F485756

General Info

Members Datasets Scaffolds Average Seq Length
921 564 726 290

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10074179|Ga0081455_100741792
Length 292
Sequence MPRVAFIGLGRMGHGMAGRYLDAGFSVQVWNRSQKKADDLIARGAEWGSSPMRAAEDADAVVTMVADDEASREVWLGEKGVLASWQPDRIAIECSTVSYDHARDLGRKLGWRRISYIDCPVTGLPDAAASGKLTLLVGADAADLERARPFLEPLGTIRHFGPVGSGTIYKLINNLMGAIQIAGLAEGLAIAEQAGLDMNLVLEAIQSGVTASPQVLRHSKRMVARDFAGATFTAALRHKDAAYAVALADSLLADKPLVGRAAVEAYARAKAVIPDDDEGKMIEIVSRPKGRD

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
23 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
24 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
25 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
26 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
27 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
28 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
29 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
30 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
31 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
32 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
33 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
34 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
35 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
36 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
37 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
38 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
39 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
40 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
41 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
42 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
43 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
44 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
45 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
46 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
47 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
48 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
49 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
50 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
51 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
52 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
53 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
54 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
55 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
56 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
57 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
58 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
59 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
60 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
61 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
62 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
63 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
64 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
65 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
66 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
67 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
68 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
69 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
70 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
71 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
72 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
73 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
74 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
75 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
76 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
77 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
78 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
79 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
80 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
81 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
82 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
83 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
84 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
85 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
86 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
87 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
88 2906610324
89 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
90 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
91 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
92 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
93 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
94 2922368715
95 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
96 2922425934
97 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
98 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
99 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
100 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
101 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
102 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
103 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
104 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
105 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
106 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
107 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
108 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
109 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
110 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
111 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
112 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
113 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
114 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
115 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
116 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
117 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
118 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
119 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
120 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
121 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
122 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
123 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
124 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
125 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
126 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
127 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
128 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
129 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
130 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
131 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
132 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
133 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
134 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
135 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
136 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
137 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
138 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
139 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
140 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
141 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
142 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
143 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
144 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
145 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
146 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
147 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
148 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
149 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
150 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
151 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
152 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
153 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
154 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
155 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
156 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
157 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
158 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
159 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
160 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
161 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
162 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
163 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
164 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
165 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
166 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
167 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
168 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
169 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
170 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
171 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
172 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
173 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
174 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
175 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
176 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
177 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
178 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
179 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
180 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
181 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
182 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
183 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
184 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
185 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
186 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
187 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
188 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
189 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
190 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
191 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
192 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
193 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
194 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
195 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
196 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
197 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
198 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
199 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
200 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
201 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
202 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
203 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
204 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
205 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
206 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
207 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
208 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
209 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
210 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
211 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
212 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
213 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
214 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
215 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
216 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
217 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
218 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
219 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
220 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
221 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
222 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
223 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
224 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
225 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
226 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
227 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
228 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
229 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
230 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
231 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
232 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
233 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
234 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
235 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
236 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
237 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
238 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
239 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
240 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
241 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
242 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
243 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
244 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
245 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
246 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
247 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
248 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
