteria | 1426 |
| 23 | Ga0070674_100172918 | 3300005356 | Bacteria | 1648 |
| 24 | Ga0070673_100298057 | 3300005364 | Bacteria | 1419 |
| 25 | Ga0070688_100205272 | 3300005365 | Bacteria | 1381 |
| 26 | Ga0070659_100176968 | 3300005366 | Bacteria | 1749 |
| 27 | Ga0070709_10005979 | 3300005434 | Bacteria | 6611 |
| 28 | Ga0070714_100147033 | 3300005435 | Bacteria | 2121 |
| 29 | Ga0070713_100009644 | 3300005436 | Bacteria | 6930 |
| 30 | Ga0070713_100076142 | 3300005436 | Bacteria | 2849 |
| 31 | Ga0070713_100161962 | 3300005436 | Bacteria | 1998 |
| 32 | Ga0070710_10000246 | 3300005437 | Bacteria | 25491 |
| 33 | Ga0070710_10004225 | 3300005437 | Bacteria | 6808 |
| 34 | Ga0070711_100003729 | 3300005439 | Bacteria | 8930 |
| 35 | Ga0070663_100012278 | 3300005455 | Bacteria | 5412 |
| 36 | Ga0070663_100073784 | 3300005455 | Bacteria | 2490 |
| 37 | Ga0070663_100325610 | 3300005455 | Bacteria | 1237 |
| 38 | Ga0070663_100341079 | 3300005455 | Bacteria | 1211 |
| 39 | Ga0070663_100366135 | 3300005455 | Bacteria | 1170 |
| 40 | Ga0070663_100429869 | 3300005455 | Bacteria | 1085 |
| 41 | Ga0070678_100389543 | 3300005456 | Bacteria | 1208 |
| 42 | Ga0070662_100057096 | 3300005457 | Bacteria | 2835 |
| 43 | Ga0070662_100121120 | 3300005457 | Bacteria | 2005 |
| 44 | Ga0070662_100449324 | 3300005457 | Bacteria | 1069 |
| 45 | Ga0070681_10088546 | 3300005458 | Bacteria | 3047 |
| 46 | Ga0070681_10279288 | 3300005458 | Bacteria | 1581 |
| 47 | Ga0070681_10533142 | 3300005458 | Bacteria | 1087 |
| 48 | Ga0070706_100612224 | 3300005467 | Bacteria | 1012 |
| 49 | Ga0070707_100128075 | 3300005468 | Bacteria | 2467 |
| 50 | Ga0070679_100046714 | 3300005530 | Bacteria | 4316 |
| 51 | Ga0070679_100098528 | 3300005530 | Bacteria | 2911 |
| 52 | Ga0070679_100101649 | 3300005530 | Bacteria | 2861 |
| 53 | Ga0070679_100193229 | 3300005530 | Bacteria | 2003 |
| 54 | Ga0070679_100685937 | 3300005530 | Bacteria | 967 |
| 55 | Ga0070684_100079765 | 3300005535 | Bacteria | 2894 |
| 56 | Ga0070684_100147421 | 3300005535 | Bacteria | 2131 |
| 57 | Ga0070684_100198803 | 3300005535 | Bacteria | 1825 |
| 58 | Ga0070697_100024733 | 3300005536 | Bacteria | 4782 |
| 59 | Ga0070697_100234930 | 3300005536 | Bacteria | 1564 |
| 60 | Ga0070686_100204505 | 3300005544 | Bacteria | 1418 |
| 61 | Ga0070686_100412663 | 3300005544 | Bacteria | 1030 |
| 62 | Ga0070693_100184891 | 3300005547 | Bacteria | 1344 |
| 63 | Ga0070665_100062661 | 3300005548 | Bacteria | 3728 |
| 64 | Ga0070665_100274524 | 3300005548 | Bacteria | 1687 |
| 65 | Ga0070665_100294346 | 3300005548 | Bacteria | 1626 |
| 66 | Ga0068855_100093456 | 3300005563 | Bacteria | 3468 |
| 67 | Ga0068855_100135169 | 3300005563 | Bacteria | 2813 |
| 68 | Ga0068855_100156301 | 3300005563 | Bacteria | 2591 |
| 69 | Ga0068855_100330249 | 3300005563 | Bacteria | 1683 |
| 70 | Ga0068855_100334599 | 3300005563 | Bacteria | 1671 |
| 71 | Ga0068857_100238179 | 3300005577 | Bacteria | 1666 |
| 72 | Ga0068854_100094706 | 3300005578 | Bacteria | 2228 |
| 73 | Ga0068854_100275322 | 3300005578 | Bacteria | 1353 |
| 74 | Ga0068856_100003004 | 3300005614 | Bacteria | 17269 |
| 75 | Ga0068856_100034334 | 3300005614 | Bacteria | 4968 |
| 76 | Ga0068856_100570670 | 3300005614 | Bacteria | 1153 |
| 77 | Ga0070702_100124688 | 3300005615 | Bacteria | 1618 |
| 78 | Ga0068852_100049804 | 3300005616 | Bacteria | 3585 |
| 79 | Ga0068852_100211194 | 3300005616 | Bacteria | 1841 |
| 80 | Ga0068859_100161007 | 3300005617 | Bacteria | 2323 |
| 81 | Ga0068864_100552636 | 3300005618 | Bacteria | 1113 |
| 82 | Ga0068861_100297464 | 3300005719 | Bacteria | 1396 |
| 83 | Ga0068851_10112618 | 3300005834 | Bacteria | 1454 |
| 84 | Ga0068858_100314985 | 3300005842 | Bacteria | 1494 |
| 85 | Ga0068860_100595316 | 3300005843 | Bacteria | 1111 |
| 86 | Ga0068862_100226788 | 3300005844 | Bacteria | 1693 |
| 87 | Ga0068862_100228430 | 3300005844 | Bacteria | 1687 |
| 88 | Ga0068862_100580673 | 3300005844 | Bacteria | 1074 |
| 89 | Ga0081455_10074179 | 3300005937 | Bacteria | 2811 |
| 90 | Ga0081455_10084110 | 3300005937 | Bacteria | 2598 |
| 91 | Ga0081540_1005800 | 3300005983 | Bacteria | 9137 |
| 92 | Ga0081540_1006577 | 3300005983 | Bacteria | 8435 |
| 93 | Ga0081540_1010678 | 3300005983 | Bacteria | 6194 |
| 94 | Ga0081539_10000616 | 3300005985 | Bacteria | 72108 |
| 95 | Ga0070717_10085820 | 3300006028 | Bacteria | 2650 |
| 96 | Ga0075365_10006882 | 3300006038 | Bacteria | 6310 |
| 97 | Ga0075365_10335431 | 3300006038 | Bacteria | 1065 |
| 98 | Ga0075363_100081222 | 3300006048 | Bacteria | 1773 |
| 99 | Ga0075364_10259823 | 3300006051 | Bacteria | 1180 |
| 100 | Ga0070716_100015027 | 3300006173 | Bacteria | 3973 |
| 101 | Ga0070716_100298926 | 3300006173 | Bacteria | 1119 |
| 102 | Ga0070712_100006021 | 3300006175 | Bacteria | 7505 |
| 103 | Ga0070712_100009398 | 3300006175 | Bacteria | 6159 |
| 104 | Ga0070712_100179306 | 3300006175 | Bacteria | 1650 |
| 105 | Ga0070712_100326598 | 3300006175 | Bacteria | 1249 |
| 106 | Ga0075366_10095091 | 3300006195 | Bacteria | 1786 |
| 107 | Ga0097621_100078349 | 3300006237 | Bacteria | 2745 |
| 108 | Ga0075370_10020275 | 3300006353 | Bacteria | 3632 |
| 109 | Ga0075370_10028498 | 3300006353 | Bacteria | 3104 |
| 110 | Ga0075370_10042918 | 3300006353 | Bacteria | 2555 |
| 111 | Ga0068871_100174650 | 3300006358 | Bacteria | 1844 |
| 112 | Ga0068871_100215575 | 3300006358 | Bacteria | 1662 |
| 113 | Ga0097620_100161013 | 3300006931 | Bacteria | 2323 |
| 114 | Ga0099824_1012782 | 3300006942 | Bacteria | 8990 |
| 115 | Ga0099823_1053392 | 3300006944 | Bacteria | 2368 |
| 116 | Ga0099795_10016821 | 3300007788 | Bacteria | 2321 |
| 117 | Ga0105240_10055530 | 3300009093 | Bacteria | 4958 |
| 118 | Ga0105240_10362726 | 3300009093 | Bacteria | 1640 |
| 119 | Ga0105245_10033500 | 3300009098 | Bacteria | 4554 |
| 120 | Ga0105245_10162980 | 3300009098 | Bacteria | 2117 |
| 121 | Ga0105247_10012294 | 3300009101 | Bacteria | 5143 |
| 122 | Ga0105247_10184937 | 3300009101 | Bacteria | 1392 |
| 123 | Ga0105243_10033316 | 3300009148 | Bacteria | 3983 |
| 124 | Ga0105243_10184381 | 3300009148 | Bacteria | 1817 |
| 125 | Ga0105243_10549905 | 3300009148 | Bacteria | 1103 |
| 126 | Ga0105243_10775032 | 3300009148 | Bacteria | 943 |
| 127 | Ga0105241_10104362 | 3300009174 | Bacteria | 2258 |
| 128 | Ga0105241_10245809 | 3300009174 | Bacteria | 1515 |
| 129 | Ga0105248_10176081 | 3300009177 | Bacteria | 2411 |
| 130 | Ga0105248_10316430 | 3300009177 | Bacteria | 1758 |
| 131 | Ga0105248_10893662 | 3300009177 | Bacteria | 1003 |
| 132 | Ga0105248_10999267 | 3300009177 | Bacteria | 945 |
| 133 | Ga0105237_10009068 | 3300009545 | Bacteria | 10692 |
| 134 | Ga0105237_10024567 | 3300009545 | Bacteria | 6162 |
| 135 | Ga0105237_10064518 | 3300009545 | Bacteria | 3658 |
| 136 | Ga0105237_10090324 | 3300009545 | Bacteria | 3052 |
| 137 | Ga0105237_10390313 | 3300009545 | Bacteria | 1397 |
| 138 | Ga0105237_10983690 | 3300009545 | Bacteria | 851 |
| 139 | Ga0105238_10018050 | 3300009551 | Bacteria | 7171 |
| 140 | Ga0105249_10046943 | 3300009553 | Bacteria | 3933 |
| 141 | Ga0105239_10144007 | 3300010375 | Bacteria | 2657 |
| 142 | Ga0105239_10294016 | 3300010375 | Bacteria | 1829 |
| 143 | Ga0105239_10347853 | 3300010375 | Bacteria | 1673 |
| 144 | Ga0105239_10476786 | 3300010375 | Bacteria | 1417 |
| 145 | Ga0105239_10490236 | 3300010375 | Bacteria | 1397 |
| 146 | Ga0105239_10632922 | 3300010375 | Bacteria | 1221 |
| 147 | Ga0105246_10001247 | 3300011119 | Bacteria | 14936 |
| 148 | Ga0105246_10023452 | 3300011119 | Bacteria | 3993 |
| 149 | Ga0105246_10529800 | 3300011119 | Bacteria | 1006 |
| 150 | Ga0157370_10434784 | 3300013104 | Bacteria | 1207 |
| 151 | Ga0157369_10007417 | 3300013105 | Bacteria | 12627 |
| 152 | Ga0157369_10055013 | 3300013105 | Bacteria | 4296 |
| 153 | Ga0157369_10374003 | 3300013105 | Bacteria | 1479 |
| 154 | Ga0157374_10060187 | 3300013296 | Bacteria | 3553 |
| 155 | Ga0157374_10106184 | 3300013296 | Bacteria | 2697 |
| 156 | Ga0157375_10115127 | 3300013308 | Bacteria | 2792 |
| 157 | Ga0163163_10171210 | 3300014325 | Bacteria | 2218 |
| 158 | Ga0157380_10159931 | 3300014326 | Bacteria | 1956 |
| 159 | Ga0157380_10165663 | 3300014326 | Bacteria | 1926 |
| 160 | Ga0157379_10362535 | 3300014968 | Bacteria | 1328 |
| 161 | Ga0157376_10396519 | 3300014969 | Bacteria | 1333 |
| 162 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 163 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 164 | Ga0214542_1020125 | 3300021321 | Bacteria | 4998 |
| 165 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 166 | Ga0214545_1019688 | 3300021324 | Bacteria | 5686 |
| 167 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 168 | Ga0213876_10054200 | 3300021384 | Bacteria | 2117 |
| 169 | Ga0209563_101347 | 3300025230 | Bacteria | 6692 |
| 170 | Ga0209677_105719 | 3300025253 | Bacteria | 3161 |
| 171 | Ga0209148_1000356 | 3300025254 | Bacteria | 58774 |
| 172 | Ga0209233_1013020 | 3300025261 | Bacteria | 2391 |
| 173 | Ga0209233_1018847 | 3300025261 | Bacteria | 1846 |
| 174 | Ga0209455_1001391 | 3300025272 | Bacteria | 11010 |
| 175 | Ga0209564_1021717 | 3300025295 | Bacteria | 2297 |
| 176 | Ga0209564_1028213 | 3300025295 | Bacteria | 1801 |
| 177 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 178 | Ga0209758_1001565 | 3300025297 | Bacteria | 26240 |
| 179 | Ga0209758_1002055 | 3300025297 | Bacteria | 21535 |
| 180 | Ga0209758_1002832 | 3300025297 | Bacteria | 16855 |
| 181 | Ga0209758_1010040 | 3300025297 | Bacteria | 5747 |
| 182 | Ga0209256_1007804 | 3300025299 | Bacteria | 5151 |
| 183 | Ga0207426_1000599 | 3300025302 | Bacteria | 47456 |
| 184 | Ga0207426_1000960 | 3300025302 | Bacteria | 28422 |
| 185 | Ga0209257_1002984 | 3300025304 | Bacteria | 15406 |
| 186 | Ga0207710_10039499 | 3300025900 | Bacteria | 2089 |
| 187 | Ga0207710_10191953 | 3300025900 | Bacteria | 1006 |
| 188 | Ga0207688_10097624 | 3300025901 | Bacteria | 1693 |
| 189 | Ga0207688_10112391 | 3300025901 | Bacteria | 1582 |
| 190 | Ga0207680_10197117 | 3300025903 | Bacteria | 1370 |
| 191 | Ga0207647_10015833 | 3300025904 | Bacteria | 5160 |
| 192 | Ga0207699_10000230 | 3300025906 | Bacteria | 31963 |
| 193 | Ga0207643_10049112 | 3300025908 | Bacteria | 2391 |
| 194 | Ga0207654_10023543 | 3300025911 | Bacteria | 3300 |
| 195 | Ga0207654_10069921 | 3300025911 | Bacteria | 2082 |
| 196 | Ga0207707_10006249 | 3300025912 | Bacteria | 10402 |
| 197 | Ga0207707_10082921 | 3300025912 | Bacteria | 2799 |
| 198 | Ga0207707_10151536 | 3300025912 | Bacteria | 2027 |
| 199 | Ga0207707_10228240 | 3300025912 | Bacteria | 1620 |
| 200 | Ga0207707_10257088 | 3300025912 | Bacteria | 1516 |
| 201 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 202 | Ga0207671_10012975 | 3300025914 | Bacteria | 6666 |
| 203 | Ga0207671_10017413 | 3300025914 | Bacteria | 5541 |
| 204 | Ga0207671_10039046 | 3300025914 | Bacteria | 3517 |
| 205 | Ga0207671_10110789 | 3300025914 | Bacteria | 2088 |
| 206 | Ga0207671_10140237 | 3300025914 | Bacteria | 1862 |
| 207 | Ga0207693_10013717 | 3300025915 | Bacteria | 6528 |
| 208 | Ga0207693_10053863 | 3300025915 | Bacteria | 3157 |
| 209 | Ga0207693_10241507 | 3300025915 | Bacteria | 1418 |
| 210 | Ga0207663_10417254 | 3300025916 | Bacteria | 1029 |
| 211 | Ga0207660_10095217 | 3300025917 | Bacteria | 2215 |
| 212 | Ga0207657_10000784 | 3300025919 | Bacteria | 33773 |
| 213 | Ga0207657_10001921 | 3300025919 | Bacteria | 22438 |
| 214 | Ga0207652_10030541 | 3300025921 | Bacteria | 4513 |
| 215 | Ga0207652_10056039 | 3300025921 | Bacteria | 3392 |
| 216 | Ga0207659_10150696 | 3300025926 | Bacteria | 1816 |
| 217 | Ga0207687_10013817 | 3300025927 | Bacteria | 5273 |
| 218 | Ga0207687_10039262 | 3300025927 | Bacteria | 3241 |
| 219 | Ga0207687_10127151 | 3300025927 | Bacteria | 1915 |
| 220 | Ga0207700_10017514 | 3300025928 | Bacteria | 4788 |
| 221 | Ga0207700_10247910 | 3300025928 | Bacteria | 1520 |
| 222 | Ga0207700_10290213 | 3300025928 | Bacteria | 1410 |
| 223 | Ga0207664_10036404 | 3300025929 | Bacteria | 3805 |
| 224 | Ga0207664_10248450 | 3300025929 | Bacteria | 1552 |
| 225 | Ga0207644_10273179 | 3300025931 | Bacteria | 1355 |
| 226 | Ga0207706_10094861 | 3300025933 | Bacteria | 2625 |
| 227 | Ga0207669_10024600 | 3300025937 | Bacteria | 3239 |
| 228 | Ga0207669_10189885 | 3300025937 | Bacteria | 1481 |
| 229 | Ga0207665_10008093 | 3300025939 | Bacteria | 6940 |
| 230 | Ga0207665_10209643 | 3300025939 | Bacteria | 1423 |
| 231 | Ga0207691_10091630 | 3300025940 | Bacteria | 2723 |
| 232 | Ga0207691_10334804 | 3300025940 | Bacteria | 1296 |
| 233 | Ga0207711_10218197 | 3300025941 | Bacteria | 1744 |
| 234 | Ga0207711_10455833 | 3300025941 | Bacteria | 1190 |
| 235 | Ga0207689_10016212 | 3300025942 | Bacteria | 6311 |
| 236 | Ga0207661_10032763 | 3300025944 | Bacteria | 4029 |
| 237 | Ga0207661_10209337 | 3300025944 | Bacteria | 1718 |
| 238 | Ga0207679_10322682 | 3300025945 | Bacteria | 1338 |
| 239 | Ga0207667_10075059 | 3300025949 | Bacteria | 3511 |
| 240 | Ga0207667_10255570 | 3300025949 | Bacteria | 1792 |
| 241 | Ga0207667_10328928 | 3300025949 | Bacteria | 1560 |
| 242 | Ga0207712_10131990 | 3300025961 | Bacteria | 1905 |
| 243 | Ga0207668_10103257 | 3300025972 | Bacteria | 2122 |
| 244 | Ga0207677_10085737 | 3300026023 | Bacteria | 2274 |
| 245 | Ga0207703_10075271 | 3300026035 | Bacteria | 2797 |
| 246 | Ga0207639_10034763 | 3300026041 | Bacteria | 3727 |
| 247 | Ga0207678_10007958 | 3300026067 | Bacteria | 9348 |
| 248 | Ga0207678_10027287 | 3300026067 | Bacteria | 4979 |