249 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
250 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
251 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
252 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
253 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
254 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
255 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
256 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
260 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
263 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
265 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
308 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
309 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
310 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
311 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
316 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
317 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
318 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
319 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
320 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
321 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
322 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
323 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
324 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
325 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
326 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
327 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
328 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
329 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
330 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
331 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
332 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
333 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
334 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
335 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
336 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
337 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
338 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
339 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
340 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
341 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
342 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
343 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
344 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
345 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
346 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
347 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
348 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
349 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
350 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
351 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
352 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
353 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
354 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
355 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
356 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
357 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
358 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
359 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
360 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
361 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
362 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
363 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
364 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
365 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
366 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
367 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
368 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
369 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
370 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
371 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
372 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
373 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
374 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
375 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
376 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
377 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
378 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
379 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
380 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
381 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
382 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
383 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
384 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
385 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
386 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
387 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
388 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
389 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
390 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
391 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
392 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
393 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
394 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
395 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
396 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
397 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
398 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
399 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
400 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
401 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
402 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
403 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
404 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
405 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
406 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
407 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
408 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
409 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
410 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
411 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
412 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
413 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
414 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
415 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
416 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
417 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
418 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
419 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
420 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
421 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
422 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
423 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
424 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
425 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
426 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
427 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
428 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
429 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
430 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
431 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
432 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
433 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
434 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
435 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
436 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
437 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
438 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
439 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
440 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
441 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
442 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
443 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
444 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
445 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
446 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
447 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
448 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
449 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
450 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
451 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
452 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
453 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
454 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
455 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
456 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
457 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
458 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
459 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
460 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
461 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
462 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
463 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
464 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
465 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
466 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
467 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
468 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
469 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
470 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
471 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
472 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
473 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
474 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
475 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
476 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
479 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
480 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
481 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
482 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
483 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
484 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
485 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
486 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
487 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
488 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
489 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
490 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
491 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
492 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
493 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
494 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
495 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
496 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
497 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
498 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
499 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
500 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
501 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
502 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
503 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
504 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
505 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
506 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
507 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
508 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
509 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
510 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
511 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
512 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
513 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
514 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
515 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
516 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
517 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
518 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
519 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
520 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
521 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
522 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
523 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
524 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
525 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
526 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
527 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
528 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
529 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
530 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
531 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
532 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
533 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
534 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
535 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
536 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
537 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
538 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
539 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
540 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
541 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
542 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
543 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
544 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
545 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
546 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
547 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
548 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
549 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
550 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
551 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
552 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
553 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
554 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
555 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
556 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
557 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
558 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
559 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
560 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
561 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
562 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
563 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
564 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.98
Metatranscriptomes 0.11
Isolates 20.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.6
Nodule 16.72
Rhizoplane 5.75
Rhizosphere 51.36
Stem 0
Stem Tuber 0
Unclassified 13.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001975 3300003215 Bacteria 12154
2 JGI25153J46596_10008298 3300003215 Bacteria 4985
3 JGI25153J46596_10015626 3300003215 Bacteria 3082
4 rootH2_10092826 3300003320 Bacteria 32546
5 JGI25160J50197_1025735 3300003354 Bacteria 1638
6 Ga0055526_1027575 3300003771 Bacteria 1751
7 Ga0065165_1001744 3300005262 Bacteria 21697
8 Ga0065165_1003890 3300005262 Bacteria 9887
9 Ga0065165_1007122 3300005262 Bacteria 5608
10 Ga0070658_10103432 3300005327 Bacteria 2355
11 Ga0070690_100351692 3300005330 Bacteria 1070
12 Ga0068869_100111434 3300005334 Bacteria 2082
13 Ga0070680_100095596 3300005336 Bacteria 2463
14 Ga0070682_100143586 3300005337 Bacteria 1630
15 Ga0070682_100299733 3300005337 Bacteria 1179
16 Ga0070691_10174307 3300005341 Bacteria 1116
17 Ga0070687_100104898 3300005343 Bacteria 1590
18 Ga0070661_100130283 3300005344 Bacteria 1888
19 Ga0070668_100017635 3300005347 Bacteria 5353
20 Ga0070668_100129208 3300005347 Bacteria 2026
21 Ga0070668_100228406 3300005347 Bacteria 1537
22 Ga0070668_100266390 3300005347 Bacteria 1426
23 Ga0070674_100172918 3300005356 Bacteria 1648
24 Ga0070673_100298057 3300005364 Bacteria 1419
25 Ga0070688_100205272 3300005365 Bacteria 1381
26 Ga0070659_100176968 3300005366 Bacteria 1749
27 Ga0070709_10005979 3300005434 Bacteria 6611
28 Ga0070714_100147033 3300005435 Bacteria 2121
29 Ga0070713_100009644 3300005436 Bacteria 6930
30 Ga0070713_100076142 3300005436 Bacteria 2849
31 Ga0070713_100161962 3300005436 Bacteria 1998
32 Ga0070710_10000246 3300005437 Bacteria 25491
33 Ga0070710_10004225 3300005437 Bacteria 6808
34 Ga0070711_100003729 3300005439 Bacteria 8930
35 Ga0070663_100012278 3300005455 Bacteria 5412
36 Ga0070663_100073784 3300005455 Bacteria 2490
37 Ga0070663_100325610 3300005455 Bacteria 1237
38 Ga0070663_100341079 3300005455 Bacteria 1211
39 Ga0070663_100366135 3300005455 Bacteria 1170
40 Ga0070663_100429869 3300005455 Bacteria 1085
41 Ga0070678_100389543 3300005456 Bacteria 1208
42 Ga0070662_100057096 3300005457 Bacteria 2835
43 Ga0070662_100121120 3300005457 Bacteria 2005
44 Ga0070662_100449324 3300005457 Bacteria 1069
45 Ga0070681_10088546 3300005458 Bacteria 3047
46 Ga0070681_10279288 3300005458 Bacteria 1581
47 Ga0070681_10533142 3300005458 Bacteria 1087
48 Ga0070706_100612224 3300005467 Bacteria 1012
49 Ga0070707_100128075 3300005468 Bacteria 2467
50 Ga0070679_100046714 3300005530 Bacteria 4316
51 Ga0070679_100098528 3300005530 Bacteria 2911
52 Ga0070679_100101649 3300005530 Bacteria 2861
53 Ga0070679_100193229 3300005530 Bacteria 2003
54 Ga0070679_100685937 3300005530 Bacteria 967
55 Ga0070684_100079765 3300005535 Bacteria 2894
56 Ga0070684_100147421 3300005535 Bacteria 2131
57 Ga0070684_100198803 3300005535 Bacteria 1825
58 Ga0070697_100024733 3300005536 Bacteria 4782
59 Ga0070697_100234930 3300005536 Bacteria 1564
60 Ga0070686_100204505 3300005544 Bacteria 1418
61 Ga0070686_100412663 3300005544 Bacteria 1030
62 Ga0070693_100184891 3300005547 Bacteria 1344
63 Ga0070665_100062661 3300005548 Bacteria 3728
64 Ga0070665_100274524 3300005548 Bacteria 1687
65 Ga0070665_100294346 3300005548 Bacteria 1626
66 Ga0068855_100093456 3300005563 Bacteria 3468
67 Ga0068855_100135169 3300005563 Bacteria 2813
68 Ga0068855_100156301 3300005563 Bacteria 2591
69 Ga0068855_100330249 3300005563 Bacteria 1683
70 Ga0068855_100334599 3300005563 Bacteria 1671
71 Ga0068857_100238179 3300005577 Bacteria 1666
72 Ga0068854_100094706 3300005578 Bacteria 2228
73 Ga0068854_100275322 3300005578 Bacteria 1353
74 Ga0068856_100003004 3300005614 Bacteria 17269
75 Ga0068856_100034334 3300005614 Bacteria 4968
76 Ga0068856_100570670 3300005614 Bacteria 1153
77 Ga0070702_100124688 3300005615 Bacteria 1618
78 Ga0068852_100049804 3300005616 Bacteria 3585
79 Ga0068852_100211194 3300005616 Bacteria 1841
80 Ga0068859_100161007 3300005617 Bacteria 2323
81 Ga0068864_100552636 3300005618 Bacteria 1113
82 Ga0068861_100297464 3300005719 Bacteria 1396
83 Ga0068851_10112618 3300005834 Bacteria 1454
84 Ga0068858_100314985 3300005842 Bacteria 1494
85 Ga0068860_100595316 3300005843 Bacteria 1111
86 Ga0068862_100226788 3300005844 Bacteria 1693
87 Ga0068862_100228430 3300005844 Bacteria 1687
88 Ga0068862_100580673 3300005844 Bacteria 1074
89 Ga0081455_10074179 3300005937 Bacteria 2811
90 Ga0081455_10084110 3300005937 Bacteria 2598
91 Ga0081540_1005800 3300005983 Bacteria 9137
92 Ga0081540_1006577 3300005983 Bacteria 8435
93 Ga0081540_1010678 3300005983 Bacteria 6194
94 Ga0081539_10000616 3300005985 Bacteria 72108
95 Ga0070717_10085820 3300006028 Bacteria 2650
96 Ga0075365_10006882 3300006038 Bacteria 6310
97 Ga0075365_10335431 3300006038 Bacteria 1065
98 Ga0075363_100081222 3300006048 Bacteria 1773
99 Ga0075364_10259823 3300006051 Bacteria 1180
100 Ga0070716_100015027 3300006173 Bacteria 3973
101 Ga0070716_100298926 3300006173 Bacteria 1119
102 Ga0070712_100006021 3300006175 Bacteria 7505
103 Ga0070712_100009398 3300006175 Bacteria 6159
104 Ga0070712_100179306 3300006175 Bacteria 1650
105 Ga0070712_100326598 3300006175 Bacteria 1249
106 Ga0075366_10095091 3300006195 Bacteria 1786
107 Ga0097621_100078349 3300006237 Bacteria 2745
108 Ga0075370_10020275 3300006353 Bacteria 3632
109 Ga0075370_10028498 3300006353 Bacteria 3104
110 Ga0075370_10042918 3300006353 Bacteria 2555
111 Ga0068871_100174650 3300006358 Bacteria 1844
112 Ga0068871_100215575 3300006358 Bacteria 1662
113 Ga0097620_100161013 3300006931 Bacteria 2323
114 Ga0099824_1012782 3300006942 Bacteria 8990
115 Ga0099823_1053392 3300006944 Bacteria 2368
116 Ga0099795_10016821 3300007788 Bacteria 2321
117 Ga0105240_10055530 3300009093 Bacteria 4958
118 Ga0105240_10362726 3300009093 Bacteria 1640
119 Ga0105245_10033500 3300009098 Bacteria 4554
120 Ga0105245_10162980 3300009098 Bacteria 2117
121 Ga0105247_10012294 3300009101 Bacteria 5143
122 Ga0105247_10184937 3300009101 Bacteria 1392
123 Ga0105243_10033316 3300009148 Bacteria 3983
124 Ga0105243_10184381 3300009148 Bacteria 1817
125 Ga0105243_10549905 3300009148 Bacteria 1103
126 Ga0105243_10775032 3300009148 Bacteria 943
127 Ga0105241_10104362 3300009174 Bacteria 2258
128 Ga0105241_10245809 3300009174 Bacteria 1515
129 Ga0105248_10176081 3300009177 Bacteria 2411
130 Ga0105248_10316430 3300009177 Bacteria 1758
131 Ga0105248_10893662 3300009177 Bacteria 1003
132 Ga0105248_10999267 3300009177 Bacteria 945
133 Ga0105237_10009068 3300009545 Bacteria 10692
134 Ga0105237_10024567 3300009545 Bacteria 6162
135 Ga0105237_10064518 3300009545 Bacteria 3658
136 Ga0105237_10090324 3300009545 Bacteria 3052
137 Ga0105237_10390313 3300009545 Bacteria 1397
138 Ga0105237_10983690 3300009545 Bacteria 851
139 Ga0105238_10018050 3300009551 Bacteria 7171
140 Ga0105249_10046943 3300009553 Bacteria 3933
141 Ga0105239_10144007 3300010375 Bacteria 2657
142 Ga0105239_10294016 3300010375 Bacteria 1829
143 Ga0105239_10347853 3300010375 Bacteria 1673
144 Ga0105239_10476786 3300010375 Bacteria 1417
145 Ga0105239_10490236 3300010375 Bacteria 1397
146 Ga0105239_10632922 3300010375 Bacteria 1221
147 Ga0105246_10001247 3300011119 Bacteria 14936
148 Ga0105246_10023452 3300011119 Bacteria 3993
149 Ga0105246_10529800 3300011119 Bacteria 1006
150 Ga0157370_10434784 3300013104 Bacteria 1207
151 Ga0157369_10007417 3300013105 Bacteria 12627
152 Ga0157369_10055013 3300013105 Bacteria 4296
153 Ga0157369_10374003 3300013105 Bacteria 1479
154 Ga0157374_10060187 3300013296 Bacteria 3553
155 Ga0157374_10106184 3300013296 Bacteria 2697
156 Ga0157375_10115127 3300013308 Bacteria 2792
157 Ga0163163_10171210 3300014325 Bacteria 2218
158 Ga0157380_10159931 3300014326 Bacteria 1956
159 Ga0157380_10165663 3300014326 Bacteria 1926
160 Ga0157379_10362535 3300014968 Bacteria 1328
161 Ga0157376_10396519 3300014969 Bacteria 1333
162 Ga0214544_1000002 3300021320 Bacteria 753857
163 Ga0214542_1000001 3300021321 Bacteria 1018696
164 Ga0214542_1020125 3300021321 Bacteria 4998
165 Ga0214545_1000001 3300021324 Bacteria 1092817
166 Ga0214545_1019688 3300021324 Bacteria 5686
167 Ga0214543_1000001 3300021327 Bacteria 776921
168 Ga0213876_10054200 3300021384 Bacteria 2117
169 Ga0209563_101347 3300025230 Bacteria 6692
170 Ga0209677_105719 3300025253 Bacteria 3161
171 Ga0209148_1000356 3300025254 Bacteria 58774
172 Ga0209233_1013020 3300025261 Bacteria 2391
173 Ga0209233_1018847 3300025261 Bacteria 1846
174 Ga0209455_1001391 3300025272 Bacteria 11010
175 Ga0209564_1021717 3300025295 Bacteria 2297
176 Ga0209564_1028213 3300025295 Bacteria 1801
177 Ga0209758_1000021 3300025297 Bacteria 697691
178 Ga0209758_1001565 3300025297 Bacteria 26240
179 Ga0209758_1002055 3300025297 Bacteria 21535
180 Ga0209758_1002832 3300025297 Bacteria 16855
181 Ga0209758_1010040 3300025297 Bacteria 5747
182 Ga0209256_1007804 3300025299 Bacteria 5151
183 Ga0207426_1000599 3300025302 Bacteria 47456
184 Ga0207426_1000960 3300025302 Bacteria 28422
185 Ga0209257_1002984 3300025304 Bacteria 15406
186 Ga0207710_10039499 3300025900 Bacteria 2089
187 Ga0207710_10191953 3300025900 Bacteria 1006
188 Ga0207688_10097624 3300025901 Bacteria 1693
189 Ga0207688_10112391 3300025901 Bacteria 1582
190 Ga0207680_10197117 3300025903 Bacteria 1370
191 Ga0207647_10015833 3300025904 Bacteria 5160
192 Ga0207699_10000230 3300025906 Bacteria 31963
193 Ga0207643_10049112 3300025908 Bacteria 2391
194 Ga0207654_10023543 3300025911 Bacteria 3300
195 Ga0207654_10069921 3300025911 Bacteria 2082
196 Ga0207707_10006249 3300025912 Bacteria 10402
197 Ga0207707_10082921 3300025912 Bacteria 2799
198 Ga0207707_10151536 3300025912 Bacteria 2027
199 Ga0207707_10228240 3300025912 Bacteria 1620
200 Ga0207707_10257088 3300025912 Bacteria 1516
201 Ga0207695_10000015 3300025913 Bacteria 803205
202 Ga0207671_10012975 3300025914 Bacteria 6666
203 Ga0207671_10017413 3300025914 Bacteria 5541
204 Ga0207671_10039046 3300025914 Bacteria 3517
205 Ga0207671_10110789 3300025914 Bacteria 2088
206 Ga0207671_10140237 3300025914 Bacteria 1862
207 Ga0207693_10013717 3300025915 Bacteria 6528
208 Ga0207693_10053863 3300025915 Bacteria 3157
209 Ga0207693_10241507 3300025915 Bacteria 1418
210 Ga0207663_10417254 3300025916 Bacteria 1029
211 Ga0207660_10095217 3300025917 Bacteria 2215
212 Ga0207657_10000784 3300025919 Bacteria 33773
213 Ga0207657_10001921 3300025919 Bacteria 22438
214 Ga0207652_10030541 3300025921 Bacteria 4513
215 Ga0207652_10056039 3300025921 Bacteria 3392
216 Ga0207659_10150696 3300025926 Bacteria 1816
217 Ga0207687_10013817 3300025927 Bacteria 5273
218 Ga0207687_10039262 3300025927 Bacteria 3241
219 Ga0207687_10127151 3300025927 Bacteria 1915
220 Ga0207700_10017514 3300025928 Bacteria 4788
221 Ga0207700_10247910 3300025928 Bacteria 1520
222 Ga0207700_10290213 3300025928 Bacteria 1410
223 Ga0207664_10036404 3300025929 Bacteria 3805
224 Ga0207664_10248450 3300025929 Bacteria 1552
225 Ga0207644_10273179 3300025931 Bacteria 1355
226 Ga0207706_10094861 3300025933 Bacteria 2625
227 Ga0207669_10024600 3300025937 Bacteria 3239
228 Ga0207669_10189885 3300025937 Bacteria 1481
229 Ga0207665_10008093 3300025939 Bacteria 6940
230 Ga0207665_10209643 3300025939 Bacteria 1423
231 Ga0207691_10091630 3300025940 Bacteria 2723
232 Ga0207691_10334804 3300025940 Bacteria 1296
233 Ga0207711_10218197 3300025941 Bacteria 1744
234 Ga0207711_10455833 3300025941 Bacteria 1190
235 Ga0207689_10016212 3300025942 Bacteria 6311
236 Ga0207661_10032763 3300025944 Bacteria 4029
237 Ga0207661_10209337 3300025944 Bacteria 1718
238 Ga0207679_10322682 3300025945 Bacteria 1338
239 Ga0207667_10075059 3300025949 Bacteria 3511