| 249 | Ga0207678_10076754 | 3300026067 | Bacteria | 2862 |
| 250 | Ga0207678_10084268 | 3300026067 | Bacteria | 2718 |
| 251 | Ga0207678_10099919 | 3300026067 | Bacteria | 2478 |
| 252 | Ga0207678_10137238 | 3300026067 | Bacteria | 2087 |
| 253 | Ga0207702_10000442 | 3300026078 | Bacteria | 47074 |
| 254 | Ga0207702_10507371 | 3300026078 | Bacteria | 1176 |
| 255 | Ga0207641_10291004 | 3300026088 | Bacteria | 1540 |
| 256 | Ga0207641_10341726 | 3300026088 | Bacteria | 1425 |
| 257 | Ga0207676_10057929 | 3300026095 | Bacteria | 3053 |
| 258 | Ga0207675_100131335 | 3300026118 | Bacteria | 2375 |
| 259 | Ga0207675_100685634 | 3300026118 | Bacteria | 1033 |
| 260 | Ga0207683_10045508 | 3300026121 | Bacteria | 3838 |
| 261 | Ga0207683_10099403 | 3300026121 | Bacteria | 2597 |
| 262 | Ga0207683_10130722 | 3300026121 | Bacteria | 2258 |
| 263 | Ga0207683_10302139 | 3300026121 | Bacteria | 1464 |
| 264 | Ga0207698_10115013 | 3300026142 | Bacteria | 2264 |
| 265 | Ga0207698_10188264 | 3300026142 | Bacteria | 1835 |
| 266 | Ga0207698_10456806 | 3300026142 | Bacteria | 1234 |
| 267 | Ga0209389_1000008 | 3300027296 | Bacteria | 227385 |
| 268 | Ga0209389_1000121 | 3300027296 | Bacteria | 70490 |
| 269 | Ga0209589_1002735 | 3300027357 | Bacteria | 30739 |
| 270 | Ga0209489_101490 | 3300027361 | Bacteria | 48185 |
| 271 | Ga0209489_103445 | 3300027361 | Bacteria | 30849 |
| 272 | Ga0209700_100036 | 3300027363 | Bacteria | 187888 |
| 273 | Ga0209179_1017416 | 3300027512 | Bacteria | 1361 |
| 274 | Ga0268266_10008371 | 3300028379 | Bacteria | 9197 |
| 275 | Ga0268266_10151361 | 3300028379 | Bacteria | 2091 |
| 276 | Ga0268266_10479226 | 3300028379 | Bacteria | 1186 |
| 277 | Ga0268265_10097945 | 3300028380 | Bacteria | 2361 |
| 278 | Ga0268265_10130921 | 3300028380 | Bacteria | 2084 |
| 279 | Ga0268265_10566576 | 3300028380 | Bacteria | 1080 |
| 280 | Ga0268264_10041134 | 3300028381 | Bacteria | 3821 |
| 281 | Ga0268264_10268499 | 3300028381 | Bacteria | 1593 |
| 282 | Ga0265337_1012538 | 3300028556 | Bacteria | 2877 |
| 283 | Ga0265326_10002188 | 3300028558 | Bacteria | 6631 |
| 284 | Ga0265319_1025553 | 3300028563 | Bacteria | 2112 |
| 285 | Ga0265334_10002607 | 3300028573 | Bacteria | 8406 |
| 286 | Ga0265323_10006127 | 3300028653 | Bacteria | 5075 |
| 287 | Ga0265322_10002310 | 3300028654 | Bacteria | 5913 |
| 288 | Ga0265336_10001608 | 3300028666 | Bacteria | 10074 |
| 289 | Ga0307515_10259502 | 3300028794 | Bacteria | 1476 |
| 290 | Ga0265338_10000667 | 3300028800 | Bacteria | 59318 |
| 291 | Ga0265324_10003760 | 3300029957 | Bacteria | 7088 |
| 292 | Ga0307511_10037393 | 3300030521 | Bacteria | 4193 |
| 293 | Ga0265330_10042024 | 3300031235 | Bacteria | 2026 |
| 294 | Ga0265330_10043768 | 3300031235 | Bacteria | 1979 |
| 295 | Ga0265332_10035696 | 3300031238 | Bacteria | 2159 |
| 296 | Ga0265332_10046119 | 3300031238 | Bacteria | 1877 |
| 297 | Ga0265325_10007037 | 3300031241 | Bacteria | 6782 |
| 298 | Ga0265340_10001939 | 3300031247 | Bacteria | 11822 |
| 299 | Ga0265339_10007152 | 3300031249 | Bacteria | 7244 |
| 300 | Ga0265339_10033648 | 3300031249 | Bacteria | 2885 |
| 301 | Ga0265331_10027187 | 3300031250 | Bacteria | 2870 |
| 302 | Ga0265316_10040807 | 3300031344 | Bacteria | 3719 |
| 303 | Ga0265316_10049430 | 3300031344 | Bacteria | 3313 |
| 304 | Ga0265316_10275781 | 3300031344 | Bacteria | 1230 |
| 305 | Ga0307513_10341525 | 3300031456 | Bacteria | 1248 |
| 306 | Ga0307509_10021973 | 3300031507 | Bacteria | 7203 |
| 307 | Ga0307509_10048183 | 3300031507 | Bacteria | 4578 |
| 308 | Ga0307509_10115985 | 3300031507 | Bacteria | 2668 |
| 309 | Ga0307509_10443253 | 3300031507 | Bacteria | 994 |
| 310 | Ga0307508_10000010 | 3300031616 | Bacteria | 255747 |
| 311 | Ga0307508_10058073 | 3300031616 | Bacteria | 3424 |
| 312 | Ga0307508_10141390 | 3300031616 | Bacteria | 2011 |
| 313 | Ga0307508_10239049 | 3300031616 | Bacteria | 1414 |
| 314 | Ga0307508_10309890 | 3300031616 | Bacteria | 1171 |
| 315 | Ga0265342_10011179 | 3300031712 | Bacteria | 6160 |
| 316 | Ga0265342_10042235 | 3300031712 | Bacteria | 2756 |
| 317 | Ga0265342_10077343 | 3300031712 | Bacteria | 1927 |
| 318 | Ga0307516_10067904 | 3300031730 | Bacteria | 3434 |
| 319 | Ga0307516_10083248 | 3300031730 | Bacteria | 3041 |
| 320 | Ga0307516_10329853 | 3300031730 | Bacteria | 1195 |
| 321 | Ga0307412_10029689 | 3300031911 | Bacteria | 3434 |
| 322 | Ga0307416_100380139 | 3300032002 | Bacteria | 1442 |
| 323 | Ga0307415_100019128 | 3300032126 | Bacteria | 4152 |
| 324 | Ga0307507_10019430 | 3300033179 | Bacteria | 7651 |
| 325 | Ga0307510_10006860 | 3300033180 | Bacteria | 13587 |
| 326 | Ga0307510_10039226 | 3300033180 | Bacteria | 5221 |
| 327 | Ga0307510_10040547 | 3300033180 | Bacteria | 5110 |
| 328 | Ga0307510_10082351 | 3300033180 | Bacteria | 3114 |
| 329 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 330 | Ga0373934_0001152 | 3300035086 | Bacteria | 9636 |
| 331 | Ga0373944_0049829 | 3300035089 | Bacteria | 1317 |
| 332 | Ga0373923_0045255 | 3300035111 | Bacteria | 1827 |
| 333 | Ga0373923_0084259 | 3300035111 | Bacteria | 1382 |
| 334 | Ga0373936_0002224 | 3300035113 | Bacteria | 7245 |
| 335 | Ga0373945_0019944 | 3300035116 | Bacteria | 2292 |
| 336 | Ga0373953_0015420 | 3300035117 | Bacteria | 2769 |
| 337 | Ga0373953_0046250 | 3300035117 | Bacteria | 1747 |
| 338 | Ga0373953_0157161 | 3300035117 | Bacteria | 976 |
| 339 | Ga0373954_0000976 | 3300035118 | Bacteria | 11241 |
| 340 | Ga0373956_0011303 | 3300035119 | Bacteria | 3677 |
| 341 | Ga0373956_0104783 | 3300035119 | Bacteria | 1314 |
| 342 | Ga0373957_0036311 | 3300035120 | Bacteria | 1835 |
| 343 | Ga0373943_0008520 | 3300035170 | Bacteria | 4599 |
| 344 | Ga0373943_0026179 | 3300035170 | Bacteria | 2731 |
| 345 | Ga0373943_0058452 | 3300035170 | Bacteria | 1919 |
| 346 | Ga0373946_0022683 | 3300035171 | Bacteria | 2446 |
| 347 | Ga0373955_0000198 | 3300035172 | Bacteria | 24944 |
| 348 | Ga0373931_0310314 | 3300035691 | Bacteria | 977 |
| 349 | Ga0373935_0426267 | 3300035692 | Bacteria | 955 |
| 350 | Ga0373927_0011994 | 3300035695 | Bacteria | 5765 |
| 351 | Ga0373927_0012818 | 3300035695 | Bacteria | 5576 |
| 352 | Ga0373927_0055937 | 3300035695 | Bacteria | 2550 |
| 353 | Ga0373927_0190737 | 3300035695 | Bacteria | 1345 |
| 354 | Ga0373927_0235662 | 3300035695 | Bacteria | 1202 |
| 355 | Ga0373933_0000274 | 3300035724 | Bacteria | 33544 |
| 356 | Ga0373933_0000475 | 3300035724 | Bacteria | 25100 |
| 357 | Ga0373933_0121136 | 3300035724 | Bacteria | 1638 |
| 358 | Ga0373933_0154998 | 3300035724 | Bacteria | 1452 |
| 359 | Ga0373947_0008223 | 3300035725 | Bacteria | 6015 |
| 360 | Ga0373947_0040403 | 3300035725 | Bacteria | 2778 |
| 361 | Ga0373947_0113970 | 3300035725 | Bacteria | 1711 |
| 362 | Ga0373937_0008251 | 3300036401 | Bacteria | 9043 |
| 363 | Ga0373937_0123251 | 3300036401 | Bacteria | 2416 |
| 364 | Ga0373937_0208030 | 3300036401 | Bacteria | 1840 |
| 365 | Ga0372808_001374 | 3300036459 | Bacteria | 2501 |
| 366 | Ga0373925_0003636 | 3300037068 | Bacteria | 11883 |
| 367 | Ga0373925_0085716 | 3300037068 | Bacteria | 2401 |
| 368 | Ga0373925_0366846 | 3300037068 | Bacteria | 1171 |
| 369 | Ga0395900_0000361 | 3300037418 | Bacteria | 65918 |
| 370 | Ga0395900_0220524 | 3300037418 | Bacteria | 1912 |
| 371 | Ga0395905_0003578 | 3300037471 | Bacteria | 16545 |
| 372 | Ga0395905_0175451 | 3300037471 | Bacteria | 2012 |
| 373 | Ga0395905_0385997 | 3300037471 | Bacteria | 1295 |
| 374 | Ga0395901_0113630 | 3300038443 | Bacteria | 2844 |
| 375 | Ga0395901_0150364 | 3300038443 | Bacteria | 2447 |
| 376 | Ga0395901_0436459 | 3300038443 | Bacteria | 1341 |
| 377 | Ga0436365_1361494 | 3300039437 | Bacteria | 15892 |
| 378 | Ga0436365_1556838 | 3300039437 | Bacteria | 2735 |
| 379 | Ga0436360_0623528 | 3300039438 | Bacteria | 2229 |
| 380 | Ga0436360_0700607 | 3300039438 | Bacteria | 2608 |
| 381 | Ga0436361_0266153 | 3300039447 | Bacteria | 2518 |
| 382 | Ga0466972_0000271 | 3300044658 | Bacteria | 32697 |
| 383 | Ga0466972_0034153 | 3300044658 | Bacteria | 2493 |
| 384 | Ga0466965_0072568 | 3300044683 | Bacteria | 1732 |
| 385 | Ga0466966_0004743 | 3300044684 | Bacteria | 8946 |
| 386 | Ga0466961_0000859 | 3300044693 | Bacteria | 18957 |
| 387 | Ga0466963_0104753 | 3300044694 | Bacteria | 1938 |
| 388 | Ga0466964_0224184 | 3300044706 | Bacteria | 914 |
| 389 | Ga0466968_0008864 | 3300044735 | Bacteria | 3860 |
| 390 | Ga0466968_0152469 | 3300044735 | Bacteria | 1063 |
| 391 | Ga0466957_0026509 | 3300044842 | Bacteria | 3439 |
| 392 | Ga0466967_0038874 | 3300045976 | Bacteria | 4084 |
| 393 | Ga0495592_0007563 | 3300046454 | Bacteria | 8138 |
| 394 | Ga0495603_0000676 | 3300046455 | Bacteria | 19328 |
| 395 | Ga0495603_0038325 | 3300046455 | Bacteria | 2874 |
| 396 | Ga0495603_0042593 | 3300046455 | Bacteria | 2713 |
| 397 | Ga0495603_0068162 | 3300046455 | Bacteria | 2093 |
| 398 | Ga0495603_0170693 | 3300046455 | Bacteria | 1260 |
| 399 | Ga0495590_0098334 | 3300046457 | Bacteria | 1039 |
| 400 | Ga0495629_0000176 | 3300046459 | Bacteria | 56922 |
| 401 | Ga0495629_0003088 | 3300046459 | Bacteria | 12634 |
| 402 | Ga0495629_0099781 | 3300046459 | Bacteria | 2026 |
| 403 | Ga0495638_0020391 | 3300046460 | Bacteria | 4381 |
| 404 | Ga0495638_0068357 | 3300046460 | Bacteria | 2178 |
| 405 | Ga0495641_0008578 | 3300046461 | Bacteria | 6198 |
| 406 | Ga0495641_0151142 | 3300046461 | Bacteria | 1038 |
| 407 | Ga0495651_0002298 | 3300046462 | Bacteria | 14746 |
| 408 | Ga0495653_0004529 | 3300046463 | Bacteria | 11230 |
| 409 | Ga0495580_0009272 | 3300046472 | Bacteria | 7744 |
| 410 | Ga0495580_0069423 | 3300046472 | Bacteria | 2462 |
| 411 | Ga0495582_0060986 | 3300046473 | Bacteria | 2082 |
| 412 | Ga0495639_0000726 | 3300046475 | Bacteria | 15095 |
| 413 | Ga0495639_0022248 | 3300046475 | Bacteria | 2780 |
| 414 | Ga0495639_0031217 | 3300046475 | Bacteria | 2371 |
| 415 | Ga0495662_0000028 | 3300046476 | Bacteria | 51556 |
| 416 | Ga0495662_0236814 | 3300046476 | Bacteria | 900 |
| 417 | Ga0495664_0025560 | 3300046477 | Bacteria | 3439 |
| 418 | Ga0495664_0033761 | 3300046477 | Bacteria | 3008 |
| 419 | Ga0495664_0033832 | 3300046477 | Bacteria | 3005 |
| 420 | Ga0495585_0110741 | 3300046492 | Bacteria | 1460 |
| 421 | Ga0495594_0000020 | 3300046499 | Bacteria | 80534 |
| 422 | Ga0495594_0083293 | 3300046499 | Bacteria | 1788 |
| 423 | Ga0495607_0125654 | 3300046501 | Bacteria | 1341 |
| 424 | Ga0495583_0061413 | 3300046506 | Bacteria | 1677 |
| 425 | Ga0495606_0106731 | 3300046507 | Bacteria | 1695 |
| 426 | Ga0495606_0182250 | 3300046507 | Bacteria | 1210 |
| 427 | Ga0495610_0091201 | 3300046512 | Bacteria | 1381 |
| 428 | Ga0495618_0213140 | 3300046514 | Bacteria | 1220 |
| 429 | Ga0495618_0296462 | 3300046514 | Bacteria | 1005 |
| 430 | Ga0495620_0026112 | 3300046515 | Bacteria | 2751 |
| 431 | Ga0495628_0004786 | 3300046516 | Bacteria | 11931 |
| 432 | Ga0495628_0074309 | 3300046516 | Bacteria | 2648 |
| 433 | Ga0495628_0114472 | 3300046516 | Bacteria | 2072 |
| 434 | Ga0495630_0002476 | 3300046517 | Bacteria | 12804 |
| 435 | Ga0495630_0225061 | 3300046517 | Bacteria | 1432 |
| 436 | Ga0495630_0439927 | 3300046517 | Bacteria | 999 |
| 437 | Ga0495632_0008927 | 3300046519 | Bacteria | 6088 |
| 438 | Ga0495644_0070482 | 3300046523 | Bacteria | 1313 |
| 439 | Ga0495648_0002422 | 3300046524 | Bacteria | 17288 |
| 440 | Ga0495648_0008933 | 3300046524 | Bacteria | 7831 |
| 441 | Ga0495648_0065300 | 3300046524 | Bacteria | 2140 |
| 442 | Ga0495648_0079826 | 3300046524 | Bacteria | 1866 |
| 443 | Ga0495666_0030178 | 3300046526 | Bacteria | 2663 |
| 444 | Ga0495652_0004769 | 3300046529 | Bacteria | 12904 |
| 445 | Ga0495652_0063452 | 3300046529 | Bacteria | 3110 |
| 446 | Ga0495652_0120212 | 3300046529 | Bacteria | 2097 |
| 447 | Ga0495654_0070787 | 3300046530 | Bacteria | 1653 |
| 448 | Ga0495665_0000057 | 3300046531 | Bacteria | 44876 |
| 449 | Ga0495665_0065399 | 3300046531 | Bacteria | 1919 |
| 450 | Ga0495640_0001533 | 3300046533 | Bacteria | 18200 |
| 451 | Ga0495640_0012355 | 3300046533 | Bacteria | 6527 |
| 452 | Ga0495640_0064317 | 3300046533 | Bacteria | 2481 |
| 453 | Ga0495586_0158752 | 3300046535 | Bacteria | 1275 |
| 454 | Ga0495587_0000736 | 3300046536 | Bacteria | 21940 |
| 455 | Ga0495587_0044061 | 3300046536 | Bacteria | 2655 |
| 456 | Ga0495609_0107403 | 3300046538 | Bacteria | 1206 |
| 457 | Ga0495645_0061248 | 3300046543 | Bacteria | 2727 |
| 458 | Ga0495622_0001520 | 3300046557 | Bacteria | 11590 |
| 459 | Ga0495622_0046695 | 3300046557 | Bacteria | 2012 |
| 460 | Ga0495622_0139824 | 3300046557 | Bacteria | 1100 |
| 461 | Ga0495667_0000319 | 3300046559 | Bacteria | 30374 |
| 462 | Ga0495667_0020907 | 3300046559 | Bacteria | 4417 |
| 463 | Ga0495667_0036184 | 3300046559 | Bacteria | 3296 |
| 464 | Ga0495656_0047350 | 3300046615 | Bacteria | 1823 |
| 465 | Ga0495656_0065840 | 3300046615 | Bacteria | 1594 |
| 466 | Ga0495668_0025829 | 3300046616 | Bacteria | 3336 |
| 467 | Ga0495668_0089991 | 3300046616 | Bacteria | 1681 |
| 468 | Ga0495634_0010828 | 3300046642 | Bacteria | 6668 |
| 469 | Ga0495634_0030256 | 3300046642 | Bacteria | 3741 |
| 470 | Ga0495634_0037223 | 3300046642 | Bacteria | 3326 |
| 471 | Ga0495634_0077148 | 3300046642 | Bacteria | 2186 |
| 472 | Ga0495611_0162168 | 3300046648 | Bacteria | 1045 |
| 473 | Ga0495625_0216748 | 3300046660 | Bacteria | 1256 |
| 474 | Ga0495635_0004372 | 3300046663 | Bacteria | 9784 |
| 475 | Ga0495635_0005161 | 3300046663 | Bacteria | 9091 |
| 476 | Ga0495635_0008850 | 3300046663 | Bacteria | 7027 |
| 477 | Ga0495635_0049438 | 3300046663 | Bacteria | 2898 |