240 Ga0207667_10255570 3300025949 Bacteria 1792
241 Ga0207667_10328928 3300025949 Bacteria 1560
242 Ga0207712_10131990 3300025961 Bacteria 1905
243 Ga0207668_10103257 3300025972 Bacteria 2122
244 Ga0207677_10085737 3300026023 Bacteria 2274
245 Ga0207703_10075271 3300026035 Bacteria 2797
246 Ga0207639_10034763 3300026041 Bacteria 3727
247 Ga0207678_10007958 3300026067 Bacteria 9348
248 Ga0207678_10027287 3300026067 Bacteria 4979
249 Ga0207678_10076754 3300026067 Bacteria 2862
250 Ga0207678_10084268 3300026067 Bacteria 2718
251 Ga0207678_10099919 3300026067 Bacteria 2478
252 Ga0207678_10137238 3300026067 Bacteria 2087
253 Ga0207702_10000442 3300026078 Bacteria 47074
254 Ga0207702_10507371 3300026078 Bacteria 1176
255 Ga0207641_10291004 3300026088 Bacteria 1540
256 Ga0207641_10341726 3300026088 Bacteria 1425
257 Ga0207676_10057929 3300026095 Bacteria 3053
258 Ga0207675_100131335 3300026118 Bacteria 2375
259 Ga0207675_100685634 3300026118 Bacteria 1033
260 Ga0207683_10045508 3300026121 Bacteria 3838
261 Ga0207683_10099403 3300026121 Bacteria 2597
262 Ga0207683_10130722 3300026121 Bacteria 2258
263 Ga0207683_10302139 3300026121 Bacteria 1464
264 Ga0207698_10115013 3300026142 Bacteria 2264
265 Ga0207698_10188264 3300026142 Bacteria 1835
266 Ga0207698_10456806 3300026142 Bacteria 1234
267 Ga0209389_1000008 3300027296 Bacteria 227385
268 Ga0209389_1000121 3300027296 Bacteria 70490
269 Ga0209589_1002735 3300027357 Bacteria 30739
270 Ga0209489_101490 3300027361 Bacteria 48185
271 Ga0209489_103445 3300027361 Bacteria 30849
272 Ga0209700_100036 3300027363 Bacteria 187888
273 Ga0209179_1017416 3300027512 Bacteria 1361
274 Ga0268266_10008371 3300028379 Bacteria 9197
275 Ga0268266_10151361 3300028379 Bacteria 2091
276 Ga0268266_10479226 3300028379 Bacteria 1186
277 Ga0268265_10097945 3300028380 Bacteria 2361
278 Ga0268265_10130921 3300028380 Bacteria 2084
279 Ga0268265_10566576 3300028380 Bacteria 1080
280 Ga0268264_10041134 3300028381 Bacteria 3821
281 Ga0268264_10268499 3300028381 Bacteria 1593
282 Ga0265337_1012538 3300028556 Bacteria 2877
283 Ga0265326_10002188 3300028558 Bacteria 6631
284 Ga0265319_1025553 3300028563 Bacteria 2112
285 Ga0265334_10002607 3300028573 Bacteria 8406
286 Ga0265323_10006127 3300028653 Bacteria 5075
287 Ga0265322_10002310 3300028654 Bacteria 5913
288 Ga0265336_10001608 3300028666 Bacteria 10074
289 Ga0307515_10259502 3300028794 Bacteria 1476
290 Ga0265338_10000667 3300028800 Bacteria 59318
291 Ga0265324_10003760 3300029957 Bacteria 7088
292 Ga0307511_10037393 3300030521 Bacteria 4193
293 Ga0265330_10042024 3300031235 Bacteria 2026
294 Ga0265330_10043768 3300031235 Bacteria 1979
295 Ga0265332_10035696 3300031238 Bacteria 2159
296 Ga0265332_10046119 3300031238 Bacteria 1877
297 Ga0265325_10007037 3300031241 Bacteria 6782
298 Ga0265340_10001939 3300031247 Bacteria 11822
299 Ga0265339_10007152 3300031249 Bacteria 7244
300 Ga0265339_10033648 3300031249 Bacteria 2885
301 Ga0265331_10027187 3300031250 Bacteria 2870
302 Ga0265316_10040807 3300031344 Bacteria 3719
303 Ga0265316_10049430 3300031344 Bacteria 3313
304 Ga0265316_10275781 3300031344 Bacteria 1230
305 Ga0307513_10341525 3300031456 Bacteria 1248
306 Ga0307509_10021973 3300031507 Bacteria 7203
307 Ga0307509_10048183 3300031507 Bacteria 4578
308 Ga0307509_10115985 3300031507 Bacteria 2668
309 Ga0307509_10443253 3300031507 Bacteria 994
310 Ga0307508_10000010 3300031616 Bacteria 255747
311 Ga0307508_10058073 3300031616 Bacteria 3424
312 Ga0307508_10141390 3300031616 Bacteria 2011
313 Ga0307508_10239049 3300031616 Bacteria 1414
314 Ga0307508_10309890 3300031616 Bacteria 1171
315 Ga0265342_10011179 3300031712 Bacteria 6160
316 Ga0265342_10042235 3300031712 Bacteria 2756
317 Ga0265342_10077343 3300031712 Bacteria 1927
318 Ga0307516_10067904 3300031730 Bacteria 3434
319 Ga0307516_10083248 3300031730 Bacteria 3041
320 Ga0307516_10329853 3300031730 Bacteria 1195
321 Ga0307412_10029689 3300031911 Bacteria 3434
322 Ga0307416_100380139 3300032002 Bacteria 1442
323 Ga0307415_100019128 3300032126 Bacteria 4152
324 Ga0307507_10019430 3300033179 Bacteria 7651
325 Ga0307510_10006860 3300033180 Bacteria 13587
326 Ga0307510_10039226 3300033180 Bacteria 5221
327 Ga0307510_10040547 3300033180 Bacteria 5110
328 Ga0307510_10082351 3300033180 Bacteria 3114
329 Ga0315911_1000001 3300033442 Bacteria 1088602
330 Ga0373934_0001152 3300035086 Bacteria 9636
331 Ga0373944_0049829 3300035089 Bacteria 1317
332 Ga0373923_0045255 3300035111 Bacteria 1827
333 Ga0373923_0084259 3300035111 Bacteria 1382
334 Ga0373936_0002224 3300035113 Bacteria 7245
335 Ga0373945_0019944 3300035116 Bacteria 2292
336 Ga0373953_0015420 3300035117 Bacteria 2769
337 Ga0373953_0046250 3300035117 Bacteria 1747
338 Ga0373953_0157161 3300035117 Bacteria 976
339 Ga0373954_0000976 3300035118 Bacteria 11241
340 Ga0373956_0011303 3300035119 Bacteria 3677
341 Ga0373956_0104783 3300035119 Bacteria 1314
342 Ga0373957_0036311 3300035120 Bacteria 1835
343 Ga0373943_0008520 3300035170 Bacteria 4599
344 Ga0373943_0026179 3300035170 Bacteria 2731
345 Ga0373943_0058452 3300035170 Bacteria 1919
346 Ga0373946_0022683 3300035171 Bacteria 2446
347 Ga0373955_0000198 3300035172 Bacteria 24944
348 Ga0373931_0310314 3300035691 Bacteria 977
349 Ga0373935_0426267 3300035692 Bacteria 955
350 Ga0373927_0011994 3300035695 Bacteria 5765
351 Ga0373927_0012818 3300035695 Bacteria 5576
352 Ga0373927_0055937 3300035695 Bacteria 2550
353 Ga0373927_0190737 3300035695 Bacteria 1345
354 Ga0373927_0235662 3300035695 Bacteria 1202
355 Ga0373933_0000274 3300035724 Bacteria 33544
356 Ga0373933_0000475 3300035724 Bacteria 25100
357 Ga0373933_0121136 3300035724 Bacteria 1638
358 Ga0373933_0154998 3300035724 Bacteria 1452
359 Ga0373947_0008223 3300035725 Bacteria 6015
360 Ga0373947_0040403 3300035725 Bacteria 2778
361 Ga0373947_0113970 3300035725 Bacteria 1711
362 Ga0373937_0008251 3300036401 Bacteria 9043
363 Ga0373937_0123251 3300036401 Bacteria 2416
364 Ga0373937_0208030 3300036401 Bacteria 1840
365 Ga0372808_001374 3300036459 Bacteria 2501
366 Ga0373925_0003636 3300037068 Bacteria 11883
367 Ga0373925_0085716 3300037068 Bacteria 2401
368 Ga0373925_0366846 3300037068 Bacteria 1171
369 Ga0395900_0000361 3300037418 Bacteria 65918
370 Ga0395900_0220524 3300037418 Bacteria 1912
371 Ga0395905_0003578 3300037471 Bacteria 16545
372 Ga0395905_0175451 3300037471 Bacteria 2012
373 Ga0395905_0385997 3300037471 Bacteria 1295
374 Ga0395901_0113630 3300038443 Bacteria 2844
375 Ga0395901_0150364 3300038443 Bacteria 2447
376 Ga0395901_0436459 3300038443 Bacteria 1341
377 Ga0436365_1361494 3300039437 Bacteria 15892
378 Ga0436365_1556838 3300039437 Bacteria 2735
379 Ga0436360_0623528 3300039438 Bacteria 2229
380 Ga0436360_0700607 3300039438 Bacteria 2608
381 Ga0436361_0266153 3300039447 Bacteria 2518
382 Ga0466972_0000271 3300044658 Bacteria 32697
383 Ga0466972_0034153 3300044658 Bacteria 2493
384 Ga0466965_0072568 3300044683 Bacteria 1732
385 Ga0466966_0004743 3300044684 Bacteria 8946
386 Ga0466961_0000859 3300044693 Bacteria 18957
387 Ga0466963_0104753 3300044694 Bacteria 1938
388 Ga0466964_0224184 3300044706 Bacteria 914
389 Ga0466968_0008864 3300044735 Bacteria 3860
390 Ga0466968_0152469 3300044735 Bacteria 1063
391 Ga0466957_0026509 3300044842 Bacteria 3439
392 Ga0466967_0038874 3300045976 Bacteria 4084
393 Ga0495592_0007563 3300046454 Bacteria 8138
394 Ga0495603_0000676 3300046455 Bacteria 19328
395 Ga0495603_0038325 3300046455 Bacteria 2874
396 Ga0495603_0042593 3300046455 Bacteria 2713
397 Ga0495603_0068162 3300046455 Bacteria 2093
398 Ga0495603_0170693 3300046455 Bacteria 1260
399 Ga0495590_0098334 3300046457 Bacteria 1039
400 Ga0495629_0000176 3300046459 Bacteria 56922
401 Ga0495629_0003088 3300046459 Bacteria 12634
402 Ga0495629_0099781 3300046459 Bacteria 2026
403 Ga0495638_0020391 3300046460 Bacteria 4381
404 Ga0495638_0068357 3300046460 Bacteria 2178
405 Ga0495641_0008578 3300046461 Bacteria 6198
406 Ga0495641_0151142 3300046461 Bacteria 1038
407 Ga0495651_0002298 3300046462 Bacteria 14746
408 Ga0495653_0004529 3300046463 Bacteria 11230
409 Ga0495580_0009272 3300046472 Bacteria 7744
410 Ga0495580_0069423 3300046472 Bacteria 2462
411 Ga0495582_0060986 3300046473 Bacteria 2082
412 Ga0495639_0000726 3300046475 Bacteria 15095
413 Ga0495639_0022248 3300046475 Bacteria 2780
414 Ga0495639_0031217 3300046475 Bacteria 2371
415 Ga0495662_0000028 3300046476 Bacteria 51556
416 Ga0495662_0236814 3300046476 Bacteria 900
417 Ga0495664_0025560 3300046477 Bacteria 3439
418 Ga0495664_0033761 3300046477 Bacteria 3008
419 Ga0495664_0033832 3300046477 Bacteria 3005
420 Ga0495585_0110741 3300046492 Bacteria 1460
421 Ga0495594_0000020 3300046499 Bacteria 80534
422 Ga0495594_0083293 3300046499 Bacteria 1788
423 Ga0495607_0125654 3300046501 Bacteria 1341
424 Ga0495583_0061413 3300046506 Bacteria 1677
425 Ga0495606_0106731 3300046507 Bacteria 1695
426 Ga0495606_0182250 3300046507 Bacteria 1210
427 Ga0495610_0091201 3300046512 Bacteria 1381
428 Ga0495618_0213140 3300046514 Bacteria 1220
429 Ga0495618_0296462 3300046514 Bacteria 1005
430 Ga0495620_0026112 3300046515 Bacteria 2751
431 Ga0495628_0004786 3300046516 Bacteria 11931
432 Ga0495628_0074309 3300046516 Bacteria 2648
433 Ga0495628_0114472 3300046516 Bacteria 2072
434 Ga0495630_0002476 3300046517 Bacteria 12804
435 Ga0495630_0225061 3300046517 Bacteria 1432
436 Ga0495630_0439927 3300046517 Bacteria 999
437 Ga0495632_0008927 3300046519 Bacteria 6088
438 Ga0495644_0070482 3300046523 Bacteria 1313
439 Ga0495648_0002422 3300046524 Bacteria 17288
440 Ga0495648_0008933 3300046524 Bacteria 7831
441 Ga0495648_0065300 3300046524 Bacteria 2140
442 Ga0495648_0079826 3300046524 Bacteria 1866
443 Ga0495666_0030178 3300046526 Bacteria 2663
444 Ga0495652_0004769 3300046529 Bacteria 12904
445 Ga0495652_0063452 3300046529 Bacteria 3110
446 Ga0495652_0120212 3300046529 Bacteria 2097
447 Ga0495654_0070787 3300046530 Bacteria 1653
448 Ga0495665_0000057 3300046531 Bacteria 44876
449 Ga0495665_0065399 3300046531 Bacteria 1919
450 Ga0495640_0001533 3300046533 Bacteria 18200
451 Ga0495640_0012355 3300046533 Bacteria 6527
452 Ga0495640_0064317 3300046533 Bacteria 2481
453 Ga0495586_0158752 3300046535 Bacteria 1275
454 Ga0495587_0000736 3300046536 Bacteria 21940
455 Ga0495587_0044061 3300046536 Bacteria 2655
456 Ga0495609_0107403 3300046538 Bacteria 1206
457 Ga0495645_0061248 3300046543 Bacteria 2727
458 Ga0495622_0001520 3300046557 Bacteria 11590
459 Ga0495622_0046695 3300046557 Bacteria 2012
460 Ga0495622_0139824 3300046557 Bacteria 1100
461 Ga0495667_0000319 3300046559 Bacteria 30374
462 Ga0495667_0020907 3300046559 Bacteria 4417
463 Ga0495667_0036184 3300046559 Bacteria 3296
464 Ga0495656_0047350 3300046615 Bacteria 1823
465 Ga0495656_0065840 3300046615 Bacteria 1594
466 Ga0495668_0025829 3300046616 Bacteria 3336
467 Ga0495668_0089991 3300046616 Bacteria 1681
468 Ga0495634_0010828 3300046642 Bacteria 6668
469 Ga0495634_0030256 3300046642 Bacteria 3741
470 Ga0495634_0037223 3300046642 Bacteria 3326
471 Ga0495634_0077148 3300046642 Bacteria 2186
472 Ga0495611_0162168 3300046648 Bacteria 1045
473 Ga0495625_0216748 3300046660 Bacteria 1256
474 Ga0495635_0004372 3300046663 Bacteria 9784
475 Ga0495635_0005161 3300046663 Bacteria 9091
476 Ga0495635_0008850 3300046663 Bacteria 7027
477 Ga0495635_0049438 3300046663 Bacteria 2898
478 Ga0495635_0112460 3300046663 Bacteria 1860
479 Ga0495661_0100617 3300046665 Bacteria 1627
480 Ga0495588_0104249 3300046674 Bacteria 1492
481 Ga0495588_0260481 3300046674 Bacteria 914
482 Ga0495657_0001557 3300046675 Bacteria 19730
483 Ga0495657_0044896 3300046675 Bacteria 3001
484 Ga0495599_0001378 3300046678 Bacteria 13874
485 Ga0495623_0008240 3300046679 Bacteria 6779
486 Ga0495623_0010692 3300046679 Bacteria 5941
487 Ga0495646_0013387 3300046680 Bacteria 5214
488 Ga0495646_0016906 3300046680 Bacteria 4632
489 Ga0495646_0061905 3300046680 Bacteria 2227
490 Ga0495647_0038207 3300046681 Bacteria 1814
491 Ga0495658_0003230 3300046683 Bacteria 8117
492 Ga0495669_0049317 3300046684 Bacteria 1885
493 Ga0495613_0013818 3300046689 Bacteria 5990
494 Ga0495613_0076840 3300046689 Bacteria 2429
495 Ga0495613_0197209 3300046689 Bacteria 1421
496 Ga0495624_0007826 3300046690 Bacteria 7500
497 Ga0495624_0054083 3300046690 Bacteria 2532
498 Ga0495670_0029296 3300046691 Bacteria 2732
499 Ga0495671_0024554 3300046692 Bacteria 3138
500 Ga0495649_0093270 3300046694 Bacteria 1603
501 Ga0495649_0144741 3300046694 Bacteria 1250
502 Ga0495600_0000314 3300046809 Bacteria 25635
503 Ga0495600_0047739 3300046809 Bacteria 2793
504 Ga0495600_0092078 3300046809 Bacteria 1977
505 Ga0495660_0059610 3300046810 Bacteria 2052
506 Ga0495581_0004028 3300047315 Bacteria 8459
507 Ga0495581_0183760 3300047315 Bacteria 1223
508 Ga0495581_0305498 3300047315 Bacteria 930
509 Ga0495604_0001137 3300047317 Bacteria 22068
510 Ga0495604_0019823 3300047317 Bacteria 5379
511 Ga0495604_0160501 3300047317 Bacteria 1589
512 Ga0495604_0202051 3300047317 Bacteria 1378
513 Ga0495604_0255091 3300047317 Bacteria 1194
514 Ga0495674_0049164 3300047319 Bacteria 3727
515 Ga0495674_0099458 3300047319 Bacteria 2476
516 Ga0495672_0105469 3300047320 Bacteria 1521
517 Ga0495672_0186351 3300047320 Bacteria 1047
518 Ga0495676_0019882 3300047321 Bacteria 5902
519 Ga0495680_0002499 3300047322 Bacteria 18805
520 Ga0495680_0019888 3300047322 Bacteria 5659
521 Ga0495680_0320383 3300047322 Bacteria 1085
522 Ga0495683_0110634 3300047323 Bacteria 1312
523 Ga0495683_0143013 3300047323 Bacteria 1119
524 Ga0495675_0002364 3300047444 Bacteria 11266
525 Ga0495684_0000023 3300047471 Bacteria 133626
526 Ga0495593_0000165 3300047673 Bacteria 33774
527 Ga0495593_0047522 3300047673 Bacteria 2282
528 Ga0495602_0084652 3300048088 Bacteria 2652
529 Ga0495614_0026074 3300048089 Bacteria 2519
530 Ga0495626_0035390 3300048091 Bacteria 2383
531 Ga0496101_0003066 3300048904 Bacteria 10322
532 Ga0496101_0302781 3300048904 Bacteria 1252
533 Ga0496102_0004610 3300048905 Bacteria 11664
534 Ga0496102_0103280 3300048905 Bacteria 2651
535 Ga0496102_0256717 3300048905 Bacteria 1648
536 Ga0496103_0022889 3300048906 Bacteria 3765
537 Ga0496103_0049381 3300048906 Bacteria 2601
538 Ga0496103_0213173 3300048906 Bacteria 1242
539 Ga0496104_0007966 3300048907 Bacteria 9396
540 Ga0496104_0071427 3300048907 Bacteria 3300
541 Ga0496104_0074057 3300048907 Bacteria 3241
542 Ga0496104_0226744 3300048907 Bacteria 1781
543 Ga0496104_0381733 3300048907 Bacteria 1322
544 Ga0496106_0000363 3300048909 Bacteria 32218
545 Ga0496106_0002373 3300048909 Bacteria 14021
546 Ga0496106_0018324 3300048909 Bacteria 5174
547 Ga0496106_0071551 3300048909 Bacteria 2651
548 Ga0496106_0140522 3300048909 Bacteria 1899
549 Ga0496107_0004064 3300048910 Bacteria 9851
550 Ga0496107_0288385 3300048910 Bacteria 1222
551 Ga0496107_0303768 3300048910 Bacteria 1188
552 Ga0496108_0001361 3300048911 Bacteria 19211
553 Ga0496108_0053812 3300048911 Bacteria 3376
554 Ga0496108_0248371 3300048911 Bacteria 1548
555 Ga0496108_0271839 3300048911 Bacteria 1475
556 Ga0496108_0319094 3300048911 Bacteria 1355
557 Ga0496109_0000909 3300048912 Bacteria 24642
558 Ga0496109_0078162 3300048912 Bacteria 3046
559 Ga0496109_0094294 3300048912 Bacteria 2770
560 Ga0496109_0199666 3300048912 Bacteria 1880
561 Ga0496110_0174928 3300048913 Bacteria 1948
562 Ga0496110_0449639 3300048913 Bacteria 1174
563 Ga0496110_0601561 3300048913 Bacteria 997
564 Ga0496111_0032439 3300048914 Bacteria 3724
565 Ga0496111_0035156 3300048914 Bacteria 3580
566 Ga0496111_0046548 3300048914 Bacteria 3123
567 Ga0496111_0222257 3300048914 Bacteria 1403
568 Ga0496112_0022560 3300048915 Bacteria 5999
569 Ga0496112_0124984 3300048915 Bacteria 2543
570 Ga0496112_0139351 3300048915 Bacteria 2395
571 Ga0496113_0046939 3300048916 Bacteria 3208
572 Ga0496113_0072569 3300048916 Bacteria 2620
573 Ga0496113_0211950 3300048916 Bacteria 1542
574 Ga0496113_0236834 3300048916 Bacteria 1456
575 Ga0496114_0008017 3300048917 Bacteria 8359
576 Ga0496114_0047001 3300048917 Bacteria 3588
577 Ga0496114_0086673 3300048917 Bacteria 2654
578 Ga0496114_0331126 3300048917 Bacteria 1346
579 Ga0496115_0000713 3300048918 Bacteria 24637
580 Ga0496115_0055903 3300048918 Bacteria 3171
581 Ga0496115_0221328 3300048918 Bacteria 1562
582 Ga0496116_0001984 3300048919 Bacteria 22042
583 Ga0496116_0090520 3300048919 Bacteria 1862
584 Ga0496116_0094575 3300048919 Bacteria 1806
585 Ga0496116_0144228 3300048919 Bacteria 1334
586 Ga0496117_0031332 3300048920 Bacteria 4062
587 Ga0496117_0116874 3300048920 Bacteria 1648
588 Ga0496118_0002080 3300048921 Bacteria 28152
589 Ga0496118_0034985 3300048921 Bacteria 4087
590 Ga0496118_0036790 3300048921 Bacteria 3951
591 Ga0496118_0037535 3300048921 Bacteria 3897
592 Ga0496119_0034349 3300048922 Bacteria 3343
593 Ga0496119_0064294 3300048922 Bacteria 2179
594 Ga0496119_0070653 3300048922 Bacteria 2047
595 Ga0496119_0083315 3300048922 Bacteria 1837
596 Ga0496120_0103576 3300048923 Bacteria 1499
597 Ga0496121_0000183 3300048924 Bacteria 139168
598 Ga0496121_0000407 3300048924 Bacteria 85728
599 Ga0496121_0011644 3300048924 Bacteria 9724
600 Ga0496121_0020343 3300048924 Bacteria 6578
601 Ga0496121_0023725 3300048924 Bacteria 5895
602 Ga0496121_0048678 3300048924 Bacteria 3604
603 Ga0496121_0092384 3300048924 Bacteria 2359
604 Ga0496121_0213735 3300048924 Bacteria 1364
605 Ga0496122_0096872 3300048925 Bacteria 1987
606 Ga0496123_0035502 3300048926 Bacteria 3550
607 Ga0496124_0040801 3300048927 Bacteria 4011
608 Ga0496124_0054405 3300048927 Bacteria 3388
609 Ga0496124_0066590 3300048927 Bacteria 2999
610 Ga0496124_0141584 3300048927 Bacteria 1897
611 Ga0496125_0001713 3300048928 Bacteria 30526
612 Ga0496125_0022884 3300048928 Bacteria 5789
613 Ga0496125_0045885 3300048928 Bacteria 3672
614 Ga0496125_0082701 3300048928 Bacteria 2446
615 Ga0496125_0090461 3300048928 Bacteria 2297
616 Ga0496125_0149418 3300048928 Bacteria 1608
617 Ga0496125_0237108 3300048928 Bacteria 1161
618 Ga0496126_0001554 3300048929 Bacteria 35268
619 Ga0496126_0008974 3300048929 Bacteria 10702
620 Ga0496126_0043018 3300048929 Bacteria 4169
621 Ga0496126_0049954 3300048929 Bacteria 3815
622 Ga0496126_0057751 3300048929 Bacteria 3501
623 Ga0496126_0123540 3300048929 Bacteria 2242
624 Ga0496126_0160575 3300048929 Bacteria 1921
625 Ga0496126_0180188 3300048929 Bacteria 1795
626 Ga0496126_0222329 3300048929 Bacteria 1585
627 Ga0496126_0305602 3300048929 Bacteria 1311
628 Ga0496126_0329531 3300048929 Bacteria 1253
629 Ga0501046_0175110 3300049580 Bacteria 1607
630 Ga0501047_0007147 3300049581 Bacteria 10488
631 Ga0501070_0185250 3300049586 Bacteria 1712
632 Ga0501073_0107798 3300049589 Bacteria 1933
633 Ga0501074_0013775 3300049590 Bacteria 5881
634 Ga0501080_0031077 3300049742 Bacteria 4976
635 Ga0501044_0081836 3300049823 Bacteria 3268
636 Ga0501044_0100775 3300049823 Bacteria 2906
637 nmdc:mga03683_109803_c1 3300050489 Bacteria 1218
638 nmdc:mga0yw44_142961_c1 3300050492 Bacteria 1556
639 nmdc:mga0yw44_171584_c1 3300050492 Bacteria 1424
640 nmdc:mga0yw44_24388_c1 3300050492 Bacteria 3422
641 nmdc:mga0yw44_3414_c1 3300050492 Bacteria 7052
642 nmdc:mga07m45_185483_c1 3300050496 Bacteria 1210
643 nmdc:mga08y16_461879_c1 3300050511 Bacteria 1294
644 nmdc:mga0n895_59753_c1 3300050512 Bacteria 3761
645 nmdc:mga0sz30_161223_c1 3300050516 Bacteria 994
646 nmdc:mga0sz30_40090_c1 3300050516 Bacteria 1968
647 Ga0495601_0085798 3300053077 Bacteria 2023
648 Ga0495612_0023453 3300053078 Bacteria 2476
649 Ga0495655_0014809 3300053083 Bacteria 1644
650 Ga0495595_0004910 3300053084 Bacteria 5395
651 Ga0495619_0000111 3300053085 Bacteria 61304
652 Ga0500578_0046581 3300053086 Bacteria 2782
653 Ga0500578_0092145 3300053086 Bacteria 1923
654 Ga0500643_000015 3300053087 Bacteria 310312
655 Ga0500646_0011629 3300053090 Bacteria 2265
656 Ga0500647_0079290 3300053091 Bacteria 1575
657 Ga0500647_0148107 3300053091 Bacteria 1097
658 Ga0500583_0135099 3300053092 Bacteria 1224
659 Ga0500651_0061510 3300053093 Bacteria 2345
660 Ga0500651_0142764 3300053093 Bacteria 1442
661 Ga0500566_0000028 3300053094 Bacteria 75589
662 Ga0500566_0000249 3300053094 Bacteria 28873
663 Ga0500566_0006790 3300053094 Bacteria 6779
664 Ga0500640_004300 3300053095 Bacteria 5154
665 Ga0500650_0019054 3300053098 Bacteria 2987
666 Ga0500650_0119589 3300053098 Bacteria 1228
667 Ga0500650_0156994 3300053098 Bacteria 1050
668 Ga0500555_003873 3300053103 Bacteria 4258
669 Ga0500556_0000004 3300053104 Bacteria 666287
670 Ga0500556_0018026 3300053104 Bacteria 2221
671 Ga0500557_000110 3300053105 Bacteria 23691
672 Ga0500569_002795 3300053109 Bacteria 3482
673 Ga0500572_000420 3300053111 Bacteria 14884
674 Ga0500572_001411 3300053111 Bacteria 6595
675 Ga0500572_052979 3300053111 Bacteria 1214
676 Ga0500592_002327 3300053116 Bacteria 3064
677 Ga0500595_015597 3300053119 Bacteria 2848
678 Ga0500595_021757 3300053119 Bacteria 2284
679 Ga0500595_027140 3300053119 Bacteria 1964
680 Ga0500595_033960 3300053119 Bacteria 1690
681 Ga0500595_034530 3300053119 Bacteria 1672
682 Ga0500595_034855 3300053119 Bacteria 1661
683 Ga0500595_047635 3300053119 Bacteria 1342
684 Ga0500608_008414 3300053122 Bacteria 4334
685 Ga0500608_040527 3300053122 Bacteria 2233
686 Ga0500614_007020 3300053123 Bacteria 2369
687 Ga0500618_009095 3300053125 Bacteria 2731
688 Ga0500642_0000036 3300053130 Bacteria 104249
689 Ga0500642_0000086 3300053130 Bacteria 48427
690 Ga0500642_0091684 3300053130 Bacteria 1405
691 Ga0500652_000837 3300053131 Bacteria 10198
692 Ga0500559_0000154 3300053136 Bacteria 54106
693 Ga0500559_0003041 3300053136 Bacteria 8382
694 Ga0500559_0004402 3300053136 Bacteria 6694
695 Ga0500559_0072859 3300053136 Bacteria 1549
696 Ga0500559_0141887 3300053136 Bacteria 1125
697 Ga0500568_0000599 3300053139 Bacteria 26179
698 Ga0500568_0003668 3300053139 Bacteria 8441
699 Ga0500568_0008132 3300053139 Bacteria 5085
700 Ga0500568_0032225 3300053139 Bacteria 2156
701 Ga0500585_060742 3300053144 Bacteria 1360
702 Ga0500586_003626 3300053145 Bacteria 3677
703 Ga0500590_031546 3300053148 Bacteria 2748
704 Ga0500603_001125 3300053150 Bacteria 6243
705 Ga0500616_0000014 3300053153 Bacteria 637918
706 Ga0500622_0003210 3300053156 Bacteria 11123
707 Ga0500627_0019326 3300053158 Bacteria 2712
708 Ga0500627_0194673 3300053158 Bacteria 910
709 Ga0500630_005371 3300053159 Bacteria 6249
710 Ga0500634_0031888 3300053161 Bacteria 2875
711 Ga0500639_000001 3300053163 Bacteria 244795
712 Ga0500639_065528 3300053163 Bacteria 1863
713 Ga0500636_0000151 3300053177 Bacteria 35998
714 Ga0500636_0005425 3300053177 Bacteria 7278
715 Ga0500636_0044785 3300053177 Bacteria 2609
716 Ga0500636_0080452 3300053177 Bacteria 1877
717 Ga0500637_0105194 3300053178 Bacteria 1636
718 Ga0500576_052240 3300053725 Bacteria 1809
719 Ga0500625_004369 3300053729 Bacteria 5765
720 Ga0500625_088820 3300053729 Bacteria 1329
721 Ga0500645_040559 3300053730 Bacteria 1376
722 Ga0500609_003486 3300053731 Bacteria 2205
723 Ga0500596_000667 3300053735 Bacteria 6644
724 Ga0500596_002168 3300053735 Bacteria 3895
725 Ga0500599_004427 3300053736 Bacteria 1739
726 Ga0500601_000098 3300053737 Bacteria 18298

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025253 Ga0209677_105719 Ga0209677_1057191 250
2 3300006175 Ga0070712_100179306 Ga0070712_1001793063 260
3 3300009545 Ga0105237_10983690 Ga0105237_109836901 260
4 3300048921 Ga0496118_0034985 Ga0496118_0034985_564_1397 260
5 3300048924 Ga0496121_0020343 Ga0496121_0020343_3937_4770 260
6 3300053136 Ga0500559_0072859 Ga0500559_0072859_379_1251 260
7 3300033442 Ga0315911_1000001 Ga0315911_1000001217 263
8 3300049823 Ga0501044_0081836 Ga0501044_0081836_2324_3169 263
9 3300005435 Ga0070714_100147033 Ga0070714_1001470332 264
10 3300005455 Ga0070663_100429869 Ga0070663_1004298691 264
11 3300005458 Ga0070681_10279288 Ga0070681_102792882 264
12 3300009177 Ga0105248_10893662 Ga0105248_108936621 264
13 3300010375 Ga0105239_10144007 Ga0105239_101440072 264
14 3300044842 Ga0466957_0026509 Ga0466957_0026509_1400_2248 264
15 3300046507 Ga0495606_0106731 Ga0495606_0106731_26_874 264
16 3300047315 Ga0495581_0305498 Ga0495581_0305498_24_863 264
17 3300047320 Ga0495672_0186351 Ga0495672_0186351_122_973 264
18 3300048913 Ga0496110_0601561 Ga0496110_0601561_24_863 264
19 3300048918 Ga0496115_0055903 Ga0496115_0055903_1153_2001 264
20 3300048924 Ga0496121_0000407 Ga0496121_0000407_56946_57797 264
21 3300048927 Ga0496124_0040801 Ga0496124_0040801_2877_3719 264
22 3300048927 Ga0496124_0066590 Ga0496124_0066590_2122_2973 264
23 3300048928 Ga0496125_0022884 Ga0496125_0022884_2662_3504 264
24 3300049589 Ga0501073_0107798 Ga0501073_0107798_10_852 264
25 3300053094 Ga0500566_0006790 Ga0500566_0006790_1347_2201 264
26 3300053098 Ga0500650_0119589 Ga0500650_0119589_29_874 264
27 3300053119 Ga0500595_027140 Ga0500595_027140_913_1764 264
28 3300053122 Ga0500608_008414 Ga0500608_008414_926_1780 264
29 3300053125 Ga0500618_009095 Ga0500618_009095_595_1449 264
30 3300053136 Ga0500559_0003041 Ga0500559_0003041_2402_3256 264
31 3300053139 Ga0500568_0032225 Ga0500568_0032225_262_1113 264
32 3300053158 Ga0500627_0194673 Ga0500627_0194673_11_853 264
33 3300053177 Ga0500636_0005425 Ga0500636_0005425_3984_4838 264
34 3300006353 Ga0075370_10020275 Ga0075370_100202752 267
35 3300053156 Ga0500622_0003210 Ga0500622_0003210_7203_8057 267
36 3300005614 Ga0068856_100034334 Ga0068856_1000343342 269
37 3300005616 Ga0068852_100049804 Ga0068852_1000498041 269
38 3300009148 Ga0105243_10184381 Ga0105243_101843811 269
39 3300025937 Ga0207669_10189885 Ga0207669_101898852 269
40 3300026078 Ga0207702_10507371 Ga0207702_105073712 269
41 3300026142 Ga0207698_10456806 Ga0207698_104568062 269
42 3300031238 Ga0265332_10046119 Ga0265332_100461192 269
43 3300046455 Ga0495603_0170693 Ga0495603_0170693_203_1072 269
44 3300046476 Ga0495662_0236814 Ga0495662_0236814_34_888 269
45 3300048917 Ga0496114_0086673 Ga0496114_0086673_785_1654 269
46 iso_pu_bacteria 2513237145 2513915164 270
47 iso_pu_bacteria 2517572143 2517892460 270
48 iso_pu_bacteria 2667528175 2671122431 270
49 iso_pu_bacteria 2906610324 2906618553 270
50 iso_pu_bacteria 2908739725 2908742767 270
51 iso_pu_bacteria 2922425934 2922430210 270
52 iso_pu_bacteria 2941507105 2941511522 270
53 iso_pu_bacteria 2941515067 2941519223 270
54 iso_pu_bacteria 2941523033 2941526197 270
55 iso_pu_bacteria 3005474847 3005480144 270
56 iso_pu_bacteria 8019555841 8019556827 270
57 iso_pu_bacteria 2507262055 2507508672 271
58 iso_pu_bacteria 2508501009 2508542768 271
59 iso_pu_bacteria 2508501042 2508691470 271
60 iso_pu_bacteria 2508501128 2509150423 271
61 iso_pu_bacteria 2511231028 2511395517 271
62 iso_pu_bacteria 2513237092 2513623123 271
63 iso_pu_bacteria 2513237094 2513639054 271
64 iso_pu_bacteria 2513237095 2513645931 271
65 iso_pu_bacteria 2513237102 2513700147 271
66 iso_pu_bacteria 2513237104 2513719536 271
67 iso_pu_bacteria 2513237139 2513872685 271
68 iso_pu_bacteria 2513237141 2513889045 271