| 478 | Ga0495635_0112460 | 3300046663 | Bacteria | 1860 |
| 479 | Ga0495661_0100617 | 3300046665 | Bacteria | 1627 |
| 480 | Ga0495588_0104249 | 3300046674 | Bacteria | 1492 |
| 481 | Ga0495588_0260481 | 3300046674 | Bacteria | 914 |
| 482 | Ga0495657_0001557 | 3300046675 | Bacteria | 19730 |
| 483 | Ga0495657_0044896 | 3300046675 | Bacteria | 3001 |
| 484 | Ga0495599_0001378 | 3300046678 | Bacteria | 13874 |
| 485 | Ga0495623_0008240 | 3300046679 | Bacteria | 6779 |
| 486 | Ga0495623_0010692 | 3300046679 | Bacteria | 5941 |
| 487 | Ga0495646_0013387 | 3300046680 | Bacteria | 5214 |
| 488 | Ga0495646_0016906 | 3300046680 | Bacteria | 4632 |
| 489 | Ga0495646_0061905 | 3300046680 | Bacteria | 2227 |
| 490 | Ga0495647_0038207 | 3300046681 | Bacteria | 1814 |
| 491 | Ga0495658_0003230 | 3300046683 | Bacteria | 8117 |
| 492 | Ga0495669_0049317 | 3300046684 | Bacteria | 1885 |
| 493 | Ga0495613_0013818 | 3300046689 | Bacteria | 5990 |
| 494 | Ga0495613_0076840 | 3300046689 | Bacteria | 2429 |
| 495 | Ga0495613_0197209 | 3300046689 | Bacteria | 1421 |
| 496 | Ga0495624_0007826 | 3300046690 | Bacteria | 7500 |
| 497 | Ga0495624_0054083 | 3300046690 | Bacteria | 2532 |
| 498 | Ga0495670_0029296 | 3300046691 | Bacteria | 2732 |
| 499 | Ga0495671_0024554 | 3300046692 | Bacteria | 3138 |
| 500 | Ga0495649_0093270 | 3300046694 | Bacteria | 1603 |
| 501 | Ga0495649_0144741 | 3300046694 | Bacteria | 1250 |
| 502 | Ga0495600_0000314 | 3300046809 | Bacteria | 25635 |
| 503 | Ga0495600_0047739 | 3300046809 | Bacteria | 2793 |
| 504 | Ga0495600_0092078 | 3300046809 | Bacteria | 1977 |
| 505 | Ga0495660_0059610 | 3300046810 | Bacteria | 2052 |
| 506 | Ga0495581_0004028 | 3300047315 | Bacteria | 8459 |
| 507 | Ga0495581_0183760 | 3300047315 | Bacteria | 1223 |
| 508 | Ga0495581_0305498 | 3300047315 | Bacteria | 930 |
| 509 | Ga0495604_0001137 | 3300047317 | Bacteria | 22068 |
| 510 | Ga0495604_0019823 | 3300047317 | Bacteria | 5379 |
| 511 | Ga0495604_0160501 | 3300047317 | Bacteria | 1589 |
| 512 | Ga0495604_0202051 | 3300047317 | Bacteria | 1378 |
| 513 | Ga0495604_0255091 | 3300047317 | Bacteria | 1194 |
| 514 | Ga0495674_0049164 | 3300047319 | Bacteria | 3727 |
| 515 | Ga0495674_0099458 | 3300047319 | Bacteria | 2476 |
| 516 | Ga0495672_0105469 | 3300047320 | Bacteria | 1521 |
| 517 | Ga0495672_0186351 | 3300047320 | Bacteria | 1047 |
| 518 | Ga0495676_0019882 | 3300047321 | Bacteria | 5902 |
| 519 | Ga0495680_0002499 | 3300047322 | Bacteria | 18805 |
| 520 | Ga0495680_0019888 | 3300047322 | Bacteria | 5659 |
| 521 | Ga0495680_0320383 | 3300047322 | Bacteria | 1085 |
| 522 | Ga0495683_0110634 | 3300047323 | Bacteria | 1312 |
| 523 | Ga0495683_0143013 | 3300047323 | Bacteria | 1119 |
| 524 | Ga0495675_0002364 | 3300047444 | Bacteria | 11266 |
| 525 | Ga0495684_0000023 | 3300047471 | Bacteria | 133626 |
| 526 | Ga0495593_0000165 | 3300047673 | Bacteria | 33774 |
| 527 | Ga0495593_0047522 | 3300047673 | Bacteria | 2282 |
| 528 | Ga0495602_0084652 | 3300048088 | Bacteria | 2652 |
| 529 | Ga0495614_0026074 | 3300048089 | Bacteria | 2519 |
| 530 | Ga0495626_0035390 | 3300048091 | Bacteria | 2383 |
| 531 | Ga0496101_0003066 | 3300048904 | Bacteria | 10322 |
| 532 | Ga0496101_0302781 | 3300048904 | Bacteria | 1252 |
| 533 | Ga0496102_0004610 | 3300048905 | Bacteria | 11664 |
| 534 | Ga0496102_0103280 | 3300048905 | Bacteria | 2651 |
| 535 | Ga0496102_0256717 | 3300048905 | Bacteria | 1648 |
| 536 | Ga0496103_0022889 | 3300048906 | Bacteria | 3765 |
| 537 | Ga0496103_0049381 | 3300048906 | Bacteria | 2601 |
| 538 | Ga0496103_0213173 | 3300048906 | Bacteria | 1242 |
| 539 | Ga0496104_0007966 | 3300048907 | Bacteria | 9396 |
| 540 | Ga0496104_0071427 | 3300048907 | Bacteria | 3300 |
| 541 | Ga0496104_0074057 | 3300048907 | Bacteria | 3241 |
| 542 | Ga0496104_0226744 | 3300048907 | Bacteria | 1781 |
| 543 | Ga0496104_0381733 | 3300048907 | Bacteria | 1322 |
| 544 | Ga0496106_0000363 | 3300048909 | Bacteria | 32218 |
| 545 | Ga0496106_0002373 | 3300048909 | Bacteria | 14021 |
| 546 | Ga0496106_0018324 | 3300048909 | Bacteria | 5174 |
| 547 | Ga0496106_0071551 | 3300048909 | Bacteria | 2651 |
| 548 | Ga0496106_0140522 | 3300048909 | Bacteria | 1899 |
| 549 | Ga0496107_0004064 | 3300048910 | Bacteria | 9851 |
| 550 | Ga0496107_0288385 | 3300048910 | Bacteria | 1222 |
| 551 | Ga0496107_0303768 | 3300048910 | Bacteria | 1188 |
| 552 | Ga0496108_0001361 | 3300048911 | Bacteria | 19211 |
| 553 | Ga0496108_0053812 | 3300048911 | Bacteria | 3376 |
| 554 | Ga0496108_0248371 | 3300048911 | Bacteria | 1548 |
| 555 | Ga0496108_0271839 | 3300048911 | Bacteria | 1475 |
| 556 | Ga0496108_0319094 | 3300048911 | Bacteria | 1355 |
| 557 | Ga0496109_0000909 | 3300048912 | Bacteria | 24642 |
| 558 | Ga0496109_0078162 | 3300048912 | Bacteria | 3046 |
| 559 | Ga0496109_0094294 | 3300048912 | Bacteria | 2770 |
| 560 | Ga0496109_0199666 | 3300048912 | Bacteria | 1880 |
| 561 | Ga0496110_0174928 | 3300048913 | Bacteria | 1948 |
| 562 | Ga0496110_0449639 | 3300048913 | Bacteria | 1174 |
| 563 | Ga0496110_0601561 | 3300048913 | Bacteria | 997 |
| 564 | Ga0496111_0032439 | 3300048914 | Bacteria | 3724 |
| 565 | Ga0496111_0035156 | 3300048914 | Bacteria | 3580 |
| 566 | Ga0496111_0046548 | 3300048914 | Bacteria | 3123 |
| 567 | Ga0496111_0222257 | 3300048914 | Bacteria | 1403 |
| 568 | Ga0496112_0022560 | 3300048915 | Bacteria | 5999 |
| 569 | Ga0496112_0124984 | 3300048915 | Bacteria | 2543 |
| 570 | Ga0496112_0139351 | 3300048915 | Bacteria | 2395 |
| 571 | Ga0496113_0046939 | 3300048916 | Bacteria | 3208 |
| 572 | Ga0496113_0072569 | 3300048916 | Bacteria | 2620 |
| 573 | Ga0496113_0211950 | 3300048916 | Bacteria | 1542 |
| 574 | Ga0496113_0236834 | 3300048916 | Bacteria | 1456 |
| 575 | Ga0496114_0008017 | 3300048917 | Bacteria | 8359 |
| 576 | Ga0496114_0047001 | 3300048917 | Bacteria | 3588 |
| 577 | Ga0496114_0086673 | 3300048917 | Bacteria | 2654 |
| 578 | Ga0496114_0331126 | 3300048917 | Bacteria | 1346 |
| 579 | Ga0496115_0000713 | 3300048918 | Bacteria | 24637 |
| 580 | Ga0496115_0055903 | 3300048918 | Bacteria | 3171 |
| 581 | Ga0496115_0221328 | 3300048918 | Bacteria | 1562 |
| 582 | Ga0496116_0001984 | 3300048919 | Bacteria | 22042 |
| 583 | Ga0496116_0090520 | 3300048919 | Bacteria | 1862 |
| 584 | Ga0496116_0094575 | 3300048919 | Bacteria | 1806 |
| 585 | Ga0496116_0144228 | 3300048919 | Bacteria | 1334 |
| 586 | Ga0496117_0031332 | 3300048920 | Bacteria | 4062 |
| 587 | Ga0496117_0116874 | 3300048920 | Bacteria | 1648 |
| 588 | Ga0496118_0002080 | 3300048921 | Bacteria | 28152 |
| 589 | Ga0496118_0034985 | 3300048921 | Bacteria | 4087 |
| 590 | Ga0496118_0036790 | 3300048921 | Bacteria | 3951 |
| 591 | Ga0496118_0037535 | 3300048921 | Bacteria | 3897 |
| 592 | Ga0496119_0034349 | 3300048922 | Bacteria | 3343 |
| 593 | Ga0496119_0064294 | 3300048922 | Bacteria | 2179 |
| 594 | Ga0496119_0070653 | 3300048922 | Bacteria | 2047 |
| 595 | Ga0496119_0083315 | 3300048922 | Bacteria | 1837 |
| 596 | Ga0496120_0103576 | 3300048923 | Bacteria | 1499 |
| 597 | Ga0496121_0000183 | 3300048924 | Bacteria | 139168 |
| 598 | Ga0496121_0000407 | 3300048924 | Bacteria | 85728 |
| 599 | Ga0496121_0011644 | 3300048924 | Bacteria | 9724 |
| 600 | Ga0496121_0020343 | 3300048924 | Bacteria | 6578 |
| 601 | Ga0496121_0023725 | 3300048924 | Bacteria | 5895 |
| 602 | Ga0496121_0048678 | 3300048924 | Bacteria | 3604 |
| 603 | Ga0496121_0092384 | 3300048924 | Bacteria | 2359 |
| 604 | Ga0496121_0213735 | 3300048924 | Bacteria | 1364 |
| 605 | Ga0496122_0096872 | 3300048925 | Bacteria | 1987 |
| 606 | Ga0496123_0035502 | 3300048926 | Bacteria | 3550 |
| 607 | Ga0496124_0040801 | 3300048927 | Bacteria | 4011 |
| 608 | Ga0496124_0054405 | 3300048927 | Bacteria | 3388 |
| 609 | Ga0496124_0066590 | 3300048927 | Bacteria | 2999 |
| 610 | Ga0496124_0141584 | 3300048927 | Bacteria | 1897 |
| 611 | Ga0496125_0001713 | 3300048928 | Bacteria | 30526 |
| 612 | Ga0496125_0022884 | 3300048928 | Bacteria | 5789 |
| 613 | Ga0496125_0045885 | 3300048928 | Bacteria | 3672 |
| 614 | Ga0496125_0082701 | 3300048928 | Bacteria | 2446 |
| 615 | Ga0496125_0090461 | 3300048928 | Bacteria | 2297 |
| 616 | Ga0496125_0149418 | 3300048928 | Bacteria | 1608 |
| 617 | Ga0496125_0237108 | 3300048928 | Bacteria | 1161 |
| 618 | Ga0496126_0001554 | 3300048929 | Bacteria | 35268 |
| 619 | Ga0496126_0008974 | 3300048929 | Bacteria | 10702 |
| 620 | Ga0496126_0043018 | 3300048929 | Bacteria | 4169 |
| 621 | Ga0496126_0049954 | 3300048929 | Bacteria | 3815 |
| 622 | Ga0496126_0057751 | 3300048929 | Bacteria | 3501 |
| 623 | Ga0496126_0123540 | 3300048929 | Bacteria | 2242 |
| 624 | Ga0496126_0160575 | 3300048929 | Bacteria | 1921 |
| 625 | Ga0496126_0180188 | 3300048929 | Bacteria | 1795 |
| 626 | Ga0496126_0222329 | 3300048929 | Bacteria | 1585 |
| 627 | Ga0496126_0305602 | 3300048929 | Bacteria | 1311 |
| 628 | Ga0496126_0329531 | 3300048929 | Bacteria | 1253 |
| 629 | Ga0501046_0175110 | 3300049580 | Bacteria | 1607 |
| 630 | Ga0501047_0007147 | 3300049581 | Bacteria | 10488 |
| 631 | Ga0501070_0185250 | 3300049586 | Bacteria | 1712 |
| 632 | Ga0501073_0107798 | 3300049589 | Bacteria | 1933 |
| 633 | Ga0501074_0013775 | 3300049590 | Bacteria | 5881 |
| 634 | Ga0501080_0031077 | 3300049742 | Bacteria | 4976 |
| 635 | Ga0501044_0081836 | 3300049823 | Bacteria | 3268 |
| 636 | Ga0501044_0100775 | 3300049823 | Bacteria | 2906 |
| 637 | nmdc:mga03683_109803_c1 | 3300050489 | Bacteria | 1218 |
| 638 | nmdc:mga0yw44_142961_c1 | 3300050492 | Bacteria | 1556 |
| 639 | nmdc:mga0yw44_171584_c1 | 3300050492 | Bacteria | 1424 |
| 640 | nmdc:mga0yw44_24388_c1 | 3300050492 | Bacteria | 3422 |
| 641 | nmdc:mga0yw44_3414_c1 | 3300050492 | Bacteria | 7052 |
| 642 | nmdc:mga07m45_185483_c1 | 3300050496 | Bacteria | 1210 |
| 643 | nmdc:mga08y16_461879_c1 | 3300050511 | Bacteria | 1294 |
| 644 | nmdc:mga0n895_59753_c1 | 3300050512 | Bacteria | 3761 |
| 645 | nmdc:mga0sz30_161223_c1 | 3300050516 | Bacteria | 994 |
| 646 | nmdc:mga0sz30_40090_c1 | 3300050516 | Bacteria | 1968 |
| 647 | Ga0495601_0085798 | 3300053077 | Bacteria | 2023 |
| 648 | Ga0495612_0023453 | 3300053078 | Bacteria | 2476 |
| 649 | Ga0495655_0014809 | 3300053083 | Bacteria | 1644 |
| 650 | Ga0495595_0004910 | 3300053084 | Bacteria | 5395 |
| 651 | Ga0495619_0000111 | 3300053085 | Bacteria | 61304 |
| 652 | Ga0500578_0046581 | 3300053086 | Bacteria | 2782 |
| 653 | Ga0500578_0092145 | 3300053086 | Bacteria | 1923 |
| 654 | Ga0500643_000015 | 3300053087 | Bacteria | 310312 |
| 655 | Ga0500646_0011629 | 3300053090 | Bacteria | 2265 |
| 656 | Ga0500647_0079290 | 3300053091 | Bacteria | 1575 |
| 657 | Ga0500647_0148107 | 3300053091 | Bacteria | 1097 |
| 658 | Ga0500583_0135099 | 3300053092 | Bacteria | 1224 |
| 659 | Ga0500651_0061510 | 3300053093 | Bacteria | 2345 |
| 660 | Ga0500651_0142764 | 3300053093 | Bacteria | 1442 |
| 661 | Ga0500566_0000028 | 3300053094 | Bacteria | 75589 |
| 662 | Ga0500566_0000249 | 3300053094 | Bacteria | 28873 |
| 663 | Ga0500566_0006790 | 3300053094 | Bacteria | 6779 |
| 664 | Ga0500640_004300 | 3300053095 | Bacteria | 5154 |
| 665 | Ga0500650_0019054 | 3300053098 | Bacteria | 2987 |
| 666 | Ga0500650_0119589 | 3300053098 | Bacteria | 1228 |
| 667 | Ga0500650_0156994 | 3300053098 | Bacteria | 1050 |
| 668 | Ga0500555_003873 | 3300053103 | Bacteria | 4258 |
| 669 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 670 | Ga0500556_0018026 | 3300053104 | Bacteria | 2221 |
| 671 | Ga0500557_000110 | 3300053105 | Bacteria | 23691 |
| 672 | Ga0500569_002795 | 3300053109 | Bacteria | 3482 |
| 673 | Ga0500572_000420 | 3300053111 | Bacteria | 14884 |
| 674 | Ga0500572_001411 | 3300053111 | Bacteria | 6595 |
| 675 | Ga0500572_052979 | 3300053111 | Bacteria | 1214 |
| 676 | Ga0500592_002327 | 3300053116 | Bacteria | 3064 |
| 677 | Ga0500595_015597 | 3300053119 | Bacteria | 2848 |
| 678 | Ga0500595_021757 | 3300053119 | Bacteria | 2284 |
| 679 | Ga0500595_027140 | 3300053119 | Bacteria | 1964 |
| 680 | Ga0500595_033960 | 3300053119 | Bacteria | 1690 |
| 681 | Ga0500595_034530 | 3300053119 | Bacteria | 1672 |
| 682 | Ga0500595_034855 | 3300053119 | Bacteria | 1661 |
| 683 | Ga0500595_047635 | 3300053119 | Bacteria | 1342 |
| 684 | Ga0500608_008414 | 3300053122 | Bacteria | 4334 |
| 685 | Ga0500608_040527 | 3300053122 | Bacteria | 2233 |
| 686 | Ga0500614_007020 | 3300053123 | Bacteria | 2369 |
| 687 | Ga0500618_009095 | 3300053125 | Bacteria | 2731 |
| 688 | Ga0500642_0000036 | 3300053130 | Bacteria | 104249 |
| 689 | Ga0500642_0000086 | 3300053130 | Bacteria | 48427 |
| 690 | Ga0500642_0091684 | 3300053130 | Bacteria | 1405 |
| 691 | Ga0500652_000837 | 3300053131 | Bacteria | 10198 |
| 692 | Ga0500559_0000154 | 3300053136 | Bacteria | 54106 |
| 693 | Ga0500559_0003041 | 3300053136 | Bacteria | 8382 |
| 694 | Ga0500559_0004402 | 3300053136 | Bacteria | 6694 |
| 695 | Ga0500559_0072859 | 3300053136 | Bacteria | 1549 |
| 696 | Ga0500559_0141887 | 3300053136 | Bacteria | 1125 |
| 697 | Ga0500568_0000599 | 3300053139 | Bacteria | 26179 |
| 698 | Ga0500568_0003668 | 3300053139 | Bacteria | 8441 |
| 699 | Ga0500568_0008132 | 3300053139 | Bacteria | 5085 |
| 700 | Ga0500568_0032225 | 3300053139 | Bacteria | 2156 |
| 701 | Ga0500585_060742 | 3300053144 | Bacteria | 1360 |
| 702 | Ga0500586_003626 | 3300053145 | Bacteria | 3677 |
| 703 | Ga0500590_031546 | 3300053148 | Bacteria | 2748 |
| 704 | Ga0500603_001125 | 3300053150 | Bacteria | 6243 |
| 705 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 706 | Ga0500622_0003210 | 3300053156 | Bacteria | 11123 |
| 707 | Ga0500627_0019326 | 3300053158 | Bacteria | 2712 |
| 708 | Ga0500627_0194673 | 3300053158 | Bacteria | 910 |
| 709 | Ga0500630_005371 | 3300053159 | Bacteria | 6249 |
| 710 | Ga0500634_0031888 | 3300053161 | Bacteria | 2875 |
| 711 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 712 | Ga0500639_065528 | 3300053163 | Bacteria | 1863 |
| 713 | Ga0500636_0000151 | 3300053177 | Bacteria | 35998 |
| 714 | Ga0500636_0005425 | 3300053177 | Bacteria | 7278 |
| 715 | Ga0500636_0044785 | 3300053177 | Bacteria | 2609 |
| 716 | Ga0500636_0080452 | 3300053177 | Bacteria | 1877 |
| 717 | Ga0500637_0105194 | 3300053178 | Bacteria | 1636 |
| 718 | Ga0500576_052240 | 3300053725 | Bacteria | 1809 |
| 719 | Ga0500625_004369 | 3300053729 | Bacteria | 5765 |
| 720 | Ga0500625_088820 | 3300053729 | Bacteria | 1329 |
| 721 | Ga0500645_040559 | 3300053730 | Bacteria | 1376 |
| 722 | Ga0500609_003486 | 3300053731 | Bacteria | 2205 |
| 723 | Ga0500596_000667 | 3300053735 | Bacteria | 6644 |
| 724 | Ga0500596_002168 | 3300053735 | Bacteria | 3895 |
| 725 | Ga0500599_004427 | 3300053736 | Bacteria | 1739 |
| 726 | Ga0500601_000098 | 3300053737 | Bacteria | 18298 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025253 | Ga0209677_105719 | Ga0209677_1057191 | 250 |
| 2 | 3300006175 | Ga0070712_100179306 | Ga0070712_1001793063 | 260 |
| 3 | 3300009545 | Ga0105237_10983690 | Ga0105237_109836901 | 260 |
| 4 | 3300048921 | Ga0496118_0034985 | Ga0496118_0034985_564_1397 | 260 |
| 5 | 3300048924 | Ga0496121_0020343 | Ga0496121_0020343_3937_4770 | 260 |
| 6 | 3300053136 | Ga0500559_0072859 | Ga0500559_0072859_379_1251 | 260 |
| 7 | 3300033442 | Ga0315911_1000001 | Ga0315911_1000001217 | 263 |
| 8 | 3300049823 | Ga0501044_0081836 | Ga0501044_0081836_2324_3169 | 263 |
| 9 | 3300005435 | Ga0070714_100147033 | Ga0070714_1001470332 | 264 |
| 10 | 3300005455 | Ga0070663_100429869 | Ga0070663_1004298691 | 264 |
| 11 | 3300005458 | Ga0070681_10279288 | Ga0070681_102792882 | 264 |
| 12 | 3300009177 | Ga0105248_10893662 | Ga0105248_108936621 | 264 |
| 13 | 3300010375 | Ga0105239_10144007 | Ga0105239_101440072 | 264 |
| 14 | 3300044842 | Ga0466957_0026509 | Ga0466957_0026509_1400_2248 | 264 |
| 15 | 3300046507 | Ga0495606_0106731 | Ga0495606_0106731_26_874 | 264 |
| 16 | 3300047315 | Ga0495581_0305498 | Ga0495581_0305498_24_863 | 264 |
| 17 | 3300047320 | Ga0495672_0186351 | Ga0495672_0186351_122_973 | 264 |
| 18 | 3300048913 | Ga0496110_0601561 | Ga0496110_0601561_24_863 | 264 |
| 19 | 3300048918 | Ga0496115_0055903 | Ga0496115_0055903_1153_2001 | 264 |
| 20 | 3300048924 | Ga0496121_0000407 | Ga0496121_0000407_56946_57797 | 264 |
| 21 | 3300048927 | Ga0496124_0040801 | Ga0496124_0040801_2877_3719 | 264 |
| 22 | 3300048927 | Ga0496124_0066590 | Ga0496124_0066590_2122_2973 | 264 |
| 23 | 3300048928 | Ga0496125_0022884 | Ga0496125_0022884_2662_3504 | 264 |
| 24 | 3300049589 | Ga0501073_0107798 | Ga0501073_0107798_10_852 | 264 |
| 25 | 3300053094 | Ga0500566_0006790 | Ga0500566_0006790_1347_2201 | 264 |
| 26 | 3300053098 | Ga0500650_0119589 | Ga0500650_0119589_29_874 | 264 |
| 27 | 3300053119 | Ga0500595_027140 | Ga0500595_027140_913_1764 | 264 |
| 28 | 3300053122 | Ga0500608_008414 | Ga0500608_008414_926_1780 | 264 |
| 29 | 3300053125 | Ga0500618_009095 | Ga0500618_009095_595_1449 | 264 |
| 30 | 3300053136 | Ga0500559_0003041 | Ga0500559_0003041_2402_3256 | 264 |
| 31 | 3300053139 | Ga0500568_0032225 | Ga0500568_0032225_262_1113 | 264 |
| 32 | 3300053158 | Ga0500627_0194673 | Ga0500627_0194673_11_853 | 264 |
| 33 | 3300053177 | Ga0500636_0005425 | Ga0500636_0005425_3984_4838 | 264 |
| 34 | 3300006353 | Ga0075370_10020275 | Ga0075370_100202752 | 267 |
| 35 | 3300053156 | Ga0500622_0003210 | Ga0500622_0003210_7203_8057 | 267 |
| 36 | 3300005614 | Ga0068856_100034334 | Ga0068856_1000343342 | 269 |
| 37 | 3300005616 | Ga0068852_100049804 | Ga0068852_1000498041 | 269 |
| 38 | 3300009148 | Ga0105243_10184381 | Ga0105243_101843811 | 269 |
| 39 | 3300025937 | Ga0207669_10189885 | Ga0207669_101898852 | 269 |
| 40 | 3300026078 | Ga0207702_10507371 | Ga0207702_105073712 | 269 |
| 41 | 3300026142 | Ga0207698_10456806 | Ga0207698_104568062 | 269 |
| 42 | 3300031238 | Ga0265332_10046119 | Ga0265332_100461192 | 269 |
| 43 | 3300046455 | Ga0495603_0170693 | Ga0495603_0170693_203_1072 | 269 |
| 44 | 3300046476 | Ga0495662_0236814 | Ga0495662_0236814_34_888 | 269 |
| 45 | 3300048917 | Ga0496114_0086673 | Ga0496114_0086673_785_1654 | 269 |
| 46 | iso_pu_bacteria | 2513237145 | 2513915164 | 270 |
| 47 | iso_pu_bacteria | 2517572143 | 2517892460 | 270 |
| 48 | iso_pu_bacteria | 2667528175 | 2671122431 | 270 |
| 49 | iso_pu_bacteria | 2906610324 | 2906618553 | 270 |
| 50 | iso_pu_bacteria | 2908739725 | 2908742767 | 270 |
| 51 | iso_pu_bacteria | 2922425934 | 2922430210 | 270 |
| 52 | iso_pu_bacteria | 2941507105 | 2941511522 | 270 |
| 53 | iso_pu_bacteria | 2941515067 | 2941519223 | 270 |
| 54 | iso_pu_bacteria | 2941523033 | 2941526197 | 270 |
| 55 | iso_pu_bacteria | 3005474847 | 3005480144 | 270 |
| 56 | iso_pu_bacteria | 8019555841 | 8019556827 | 270 |
| 57 | iso_pu_bacteria | 2507262055 | 2507508672 | 271 |
| 58 | iso_pu_bacteria | 2508501009 | 2508542768 | 271 |
| 59 | iso_pu_bacteria | 2508501042 | 2508691470 | 271 |
| 60 | iso_pu_bacteria | 2508501128 | 2509150423 | 271 |
| 61 | iso_pu_bacteria | 2511231028 | 2511395517 | 271 |
| 62 | iso_pu_bacteria | 2513237092 | 2513623123 | 271 |
| 63 | iso_pu_bacteria | 2513237094 | 2513639054 | 271 |
| 64 | iso_pu_bacteria | 2513237095 | 2513645931 | 271 |
| 65 | iso_pu_bacteria | 2513237102 | 2513700147 | 271 |
| 66 | iso_pu_bacteria | 2513237104 | 2513719536 | 271 |
| 67 | iso_pu_bacteria | 2513237139 | 2513872685 | 271 |
| 68 | iso_pu_bacteria | 2513237141 | 2513889045 | 271 |
| 69 | iso_pu_bacteria | 2513237161 | 2514011937 | 271 |
| 70 | iso_pu_bacteria | 2515154112 | 2515628277 | 271 |
| 71 | iso_pu_bacteria | 2517093001 | 2517101318 | 271 |
| 72 | iso_pu_bacteria | 2524023205 | 2524440484 | 271 |
| 73 | iso_pu_bacteria | 2602042107 | 2603859368 | 271 |
| 74 | iso_pu_bacteria | 2617270735 | 2617348931 | 271 |
| 75 | iso_pu_bacteria | 2617270741 | 2617375851 | 271 |
| 76 | iso_pu_bacteria | 2744054633 | 2745075247 | 271 |
| 77 | iso_pu_bacteria | 2791355196 | 2793062483 | 271 |
| 78 | iso_pu_bacteria | 2802429603 | 2805915417 | 271 |
| 79 | iso_pu_bacteria | 2816332527 | 2818239000 | 271 |
| 80 | iso_pu_bacteria | 2824600985 | 2824603485 | 271 |
| 81 | iso_pu_bacteria | 2824609381 | 2824617604 | 271 |
| 82 | iso_pu_bacteria | 2824617872 | 2824625710 | 271 |
| 83 | iso_pu_bacteria | 2824626560 | 2824634519 | 271 |
| 84 | iso_pu_bacteria | 2824635225 | 2824642035 | 271 |
| 85 | iso_pu_bacteria | 2824644064 | 2824650362 | 271 |
| 86 | iso_pu_bacteria | 2824653114 | 2824654729 | 271 |
| 87 | iso_pu_bacteria | 2824661429 | 2824667458 | 271 |
| 88 | iso_pu_bacteria | 2824671348 | 2824675821 | 271 |
| 89 | iso_pu_bacteria | 2824679649 | 2824686548 | 271 |
| 90 | iso_pu_bacteria | 2824687955 | 2824693111 | 271 |
| 91 | iso_pu_bacteria | 2824696289 | 2824701721 | 271 |
| 92 | iso_pu_bacteria | 2824704595 | 2824711900 | 271 |
| 93 | iso_pu_bacteria | 2824714736 | 2824720230 | 271 |
| 94 | iso_pu_bacteria | 2824723954 | 2824730583 | 271 |
| 95 | iso_pu_bacteria | 2824732956 | 2824739270 | 271 |
| 96 | iso_pu_bacteria | 2824746037 | 2824751593 | 271 |
| 97 | iso_pu_bacteria | 2824753945 | 2824762672 | 271 |
| 98 | iso_pu_bacteria | 2824763712 | 2824772768 | 271 |
| 99 | iso_pu_bacteria | 2824773399 | 2824777671 | 271 |
| 100 | iso_pu_bacteria | 2838122688 | 2838123838 | 271 |
| 101 | iso_pu_bacteria | 2841941048 | 2841944033 | 271 |
| 102 | iso_pu_bacteria | 2841949485 | 2841949938 | 271 |
| 103 | iso_pu_bacteria | 2841957949 | 2841958583 | 271 |
| 104 | iso_pu_bacteria | 2841966195 | 2841966356 | 271 |
| 105 | iso_pu_bacteria | 2841974524 | 2841975090 | 271 |
| 106 | iso_pu_bacteria | 2841983080 | 2841983338 | 271 |
| 107 | iso_pu_bacteria | 2842038055 | 2842039151 | 271 |
| 108 | iso_pu_bacteria | 2842045827 | 2842047902 | 271 |
| 109 | iso_pu_bacteria | 2844315083 | 2844319003 | 271 |
| 110 | iso_pu_bacteria | 2847930680 | 2847936128 | 271 |
| 111 | iso_pu_bacteria | 2847939898 | 2847946479 | 271 |
| 112 | iso_pu_bacteria | 2849076700 | 2849079400 | 271 |
| 113 | iso_pu_bacteria | 2857509624 | 2857514397 | 271 |
| 114 | iso_pu_bacteria | 2857524615 | 2857529219 | 271 |
| 115 | iso_pu_bacteria | 2874590934 | 2874593407 | 271 |
| 116 | iso_pu_bacteria | 2874604998 | 2874605108 | 271 |
| 117 | iso_pu_bacteria | 2874612657 | 2874615222 | 271 |
| 118 | iso_pu_bacteria | 2874620515 | 2874627185 | 271 |
| 119 | iso_pu_bacteria | 2874628541 | 2874631759 | 271 |
| 120 | iso_pu_bacteria | 2874645413 | 2874648962 | 271 |
| 121 | iso_pu_bacteria | 2876761206 | 2876767045 | 271 |
| 122 | iso_pu_bacteria | 2876771140 | 2876771989 | 271 |
| 123 | iso_pu_bacteria | 2876818435 | 2876822066 | 271 |
| 124 | iso_pu_bacteria | 2879074833 | 2879075579 | 271 |
| 125 | iso_pu_bacteria | 2879083081 | 2879090105 | 271 |
| 126 | iso_pu_bacteria | 2879099564 | 2879103273 | 271 |
| 127 | iso_pu_bacteria | 2879127579 | 2879130011 | 271 |
| 128 | iso_pu_bacteria | 2879142872 | 2879147072 | 271 |
| 129 | iso_pu_bacteria | 2881364244 | 2881367023 | 271 |
| 130 | iso_pu_bacteria | 2881665667 | 2881671091 | 271 |
| 131 | iso_pu_bacteria | 2885366525 | 2885370554 | 271 |
| 132 | iso_pu_bacteria | 2885409591 | 2885412140 | 271 |
| 133 | iso_pu_bacteria | 2888378607 | 2888383973 | 271 |
| 134 | iso_pu_bacteria | 2888388044 | 2888393883 | 271 |
| 135 | iso_pu_bacteria | 2888419890 | 2888424384 | 271 |
| 136 | iso_pu_bacteria | 2903727486 | 2903729072 | 271 |
| 137 | iso_pu_bacteria | 2904666416 | 2904671296 | 271 |
| 138 | iso_pu_bacteria | 2904711408 | 2904714527 | 271 |
| 139 | iso_pu_bacteria | 2906602504 | 2906610118 | 271 |
| 140 | iso_pu_bacteria | 2906626472 | 2906628584 | 271 |
| 141 | iso_pu_bacteria | 2906643746 | 2906651183 | 271 |
| 142 | iso_pu_bacteria | 2908775508 | 2908780092 | 271 |
| 143 | iso_pu_bacteria | 2919073203 | 2919076727 | 271 |
| 144 | iso_pu_bacteria | 2922368715 | 2922374297 | 271 |
| 145 | iso_pu_bacteria | 2922393267 | 2922396393 | 271 |
| 146 | iso_pu_bacteria | 2929615660 | 2929617971 | 271 |
| 147 | iso_pu_bacteria | 2929624759 | 2929627652 | 271 |
| 148 | iso_pu_bacteria | 2932784394 | 2932788246 | 271 |
| 149 | iso_pu_bacteria | 2932794094 | 2932797560 | 271 |
| 150 | iso_pu_bacteria | 2932801729 | 2932802876 | 271 |
| 151 | iso_pu_bacteria | 2932809354 | 2932810604 | 271 |
| 152 | iso_pu_bacteria | 2932818245 | 2932821250 | 271 |
| 153 | iso_pu_bacteria | 2932828146 | 2932831243 | 271 |
| 154 | iso_pu_bacteria | 2933577622 | 2933579900 | 271 |
| 155 | iso_pu_bacteria | 2935608549 | 2935608799 | 271 |
| 156 | iso_pu_bacteria | 2935616580 | 2935622961 | 271 |
| 157 | iso_pu_bacteria | 2935638405 | 2935642321 | 271 |
| 158 | iso_pu_bacteria | 2935648319 | 2935649954 | 271 |
| 159 | iso_pu_bacteria | 2935656913 | 2935661894 | 271 |
| 160 | iso_pu_bacteria | 2935665750 | 2935668376 | 271 |
| 161 | iso_pu_bacteria | 2935675223 | 2935680509 | 271 |
| 162 | iso_pu_bacteria | 2935684952 | 2935692821 | 271 |
| 163 | iso_pu_bacteria | 2935694250 | 2935700990 | 271 |
| 164 | iso_pu_bacteria | 2935703347 | 2935706231 | 271 |
| 165 | iso_pu_bacteria | 2935713505 | 2935721454 | 271 |
| 166 | iso_pu_bacteria | 2935722832 | 2935730372 | 271 |
| 167 | iso_pu_bacteria | 2935732158 | 2935740385 | 271 |
| 168 | iso_pu_bacteria | 2935741537 | 2935749649 | 271 |
| 169 | iso_pu_bacteria | 2935750917 | 2935759038 | 271 |
| 170 | iso_pu_bacteria | 2935760218 | 2935762632 | 271 |
| 171 | iso_pu_bacteria | 2935769743 | 2935773211 | 271 |
| 172 | iso_pu_bacteria | 2935777560 | 2935778456 | 271 |
| 173 | iso_pu_bacteria | 2935785616 | 2935790424 | 271 |
| 174 | iso_pu_bacteria | 2935793552 | 2935798153 | 271 |
| 175 | iso_pu_bacteria | 2935801545 | 2935803231 | 271 |
| 176 | iso_pu_bacteria | 2935810662 | 2935814551 | 271 |
| 177 | iso_pu_bacteria | 2935819856 | 2935821959 | 271 |
| 178 | iso_pu_bacteria | 2935827899 | 2935831689 | 271 |
| 179 | iso_pu_bacteria | 2935837841 | 2935838557 | 271 |
| 180 | iso_pu_bacteria | 2935847175 | 2935847541 | 271 |
| 181 | iso_pu_bacteria | 2935855204 | 2935861209 | 271 |
| 182 | iso_pu_bacteria | 2935864058 | 2935865747 | 271 |
| 183 | iso_pu_bacteria | 2935873716 | 2935878248 | 271 |
| 184 | iso_pu_bacteria | 2935883170 | 2935885217 | 271 |
| 185 | iso_pu_bacteria | 2935908558 | 2935909192 | 271 |
| 186 | iso_pu_bacteria | 2935916978 | 2935919913 | 271 |
| 187 | iso_pu_bacteria | 2935926038 | 2935926234 | 271 |
| 188 | iso_pu_bacteria | 2935934488 | 2935934684 | 271 |
| 189 | iso_pu_bacteria | 2935942939 | 2935943134 | 271 |
| 190 | iso_pu_bacteria | 2935951376 | 2935951572 | 271 |
| 191 | iso_pu_bacteria | 2935959822 | 2935966400 | 271 |
| 192 | iso_pu_bacteria | 2935967501 | 2935967697 | 271 |
| 193 | iso_pu_bacteria | 2935975950 | 2935977103 | 271 |
| 194 | iso_pu_bacteria | 2935984226 | 2935988262 | 271 |
| 195 | iso_pu_bacteria | 2935992306 | 2935994561 | 271 |
| 196 | iso_pu_bacteria | 2936002035 | 2936007639 | 271 |
| 197 | iso_pu_bacteria | 2936011229 | 2936012563 | 271 |
| 198 | iso_pu_bacteria | 2936019824 | 2936021127 | 271 |
| 199 | iso_pu_bacteria | 2936028420 | 2936029856 | 271 |
| 200 | iso_pu_bacteria | 2936037263 | 2936040108 | 271 |
| 201 | iso_pu_bacteria | 2936046547 | 2936047321 | 271 |
| 202 | iso_pu_bacteria | 2936055302 | 2936057521 | 271 |
| 203 | iso_pu_bacteria | 2940556831 | 2940564957 | 271 |