69 iso_pu_bacteria 2513237161 2514011937 271
70 iso_pu_bacteria 2515154112 2515628277 271
71 iso_pu_bacteria 2517093001 2517101318 271
72 iso_pu_bacteria 2524023205 2524440484 271
73 iso_pu_bacteria 2602042107 2603859368 271
74 iso_pu_bacteria 2617270735 2617348931 271
75 iso_pu_bacteria 2617270741 2617375851 271
76 iso_pu_bacteria 2744054633 2745075247 271
77 iso_pu_bacteria 2791355196 2793062483 271
78 iso_pu_bacteria 2802429603 2805915417 271
79 iso_pu_bacteria 2816332527 2818239000 271
80 iso_pu_bacteria 2824600985 2824603485 271
81 iso_pu_bacteria 2824609381 2824617604 271
82 iso_pu_bacteria 2824617872 2824625710 271
83 iso_pu_bacteria 2824626560 2824634519 271
84 iso_pu_bacteria 2824635225 2824642035 271
85 iso_pu_bacteria 2824644064 2824650362 271
86 iso_pu_bacteria 2824653114 2824654729 271
87 iso_pu_bacteria 2824661429 2824667458 271
88 iso_pu_bacteria 2824671348 2824675821 271
89 iso_pu_bacteria 2824679649 2824686548 271
90 iso_pu_bacteria 2824687955 2824693111 271
91 iso_pu_bacteria 2824696289 2824701721 271
92 iso_pu_bacteria 2824704595 2824711900 271
93 iso_pu_bacteria 2824714736 2824720230 271
94 iso_pu_bacteria 2824723954 2824730583 271
95 iso_pu_bacteria 2824732956 2824739270 271
96 iso_pu_bacteria 2824746037 2824751593 271
97 iso_pu_bacteria 2824753945 2824762672 271
98 iso_pu_bacteria 2824763712 2824772768 271
99 iso_pu_bacteria 2824773399 2824777671 271
100 iso_pu_bacteria 2838122688 2838123838 271
101 iso_pu_bacteria 2841941048 2841944033 271
102 iso_pu_bacteria 2841949485 2841949938 271
103 iso_pu_bacteria 2841957949 2841958583 271
104 iso_pu_bacteria 2841966195 2841966356 271
105 iso_pu_bacteria 2841974524 2841975090 271
106 iso_pu_bacteria 2841983080 2841983338 271
107 iso_pu_bacteria 2842038055 2842039151 271
108 iso_pu_bacteria 2842045827 2842047902 271
109 iso_pu_bacteria 2844315083 2844319003 271
110 iso_pu_bacteria 2847930680 2847936128 271
111 iso_pu_bacteria 2847939898 2847946479 271
112 iso_pu_bacteria 2849076700 2849079400 271
113 iso_pu_bacteria 2857509624 2857514397 271
114 iso_pu_bacteria 2857524615 2857529219 271
115 iso_pu_bacteria 2874590934 2874593407 271
116 iso_pu_bacteria 2874604998 2874605108 271
117 iso_pu_bacteria 2874612657 2874615222 271
118 iso_pu_bacteria 2874620515 2874627185 271
119 iso_pu_bacteria 2874628541 2874631759 271
120 iso_pu_bacteria 2874645413 2874648962 271
121 iso_pu_bacteria 2876761206 2876767045 271
122 iso_pu_bacteria 2876771140 2876771989 271
123 iso_pu_bacteria 2876818435 2876822066 271
124 iso_pu_bacteria 2879074833 2879075579 271
125 iso_pu_bacteria 2879083081 2879090105 271
126 iso_pu_bacteria 2879099564 2879103273 271
127 iso_pu_bacteria 2879127579 2879130011 271
128 iso_pu_bacteria 2879142872 2879147072 271
129 iso_pu_bacteria 2881364244 2881367023 271
130 iso_pu_bacteria 2881665667 2881671091 271
131 iso_pu_bacteria 2885366525 2885370554 271
132 iso_pu_bacteria 2885409591 2885412140 271
133 iso_pu_bacteria 2888378607 2888383973 271
134 iso_pu_bacteria 2888388044 2888393883 271
135 iso_pu_bacteria 2888419890 2888424384 271
136 iso_pu_bacteria 2903727486 2903729072 271
137 iso_pu_bacteria 2904666416 2904671296 271
138 iso_pu_bacteria 2904711408 2904714527 271
139 iso_pu_bacteria 2906602504 2906610118 271
140 iso_pu_bacteria 2906626472 2906628584 271
141 iso_pu_bacteria 2906643746 2906651183 271
142 iso_pu_bacteria 2908775508 2908780092 271
143 iso_pu_bacteria 2919073203 2919076727 271
144 iso_pu_bacteria 2922368715 2922374297 271
145 iso_pu_bacteria 2922393267 2922396393 271
146 iso_pu_bacteria 2929615660 2929617971 271
147 iso_pu_bacteria 2929624759 2929627652 271
148 iso_pu_bacteria 2932784394 2932788246 271
149 iso_pu_bacteria 2932794094 2932797560 271
150 iso_pu_bacteria 2932801729 2932802876 271
151 iso_pu_bacteria 2932809354 2932810604 271
152 iso_pu_bacteria 2932818245 2932821250 271
153 iso_pu_bacteria 2932828146 2932831243 271
154 iso_pu_bacteria 2933577622 2933579900 271
155 iso_pu_bacteria 2935608549 2935608799 271
156 iso_pu_bacteria 2935616580 2935622961 271
157 iso_pu_bacteria 2935638405 2935642321 271
158 iso_pu_bacteria 2935648319 2935649954 271
159 iso_pu_bacteria 2935656913 2935661894 271
160 iso_pu_bacteria 2935665750 2935668376 271
161 iso_pu_bacteria 2935675223 2935680509 271
162 iso_pu_bacteria 2935684952 2935692821 271
163 iso_pu_bacteria 2935694250 2935700990 271
164 iso_pu_bacteria 2935703347 2935706231 271
165 iso_pu_bacteria 2935713505 2935721454 271
166 iso_pu_bacteria 2935722832 2935730372 271
167 iso_pu_bacteria 2935732158 2935740385 271
168 iso_pu_bacteria 2935741537 2935749649 271
169 iso_pu_bacteria 2935750917 2935759038 271
170 iso_pu_bacteria 2935760218 2935762632 271
171 iso_pu_bacteria 2935769743 2935773211 271
172 iso_pu_bacteria 2935777560 2935778456 271
173 iso_pu_bacteria 2935785616 2935790424 271
174 iso_pu_bacteria 2935793552 2935798153 271
175 iso_pu_bacteria 2935801545 2935803231 271
176 iso_pu_bacteria 2935810662 2935814551 271
177 iso_pu_bacteria 2935819856 2935821959 271
178 iso_pu_bacteria 2935827899 2935831689 271
179 iso_pu_bacteria 2935837841 2935838557 271
180 iso_pu_bacteria 2935847175 2935847541 271
181 iso_pu_bacteria 2935855204 2935861209 271
182 iso_pu_bacteria 2935864058 2935865747 271
183 iso_pu_bacteria 2935873716 2935878248 271
184 iso_pu_bacteria 2935883170 2935885217 271
185 iso_pu_bacteria 2935908558 2935909192 271
186 iso_pu_bacteria 2935916978 2935919913 271
187 iso_pu_bacteria 2935926038 2935926234 271
188 iso_pu_bacteria 2935934488 2935934684 271
189 iso_pu_bacteria 2935942939 2935943134 271
190 iso_pu_bacteria 2935951376 2935951572 271
191 iso_pu_bacteria 2935959822 2935966400 271
192 iso_pu_bacteria 2935967501 2935967697 271
193 iso_pu_bacteria 2935975950 2935977103 271
194 iso_pu_bacteria 2935984226 2935988262 271
195 iso_pu_bacteria 2935992306 2935994561 271
196 iso_pu_bacteria 2936002035 2936007639 271
197 iso_pu_bacteria 2936011229 2936012563 271
198 iso_pu_bacteria 2936019824 2936021127 271
199 iso_pu_bacteria 2936028420 2936029856 271
200 iso_pu_bacteria 2936037263 2936040108 271
201 iso_pu_bacteria 2936046547 2936047321 271
202 iso_pu_bacteria 2936055302 2936057521 271
203 iso_pu_bacteria 2940556831 2940564957 271
204 iso_pu_bacteria 2941531003 2941532672 271
205 iso_pu_bacteria 2941538514 2941538775 271
206 iso_pu_bacteria 3005483717 3005487260 271
207 iso_pu_bacteria 3005506211 3005510252 271
208 iso_pu_bacteria 3005587118 3005591049 271
209 iso_pu_bacteria 3005594810 3005599149 271
210 iso_pu_bacteria 3005710791 3005714814 271
211 iso_pu_bacteria 3005718088 3005722244 271
212 iso_pu_bacteria 8006926726 8006929978 271
213 iso_pu_bacteria 8016511872 8016522433 271
214 iso_pu_bacteria 8016522445 8016529699 271
215 iso_pu_bacteria 8016530956 8016534919 271
216 iso_pu_bacteria 8016539877 8016548129 271
217 iso_pu_bacteria 8016548790 8016553996 271
218 iso_pu_bacteria 8016557553 8016562369 271
219 iso_pu_bacteria 8016566248 8016573262 271
220 iso_pu_bacteria 8016575299 8016577404 271
221 iso_pu_bacteria 8016583857 8016591887 271
222 iso_pu_bacteria 8016595262 8016600173 271
223 iso_pu_bacteria 8016603502 8016610578 271
224 iso_pu_bacteria 8016613128 8016614352 271
225 iso_pu_bacteria 8016622563 8016626633 271
226 iso_pu_bacteria 8016630954 8016640445 271
227 iso_pu_bacteria 8017057580 8017063130 271
228 iso_pu_bacteria 8019538911 8019544793 271
229 iso_pu_bacteria 8019547302 8019553744 271
230 iso_pu_bacteria 8019597564 8019601000 271
231 iso_pu_bacteria 8019608314 8019617550 271
232 iso_pu_bacteria 8019629233 8019634558 271
233 iso_pu_bacteria 8019648815 8019658301 271
234 iso_pu_bacteria 8019659431 8019662451 271
235 iso_pu_bacteria 8019668869 8019671949 271
236 iso_pu_bacteria 8019678201 8019684145 271
237 iso_pu_bacteria 8019687851 8019689982 271
238 iso_pu_bacteria 8055742211 8055746439 271
239 iso_pu_bacteria 8056967851 8056967947 271
240 3300003320 rootH2_10092826 rootH2_1009282617 274
241 3300005337 Ga0070682_100143586 Ga0070682_1001435862 274
242 3300005437 Ga0070710_10000246 Ga0070710_100002466 274
243 3300005458 Ga0070681_10088546 Ga0070681_100885462 274
244 3300005530 Ga0070679_100046714 Ga0070679_1000467145 274
245 3300005530 Ga0070679_100193229 Ga0070679_1001932291 274
246 3300005535 Ga0070684_100079765 Ga0070684_1000797652 274
247 3300005547 Ga0070693_100184891 Ga0070693_1001848911 274
248 3300005563 Ga0068855_100330249 Ga0068855_1003302492 274
249 3300005563 Ga0068855_100334599 Ga0068855_1003345992 274
250 3300005618 Ga0068864_100552636 Ga0068864_1005526362 274
251 3300005937 Ga0081455_10074179 Ga0081455_100741792 274
252 3300005937 Ga0081455_10084110 Ga0081455_100841102 274
253 3300005983 Ga0081540_1005800 Ga0081540_10058004 274
254 3300005983 Ga0081540_1006577 Ga0081540_10065778 274
255 3300005983 Ga0081540_1010678 Ga0081540_10106785 274
256 3300005985 Ga0081539_10000616 Ga0081539_1000061623 274
257 3300006173 Ga0070716_100015027 Ga0070716_1000150273 274
258 3300006358 Ga0068871_100215575 Ga0068871_1002155752 274
259 3300009093 Ga0105240_10362726 Ga0105240_103627262 274
260 3300009177 Ga0105248_10316430 Ga0105248_103164302 274
261 3300010375 Ga0105239_10632922 Ga0105239_106329222 274
262 3300013104 Ga0157370_10434784 Ga0157370_104347842 274
263 3300013105 Ga0157369_10007417 Ga0157369_100074179 274
264 3300013105 Ga0157369_10055013 Ga0157369_100550132 274
265 3300014326 Ga0157380_10165663 Ga0157380_101656632 274
266 3300021384 Ga0213876_10054200 Ga0213876_100542003 274
267 3300025906 Ga0207699_10000230 Ga0207699_1000023024 274
268 3300025912 Ga0207707_10006249 Ga0207707_100062495 274
269 3300025912 Ga0207707_10082921 Ga0207707_100829214 274
270 3300025916 Ga0207663_10417254 Ga0207663_104172542 274
271 3300025917 Ga0207660_10095217 Ga0207660_100952172 274
272 3300025919 Ga0207657_10000784 Ga0207657_1000078428 274
273 3300025921 Ga0207652_10030541 Ga0207652_100305413 274
274 3300025921 Ga0207652_10056039 Ga0207652_100560392 274
275 3300025929 Ga0207664_10036404 Ga0207664_100364042 274
276 3300025939 Ga0207665_10008093 Ga0207665_100080935 274
277 3300025941 Ga0207711_10455833 Ga0207711_104558331 274
278 3300025944 Ga0207661_10032763 Ga0207661_100327631 274
279 3300025949 Ga0207667_10255570 Ga0207667_102555702 274
280 3300026088 Ga0207641_10291004 Ga0207641_102910042 274
281 3300035111 Ga0373923_0084259 Ga0373923_0084259_491_1360 274
282 3300035117 Ga0373953_0157161 Ga0373953_0157161_49_918 274
283 3300035119 Ga0373956_0104783 Ga0373956_0104783_59_928 274
284 3300035170 Ga0373943_0058452 Ga0373943_0058452_530_1399 274
285 3300035171 Ga0373946_0022683 Ga0373946_0022683_1181_2050 274
286 3300035692 Ga0373935_0426267 Ga0373935_0426267_27_896 274
287 3300035695 Ga0373927_0235662 Ga0373927_0235662_21_890 274
288 3300035724 Ga0373933_0121136 Ga0373933_0121136_748_1617 274
289 3300035724 Ga0373933_0154998 Ga0373933_0154998_482_1351 274
290 3300035725 Ga0373947_0008223 Ga0373947_0008223_2126_2995 274
291 3300036401 Ga0373937_0123251 Ga0373937_0123251_801_1670 274
292 3300037068 Ga0373925_0085716 Ga0373925_0085716_1513_2382 274
293 3300039437 Ga0436365_1361494 Ga0436365_1361494_5589_6467 274
294 3300046472 Ga0495580_0069423 Ga0495580_0069423_21_890 274
295 3300046475 Ga0495639_0022248 Ga0495639_0022248_542_1411 274
296 3300046477 Ga0495664_0025560 Ga0495664_0025560_1171_2040 274
297 3300046477 Ga0495664_0033832 Ga0495664_0033832_1485_2354 274
298 3300046499 Ga0495594_0083293 Ga0495594_0083293_721_1590 274
299 3300046514 Ga0495618_0213140 Ga0495618_0213140_287_1156 274
300 3300046517 Ga0495630_0225061 Ga0495630_0225061_163_1032 274
301 3300046526 Ga0495666_0030178 Ga0495666_0030178_776_1645 274
302 3300046529 Ga0495652_0120212 Ga0495652_0120212_747_1616 274
303 3300046531 Ga0495665_0065399 Ga0495665_0065399_611_1480 274
304 3300046616 Ga0495668_0025829 Ga0495668_0025829_1585_2460 274
305 3300046642 Ga0495634_0037223 Ga0495634_0037223_1982_2851 274
306 3300046674 Ga0495588_0260481 Ga0495588_0260481_26_895 274
307 3300047317 Ga0495604_0160501 Ga0495604_0160501_670_1539 274
308 3300047673 Ga0495593_0047522 Ga0495593_0047522_1251_2120 274
309 3300048905 Ga0496102_0103280 Ga0496102_0103280_1359_2228 274
310 3300048910 Ga0496107_0303768 Ga0496107_0303768_169_1038 274
311 3300048911 Ga0496108_0319094 Ga0496108_0319094_422_1297 274
312 3300048914 Ga0496111_0032439 Ga0496111_0032439_1031_1900 274
313 3300048921 Ga0496118_0037535 Ga0496118_0037535_1731_2627 274
314 3300048924 Ga0496121_0011644 Ga0496121_0011644_2369_3265 274
315 3300048929 Ga0496126_0160575 Ga0496126_0160575_623_1501 274
316 3300050489 nmdc:mga03683_109803_c1 nmdc:mga03683_109803_c1_245_1114 274
317 3300050492 nmdc:mga0yw44_142961_c1 nmdc:mga0yw44_142961_c1_397_1266 274
318 3300053078 Ga0495612_0023453 Ga0495612_0023453_1075_1944 274
319 3300053104 Ga0500556_0000004 Ga0500556_0000004_308814_309689 274
320 3300053119 Ga0500595_015597 Ga0500595_015597_797_1672 274
321 3300053119 Ga0500595_033960 Ga0500595_033960_169_1059 274
322 3300053119 Ga0500595_034530 Ga0500595_034530_485_1381 274
323 3300003215 JGI25153J46596_10001975 JGI25153J46596_100019754 275
324 3300003215 JGI25153J46596_10008298 JGI25153J46596_100082985 275
325 3300003215 JGI25153J46596_10015626 JGI25153J46596_100156264 275
326 3300003354 JGI25160J50197_1025735 JGI25160J50197_10257352 275
327 3300003771 Ga0055526_1027575 Ga0055526_10275752 275
328 3300005262 Ga0065165_1001744 Ga0065165_100174414 275
329 3300005262 Ga0065165_1003890 Ga0065165_10038902 275
330 3300005262 Ga0065165_1007122 Ga0065165_10071225 275
331 3300005327 Ga0070658_10103432 Ga0070658_101034322 275
332 3300005330 Ga0070690_100351692 Ga0070690_1003516922 275
333 3300005334 Ga0068869_100111434 Ga0068869_1001114342 275
334 3300005336 Ga0070680_100095596 Ga0070680_1000955963 275
335 3300005337 Ga0070682_100299733 Ga0070682_1002997331 275
336 3300005341 Ga0070691_10174307 Ga0070691_101743071 275
337 3300005343 Ga0070687_100104898 Ga0070687_1001048982 275
338 3300005344 Ga0070661_100130283 Ga0070661_1001302832 275
339 3300005347 Ga0070668_100017635 Ga0070668_1000176352 275
340 3300005347 Ga0070668_100129208 Ga0070668_1001292082 275
341 3300005347 Ga0070668_100228406 Ga0070668_1002284062 275
342 3300005347 Ga0070668_100266390 Ga0070668_1002663901 275
343 3300005356 Ga0070674_100172918 Ga0070674_1001729181 275
344 3300005364 Ga0070673_100298057 Ga0070673_1002980572 275
345 3300005365 Ga0070688_100205272 Ga0070688_1002052722 275
346 3300005366 Ga0070659_100176968 Ga0070659_1001769682 275
347 3300005434 Ga0070709_10005979 Ga0070709_100059792 275
348 3300005436 Ga0070713_100009644 Ga0070713_1000096445 275
349 3300005436 Ga0070713_100076142 Ga0070713_1000761422 275
350 3300005436 Ga0070713_100161962 Ga0070713_1001619621 275
351 3300005437 Ga0070710_10004225 Ga0070710_100042252 275
352 3300005439 Ga0070711_100003729 Ga0070711_1000037293 275
353 3300005455 Ga0070663_100012278 Ga0070663_1000122785 275
354 3300005455 Ga0070663_100073784 Ga0070663_1000737842 275
355 3300005455 Ga0070663_100325610 Ga0070663_1003256101 275
356 3300005455 Ga0070663_100341079 Ga0070663_1003410792 275
357 3300005455 Ga0070663_100366135 Ga0070663_1003661352 275
358 3300005456 Ga0070678_100389543 Ga0070678_1003895432 275
359 3300005457 Ga0070662_100057096 Ga0070662_1000570962 275
360 3300005457 Ga0070662_100121120 Ga0070662_1001211203 275
361 3300005457 Ga0070662_100449324 Ga0070662_1004493241 275
362 3300005458 Ga0070681_10533142 Ga0070681_105331422 275
363 3300005467 Ga0070706_100612224 Ga0070706_1006122241 275
364 3300005468 Ga0070707_100128075 Ga0070707_1001280752 275
365 3300005530 Ga0070679_100098528 Ga0070679_1000985282 275
366 3300005530 Ga0070679_100101649 Ga0070679_1001016492 275
367 3300005530 Ga0070679_100685937 Ga0070679_1006859371 275
368 3300005535 Ga0070684_100147421 Ga0070684_1001474212 275
369 3300005535 Ga0070684_100198803 Ga0070684_1001988032 275
370 3300005536 Ga0070697_100024733 Ga0070697_1000247332 275
371 3300005536 Ga0070697_100234930 Ga0070697_1002349302 275
372 3300005544 Ga0070686_100204505 Ga0070686_1002045051 275
373 3300005544 Ga0070686_100412663 Ga0070686_1004126631 275
374 3300005548 Ga0070665_100062661 Ga0070665_1000626612 275
375 3300005548 Ga0070665_100274524 Ga0070665_1002745242 275
376 3300005548 Ga0070665_100294346 Ga0070665_1002943462 275
377 3300005563 Ga0068855_100093456 Ga0068855_1000934563 275
378 3300005563 Ga0068855_100135169 Ga0068855_1001351692 275
379 3300005563 Ga0068855_100156301 Ga0068855_1001563012 275
380 3300005577 Ga0068857_100238179 Ga0068857_1002381792 275
381 3300005578 Ga0068854_100094706 Ga0068854_1000947062 275
382 3300005578 Ga0068854_100275322 Ga0068854_1002753222 275
383 3300005614 Ga0068856_100003004 Ga0068856_1000030047 275
384 3300005614 Ga0068856_100570670 Ga0068856_1005706702 275
385 3300005615 Ga0070702_100124688 Ga0070702_1001246882 275
386 3300005616 Ga0068852_100211194 Ga0068852_1002111942 275
387 3300005617 Ga0068859_100161007 Ga0068859_1001610072 275
388 3300005719 Ga0068861_100297464 Ga0068861_1002974642 275
389 3300005834 Ga0068851_10112618 Ga0068851_101126182 275
390 3300005842 Ga0068858_100314985 Ga0068858_1003149852 275
391 3300005843 Ga0068860_100595316 Ga0068860_1005953161 275
392 3300005844 Ga0068862_100226788 Ga0068862_1002267882 275
393 3300005844 Ga0068862_100228430 Ga0068862_1002284302 275
394 3300005844 Ga0068862_100580673 Ga0068862_1005806732 275
395 3300006028 Ga0070717_10085820 Ga0070717_100858202 275
396 3300006038 Ga0075365_10006882 Ga0075365_100068822 275
397 3300006038 Ga0075365_10335431 Ga0075365_103354311 275
398 3300006048 Ga0075363_100081222 Ga0075363_1000812222 275
399 3300006051 Ga0075364_10259823 Ga0075364_102598232 275
400 3300006173 Ga0070716_100298926 Ga0070716_1002989262 275
401 3300006175 Ga0070712_100006021 Ga0070712_1000060212 275
402 3300006175 Ga0070712_100009398 Ga0070712_1000093983 275
403 3300006175 Ga0070712_100326598 Ga0070712_1003265982 275
404 3300006195 Ga0075366_10095091 Ga0075366_100950912 275
405 3300006237 Ga0097621_100078349 Ga0097621_1000783492 275
406 3300006353 Ga0075370_10028498 Ga0075370_100284984 275
407 3300006353 Ga0075370_10042918 Ga0075370_100429183 275
408 3300006358 Ga0068871_100174650 Ga0068871_1001746502 275
409 3300006931 Ga0097620_100161013 Ga0097620_1001610132 275
410 3300006942 Ga0099824_1012782 Ga0099824_10127823 275
411 3300006944 Ga0099823_1053392 Ga0099823_10533922 275
412 3300007788 Ga0099795_10016821 Ga0099795_100168213 275
413 3300009093 Ga0105240_10055530 Ga0105240_100555303 275
414 3300009098 Ga0105245_10033500 Ga0105245_100335002 275
415 3300009098 Ga0105245_10162980 Ga0105245_101629802 275
416 3300009101 Ga0105247_10012294 Ga0105247_100122943 275
417 3300009101 Ga0105247_10184937 Ga0105247_101849372 275
418 3300009148 Ga0105243_10033316 Ga0105243_100333163 275
419 3300009148 Ga0105243_10549905 Ga0105243_105499052 275
420 3300009148 Ga0105243_10775032 Ga0105243_107750321 275
421 3300009174 Ga0105241_10104362 Ga0105241_101043622 275
422 3300009174 Ga0105241_10245809 Ga0105241_102458092 275
423 3300009177 Ga0105248_10176081 Ga0105248_101760812 275
424 3300009177 Ga0105248_10999267 Ga0105248_109992671 275
425 3300009545 Ga0105237_10009068 Ga0105237_100090682 275
426 3300009545 Ga0105237_10024567 Ga0105237_100245673 275
427 3300009545 Ga0105237_10064518 Ga0105237_100645182 275
428 3300009545 Ga0105237_10090324 Ga0105237_100903243 275
429 3300009545 Ga0105237_10390313 Ga0105237_103903132 275
430 3300009551 Ga0105238_10018050 Ga0105238_100180505 275
431 3300009553 Ga0105249_10046943 Ga0105249_100469433 275
432 3300010375 Ga0105239_10294016 Ga0105239_102940162 275
433 3300010375 Ga0105239_10347853 Ga0105239_103478532 275
434 3300010375 Ga0105239_10476786 Ga0105239_104767862 275
435 3300010375 Ga0105239_10490236 Ga0105239_104902362 275
436 3300011119 Ga0105246_10001247 Ga0105246_100012479 275
437 3300011119 Ga0105246_10023452 Ga0105246_100234522 275
438 3300011119 Ga0105246_10529800 Ga0105246_105298002 275
439 3300013105 Ga0157369_10374003 Ga0157369_103740032 275
440 3300013296 Ga0157374_10060187 Ga0157374_100601873 275
441 3300013296 Ga0157374_10106184 Ga0157374_101061843 275
442 3300013308 Ga0157375_10115127 Ga0157375_101151272 275
443 3300014325 Ga0163163_10171210 Ga0163163_101712102 275
444 3300014326 Ga0157380_10159931 Ga0157380_101599312 275
445 3300014968 Ga0157379_10362535 Ga0157379_103625352 275
446 3300014969 Ga0157376_10396519 Ga0157376_103965192 275
447 3300021320 Ga0214544_1000002 Ga0214544_1000002513 275
448 3300021321 Ga0214542_1000001 Ga0214542_1000001863 275
449 3300021321 Ga0214542_1020125 Ga0214542_10201254 275
450 3300021324 Ga0214545_1000001 Ga0214545_1000001929 275
451 3300021324 Ga0214545_1019688 Ga0214545_10196885 275
452 3300021327 Ga0214543_1000001 Ga0214543_1000001264 275
453 3300025230 Ga0209563_101347 Ga0209563_1013472 275
454 3300025254 Ga0209148_1000356 Ga0209148_100035631 275
455 3300025261 Ga0209233_1013020 Ga0209233_10130202 275
456 3300025261 Ga0209233_1018847 Ga0209233_10188472 275
457 3300025272 Ga0209455_1001391 Ga0209455_10013917 275
458 3300025295 Ga0209564_1021717 Ga0209564_10217172 275
459 3300025295 Ga0209564_1028213 Ga0209564_10282132 275
460 3300025297 Ga0209758_1000021 Ga0209758_1000021627 275
461 3300025297 Ga0209758_1001565 Ga0209758_100156523 275
462 3300025297 Ga0209758_1002055 Ga0209758_100205518 275
463 3300025297 Ga0209758_1002832 Ga0209758_100283210 275
464 3300025297 Ga0209758_1010040 Ga0209758_10100403 275
465 3300025299 Ga0209256_1007804 Ga0209256_10078044 275
466 3300025302 Ga0207426_1000599 Ga0207426_10005991 275
467 3300025302 Ga0207426_1000960 Ga0207426_10009603 275
468 3300025304 Ga0209257_1002984 Ga0209257_100298411 275
469 3300025900 Ga0207710_10039499 Ga0207710_100394992 275
470 3300025900 Ga0207710_10191953 Ga0207710_101919531 275
471 3300025901 Ga0207688_10097624 Ga0207688_100976242 275
472 3300025901 Ga0207688_10112391 Ga0207688_101123912 275
473 3300025903 Ga0207680_10197117 Ga0207680_101971171 275
474 3300025904 Ga0207647_10015833 Ga0207647_100158332 275
475 3300025908 Ga0207643_10049112 Ga0207643_100491122 275
476 3300025911 Ga0207654_10023543 Ga0207654_100235433 275
477 3300025911 Ga0207654_10069921 Ga0207654_100699212 275
478 3300025912 Ga0207707_10151536 Ga0207707_101515362 275
479 3300025912 Ga0207707_10228240 Ga0207707_102282402 275
480 3300025912 Ga0207707_10257088 Ga0207707_102570882 275
481 3300025913 Ga0207695_10000015 Ga0207695_10000015178 275
482 3300025914 Ga0207671_10012975 Ga0207671_100129755 275
483 3300025914 Ga0207671_10017413 Ga0207671_100174134 275
484 3300025914 Ga0207671_10039046 Ga0207671_100390463 275
485 3300025914 Ga0207671_10110789 Ga0207671_101107891 275
486 3300025914 Ga0207671_10140237 Ga0207671_101402371 275
487 3300025915 Ga0207693_10013717 Ga0207693_100137174 275
488 3300025915 Ga0207693_10053863 Ga0207693_100538632 275
489 3300025915 Ga0207693_10241507 Ga0207693_102415072 275
490 3300025919 Ga0207657_10001921 Ga0207657_1000192115 275
491 3300025926 Ga0207659_10150696 Ga0207659_101506962 275
492 3300025927 Ga0207687_10013817 Ga0207687_100138173 275
493 3300025927 Ga0207687_10039262 Ga0207687_100392622 275
494 3300025927 Ga0207687_10127151 Ga0207687_101271512 275
495 3300025928 Ga0207700_10017514 Ga0207700_100175144 275
496 3300025928 Ga0207700_10247910 Ga0207700_102479102 275
497 3300025928 Ga0207700_10290213 Ga0207700_102902132 275
498 3300025929 Ga0207664_10248450 Ga0207664_102484502 275
499 3300025931 Ga0207644_10273179 Ga0207644_102731792 275
500 3300025933 Ga0207706_10094861 Ga0207706_100948613 275
501 3300025937 Ga0207669_10024600 Ga0207669_100246002 275
502 3300025939 Ga0207665_10209643 Ga0207665_102096432 275
503 3300025940 Ga0207691_10091630 Ga0207691_100916302 275
504 3300025940 Ga0207691_10334804 Ga0207691_103348042 275
505 3300025941 Ga0207711_10218197 Ga0207711_102181972 275
506 3300025942 Ga0207689_10016212 Ga0207689_100162122 275
507 3300025944 Ga0207661_10209337 Ga0207661_102093372 275
508 3300025945 Ga0207679_10322682 Ga0207679_103226822 275
509 3300025949 Ga0207667_10075059 Ga0207667_100750592 275
510 3300025949 Ga0207667_10328928 Ga0207667_103289281 275
511 3300025961 Ga0207712_10131990 Ga0207712_101319902 275
512 3300025972 Ga0207668_10103257 Ga0207668_101032572 275
513 3300026023 Ga0207677_10085737 Ga0207677_100857372 275
514 3300026035 Ga0207703_10075271 Ga0207703_100752713 275
515 3300026041 Ga0207639_10034763 Ga0207639_100347633 275
516 3300026067 Ga0207678_10007958 Ga0207678_100079585 275
517 3300026067 Ga0207678_10027287 Ga0207678_100272872 275
518 3300026067 Ga0207678_10076754 Ga0207678_100767542 275
519 3300026067 Ga0207678_10084268 Ga0207678_100842682 275
520 3300026067 Ga0207678_10099919 Ga0207678_100999192 275
521 3300026067 Ga0207678_10137238 Ga0207678_101372382 275
522 3300026078 Ga0207702_10000442 Ga0207702_1000044216 275
523 3300026088 Ga0207641_10341726 Ga0207641_103417262 275
524 3300026095 Ga0207676_10057929 Ga0207676_100579293 275
525 3300026118 Ga0207675_100131335 Ga0207675_1001313352 275
526 3300026118 Ga0207675_100685634 Ga0207675_1006856342 275
527 3300026121 Ga0207683_10045508 Ga0207683_100455083 275
528 3300026121 Ga0207683_10099403 Ga0207683_100994033 275
529 3300026121 Ga0207683_10130722 Ga0207683_101307223 275
530 3300026121 Ga0207683_10302139 Ga0207683_103021392 275
531 3300026142 Ga0207698_10115013 Ga0207698_101150132 275
532 3300026142 Ga0207698_10188264 Ga0207698_101882643 275
533 3300027296 Ga0209389_1000008 Ga0209389_1000008216 275
534 3300027296 Ga0209389_1000121 Ga0209389_100012143 275
535 3300027357 Ga0209589_1002735 Ga0209589_100273516 275
536 3300027361 Ga0209489_101490 Ga0209489_1014904 275
537 3300027361 Ga0209489_103445 Ga0209489_10344516 275
538 3300027363 Ga0209700_100036 Ga0209700_100036103 275
539 3300027512 Ga0209179_1017416 Ga0209179_10174161 275
540 3300028379 Ga0268266_10008371 Ga0268266_100083715 275
541 3300028379 Ga0268266_10151361 Ga0268266_101513612 275
542 3300028379 Ga0268266_10479226 Ga0268266_104792262 275
543 3300028380 Ga0268265_10097945 Ga0268265_100979452 275
544 3300028380 Ga0268265_10130921 Ga0268265_101309212 275
545 3300028380 Ga0268265_10566576 Ga0268265_105665761 275
546 3300028381 Ga0268264_10041134 Ga0268264_100411342 275
547 3300028381 Ga0268264_10268499 Ga0268264_102684992 275
548 3300028556 Ga0265337_1012538 Ga0265337_10125382 275
549 3300028558 Ga0265326_10002188 Ga0265326_100021884 275
550 3300028563 Ga0265319_1025553 Ga0265319_10255532 275
551 3300028573 Ga0265334_10002607 Ga0265334_100026074 275
552 3300028653 Ga0265323_10006127 Ga0265323_100061271 275
553 3300028654 Ga0265322_10002310 Ga0265322_100023103 275
554 3300028666 Ga0265336_10001608 Ga0265336_100016084 275
555 3300028794 Ga0307515_10259502 Ga0307515_102595022 275
556 3300028800 Ga0265338_10000667 Ga0265338_1000066731 275
557 3300029957 Ga0265324_10003760 Ga0265324_100037602 275
558 3300030521 Ga0307511_10037393 Ga0307511_100373934 275
559 3300031235 Ga0265330_10042024 Ga0265330_100420242 275
560 3300031235 Ga0265330_10043768 Ga0265330_100437682 275