| 204 | iso_pu_bacteria | 2941531003 | 2941532672 | 271 |
| 205 | iso_pu_bacteria | 2941538514 | 2941538775 | 271 |
| 206 | iso_pu_bacteria | 3005483717 | 3005487260 | 271 |
| 207 | iso_pu_bacteria | 3005506211 | 3005510252 | 271 |
| 208 | iso_pu_bacteria | 3005587118 | 3005591049 | 271 |
| 209 | iso_pu_bacteria | 3005594810 | 3005599149 | 271 |
| 210 | iso_pu_bacteria | 3005710791 | 3005714814 | 271 |
| 211 | iso_pu_bacteria | 3005718088 | 3005722244 | 271 |
| 212 | iso_pu_bacteria | 8006926726 | 8006929978 | 271 |
| 213 | iso_pu_bacteria | 8016511872 | 8016522433 | 271 |
| 214 | iso_pu_bacteria | 8016522445 | 8016529699 | 271 |
| 215 | iso_pu_bacteria | 8016530956 | 8016534919 | 271 |
| 216 | iso_pu_bacteria | 8016539877 | 8016548129 | 271 |
| 217 | iso_pu_bacteria | 8016548790 | 8016553996 | 271 |
| 218 | iso_pu_bacteria | 8016557553 | 8016562369 | 271 |
| 219 | iso_pu_bacteria | 8016566248 | 8016573262 | 271 |
| 220 | iso_pu_bacteria | 8016575299 | 8016577404 | 271 |
| 221 | iso_pu_bacteria | 8016583857 | 8016591887 | 271 |
| 222 | iso_pu_bacteria | 8016595262 | 8016600173 | 271 |
| 223 | iso_pu_bacteria | 8016603502 | 8016610578 | 271 |
| 224 | iso_pu_bacteria | 8016613128 | 8016614352 | 271 |
| 225 | iso_pu_bacteria | 8016622563 | 8016626633 | 271 |
| 226 | iso_pu_bacteria | 8016630954 | 8016640445 | 271 |
| 227 | iso_pu_bacteria | 8017057580 | 8017063130 | 271 |
| 228 | iso_pu_bacteria | 8019538911 | 8019544793 | 271 |
| 229 | iso_pu_bacteria | 8019547302 | 8019553744 | 271 |
| 230 | iso_pu_bacteria | 8019597564 | 8019601000 | 271 |
| 231 | iso_pu_bacteria | 8019608314 | 8019617550 | 271 |
| 232 | iso_pu_bacteria | 8019629233 | 8019634558 | 271 |
| 233 | iso_pu_bacteria | 8019648815 | 8019658301 | 271 |
| 234 | iso_pu_bacteria | 8019659431 | 8019662451 | 271 |
| 235 | iso_pu_bacteria | 8019668869 | 8019671949 | 271 |
| 236 | iso_pu_bacteria | 8019678201 | 8019684145 | 271 |
| 237 | iso_pu_bacteria | 8019687851 | 8019689982 | 271 |
| 238 | iso_pu_bacteria | 8055742211 | 8055746439 | 271 |
| 239 | iso_pu_bacteria | 8056967851 | 8056967947 | 271 |
| 240 | 3300003320 | rootH2_10092826 | rootH2_1009282617 | 274 |
| 241 | 3300005337 | Ga0070682_100143586 | Ga0070682_1001435862 | 274 |
| 242 | 3300005437 | Ga0070710_10000246 | Ga0070710_100002466 | 274 |
| 243 | 3300005458 | Ga0070681_10088546 | Ga0070681_100885462 | 274 |
| 244 | 3300005530 | Ga0070679_100046714 | Ga0070679_1000467145 | 274 |
| 245 | 3300005530 | Ga0070679_100193229 | Ga0070679_1001932291 | 274 |
| 246 | 3300005535 | Ga0070684_100079765 | Ga0070684_1000797652 | 274 |
| 247 | 3300005547 | Ga0070693_100184891 | Ga0070693_1001848911 | 274 |
| 248 | 3300005563 | Ga0068855_100330249 | Ga0068855_1003302492 | 274 |
| 249 | 3300005563 | Ga0068855_100334599 | Ga0068855_1003345992 | 274 |
| 250 | 3300005618 | Ga0068864_100552636 | Ga0068864_1005526362 | 274 |
| 251 | 3300005937 | Ga0081455_10074179 | Ga0081455_100741792 | 274 |
| 252 | 3300005937 | Ga0081455_10084110 | Ga0081455_100841102 | 274 |
| 253 | 3300005983 | Ga0081540_1005800 | Ga0081540_10058004 | 274 |
| 254 | 3300005983 | Ga0081540_1006577 | Ga0081540_10065778 | 274 |
| 255 | 3300005983 | Ga0081540_1010678 | Ga0081540_10106785 | 274 |
| 256 | 3300005985 | Ga0081539_10000616 | Ga0081539_1000061623 | 274 |
| 257 | 3300006173 | Ga0070716_100015027 | Ga0070716_1000150273 | 274 |
| 258 | 3300006358 | Ga0068871_100215575 | Ga0068871_1002155752 | 274 |
| 259 | 3300009093 | Ga0105240_10362726 | Ga0105240_103627262 | 274 |
| 260 | 3300009177 | Ga0105248_10316430 | Ga0105248_103164302 | 274 |
| 261 | 3300010375 | Ga0105239_10632922 | Ga0105239_106329222 | 274 |
| 262 | 3300013104 | Ga0157370_10434784 | Ga0157370_104347842 | 274 |
| 263 | 3300013105 | Ga0157369_10007417 | Ga0157369_100074179 | 274 |
| 264 | 3300013105 | Ga0157369_10055013 | Ga0157369_100550132 | 274 |
| 265 | 3300014326 | Ga0157380_10165663 | Ga0157380_101656632 | 274 |
| 266 | 3300021384 | Ga0213876_10054200 | Ga0213876_100542003 | 274 |
| 267 | 3300025906 | Ga0207699_10000230 | Ga0207699_1000023024 | 274 |
| 268 | 3300025912 | Ga0207707_10006249 | Ga0207707_100062495 | 274 |
| 269 | 3300025912 | Ga0207707_10082921 | Ga0207707_100829214 | 274 |
| 270 | 3300025916 | Ga0207663_10417254 | Ga0207663_104172542 | 274 |
| 271 | 3300025917 | Ga0207660_10095217 | Ga0207660_100952172 | 274 |
| 272 | 3300025919 | Ga0207657_10000784 | Ga0207657_1000078428 | 274 |
| 273 | 3300025921 | Ga0207652_10030541 | Ga0207652_100305413 | 274 |
| 274 | 3300025921 | Ga0207652_10056039 | Ga0207652_100560392 | 274 |
| 275 | 3300025929 | Ga0207664_10036404 | Ga0207664_100364042 | 274 |
| 276 | 3300025939 | Ga0207665_10008093 | Ga0207665_100080935 | 274 |
| 277 | 3300025941 | Ga0207711_10455833 | Ga0207711_104558331 | 274 |
| 278 | 3300025944 | Ga0207661_10032763 | Ga0207661_100327631 | 274 |
| 279 | 3300025949 | Ga0207667_10255570 | Ga0207667_102555702 | 274 |
| 280 | 3300026088 | Ga0207641_10291004 | Ga0207641_102910042 | 274 |
| 281 | 3300035111 | Ga0373923_0084259 | Ga0373923_0084259_491_1360 | 274 |
| 282 | 3300035117 | Ga0373953_0157161 | Ga0373953_0157161_49_918 | 274 |
| 283 | 3300035119 | Ga0373956_0104783 | Ga0373956_0104783_59_928 | 274 |
| 284 | 3300035170 | Ga0373943_0058452 | Ga0373943_0058452_530_1399 | 274 |
| 285 | 3300035171 | Ga0373946_0022683 | Ga0373946_0022683_1181_2050 | 274 |
| 286 | 3300035692 | Ga0373935_0426267 | Ga0373935_0426267_27_896 | 274 |
| 287 | 3300035695 | Ga0373927_0235662 | Ga0373927_0235662_21_890 | 274 |
| 288 | 3300035724 | Ga0373933_0121136 | Ga0373933_0121136_748_1617 | 274 |
| 289 | 3300035724 | Ga0373933_0154998 | Ga0373933_0154998_482_1351 | 274 |
| 290 | 3300035725 | Ga0373947_0008223 | Ga0373947_0008223_2126_2995 | 274 |
| 291 | 3300036401 | Ga0373937_0123251 | Ga0373937_0123251_801_1670 | 274 |
| 292 | 3300037068 | Ga0373925_0085716 | Ga0373925_0085716_1513_2382 | 274 |
| 293 | 3300039437 | Ga0436365_1361494 | Ga0436365_1361494_5589_6467 | 274 |
| 294 | 3300046472 | Ga0495580_0069423 | Ga0495580_0069423_21_890 | 274 |
| 295 | 3300046475 | Ga0495639_0022248 | Ga0495639_0022248_542_1411 | 274 |
| 296 | 3300046477 | Ga0495664_0025560 | Ga0495664_0025560_1171_2040 | 274 |
| 297 | 3300046477 | Ga0495664_0033832 | Ga0495664_0033832_1485_2354 | 274 |
| 298 | 3300046499 | Ga0495594_0083293 | Ga0495594_0083293_721_1590 | 274 |
| 299 | 3300046514 | Ga0495618_0213140 | Ga0495618_0213140_287_1156 | 274 |
| 300 | 3300046517 | Ga0495630_0225061 | Ga0495630_0225061_163_1032 | 274 |
| 301 | 3300046526 | Ga0495666_0030178 | Ga0495666_0030178_776_1645 | 274 |
| 302 | 3300046529 | Ga0495652_0120212 | Ga0495652_0120212_747_1616 | 274 |
| 303 | 3300046531 | Ga0495665_0065399 | Ga0495665_0065399_611_1480 | 274 |
| 304 | 3300046616 | Ga0495668_0025829 | Ga0495668_0025829_1585_2460 | 274 |
| 305 | 3300046642 | Ga0495634_0037223 | Ga0495634_0037223_1982_2851 | 274 |
| 306 | 3300046674 | Ga0495588_0260481 | Ga0495588_0260481_26_895 | 274 |
| 307 | 3300047317 | Ga0495604_0160501 | Ga0495604_0160501_670_1539 | 274 |
| 308 | 3300047673 | Ga0495593_0047522 | Ga0495593_0047522_1251_2120 | 274 |
| 309 | 3300048905 | Ga0496102_0103280 | Ga0496102_0103280_1359_2228 | 274 |
| 310 | 3300048910 | Ga0496107_0303768 | Ga0496107_0303768_169_1038 | 274 |
| 311 | 3300048911 | Ga0496108_0319094 | Ga0496108_0319094_422_1297 | 274 |
| 312 | 3300048914 | Ga0496111_0032439 | Ga0496111_0032439_1031_1900 | 274 |
| 313 | 3300048921 | Ga0496118_0037535 | Ga0496118_0037535_1731_2627 | 274 |
| 314 | 3300048924 | Ga0496121_0011644 | Ga0496121_0011644_2369_3265 | 274 |
| 315 | 3300048929 | Ga0496126_0160575 | Ga0496126_0160575_623_1501 | 274 |
| 316 | 3300050489 | nmdc:mga03683_109803_c1 | nmdc:mga03683_109803_c1_245_1114 | 274 |
| 317 | 3300050492 | nmdc:mga0yw44_142961_c1 | nmdc:mga0yw44_142961_c1_397_1266 | 274 |
| 318 | 3300053078 | Ga0495612_0023453 | Ga0495612_0023453_1075_1944 | 274 |
| 319 | 3300053104 | Ga0500556_0000004 | Ga0500556_0000004_308814_309689 | 274 |
| 320 | 3300053119 | Ga0500595_015597 | Ga0500595_015597_797_1672 | 274 |
| 321 | 3300053119 | Ga0500595_033960 | Ga0500595_033960_169_1059 | 274 |
| 322 | 3300053119 | Ga0500595_034530 | Ga0500595_034530_485_1381 | 274 |
| 323 | 3300003215 | JGI25153J46596_10001975 | JGI25153J46596_100019754 | 275 |
| 324 | 3300003215 | JGI25153J46596_10008298 | JGI25153J46596_100082985 | 275 |
| 325 | 3300003215 | JGI25153J46596_10015626 | JGI25153J46596_100156264 | 275 |
| 326 | 3300003354 | JGI25160J50197_1025735 | JGI25160J50197_10257352 | 275 |
| 327 | 3300003771 | Ga0055526_1027575 | Ga0055526_10275752 | 275 |
| 328 | 3300005262 | Ga0065165_1001744 | Ga0065165_100174414 | 275 |
| 329 | 3300005262 | Ga0065165_1003890 | Ga0065165_10038902 | 275 |
| 330 | 3300005262 | Ga0065165_1007122 | Ga0065165_10071225 | 275 |
| 331 | 3300005327 | Ga0070658_10103432 | Ga0070658_101034322 | 275 |
| 332 | 3300005330 | Ga0070690_100351692 | Ga0070690_1003516922 | 275 |
| 333 | 3300005334 | Ga0068869_100111434 | Ga0068869_1001114342 | 275 |
| 334 | 3300005336 | Ga0070680_100095596 | Ga0070680_1000955963 | 275 |
| 335 | 3300005337 | Ga0070682_100299733 | Ga0070682_1002997331 | 275 |
| 336 | 3300005341 | Ga0070691_10174307 | Ga0070691_101743071 | 275 |
| 337 | 3300005343 | Ga0070687_100104898 | Ga0070687_1001048982 | 275 |
| 338 | 3300005344 | Ga0070661_100130283 | Ga0070661_1001302832 | 275 |
| 339 | 3300005347 | Ga0070668_100017635 | Ga0070668_1000176352 | 275 |
| 340 | 3300005347 | Ga0070668_100129208 | Ga0070668_1001292082 | 275 |
| 341 | 3300005347 | Ga0070668_100228406 | Ga0070668_1002284062 | 275 |
| 342 | 3300005347 | Ga0070668_100266390 | Ga0070668_1002663901 | 275 |
| 343 | 3300005356 | Ga0070674_100172918 | Ga0070674_1001729181 | 275 |
| 344 | 3300005364 | Ga0070673_100298057 | Ga0070673_1002980572 | 275 |
| 345 | 3300005365 | Ga0070688_100205272 | Ga0070688_1002052722 | 275 |
| 346 | 3300005366 | Ga0070659_100176968 | Ga0070659_1001769682 | 275 |
| 347 | 3300005434 | Ga0070709_10005979 | Ga0070709_100059792 | 275 |
| 348 | 3300005436 | Ga0070713_100009644 | Ga0070713_1000096445 | 275 |
| 349 | 3300005436 | Ga0070713_100076142 | Ga0070713_1000761422 | 275 |
| 350 | 3300005436 | Ga0070713_100161962 | Ga0070713_1001619621 | 275 |
| 351 | 3300005437 | Ga0070710_10004225 | Ga0070710_100042252 | 275 |
| 352 | 3300005439 | Ga0070711_100003729 | Ga0070711_1000037293 | 275 |
| 353 | 3300005455 | Ga0070663_100012278 | Ga0070663_1000122785 | 275 |
| 354 | 3300005455 | Ga0070663_100073784 | Ga0070663_1000737842 | 275 |
| 355 | 3300005455 | Ga0070663_100325610 | Ga0070663_1003256101 | 275 |
| 356 | 3300005455 | Ga0070663_100341079 | Ga0070663_1003410792 | 275 |
| 357 | 3300005455 | Ga0070663_100366135 | Ga0070663_1003661352 | 275 |
| 358 | 3300005456 | Ga0070678_100389543 | Ga0070678_1003895432 | 275 |
| 359 | 3300005457 | Ga0070662_100057096 | Ga0070662_1000570962 | 275 |
| 360 | 3300005457 | Ga0070662_100121120 | Ga0070662_1001211203 | 275 |
| 361 | 3300005457 | Ga0070662_100449324 | Ga0070662_1004493241 | 275 |
| 362 | 3300005458 | Ga0070681_10533142 | Ga0070681_105331422 | 275 |
| 363 | 3300005467 | Ga0070706_100612224 | Ga0070706_1006122241 | 275 |
| 364 | 3300005468 | Ga0070707_100128075 | Ga0070707_1001280752 | 275 |
| 365 | 3300005530 | Ga0070679_100098528 | Ga0070679_1000985282 | 275 |
| 366 | 3300005530 | Ga0070679_100101649 | Ga0070679_1001016492 | 275 |
| 367 | 3300005530 | Ga0070679_100685937 | Ga0070679_1006859371 | 275 |
| 368 | 3300005535 | Ga0070684_100147421 | Ga0070684_1001474212 | 275 |
| 369 | 3300005535 | Ga0070684_100198803 | Ga0070684_1001988032 | 275 |
| 370 | 3300005536 | Ga0070697_100024733 | Ga0070697_1000247332 | 275 |
| 371 | 3300005536 | Ga0070697_100234930 | Ga0070697_1002349302 | 275 |
| 372 | 3300005544 | Ga0070686_100204505 | Ga0070686_1002045051 | 275 |
| 373 | 3300005544 | Ga0070686_100412663 | Ga0070686_1004126631 | 275 |
| 374 | 3300005548 | Ga0070665_100062661 | Ga0070665_1000626612 | 275 |
| 375 | 3300005548 | Ga0070665_100274524 | Ga0070665_1002745242 | 275 |
| 376 | 3300005548 | Ga0070665_100294346 | Ga0070665_1002943462 | 275 |
| 377 | 3300005563 | Ga0068855_100093456 | Ga0068855_1000934563 | 275 |
| 378 | 3300005563 | Ga0068855_100135169 | Ga0068855_1001351692 | 275 |
| 379 | 3300005563 | Ga0068855_100156301 | Ga0068855_1001563012 | 275 |
| 380 | 3300005577 | Ga0068857_100238179 | Ga0068857_1002381792 | 275 |
| 381 | 3300005578 | Ga0068854_100094706 | Ga0068854_1000947062 | 275 |
| 382 | 3300005578 | Ga0068854_100275322 | Ga0068854_1002753222 | 275 |
| 383 | 3300005614 | Ga0068856_100003004 | Ga0068856_1000030047 | 275 |
| 384 | 3300005614 | Ga0068856_100570670 | Ga0068856_1005706702 | 275 |
| 385 | 3300005615 | Ga0070702_100124688 | Ga0070702_1001246882 | 275 |
| 386 | 3300005616 | Ga0068852_100211194 | Ga0068852_1002111942 | 275 |
| 387 | 3300005617 | Ga0068859_100161007 | Ga0068859_1001610072 | 275 |
| 388 | 3300005719 | Ga0068861_100297464 | Ga0068861_1002974642 | 275 |
| 389 | 3300005834 | Ga0068851_10112618 | Ga0068851_101126182 | 275 |
| 390 | 3300005842 | Ga0068858_100314985 | Ga0068858_1003149852 | 275 |
| 391 | 3300005843 | Ga0068860_100595316 | Ga0068860_1005953161 | 275 |
| 392 | 3300005844 | Ga0068862_100226788 | Ga0068862_1002267882 | 275 |
| 393 | 3300005844 | Ga0068862_100228430 | Ga0068862_1002284302 | 275 |
| 394 | 3300005844 | Ga0068862_100580673 | Ga0068862_1005806732 | 275 |
| 395 | 3300006028 | Ga0070717_10085820 | Ga0070717_100858202 | 275 |
| 396 | 3300006038 | Ga0075365_10006882 | Ga0075365_100068822 | 275 |
| 397 | 3300006038 | Ga0075365_10335431 | Ga0075365_103354311 | 275 |
| 398 | 3300006048 | Ga0075363_100081222 | Ga0075363_1000812222 | 275 |
| 399 | 3300006051 | Ga0075364_10259823 | Ga0075364_102598232 | 275 |
| 400 | 3300006173 | Ga0070716_100298926 | Ga0070716_1002989262 | 275 |
| 401 | 3300006175 | Ga0070712_100006021 | Ga0070712_1000060212 | 275 |
| 402 | 3300006175 | Ga0070712_100009398 | Ga0070712_1000093983 | 275 |
| 403 | 3300006175 | Ga0070712_100326598 | Ga0070712_1003265982 | 275 |
| 404 | 3300006195 | Ga0075366_10095091 | Ga0075366_100950912 | 275 |
| 405 | 3300006237 | Ga0097621_100078349 | Ga0097621_1000783492 | 275 |
| 406 | 3300006353 | Ga0075370_10028498 | Ga0075370_100284984 | 275 |
| 407 | 3300006353 | Ga0075370_10042918 | Ga0075370_100429183 | 275 |
| 408 | 3300006358 | Ga0068871_100174650 | Ga0068871_1001746502 | 275 |
| 409 | 3300006931 | Ga0097620_100161013 | Ga0097620_1001610132 | 275 |
| 410 | 3300006942 | Ga0099824_1012782 | Ga0099824_10127823 | 275 |
| 411 | 3300006944 | Ga0099823_1053392 | Ga0099823_10533922 | 275 |
| 412 | 3300007788 | Ga0099795_10016821 | Ga0099795_100168213 | 275 |
| 413 | 3300009093 | Ga0105240_10055530 | Ga0105240_100555303 | 275 |
| 414 | 3300009098 | Ga0105245_10033500 | Ga0105245_100335002 | 275 |
| 415 | 3300009098 | Ga0105245_10162980 | Ga0105245_101629802 | 275 |
| 416 | 3300009101 | Ga0105247_10012294 | Ga0105247_100122943 | 275 |
| 417 | 3300009101 | Ga0105247_10184937 | Ga0105247_101849372 | 275 |
| 418 | 3300009148 | Ga0105243_10033316 | Ga0105243_100333163 | 275 |
| 419 | 3300009148 | Ga0105243_10549905 | Ga0105243_105499052 | 275 |
| 420 | 3300009148 | Ga0105243_10775032 | Ga0105243_107750321 | 275 |
| 421 | 3300009174 | Ga0105241_10104362 | Ga0105241_101043622 | 275 |
| 422 | 3300009174 | Ga0105241_10245809 | Ga0105241_102458092 | 275 |
| 423 | 3300009177 | Ga0105248_10176081 | Ga0105248_101760812 | 275 |
| 424 | 3300009177 | Ga0105248_10999267 | Ga0105248_109992671 | 275 |
| 425 | 3300009545 | Ga0105237_10009068 | Ga0105237_100090682 | 275 |
| 426 | 3300009545 | Ga0105237_10024567 | Ga0105237_100245673 | 275 |
| 427 | 3300009545 | Ga0105237_10064518 | Ga0105237_100645182 | 275 |
| 428 | 3300009545 | Ga0105237_10090324 | Ga0105237_100903243 | 275 |
| 429 | 3300009545 | Ga0105237_10390313 | Ga0105237_103903132 | 275 |
| 430 | 3300009551 | Ga0105238_10018050 | Ga0105238_100180505 | 275 |
| 431 | 3300009553 | Ga0105249_10046943 | Ga0105249_100469433 | 275 |
| 432 | 3300010375 | Ga0105239_10294016 | Ga0105239_102940162 | 275 |
| 433 | 3300010375 | Ga0105239_10347853 | Ga0105239_103478532 | 275 |
| 434 | 3300010375 | Ga0105239_10476786 | Ga0105239_104767862 | 275 |
| 435 | 3300010375 | Ga0105239_10490236 | Ga0105239_104902362 | 275 |
| 436 | 3300011119 | Ga0105246_10001247 | Ga0105246_100012479 | 275 |
| 437 | 3300011119 | Ga0105246_10023452 | Ga0105246_100234522 | 275 |
| 438 | 3300011119 | Ga0105246_10529800 | Ga0105246_105298002 | 275 |
| 439 | 3300013105 | Ga0157369_10374003 | Ga0157369_103740032 | 275 |
| 440 | 3300013296 | Ga0157374_10060187 | Ga0157374_100601873 | 275 |
| 441 | 3300013296 | Ga0157374_10106184 | Ga0157374_101061843 | 275 |
| 442 | 3300013308 | Ga0157375_10115127 | Ga0157375_101151272 | 275 |
| 443 | 3300014325 | Ga0163163_10171210 | Ga0163163_101712102 | 275 |
| 444 | 3300014326 | Ga0157380_10159931 | Ga0157380_101599312 | 275 |
| 445 | 3300014968 | Ga0157379_10362535 | Ga0157379_103625352 | 275 |
| 446 | 3300014969 | Ga0157376_10396519 | Ga0157376_103965192 | 275 |
| 447 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002513 | 275 |
| 448 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001863 | 275 |
| 449 | 3300021321 | Ga0214542_1020125 | Ga0214542_10201254 | 275 |
| 450 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001929 | 275 |
| 451 | 3300021324 | Ga0214545_1019688 | Ga0214545_10196885 | 275 |
| 452 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001264 | 275 |
| 453 | 3300025230 | Ga0209563_101347 | Ga0209563_1013472 | 275 |
| 454 | 3300025254 | Ga0209148_1000356 | Ga0209148_100035631 | 275 |
| 455 | 3300025261 | Ga0209233_1013020 | Ga0209233_10130202 | 275 |
| 456 | 3300025261 | Ga0209233_1018847 | Ga0209233_10188472 | 275 |
| 457 | 3300025272 | Ga0209455_1001391 | Ga0209455_10013917 | 275 |
| 458 | 3300025295 | Ga0209564_1021717 | Ga0209564_10217172 | 275 |
| 459 | 3300025295 | Ga0209564_1028213 | Ga0209564_10282132 | 275 |
| 460 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021627 | 275 |
| 461 | 3300025297 | Ga0209758_1001565 | Ga0209758_100156523 | 275 |
| 462 | 3300025297 | Ga0209758_1002055 | Ga0209758_100205518 | 275 |
| 463 | 3300025297 | Ga0209758_1002832 | Ga0209758_100283210 | 275 |
| 464 | 3300025297 | Ga0209758_1010040 | Ga0209758_10100403 | 275 |
| 465 | 3300025299 | Ga0209256_1007804 | Ga0209256_10078044 | 275 |
| 466 | 3300025302 | Ga0207426_1000599 | Ga0207426_10005991 | 275 |
| 467 | 3300025302 | Ga0207426_1000960 | Ga0207426_10009603 | 275 |
| 468 | 3300025304 | Ga0209257_1002984 | Ga0209257_100298411 | 275 |
| 469 | 3300025900 | Ga0207710_10039499 | Ga0207710_100394992 | 275 |
| 470 | 3300025900 | Ga0207710_10191953 | Ga0207710_101919531 | 275 |
| 471 | 3300025901 | Ga0207688_10097624 | Ga0207688_100976242 | 275 |
| 472 | 3300025901 | Ga0207688_10112391 | Ga0207688_101123912 | 275 |
| 473 | 3300025903 | Ga0207680_10197117 | Ga0207680_101971171 | 275 |
| 474 | 3300025904 | Ga0207647_10015833 | Ga0207647_100158332 | 275 |
| 475 | 3300025908 | Ga0207643_10049112 | Ga0207643_100491122 | 275 |
| 476 | 3300025911 | Ga0207654_10023543 | Ga0207654_100235433 | 275 |
| 477 | 3300025911 | Ga0207654_10069921 | Ga0207654_100699212 | 275 |
| 478 | 3300025912 | Ga0207707_10151536 | Ga0207707_101515362 | 275 |
| 479 | 3300025912 | Ga0207707_10228240 | Ga0207707_102282402 | 275 |
| 480 | 3300025912 | Ga0207707_10257088 | Ga0207707_102570882 | 275 |
| 481 | 3300025913 | Ga0207695_10000015 | Ga0207695_10000015178 | 275 |
| 482 | 3300025914 | Ga0207671_10012975 | Ga0207671_100129755 | 275 |
| 483 | 3300025914 | Ga0207671_10017413 | Ga0207671_100174134 | 275 |
| 484 | 3300025914 | Ga0207671_10039046 | Ga0207671_100390463 | 275 |
| 485 | 3300025914 | Ga0207671_10110789 | Ga0207671_101107891 | 275 |
| 486 | 3300025914 | Ga0207671_10140237 | Ga0207671_101402371 | 275 |
| 487 | 3300025915 | Ga0207693_10013717 | Ga0207693_100137174 | 275 |
| 488 | 3300025915 | Ga0207693_10053863 | Ga0207693_100538632 | 275 |
| 489 | 3300025915 | Ga0207693_10241507 | Ga0207693_102415072 | 275 |
| 490 | 3300025919 | Ga0207657_10001921 | Ga0207657_1000192115 | 275 |
| 491 | 3300025926 | Ga0207659_10150696 | Ga0207659_101506962 | 275 |
| 492 | 3300025927 | Ga0207687_10013817 | Ga0207687_100138173 | 275 |
| 493 | 3300025927 | Ga0207687_10039262 | Ga0207687_100392622 | 275 |
| 494 | 3300025927 | Ga0207687_10127151 | Ga0207687_101271512 | 275 |
| 495 | 3300025928 | Ga0207700_10017514 | Ga0207700_100175144 | 275 |
| 496 | 3300025928 | Ga0207700_10247910 | Ga0207700_102479102 | 275 |
| 497 | 3300025928 | Ga0207700_10290213 | Ga0207700_102902132 | 275 |
| 498 | 3300025929 | Ga0207664_10248450 | Ga0207664_102484502 | 275 |
| 499 | 3300025931 | Ga0207644_10273179 | Ga0207644_102731792 | 275 |
| 500 | 3300025933 | Ga0207706_10094861 | Ga0207706_100948613 | 275 |
| 501 | 3300025937 | Ga0207669_10024600 | Ga0207669_100246002 | 275 |
| 502 | 3300025939 | Ga0207665_10209643 | Ga0207665_102096432 | 275 |
| 503 | 3300025940 | Ga0207691_10091630 | Ga0207691_100916302 | 275 |
| 504 | 3300025940 | Ga0207691_10334804 | Ga0207691_103348042 | 275 |
| 505 | 3300025941 | Ga0207711_10218197 | Ga0207711_102181972 | 275 |
| 506 | 3300025942 | Ga0207689_10016212 | Ga0207689_100162122 | 275 |
| 507 | 3300025944 | Ga0207661_10209337 | Ga0207661_102093372 | 275 |
| 508 | 3300025945 | Ga0207679_10322682 | Ga0207679_103226822 | 275 |
| 509 | 3300025949 | Ga0207667_10075059 | Ga0207667_100750592 | 275 |
| 510 | 3300025949 | Ga0207667_10328928 | Ga0207667_103289281 | 275 |
| 511 | 3300025961 | Ga0207712_10131990 | Ga0207712_101319902 | 275 |
| 512 | 3300025972 | Ga0207668_10103257 | Ga0207668_101032572 | 275 |
| 513 | 3300026023 | Ga0207677_10085737 | Ga0207677_100857372 | 275 |
| 514 | 3300026035 | Ga0207703_10075271 | Ga0207703_100752713 | 275 |
| 515 | 3300026041 | Ga0207639_10034763 | Ga0207639_100347633 | 275 |
| 516 | 3300026067 | Ga0207678_10007958 | Ga0207678_100079585 | 275 |
| 517 | 3300026067 | Ga0207678_10027287 | Ga0207678_100272872 | 275 |
| 518 | 3300026067 | Ga0207678_10076754 | Ga0207678_100767542 | 275 |
| 519 | 3300026067 | Ga0207678_10084268 | Ga0207678_100842682 | 275 |
| 520 | 3300026067 | Ga0207678_10099919 | Ga0207678_100999192 | 275 |
| 521 | 3300026067 | Ga0207678_10137238 | Ga0207678_101372382 | 275 |
| 522 | 3300026078 | Ga0207702_10000442 | Ga0207702_1000044216 | 275 |
| 523 | 3300026088 | Ga0207641_10341726 | Ga0207641_103417262 | 275 |
| 524 | 3300026095 | Ga0207676_10057929 | Ga0207676_100579293 | 275 |
| 525 | 3300026118 | Ga0207675_100131335 | Ga0207675_1001313352 | 275 |
| 526 | 3300026118 | Ga0207675_100685634 | Ga0207675_1006856342 | 275 |
| 527 | 3300026121 | Ga0207683_10045508 | Ga0207683_100455083 | 275 |
| 528 | 3300026121 | Ga0207683_10099403 | Ga0207683_100994033 | 275 |
| 529 | 3300026121 | Ga0207683_10130722 | Ga0207683_101307223 | 275 |
| 530 | 3300026121 | Ga0207683_10302139 | Ga0207683_103021392 | 275 |
| 531 | 3300026142 | Ga0207698_10115013 | Ga0207698_101150132 | 275 |
| 532 | 3300026142 | Ga0207698_10188264 | Ga0207698_101882643 | 275 |
| 533 | 3300027296 | Ga0209389_1000008 | Ga0209389_1000008216 | 275 |
| 534 | 3300027296 | Ga0209389_1000121 | Ga0209389_100012143 | 275 |
| 535 | 3300027357 | Ga0209589_1002735 | Ga0209589_100273516 | 275 |
| 536 | 3300027361 | Ga0209489_101490 | Ga0209489_1014904 | 275 |
| 537 | 3300027361 | Ga0209489_103445 | Ga0209489_10344516 | 275 |
| 538 | 3300027363 | Ga0209700_100036 | Ga0209700_100036103 | 275 |
| 539 | 3300027512 | Ga0209179_1017416 | Ga0209179_10174161 | 275 |
| 540 | 3300028379 | Ga0268266_10008371 | Ga0268266_100083715 | 275 |
| 541 | 3300028379 | Ga0268266_10151361 | Ga0268266_101513612 | 275 |
| 542 | 3300028379 | Ga0268266_10479226 | Ga0268266_104792262 | 275 |
| 543 | 3300028380 | Ga0268265_10097945 | Ga0268265_100979452 | 275 |
| 544 | 3300028380 | Ga0268265_10130921 | Ga0268265_101309212 | 275 |
| 545 | 3300028380 | Ga0268265_10566576 | Ga0268265_105665761 | 275 |
| 546 | 3300028381 | Ga0268264_10041134 | Ga0268264_100411342 | 275 |
| 547 | 3300028381 | Ga0268264_10268499 | Ga0268264_102684992 | 275 |
| 548 | 3300028556 | Ga0265337_1012538 | Ga0265337_10125382 | 275 |
| 549 | 3300028558 | Ga0265326_10002188 | Ga0265326_100021884 | 275 |
| 550 | 3300028563 | Ga0265319_1025553 | Ga0265319_10255532 | 275 |
| 551 | 3300028573 | Ga0265334_10002607 | Ga0265334_100026074 | 275 |
| 552 | 3300028653 | Ga0265323_10006127 | Ga0265323_100061271 | 275 |
| 553 | 3300028654 | Ga0265322_10002310 | Ga0265322_100023103 | 275 |
| 554 | 3300028666 | Ga0265336_10001608 | Ga0265336_100016084 | 275 |
| 555 | 3300028794 | Ga0307515_10259502 | Ga0307515_102595022 | 275 |
| 556 | 3300028800 | Ga0265338_10000667 | Ga0265338_1000066731 | 275 |
| 557 | 3300029957 | Ga0265324_10003760 | Ga0265324_100037602 | 275 |
| 558 | 3300030521 | Ga0307511_10037393 | Ga0307511_100373934 | 275 |
| 559 | 3300031235 | Ga0265330_10042024 | Ga0265330_100420242 | 275 |
| 560 | 3300031235 | Ga0265330_10043768 | Ga0265330_100437682 | 275 |
| 561 | 3300031238 | Ga0265332_10035696 | Ga0265332_100356963 | 275 |
| 562 | 3300031241 | Ga0265325_10007037 | Ga0265325_100070374 | 275 |
| 563 | 3300031247 | Ga0265340_10001939 | Ga0265340_100019392 | 275 |
| 564 | 3300031249 | Ga0265339_10007152 | Ga0265339_100071523 | 275 |
| 565 | 3300031249 | Ga0265339_10033648 | Ga0265339_100336482 | 275 |
| 566 | 3300031250 | Ga0265331_10027187 | Ga0265331_100271873 | 275 |
| 567 | 3300031344 | Ga0265316_10040807 | Ga0265316_100408074 | 275 |
| 568 | 3300031344 | Ga0265316_10049430 | Ga0265316_100494302 | 275 |
| 569 | 3300031344 | Ga0265316_10275781 | Ga0265316_102757812 | 275 |
| 570 | 3300031456 | Ga0307513_10341525 | Ga0307513_103415252 | 275 |
| 571 | 3300031507 | Ga0307509_10021973 | Ga0307509_100219732 | 275 |
| 572 | 3300031507 | Ga0307509_10048183 | Ga0307509_100481833 | 275 |
| 573 | 3300031507 | Ga0307509_10115985 | Ga0307509_101159852 | 275 |
| 574 | 3300031507 | Ga0307509_10443253 | Ga0307509_104432531 | 275 |
| 575 | 3300031616 | Ga0307508_10000010 | Ga0307508_100000102 | 275 |
| 576 | 3300031616 | Ga0307508_10058073 | Ga0307508_100580733 | 275 |
| 577 | 3300031616 | Ga0307508_10141390 | Ga0307508_101413902 | 275 |
| 578 | 3300031616 | Ga0307508_10239049 | Ga0307508_102390492 | 275 |
| 579 | 3300031616 | Ga0307508_10309890 | Ga0307508_103098902 | 275 |
| 580 | 3300031712 | Ga0265342_10011179 | Ga0265342_100111793 | 275 |
| 581 | 3300031712 | Ga0265342_10042235 | Ga0265342_100422352 | 275 |
| 582 | 3300031712 | Ga0265342_10077343 | Ga0265342_100773432 | 275 |
| 583 | 3300031730 | Ga0307516_10067904 | Ga0307516_100679042 | 275 |
| 584 | 3300031730 | Ga0307516_10083248 | Ga0307516_100832482 | 275 |
| 585 | 3300031730 | Ga0307516_10329853 | Ga0307516_103298532 | 275 |
| 586 | 3300031911 | Ga0307412_10029689 | Ga0307412_100296892 | 275 |
| 587 | 3300032002 | Ga0307416_100380139 | Ga0307416_1003801391 | 275 |
| 588 | 3300032126 | Ga0307415_100019128 | Ga0307415_1000191282 | 275 |
| 589 | 3300033179 | Ga0307507_10019430 | Ga0307507_100194306 | 275 |
| 590 | 3300033180 | Ga0307510_10006860 | Ga0307510_100068603 | 275 |
| 591 | 3300033180 | Ga0307510_10039226 | Ga0307510_100392264 | 275 |