561 3300031238 Ga0265332_10035696 Ga0265332_100356963 275
562 3300031241 Ga0265325_10007037 Ga0265325_100070374 275
563 3300031247 Ga0265340_10001939 Ga0265340_100019392 275
564 3300031249 Ga0265339_10007152 Ga0265339_100071523 275
565 3300031249 Ga0265339_10033648 Ga0265339_100336482 275
566 3300031250 Ga0265331_10027187 Ga0265331_100271873 275
567 3300031344 Ga0265316_10040807 Ga0265316_100408074 275
568 3300031344 Ga0265316_10049430 Ga0265316_100494302 275
569 3300031344 Ga0265316_10275781 Ga0265316_102757812 275
570 3300031456 Ga0307513_10341525 Ga0307513_103415252 275
571 3300031507 Ga0307509_10021973 Ga0307509_100219732 275
572 3300031507 Ga0307509_10048183 Ga0307509_100481833 275
573 3300031507 Ga0307509_10115985 Ga0307509_101159852 275
574 3300031507 Ga0307509_10443253 Ga0307509_104432531 275
575 3300031616 Ga0307508_10000010 Ga0307508_100000102 275
576 3300031616 Ga0307508_10058073 Ga0307508_100580733 275
577 3300031616 Ga0307508_10141390 Ga0307508_101413902 275
578 3300031616 Ga0307508_10239049 Ga0307508_102390492 275
579 3300031616 Ga0307508_10309890 Ga0307508_103098902 275
580 3300031712 Ga0265342_10011179 Ga0265342_100111793 275
581 3300031712 Ga0265342_10042235 Ga0265342_100422352 275
582 3300031712 Ga0265342_10077343 Ga0265342_100773432 275
583 3300031730 Ga0307516_10067904 Ga0307516_100679042 275
584 3300031730 Ga0307516_10083248 Ga0307516_100832482 275
585 3300031730 Ga0307516_10329853 Ga0307516_103298532 275
586 3300031911 Ga0307412_10029689 Ga0307412_100296892 275
587 3300032002 Ga0307416_100380139 Ga0307416_1003801391 275
588 3300032126 Ga0307415_100019128 Ga0307415_1000191282 275
589 3300033179 Ga0307507_10019430 Ga0307507_100194306 275
590 3300033180 Ga0307510_10006860 Ga0307510_100068603 275
591 3300033180 Ga0307510_10039226 Ga0307510_100392264 275
592 3300033180 Ga0307510_10040547 Ga0307510_100405474 275
593 3300033180 Ga0307510_10082351 Ga0307510_100823514 275
594 3300035086 Ga0373934_0001152 Ga0373934_0001152_6335_7207 275
595 3300035089 Ga0373944_0049829 Ga0373944_0049829_377_1264 275
596 3300035111 Ga0373923_0045255 Ga0373923_0045255_104_976 275
597 3300035113 Ga0373936_0002224 Ga0373936_0002224_1282_2169 275
598 3300035116 Ga0373945_0019944 Ga0373945_0019944_1247_2134 275
599 3300035117 Ga0373953_0015420 Ga0373953_0015420_1069_1941 275
600 3300035117 Ga0373953_0046250 Ga0373953_0046250_148_1035 275
601 3300035118 Ga0373954_0000976 Ga0373954_0000976_4748_5620 275
602 3300035119 Ga0373956_0011303 Ga0373956_0011303_1942_2814 275
603 3300035120 Ga0373957_0036311 Ga0373957_0036311_437_1309 275
604 3300035170 Ga0373943_0008520 Ga0373943_0008520_460_1344 275
605 3300035170 Ga0373943_0026179 Ga0373943_0026179_585_1472 275
606 3300035172 Ga0373955_0000198 Ga0373955_0000198_5943_6815 275
607 3300035691 Ga0373931_0310314 Ga0373931_0310314_73_948 275
608 3300035695 Ga0373927_0011994 Ga0373927_0011994_624_1511 275
609 3300035695 Ga0373927_0012818 Ga0373927_0012818_2244_3128 275
610 3300035695 Ga0373927_0055937 Ga0373927_0055937_1641_2528 275
611 3300035695 Ga0373927_0190737 Ga0373927_0190737_180_1052 275
612 3300035724 Ga0373933_0000274 Ga0373933_0000274_4971_5843 275
613 3300035724 Ga0373933_0000475 Ga0373933_0000475_3314_4198 275
614 3300035725 Ga0373947_0040403 Ga0373947_0040403_591_1478 275
615 3300035725 Ga0373947_0113970 Ga0373947_0113970_20_904 275
616 3300036401 Ga0373937_0008251 Ga0373937_0008251_6876_7748 275
617 3300036401 Ga0373937_0208030 Ga0373937_0208030_721_1608 275
618 3300036459 Ga0372808_001374 Ga0372808_001374_408_1280 275
619 3300037068 Ga0373925_0003636 Ga0373925_0003636_1051_1938 275
620 3300037068 Ga0373925_0366846 Ga0373925_0366846_64_936 275
621 3300037418 Ga0395900_0000361 Ga0395900_0000361_40992_41864 275
622 3300037418 Ga0395900_0220524 Ga0395900_0220524_623_1498 275
623 3300037471 Ga0395905_0003578 Ga0395905_0003578_11859_12740 275
624 3300037471 Ga0395905_0175451 Ga0395905_0175451_220_1101 275
625 3300037471 Ga0395905_0385997 Ga0395905_0385997_371_1243 275
626 3300038443 Ga0395901_0113630 Ga0395901_0113630_904_1785 275
627 3300038443 Ga0395901_0150364 Ga0395901_0150364_1117_1989 275
628 3300038443 Ga0395901_0436459 Ga0395901_0436459_133_1017 275
629 3300039437 Ga0436365_1556838 Ga0436365_1556838_994_1869 275
630 3300039438 Ga0436360_0623528 Ga0436360_0623528_992_1867 275
631 3300039438 Ga0436360_0700607 Ga0436360_0700607_104_979 275
632 3300039447 Ga0436361_0266153 Ga0436361_0266153_986_1864 275
633 3300044658 Ga0466972_0000271 Ga0466972_0000271_11544_12425 275
634 3300044658 Ga0466972_0034153 Ga0466972_0034153_1255_2136 275
635 3300044683 Ga0466965_0072568 Ga0466965_0072568_163_1044 275
636 3300044684 Ga0466966_0004743 Ga0466966_0004743_5022_5897 275
637 3300044693 Ga0466961_0000859 Ga0466961_0000859_1280_2155 275
638 3300044694 Ga0466963_0104753 Ga0466963_0104753_784_1665 275
639 3300044706 Ga0466964_0224184 Ga0466964_0224184_15_896 275
640 3300044735 Ga0466968_0008864 Ga0466968_0008864_1779_2651 275
641 3300044735 Ga0466968_0152469 Ga0466968_0152469_87_968 275
642 3300045976 Ga0466967_0038874 Ga0466967_0038874_2525_3406 275
643 3300046454 Ga0495592_0007563 Ga0495592_0007563_6705_7592 275
644 3300046455 Ga0495603_0000676 Ga0495603_0000676_629_1516 275
645 3300046455 Ga0495603_0038325 Ga0495603_0038325_1880_2764 275
646 3300046455 Ga0495603_0042593 Ga0495603_0042593_186_1058 275
647 3300046455 Ga0495603_0068162 Ga0495603_0068162_800_1672 275
648 3300046457 Ga0495590_0098334 Ga0495590_0098334_34_915 275
649 3300046459 Ga0495629_0000176 Ga0495629_0000176_3672_4544 275
650 3300046459 Ga0495629_0003088 Ga0495629_0003088_11118_12005 275
651 3300046459 Ga0495629_0099781 Ga0495629_0099781_518_1390 275
652 3300046460 Ga0495638_0020391 Ga0495638_0020391_616_1497 275
653 3300046460 Ga0495638_0068357 Ga0495638_0068357_1081_1953 275
654 3300046461 Ga0495641_0008578 Ga0495641_0008578_3907_4794 275
655 3300046461 Ga0495641_0151142 Ga0495641_0151142_89_961 275
656 3300046462 Ga0495651_0002298 Ga0495651_0002298_8519_9391 275
657 3300046463 Ga0495653_0004529 Ga0495653_0004529_4744_5616 275
658 3300046472 Ga0495580_0009272 Ga0495580_0009272_554_1441 275
659 3300046473 Ga0495582_0060986 Ga0495582_0060986_974_1846 275
660 3300046475 Ga0495639_0000726 Ga0495639_0000726_12804_13691 275
661 3300046475 Ga0495639_0031217 Ga0495639_0031217_1461_2333 275
662 3300046476 Ga0495662_0000028 Ga0495662_0000028_27736_28623 275
663 3300046477 Ga0495664_0033761 Ga0495664_0033761_1848_2735 275
664 3300046492 Ga0495585_0110741 Ga0495585_0110741_134_1006 275
665 3300046499 Ga0495594_0000020 Ga0495594_0000020_30413_31300 275
666 3300046501 Ga0495607_0125654 Ga0495607_0125654_427_1317 275
667 3300046506 Ga0495583_0061413 Ga0495583_0061413_208_1089 275
668 3300046507 Ga0495606_0182250 Ga0495606_0182250_75_956 275
669 3300046512 Ga0495610_0091201 Ga0495610_0091201_356_1246 275
670 3300046514 Ga0495618_0296462 Ga0495618_0296462_73_945 275
671 3300046515 Ga0495620_0026112 Ga0495620_0026112_1273_2151 275
672 3300046516 Ga0495628_0004786 Ga0495628_0004786_8367_9239 275
673 3300046516 Ga0495628_0074309 Ga0495628_0074309_557_1444 275
674 3300046516 Ga0495628_0114472 Ga0495628_0114472_310_1197 275
675 3300046517 Ga0495630_0002476 Ga0495630_0002476_9987_10874 275
676 3300046517 Ga0495630_0439927 Ga0495630_0439927_14_898 275
677 3300046519 Ga0495632_0008927 Ga0495632_0008927_5041_5913 275
678 3300046523 Ga0495644_0070482 Ga0495644_0070482_45_917 275
679 3300046524 Ga0495648_0002422 Ga0495648_0002422_14637_15524 275
680 3300046524 Ga0495648_0008933 Ga0495648_0008933_2758_3639 275
681 3300046524 Ga0495648_0065300 Ga0495648_0065300_944_1825 275
682 3300046524 Ga0495648_0079826 Ga0495648_0079826_736_1617 275
683 3300046529 Ga0495652_0004769 Ga0495652_0004769_661_1533 275
684 3300046529 Ga0495652_0063452 Ga0495652_0063452_1146_2033 275
685 3300046530 Ga0495654_0070787 Ga0495654_0070787_531_1421 275
686 3300046531 Ga0495665_0000057 Ga0495665_0000057_18693_19580 275
687 3300046533 Ga0495640_0001533 Ga0495640_0001533_3637_4509 275
688 3300046533 Ga0495640_0012355 Ga0495640_0012355_4701_5588 275
689 3300046533 Ga0495640_0064317 Ga0495640_0064317_1534_2421 275
690 3300046535 Ga0495586_0158752 Ga0495586_0158752_151_1038 275
691 3300046536 Ga0495587_0000736 Ga0495587_0000736_2176_3048 275
692 3300046536 Ga0495587_0044061 Ga0495587_0044061_1069_1956 275
693 3300046538 Ga0495609_0107403 Ga0495609_0107403_247_1119 275
694 3300046543 Ga0495645_0061248 Ga0495645_0061248_1233_2105 275
695 3300046557 Ga0495622_0001520 Ga0495622_0001520_519_1406 275
696 3300046557 Ga0495622_0046695 Ga0495622_0046695_168_1040 275
697 3300046557 Ga0495622_0139824 Ga0495622_0139824_169_1050 275
698 3300046559 Ga0495667_0000319 Ga0495667_0000319_1722_2594 275
699 3300046559 Ga0495667_0020907 Ga0495667_0020907_2949_3836 275
700 3300046559 Ga0495667_0036184 Ga0495667_0036184_2225_3112 275
701 3300046615 Ga0495656_0047350 Ga0495656_0047350_410_1285 275
702 3300046615 Ga0495656_0065840 Ga0495656_0065840_429_1301 275
703 3300046616 Ga0495668_0089991 Ga0495668_0089991_693_1565 275
704 3300046642 Ga0495634_0010828 Ga0495634_0010828_1118_2005 275
705 3300046642 Ga0495634_0030256 Ga0495634_0030256_2125_2997 275
706 3300046642 Ga0495634_0077148 Ga0495634_0077148_411_1298 275
707 3300046648 Ga0495611_0162168 Ga0495611_0162168_23_904 275
708 3300046660 Ga0495625_0216748 Ga0495625_0216748_176_1048 275
709 3300046663 Ga0495635_0004372 Ga0495635_0004372_2303_3175 275
710 3300046663 Ga0495635_0005161 Ga0495635_0005161_7247_8128 275
711 3300046663 Ga0495635_0008850 Ga0495635_0008850_5559_6446 275
712 3300046663 Ga0495635_0049438 Ga0495635_0049438_461_1348 275
713 3300046663 Ga0495635_0112460 Ga0495635_0112460_931_1803 275
714 3300046665 Ga0495661_0100617 Ga0495661_0100617_307_1185 275
715 3300046674 Ga0495588_0104249 Ga0495588_0104249_26_907 275
716 3300046675 Ga0495657_0001557 Ga0495657_0001557_4871_5743 275
717 3300046675 Ga0495657_0044896 Ga0495657_0044896_1445_2332 275
718 3300046678 Ga0495599_0001378 Ga0495599_0001378_8059_8931 275
719 3300046679 Ga0495623_0008240 Ga0495623_0008240_4771_5643 275
720 3300046679 Ga0495623_0010692 Ga0495623_0010692_193_1080 275
721 3300046680 Ga0495646_0013387 Ga0495646_0013387_2201_3073 275
722 3300046680 Ga0495646_0016906 Ga0495646_0016906_3203_4090 275
723 3300046680 Ga0495646_0061905 Ga0495646_0061905_482_1363 275
724 3300046681 Ga0495647_0038207 Ga0495647_0038207_520_1407 275
725 3300046683 Ga0495658_0003230 Ga0495658_0003230_6703_7590 275
726 3300046684 Ga0495669_0049317 Ga0495669_0049317_439_1311 275
727 3300046689 Ga0495613_0013818 Ga0495613_0013818_3990_4862 275
728 3300046689 Ga0495613_0076840 Ga0495613_0076840_1008_1895 275
729 3300046689 Ga0495613_0197209 Ga0495613_0197209_139_1020 275
730 3300046690 Ga0495624_0007826 Ga0495624_0007826_5981_6868 275
731 3300046690 Ga0495624_0054083 Ga0495624_0054083_244_1125 275
732 3300046691 Ga0495670_0029296 Ga0495670_0029296_1386_2276 275
733 3300046692 Ga0495671_0024554 Ga0495671_0024554_749_1621 275
734 3300046694 Ga0495649_0093270 Ga0495649_0093270_484_1356 275
735 3300046694 Ga0495649_0144741 Ga0495649_0144741_315_1196 275
736 3300046809 Ga0495600_0000314 Ga0495600_0000314_5346_6218 275
737 3300046809 Ga0495600_0047739 Ga0495600_0047739_1326_2213 275
738 3300046809 Ga0495600_0092078 Ga0495600_0092078_399_1280 275
739 3300046810 Ga0495660_0059610 Ga0495660_0059610_233_1123 275
740 3300047315 Ga0495581_0004028 Ga0495581_0004028_6935_7822 275
741 3300047315 Ga0495581_0183760 Ga0495581_0183760_248_1120 275
742 3300047317 Ga0495604_0001137 Ga0495604_0001137_19021_19893 275
743 3300047317 Ga0495604_0019823 Ga0495604_0019823_2473_3360 275
744 3300047317 Ga0495604_0202051 Ga0495604_0202051_457_1329 275
745 3300047317 Ga0495604_0255091 Ga0495604_0255091_148_1029 275
746 3300047319 Ga0495674_0049164 Ga0495674_0049164_560_1447 275
747 3300047319 Ga0495674_0099458 Ga0495674_0099458_1409_2281 275
748 3300047320 Ga0495672_0105469 Ga0495672_0105469_67_939 275
749 3300047321 Ga0495676_0019882 Ga0495676_0019882_4426_5313 275
750 3300047322 Ga0495680_0002499 Ga0495680_0002499_2304_3176 275
751 3300047322 Ga0495680_0019888 Ga0495680_0019888_2771_3658 275
752 3300047322 Ga0495680_0320383 Ga0495680_0320383_131_1003 275
753 3300047323 Ga0495683_0110634 Ga0495683_0110634_177_1058 275
754 3300047323 Ga0495683_0143013 Ga0495683_0143013_72_944 275
755 3300047444 Ga0495675_0002364 Ga0495675_0002364_2206_3078 275
756 3300047471 Ga0495684_0000023 Ga0495684_0000023_87283_88155 275
757 3300047673 Ga0495593_0000165 Ga0495593_0000165_16663_17550 275
758 3300048088 Ga0495602_0084652 Ga0495602_0084652_438_1325 275
759 3300048089 Ga0495614_0026074 Ga0495614_0026074_490_1377 275
760 3300048091 Ga0495626_0035390 Ga0495626_0035390_1151_2041 275
761 3300048904 Ga0496101_0003066 Ga0496101_0003066_7982_8854 275
762 3300048904 Ga0496101_0302781 Ga0496101_0302781_113_994 275
763 3300048905 Ga0496102_0004610 Ga0496102_0004610_9848_10720 275
764 3300048905 Ga0496102_0256717 Ga0496102_0256717_570_1451 275
765 3300048906 Ga0496103_0022889 Ga0496103_0022889_1623_2495 275
766 3300048906 Ga0496103_0049381 Ga0496103_0049381_735_1616 275
767 3300048906 Ga0496103_0213173 Ga0496103_0213173_148_1020 275
768 3300048907 Ga0496104_0007966 Ga0496104_0007966_7177_8049 275
769 3300048907 Ga0496104_0071427 Ga0496104_0071427_400_1272 275
770 3300048907 Ga0496104_0074057 Ga0496104_0074057_1486_2367 275
771 3300048907 Ga0496104_0226744 Ga0496104_0226744_416_1288 275
772 3300048907 Ga0496104_0381733 Ga0496104_0381