| 592 | 3300033180 | Ga0307510_10040547 | Ga0307510_100405474 | 275 |
| 593 | 3300033180 | Ga0307510_10082351 | Ga0307510_100823514 | 275 |
| 594 | 3300035086 | Ga0373934_0001152 | Ga0373934_0001152_6335_7207 | 275 |
| 595 | 3300035089 | Ga0373944_0049829 | Ga0373944_0049829_377_1264 | 275 |
| 596 | 3300035111 | Ga0373923_0045255 | Ga0373923_0045255_104_976 | 275 |
| 597 | 3300035113 | Ga0373936_0002224 | Ga0373936_0002224_1282_2169 | 275 |
| 598 | 3300035116 | Ga0373945_0019944 | Ga0373945_0019944_1247_2134 | 275 |
| 599 | 3300035117 | Ga0373953_0015420 | Ga0373953_0015420_1069_1941 | 275 |
| 600 | 3300035117 | Ga0373953_0046250 | Ga0373953_0046250_148_1035 | 275 |
| 601 | 3300035118 | Ga0373954_0000976 | Ga0373954_0000976_4748_5620 | 275 |
| 602 | 3300035119 | Ga0373956_0011303 | Ga0373956_0011303_1942_2814 | 275 |
| 603 | 3300035120 | Ga0373957_0036311 | Ga0373957_0036311_437_1309 | 275 |
| 604 | 3300035170 | Ga0373943_0008520 | Ga0373943_0008520_460_1344 | 275 |
| 605 | 3300035170 | Ga0373943_0026179 | Ga0373943_0026179_585_1472 | 275 |
| 606 | 3300035172 | Ga0373955_0000198 | Ga0373955_0000198_5943_6815 | 275 |
| 607 | 3300035691 | Ga0373931_0310314 | Ga0373931_0310314_73_948 | 275 |
| 608 | 3300035695 | Ga0373927_0011994 | Ga0373927_0011994_624_1511 | 275 |
| 609 | 3300035695 | Ga0373927_0012818 | Ga0373927_0012818_2244_3128 | 275 |
| 610 | 3300035695 | Ga0373927_0055937 | Ga0373927_0055937_1641_2528 | 275 |
| 611 | 3300035695 | Ga0373927_0190737 | Ga0373927_0190737_180_1052 | 275 |
| 612 | 3300035724 | Ga0373933_0000274 | Ga0373933_0000274_4971_5843 | 275 |
| 613 | 3300035724 | Ga0373933_0000475 | Ga0373933_0000475_3314_4198 | 275 |
| 614 | 3300035725 | Ga0373947_0040403 | Ga0373947_0040403_591_1478 | 275 |
| 615 | 3300035725 | Ga0373947_0113970 | Ga0373947_0113970_20_904 | 275 |
| 616 | 3300036401 | Ga0373937_0008251 | Ga0373937_0008251_6876_7748 | 275 |
| 617 | 3300036401 | Ga0373937_0208030 | Ga0373937_0208030_721_1608 | 275 |
| 618 | 3300036459 | Ga0372808_001374 | Ga0372808_001374_408_1280 | 275 |
| 619 | 3300037068 | Ga0373925_0003636 | Ga0373925_0003636_1051_1938 | 275 |
| 620 | 3300037068 | Ga0373925_0366846 | Ga0373925_0366846_64_936 | 275 |
| 621 | 3300037418 | Ga0395900_0000361 | Ga0395900_0000361_40992_41864 | 275 |
| 622 | 3300037418 | Ga0395900_0220524 | Ga0395900_0220524_623_1498 | 275 |
| 623 | 3300037471 | Ga0395905_0003578 | Ga0395905_0003578_11859_12740 | 275 |
| 624 | 3300037471 | Ga0395905_0175451 | Ga0395905_0175451_220_1101 | 275 |
| 625 | 3300037471 | Ga0395905_0385997 | Ga0395905_0385997_371_1243 | 275 |
| 626 | 3300038443 | Ga0395901_0113630 | Ga0395901_0113630_904_1785 | 275 |
| 627 | 3300038443 | Ga0395901_0150364 | Ga0395901_0150364_1117_1989 | 275 |
| 628 | 3300038443 | Ga0395901_0436459 | Ga0395901_0436459_133_1017 | 275 |
| 629 | 3300039437 | Ga0436365_1556838 | Ga0436365_1556838_994_1869 | 275 |
| 630 | 3300039438 | Ga0436360_0623528 | Ga0436360_0623528_992_1867 | 275 |
| 631 | 3300039438 | Ga0436360_0700607 | Ga0436360_0700607_104_979 | 275 |
| 632 | 3300039447 | Ga0436361_0266153 | Ga0436361_0266153_986_1864 | 275 |
| 633 | 3300044658 | Ga0466972_0000271 | Ga0466972_0000271_11544_12425 | 275 |
| 634 | 3300044658 | Ga0466972_0034153 | Ga0466972_0034153_1255_2136 | 275 |
| 635 | 3300044683 | Ga0466965_0072568 | Ga0466965_0072568_163_1044 | 275 |
| 636 | 3300044684 | Ga0466966_0004743 | Ga0466966_0004743_5022_5897 | 275 |
| 637 | 3300044693 | Ga0466961_0000859 | Ga0466961_0000859_1280_2155 | 275 |
| 638 | 3300044694 | Ga0466963_0104753 | Ga0466963_0104753_784_1665 | 275 |
| 639 | 3300044706 | Ga0466964_0224184 | Ga0466964_0224184_15_896 | 275 |
| 640 | 3300044735 | Ga0466968_0008864 | Ga0466968_0008864_1779_2651 | 275 |
| 641 | 3300044735 | Ga0466968_0152469 | Ga0466968_0152469_87_968 | 275 |
| 642 | 3300045976 | Ga0466967_0038874 | Ga0466967_0038874_2525_3406 | 275 |
| 643 | 3300046454 | Ga0495592_0007563 | Ga0495592_0007563_6705_7592 | 275 |
| 644 | 3300046455 | Ga0495603_0000676 | Ga0495603_0000676_629_1516 | 275 |
| 645 | 3300046455 | Ga0495603_0038325 | Ga0495603_0038325_1880_2764 | 275 |
| 646 | 3300046455 | Ga0495603_0042593 | Ga0495603_0042593_186_1058 | 275 |
| 647 | 3300046455 | Ga0495603_0068162 | Ga0495603_0068162_800_1672 | 275 |
| 648 | 3300046457 | Ga0495590_0098334 | Ga0495590_0098334_34_915 | 275 |
| 649 | 3300046459 | Ga0495629_0000176 | Ga0495629_0000176_3672_4544 | 275 |
| 650 | 3300046459 | Ga0495629_0003088 | Ga0495629_0003088_11118_12005 | 275 |
| 651 | 3300046459 | Ga0495629_0099781 | Ga0495629_0099781_518_1390 | 275 |
| 652 | 3300046460 | Ga0495638_0020391 | Ga0495638_0020391_616_1497 | 275 |
| 653 | 3300046460 | Ga0495638_0068357 | Ga0495638_0068357_1081_1953 | 275 |
| 654 | 3300046461 | Ga0495641_0008578 | Ga0495641_0008578_3907_4794 | 275 |
| 655 | 3300046461 | Ga0495641_0151142 | Ga0495641_0151142_89_961 | 275 |
| 656 | 3300046462 | Ga0495651_0002298 | Ga0495651_0002298_8519_9391 | 275 |
| 657 | 3300046463 | Ga0495653_0004529 | Ga0495653_0004529_4744_5616 | 275 |
| 658 | 3300046472 | Ga0495580_0009272 | Ga0495580_0009272_554_1441 | 275 |
| 659 | 3300046473 | Ga0495582_0060986 | Ga0495582_0060986_974_1846 | 275 |
| 660 | 3300046475 | Ga0495639_0000726 | Ga0495639_0000726_12804_13691 | 275 |
| 661 | 3300046475 | Ga0495639_0031217 | Ga0495639_0031217_1461_2333 | 275 |
| 662 | 3300046476 | Ga0495662_0000028 | Ga0495662_0000028_27736_28623 | 275 |
| 663 | 3300046477 | Ga0495664_0033761 | Ga0495664_0033761_1848_2735 | 275 |
| 664 | 3300046492 | Ga0495585_0110741 | Ga0495585_0110741_134_1006 | 275 |
| 665 | 3300046499 | Ga0495594_0000020 | Ga0495594_0000020_30413_31300 | 275 |
| 666 | 3300046501 | Ga0495607_0125654 | Ga0495607_0125654_427_1317 | 275 |
| 667 | 3300046506 | Ga0495583_0061413 | Ga0495583_0061413_208_1089 | 275 |
| 668 | 3300046507 | Ga0495606_0182250 | Ga0495606_0182250_75_956 | 275 |
| 669 | 3300046512 | Ga0495610_0091201 | Ga0495610_0091201_356_1246 | 275 |
| 670 | 3300046514 | Ga0495618_0296462 | Ga0495618_0296462_73_945 | 275 |
| 671 | 3300046515 | Ga0495620_0026112 | Ga0495620_0026112_1273_2151 | 275 |
| 672 | 3300046516 | Ga0495628_0004786 | Ga0495628_0004786_8367_9239 | 275 |
| 673 | 3300046516 | Ga0495628_0074309 | Ga0495628_0074309_557_1444 | 275 |
| 674 | 3300046516 | Ga0495628_0114472 | Ga0495628_0114472_310_1197 | 275 |
| 675 | 3300046517 | Ga0495630_0002476 | Ga0495630_0002476_9987_10874 | 275 |
| 676 | 3300046517 | Ga0495630_0439927 | Ga0495630_0439927_14_898 | 275 |
| 677 | 3300046519 | Ga0495632_0008927 | Ga0495632_0008927_5041_5913 | 275 |
| 678 | 3300046523 | Ga0495644_0070482 | Ga0495644_0070482_45_917 | 275 |
| 679 | 3300046524 | Ga0495648_0002422 | Ga0495648_0002422_14637_15524 | 275 |
| 680 | 3300046524 | Ga0495648_0008933 | Ga0495648_0008933_2758_3639 | 275 |
| 681 | 3300046524 | Ga0495648_0065300 | Ga0495648_0065300_944_1825 | 275 |
| 682 | 3300046524 | Ga0495648_0079826 | Ga0495648_0079826_736_1617 | 275 |
| 683 | 3300046529 | Ga0495652_0004769 | Ga0495652_0004769_661_1533 | 275 |
| 684 | 3300046529 | Ga0495652_0063452 | Ga0495652_0063452_1146_2033 | 275 |
| 685 | 3300046530 | Ga0495654_0070787 | Ga0495654_0070787_531_1421 | 275 |
| 686 | 3300046531 | Ga0495665_0000057 | Ga0495665_0000057_18693_19580 | 275 |
| 687 | 3300046533 | Ga0495640_0001533 | Ga0495640_0001533_3637_4509 | 275 |
| 688 | 3300046533 | Ga0495640_0012355 | Ga0495640_0012355_4701_5588 | 275 |
| 689 | 3300046533 | Ga0495640_0064317 | Ga0495640_0064317_1534_2421 | 275 |
| 690 | 3300046535 | Ga0495586_0158752 | Ga0495586_0158752_151_1038 | 275 |
| 691 | 3300046536 | Ga0495587_0000736 | Ga0495587_0000736_2176_3048 | 275 |
| 692 | 3300046536 | Ga0495587_0044061 | Ga0495587_0044061_1069_1956 | 275 |
| 693 | 3300046538 | Ga0495609_0107403 | Ga0495609_0107403_247_1119 | 275 |
| 694 | 3300046543 | Ga0495645_0061248 | Ga0495645_0061248_1233_2105 | 275 |
| 695 | 3300046557 | Ga0495622_0001520 | Ga0495622_0001520_519_1406 | 275 |
| 696 | 3300046557 | Ga0495622_0046695 | Ga0495622_0046695_168_1040 | 275 |
| 697 | 3300046557 | Ga0495622_0139824 | Ga0495622_0139824_169_1050 | 275 |
| 698 | 3300046559 | Ga0495667_0000319 | Ga0495667_0000319_1722_2594 | 275 |
| 699 | 3300046559 | Ga0495667_0020907 | Ga0495667_0020907_2949_3836 | 275 |
| 700 | 3300046559 | Ga0495667_0036184 | Ga0495667_0036184_2225_3112 | 275 |
| 701 | 3300046615 | Ga0495656_0047350 | Ga0495656_0047350_410_1285 | 275 |
| 702 | 3300046615 | Ga0495656_0065840 | Ga0495656_0065840_429_1301 | 275 |
| 703 | 3300046616 | Ga0495668_0089991 | Ga0495668_0089991_693_1565 | 275 |
| 704 | 3300046642 | Ga0495634_0010828 | Ga0495634_0010828_1118_2005 | 275 |
| 705 | 3300046642 | Ga0495634_0030256 | Ga0495634_0030256_2125_2997 | 275 |
| 706 | 3300046642 | Ga0495634_0077148 | Ga0495634_0077148_411_1298 | 275 |
| 707 | 3300046648 | Ga0495611_0162168 | Ga0495611_0162168_23_904 | 275 |
| 708 | 3300046660 | Ga0495625_0216748 | Ga0495625_0216748_176_1048 | 275 |
| 709 | 3300046663 | Ga0495635_0004372 | Ga0495635_0004372_2303_3175 | 275 |
| 710 | 3300046663 | Ga0495635_0005161 | Ga0495635_0005161_7247_8128 | 275 |
| 711 | 3300046663 | Ga0495635_0008850 | Ga0495635_0008850_5559_6446 | 275 |
| 712 | 3300046663 | Ga0495635_0049438 | Ga0495635_0049438_461_1348 | 275 |
| 713 | 3300046663 | Ga0495635_0112460 | Ga0495635_0112460_931_1803 | 275 |
| 714 | 3300046665 | Ga0495661_0100617 | Ga0495661_0100617_307_1185 | 275 |
| 715 | 3300046674 | Ga0495588_0104249 | Ga0495588_0104249_26_907 | 275 |
| 716 | 3300046675 | Ga0495657_0001557 | Ga0495657_0001557_4871_5743 | 275 |
| 717 | 3300046675 | Ga0495657_0044896 | Ga0495657_0044896_1445_2332 | 275 |
| 718 | 3300046678 | Ga0495599_0001378 | Ga0495599_0001378_8059_8931 | 275 |
| 719 | 3300046679 | Ga0495623_0008240 | Ga0495623_0008240_4771_5643 | 275 |
| 720 | 3300046679 | Ga0495623_0010692 | Ga0495623_0010692_193_1080 | 275 |
| 721 | 3300046680 | Ga0495646_0013387 | Ga0495646_0013387_2201_3073 | 275 |
| 722 | 3300046680 | Ga0495646_0016906 | Ga0495646_0016906_3203_4090 | 275 |
| 723 | 3300046680 | Ga0495646_0061905 | Ga0495646_0061905_482_1363 | 275 |
| 724 | 3300046681 | Ga0495647_0038207 | Ga0495647_0038207_520_1407 | 275 |
| 725 | 3300046683 | Ga0495658_0003230 | Ga0495658_0003230_6703_7590 | 275 |
| 726 | 3300046684 | Ga0495669_0049317 | Ga0495669_0049317_439_1311 | 275 |
| 727 | 3300046689 | Ga0495613_0013818 | Ga0495613_0013818_3990_4862 | 275 |
| 728 | 3300046689 | Ga0495613_0076840 | Ga0495613_0076840_1008_1895 | 275 |
| 729 | 3300046689 | Ga0495613_0197209 | Ga0495613_0197209_139_1020 | 275 |
| 730 | 3300046690 | Ga0495624_0007826 | Ga0495624_0007826_5981_6868 | 275 |
| 731 | 3300046690 | Ga0495624_0054083 | Ga0495624_0054083_244_1125 | 275 |
| 732 | 3300046691 | Ga0495670_0029296 | Ga0495670_0029296_1386_2276 | 275 |
| 733 | 3300046692 | Ga0495671_0024554 | Ga0495671_0024554_749_1621 | 275 |
| 734 | 3300046694 | Ga0495649_0093270 | Ga0495649_0093270_484_1356 | 275 |
| 735 | 3300046694 | Ga0495649_0144741 | Ga0495649_0144741_315_1196 | 275 |
| 736 | 3300046809 | Ga0495600_0000314 | Ga0495600_0000314_5346_6218 | 275 |
| 737 | 3300046809 | Ga0495600_0047739 | Ga0495600_0047739_1326_2213 | 275 |
| 738 | 3300046809 | Ga0495600_0092078 | Ga0495600_0092078_399_1280 | 275 |
| 739 | 3300046810 | Ga0495660_0059610 | Ga0495660_0059610_233_1123 | 275 |
| 740 | 3300047315 | Ga0495581_0004028 | Ga0495581_0004028_6935_7822 | 275 |
| 741 | 3300047315 | Ga0495581_0183760 | Ga0495581_0183760_248_1120 | 275 |
| 742 | 3300047317 | Ga0495604_0001137 | Ga0495604_0001137_19021_19893 | 275 |
| 743 | 3300047317 | Ga0495604_0019823 | Ga0495604_0019823_2473_3360 | 275 |
| 744 | 3300047317 | Ga0495604_0202051 | Ga0495604_0202051_457_1329 | 275 |
| 745 | 3300047317 | Ga0495604_0255091 | Ga0495604_0255091_148_1029 | 275 |
| 746 | 3300047319 | Ga0495674_0049164 | Ga0495674_0049164_560_1447 | 275 |
| 747 | 3300047319 | Ga0495674_0099458 | Ga0495674_0099458_1409_2281 | 275 |
| 748 | 3300047320 | Ga0495672_0105469 | Ga0495672_0105469_67_939 | 275 |
| 749 | 3300047321 | Ga0495676_0019882 | Ga0495676_0019882_4426_5313 | 275 |
| 750 | 3300047322 | Ga0495680_0002499 | Ga0495680_0002499_2304_3176 | 275 |
| 751 | 3300047322 | Ga0495680_0019888 | Ga0495680_0019888_2771_3658 | 275 |
| 752 | 3300047322 | Ga0495680_0320383 | Ga0495680_0320383_131_1003 | 275 |
| 753 | 3300047323 | Ga0495683_0110634 | Ga0495683_0110634_177_1058 | 275 |
| 754 | 3300047323 | Ga0495683_0143013 | Ga0495683_0143013_72_944 | 275 |
| 755 | 3300047444 | Ga0495675_0002364 | Ga0495675_0002364_2206_3078 | 275 |
| 756 | 3300047471 | Ga0495684_0000023 | Ga0495684_0000023_87283_88155 | 275 |
| 757 | 3300047673 | Ga0495593_0000165 | Ga0495593_0000165_16663_17550 | 275 |
| 758 | 3300048088 | Ga0495602_0084652 | Ga0495602_0084652_438_1325 | 275 |
| 759 | 3300048089 | Ga0495614_0026074 | Ga0495614_0026074_490_1377 | 275 |
| 760 | 3300048091 | Ga0495626_0035390 | Ga0495626_0035390_1151_2041 | 275 |
| 761 | 3300048904 | Ga0496101_0003066 | Ga0496101_0003066_7982_8854 | 275 |
| 762 | 3300048904 | Ga0496101_0302781 | Ga0496101_0302781_113_994 | 275 |
| 763 | 3300048905 | Ga0496102_0004610 | Ga0496102_0004610_9848_10720 | 275 |
| 764 | 3300048905 | Ga0496102_0256717 | Ga0496102_0256717_570_1451 | 275 |
| 765 | 3300048906 | Ga0496103_0022889 | Ga0496103_0022889_1623_2495 | 275 |
| 766 | 3300048906 | Ga0496103_0049381 | Ga0496103_0049381_735_1616 | 275 |
| 767 | 3300048906 | Ga0496103_0213173 | Ga0496103_0213173_148_1020 | 275 |
| 768 | 3300048907 | Ga0496104_0007966 | Ga0496104_0007966_7177_8049 | 275 |
| 769 | 3300048907 | Ga0496104_0071427 | Ga0496104_0071427_400_1272 | 275 |
| 770 | 3300048907 | Ga0496104_0074057 | Ga0496104_0074057_1486_2367 | 275 |
| 771 | 3300048907 | Ga0496104_0226744 | Ga0496104_0226744_416_1288 | 275 |
| 772 | 3300048907 | Ga0496104_0381733 | Ga0496104_0381733_385_1266 | 275 |
| 773 | 3300048909 | Ga0496106_0000363 | Ga0496106_0000363_18322_19209 | 275 |
| 774 | 3300048909 | Ga0496106_0002373 | Ga0496106_0002373_10882_11754 | 275 |
| 775 | 3300048909 | Ga0496106_0018324 | Ga0496106_0018324_3308_4180 | 275 |
| 776 | 3300048909 | Ga0496106_0071551 | Ga0496106_0071551_459_1331 | 275 |
| 777 | 3300048909 | Ga0496106_0140522 | Ga0496106_0140522_706_1578 | 275 |
| 778 | 3300048910 | Ga0496107_0004064 | Ga0496107_0004064_2869_3741 | 275 |
| 779 | 3300048910 | Ga0496107_0288385 | Ga0496107_0288385_326_1207 | 275 |
| 780 | 3300048911 | Ga0496108_0001361 | Ga0496108_0001361_3706_4578 | 275 |
| 781 | 3300048911 | Ga0496108_0053812 | Ga0496108_0053812_940_1812 | 275 |
| 782 | 3300048911 | Ga0496108_0248371 | Ga0496108_0248371_248_1129 | 275 |
| 783 | 3300048911 | Ga0496108_0271839 | Ga0496108_0271839_325_1206 | 275 |
| 784 | 3300048912 | Ga0496109_0000909 | Ga0496109_0000909_18299_19171 | 275 |
| 785 | 3300048912 | Ga0496109_0078162 | Ga0496109_0078162_2107_2979 | 275 |
| 786 | 3300048912 | Ga0496109_0094294 | Ga0496109_0094294_171_1043 | 275 |
| 787 | 3300048912 | Ga0496109_0199666 | Ga0496109_0199666_763_1638 | 275 |
| 788 | 3300048913 | Ga0496110_0174928 | Ga0496110_0174928_47_928 | 275 |
| 789 | 3300048913 | Ga0496110_0449639 | Ga0496110_0449639_105_986 | 275 |
| 790 | 3300048914 | Ga0496111_0035156 | Ga0496111_0035156_2448_3320 | 275 |
| 791 | 3300048914 | Ga0496111_0046548 | Ga0496111_0046548_1706_2578 | 275 |
| 792 | 3300048914 | Ga0496111_0222257 | Ga0496111_0222257_25_906 | 275 |
| 793 | 3300048915 | Ga0496112_0022560 | Ga0496112_0022560_802_1683 | 275 |
| 794 | 3300048915 | Ga0496112_0124984 | Ga0496112_0124984_959_1831 | 275 |
| 795 | 3300048915 | Ga0496112_0139351 | Ga0496112_0139351_1166_2047 | 275 |
| 796 | 3300048916 | Ga0496113_0046939 | Ga0496113_0046939_650_1522 | 275 |
| 797 | 3300048916 | Ga0496113_0072569 | Ga0496113_0072569_344_1216 | 275 |
| 798 | 3300048916 | Ga0496113_0211950 | Ga0496113_0211950_203_1084 | 275 |
| 799 | 3300048916 | Ga0496113_0236834 | Ga0496113_0236834_334_1215 | 275 |
| 800 | 3300048917 | Ga0496114_0008017 | Ga0496114_0008017_7307_8179 | 275 |
| 801 | 3300048917 | Ga0496114_0047001 | Ga0496114_0047001_2052_2924 | 275 |
| 802 | 3300048917 | Ga0496114_0331126 | Ga0496114_0331126_174_1055 | 275 |
| 803 | 3300048918 | Ga0496115_0000713 | Ga0496115_0000713_11251_12123 | 275 |
| 804 | 3300048918 | Ga0496115_0221328 | Ga0496115_0221328_319_1191 | 275 |
| 805 | 3300048919 | Ga0496116_0001984 | Ga0496116_0001984_5913_6800 | 275 |
| 806 | 3300048919 | Ga0496116_0090520 | Ga0496116_0090520_209_1087 | 275 |
| 807 | 3300048919 | Ga0496116_0094575 | Ga0496116_0094575_305_1189 | 275 |
| 808 | 3300048919 | Ga0496116_0144228 | Ga0496116_0144228_323_1204 | 275 |
| 809 | 3300048920 | Ga0496117_0031332 | Ga0496117_0031332_383_1270 | 275 |
| 810 | 3300048920 | Ga0496117_0116874 | Ga0496117_0116874_488_1369 | 275 |
| 811 | 3300048921 | Ga0496118_0002080 | Ga0496118_0002080_19160_20047 | 275 |
| 812 | 3300048921 | Ga0496118_0036790 | Ga0496118_0036790_496_1380 | 275 |
| 813 | 3300048922 | Ga0496119_0034349 | Ga0496119_0034349_640_1524 | 275 |
| 814 | 3300048922 | Ga0496119_0064294 | Ga0496119_0064294_939_1820 | 275 |
| 815 | 3300048922 | Ga0496119_0070653 | Ga0496119_0070653_799_1689 | 275 |
| 816 | 3300048922 | Ga0496119_0083315 | Ga0496119_0083315_781_1668 | 275 |
| 817 | 3300048923 | Ga0496120_0103576 | Ga0496120_0103576_111_1001 | 275 |
| 818 | 3300048924 | Ga0496121_0000183 | Ga0496121_0000183_80183_81070 | 275 |
| 819 | 3300048924 | Ga0496121_0023725 | Ga0496121_0023725_2728_3612 | 275 |
| 820 | 3300048924 | Ga0496121_0048678 | Ga0496121_0048678_1142_2014 | 275 |
| 821 | 3300048924 | Ga0496121_0092384 | Ga0496121_0092384_186_1073 | 275 |
| 822 | 3300048924 | Ga0496121_0213735 | Ga0496121_0213735_408_1280 | 275 |
| 823 | 3300048925 | Ga0496122_0096872 | Ga0496122_0096872_608_1486 | 275 |
| 824 | 3300048926 | Ga0496123_0035502 | Ga0496123_0035502_1585_2463 | 275 |
| 825 | 3300048927 | Ga0496124_0054405 | Ga0496124_0054405_2401_3273 | 275 |
| 826 | 3300048927 | Ga0496124_0141584 | Ga0496124_0141584_662_1534 | 275 |
| 827 | 3300048928 | Ga0496125_0001713 | Ga0496125_0001713_15331_16209 | 275 |
| 828 | 3300048928 | Ga0496125_0045885 | Ga0496125_0045885_789_1676 | 275 |
| 829 | 3300048928 | Ga0496125_0082701 | Ga0496125_0082701_497_1378 | 275 |
| 830 | 3300048928 | Ga0496125_0090461 | Ga0496125_0090461_1167_2051 | 275 |
| 831 | 3300048928 | Ga0496125_0149418 | Ga0496125_0149418_258_1145 | 275 |
| 832 | 3300048928 | Ga0496125_0237108 | Ga0496125_0237108_266_1147 | 275 |
| 833 | 3300048929 | Ga0496126_0001554 | Ga0496126_0001554_27419_28303 | 275 |
| 834 | 3300048929 | Ga0496126_0008974 | Ga0496126_0008974_5558_6445 | 275 |
| 835 | 3300048929 | Ga0496126_0043018 | Ga0496126_0043018_1254_2138 | 275 |
| 836 | 3300048929 | Ga0496126_0049954 | Ga0496126_0049954_2625_3497 | 275 |
| 837 | 3300048929 | Ga0496126_0057751 | Ga0496126_0057751_2571_3443 | 275 |
| 838 | 3300048929 | Ga0496126_0123540 | Ga0496126_0123540_366_1247 | 275 |
| 839 | 3300048929 | Ga0496126_0180188 | Ga0496126_0180188_344_1225 | 275 |
| 840 | 3300048929 | Ga0496126_0222329 | Ga0496126_0222329_228_1109 | 275 |
| 841 | 3300048929 | Ga0496126_0305602 | Ga0496126_0305602_117_1001 | 275 |
| 842 | 3300048929 | Ga0496126_0329531 | Ga0496126_0329531_262_1143 | 275 |
| 843 | 3300049580 | Ga0501046_0175110 | Ga0501046_0175110_269_1144 | 275 |
| 844 | 3300049581 | Ga0501047_0007147 | Ga0501047_0007147_1960_2835 | 275 |
| 845 | 3300049586 | Ga0501070_0185250 | Ga0501070_0185250_219_1094 | 275 |
| 846 | 3300049590 | Ga0501074_0013775 | Ga0501074_0013775_2087_2962 | 275 |
| 847 | 3300049742 | Ga0501080_0031077 | Ga0501080_0031077_1343_2218 | 275 |
| 848 | 3300049823 | Ga0501044_0100775 | Ga0501044_0100775_1316_2191 | 275 |
| 849 | 3300050492 | nmdc:mga0yw44_171584_c1 | nmdc:mga0yw44_171584_c1_414_1295 | 275 |
| 850 | 3300050492 | nmdc:mga0yw44_24388_c1 | nmdc:mga0yw44_24388_c1_1421_2302 | 275 |
| 851 | 3300050492 | nmdc:mga0yw44_3414_c1 | nmdc:mga0yw44_3414_c1_726_1604 | 275 |
| 852 | 3300050496 | nmdc:mga07m45_185483_c1 | nmdc:mga07m45_185483_c1_123_1004 | 275 |
| 853 | 3300050511 | nmdc:mga08y16_461879_c1 | nmdc:mga08y16_461879_c1_407_1279 | 275 |
| 854 | 3300050512 | nmdc:mga0n895_59753_c1 | nmdc:mga0n895_59753_c1_731_1603 | 275 |
| 855 | 3300050516 | nmdc:mga0sz30_161223_c1 | nmdc:mga0sz30_161223_c1_26_907 | 275 |
| 856 | 3300050516 | nmdc:mga0sz30_40090_c1 | nmdc:mga0sz30_40090_c1_690_1577 | 275 |
| 857 | 3300053077 | Ga0495601_0085798 | Ga0495601_0085798_504_1376 | 275 |
| 858 | 3300053083 | Ga0495655_0014809 | Ga0495655_0014809_417_1298 | 275 |
| 859 | 3300053084 | Ga0495595_0004910 | Ga0495595_0004910_4459_5331 | 275 |
| 860 | 3300053085 | Ga0495619_0000111 | Ga0495619_0000111_24632_25504 | 275 |
| 861 | 3300053086 | Ga0500578_0046581 | Ga0500578_0046581_37_918 | 275 |
| 862 | 3300053086 | Ga0500578_0092145 | Ga0500578_0092145_930_1820 | 275 |
| 863 | 3300053087 | Ga0500643_000015 | Ga0500643_000015_115602_116483 | 275 |
| 864 | 3300053090 | Ga0500646_0011629 | Ga0500646_0011629_1185_2075 | 275 |
| 865 | 3300053091 | Ga0500647_0079290 | Ga0500647_0079290_585_1457 | 275 |
| 866 | 3300053091 | Ga0500647_0148107 | Ga0500647_0148107_31_918 | 275 |
| 867 | 3300053092 | Ga0500583_0135099 | Ga0500583_0135099_136_1008 | 275 |
| 868 | 3300053093 | Ga0500651_0061510 | Ga0500651_0061510_320_1198 | 275 |
| 869 | 3300053093 | Ga0500651_0142764 | Ga0500651_0142764_114_986 | 275 |
| 870 | 3300053094 | Ga0500566_0000028 | Ga0500566_0000028_53445_54317 | 275 |
| 871 | 3300053094 | Ga0500566_0000249 | Ga0500566_0000249_10502_11383 | 275 |
| 872 | 3300053095 | Ga0500640_004300 | Ga0500640_004300_4124_4996 | 275 |
| 873 | 3300053098 | Ga0500650_0019054 | Ga0500650_0019054_728_1618 | 275 |
| 874 | 3300053098 | Ga0500650_0156994 | Ga0500650_0156994_101_973 | 275 |
| 875 | 3300053103 | Ga0500555_003873 | Ga0500555_003873_2168_3040 | 275 |
| 876 | 3300053104 | Ga0500556_0018026 | Ga0500556_0018026_286_1167 | 275 |
| 877 | 3300053105 | Ga0500557_000110 | Ga0500557_000110_20863_21744 | 275 |
| 878 | 3300053109 | Ga0500569_002795 | Ga0500569_002795_1992_2873 | 275 |
| 879 | 3300053111 | Ga0500572_000420 | Ga0500572_000420_1910_2782 | 275 |
| 880 | 3300053111 | Ga0500572_001411 | Ga0500572_001411_3794_4666 | 275 |
| 881 | 3300053111 | Ga0500572_052979 | Ga0500572_052979_31_912 | 275 |
| 882 | 3300053116 | Ga0500592_002327 | Ga0500592_002327_1330_2220 | 275 |
| 883 | 3300053119 | Ga0500595_021757 | Ga0500595_021757_1145_2026 | 275 |
| 884 | 3300053119 | Ga0500595_034855 | Ga0500595_034855_706_1587 | 275 |
| 885 | 3300053119 | Ga0500595_047635 | Ga0500595_047635_237_1124 | 275 |
| 886 | 3300053122 | Ga0500608_040527 | Ga0500608_040527_15_887 | 275 |
| 887 | 3300053123 | Ga0500614_007020 | Ga0500614_007020_957_1829 | 275 |
| 888 | 3300053130 | Ga0500642_0000036 | Ga0500642_0000036_81683_82561 | 275 |
| 889 | 3300053130 | Ga0500642_0000086 | Ga0500642_0000086_23997_24878 | 275 |
| 890 | 3300053130 | Ga0500642_0091684 | Ga0500642_0091684_452_1333 | 275 |
| 891 | 3300053131 | Ga0500652_000837 | Ga0500652_000837_8883_9773 | 275 |
| 892 | 3300053136 | Ga0500559_0000154 | Ga0500559_0000154_50685_51557 | 275 |
| 893 | 3300053136 | Ga0500559_0004402 | Ga0500559_0004402_1320_2192 | 275 |
| 894 | 3300053136 | Ga0500559_0141887 | Ga0500559_0141887_162_1043 | 275 |
| 895 | 3300053139 | Ga0500568_0000599 | Ga0500568_0000599_15127_16017 | 275 |
| 896 | 3300053139 | Ga0500568_0003668 | Ga0500568_0003668_3046_3918 | 275 |
| 897 | 3300053139 | Ga0500568_0008132 | Ga0500568_0008132_41_913 | 275 |
| 898 | 3300053144 | Ga0500585_060742 | Ga0500585_060742_157_1038 | 275 |
| 899 | 3300053145 | Ga0500586_003626 | Ga0500586_003626_1170_2057 | 275 |
| 900 | 3300053148 | Ga0500590_031546 | Ga0500590_031546_360_1232 | 275 |
| 901 | 3300053150 | Ga0500603_001125 | Ga0500603_001125_4024_4896 | 275 |
| 902 | 3300053153 | Ga0500616_0000014 | Ga0500616_0000014_336145_337023 | 275 |
| 903 | 3300053158 | Ga0500627_0019326 | Ga0500627_0019326_92_964 | 275 |
| 904 | 3300053159 | Ga0500630_005371 | Ga0500630_005371_4795_5667 | 275 |
| 905 | 3300053161 | Ga0500634_0031888 | Ga0500634_0031888_743_1621 | 275 |
| 906 | 3300053163 | Ga0500639_000001 | Ga0500639_000001_137824_138696 | 275 |
| 907 | 3300053163 | Ga0500639_065528 | Ga0500639_065528_90_962 | 275 |
| 908 | 3300053177 | Ga0500636_0000151 | Ga0500636_0000151_31877_32758 | 275 |
| 909 | 3300053177 | Ga0500636_0044785 | Ga0500636_0044785_766_1638 | 275 |
| 910 | 3300053177 | Ga0500636_0080452 | Ga0500636_0080452_660_1547 | 275 |
| 911 | 3300053178 | Ga0500637_0105194 | Ga0500637_0105194_569_1456 | 275 |
| 912 | 3300053725 | Ga0500576_052240 | Ga0500576_052240_356_1228 | 275 |
| 913 | 3300053729 | Ga0500625_004369 | Ga0500625_004369_4043_4924 | 275 |
| 914 | 3300053729 | Ga0500625_088820 | Ga0500625_088820_421_1302 | 275 |
| 915 | 3300053730 | Ga0500645_040559 | Ga0500645_040559_130_1008 | 275 |
| 916 | 3300053731 | Ga0500609_003486 | Ga0500609_003486_1061_1942 | 275 |
| 917 | 3300053735 | Ga0500596_000667 | Ga0500596_000667_890_1762 | 275 |
| 918 | 3300053735 | Ga0500596_002168 | Ga0500596_002168_2277_3149 | 275 |
| 919 | 3300053736 | Ga0500599_004427 | Ga0500599_004427_711_1592 | 275 |
| 920 | 3300053737 | Ga0500601_000098 | Ga0500601_000098_4756_5637 | 275 |
| 921 | iso_pu_bacteria | 2893066018 | 2893071333 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF14833
NAD_binding_11
NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
164
285
0.88
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j34-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. | 0.9553 | 1 | 30 |
| 6lkd-assembly1.cif.gz_A | in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor | 0.9416 | 2 | 30 |
| 3pef-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ | 0.9289 | 1 | 271 |
| 3pdu-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ | 0.9254 | 1 | 273 |
| 6lke-assembly1.cif.gz_B | in meso full-length rat kmo in complex with an inhibitor identified via dna-encoded chemical library screening | 0.9195 | 2 | 30 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ckyD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.95 | 50 | 147 | 3.40.50.720 |
| af_O15229_1_369_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9387 | 2 | 30 | 3.50.50.60 |
| af_P0A9V8_1_162_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9239 | 1 | 143 | 3.40.50.720 |
| af_F1QE62_28_195_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9221 | 2 | 149 | 3.40.50.720 |
| af_A0A1D6LWN3_490_603_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9192 | 150 | 258 | 1.10.1040.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X6ISJ6-F1-model_v4 | deleted | 0.9693 | 50 | 159 |
|
| AF-A0A352NJE8-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9685 | 57 | 162 |
GO:0016616
GO:0050661 |
| AF-A0A183U7X3-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) | 0.9588 | 70 | 155 |
GO:0005739
GO:0006574 GO:0008442 GO:0050661 |
| AF-A0A352S2Q2-F1-model_v4 | 2-hydroxy-3-oxopropionate reductase | 0.9585 | 57 | 144 |
GO:0050661
|
| AF-A0A4R3T858-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase | 0.952 | 3 | 271 |
GO:0016054
GO:0016491 GO:0050661 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar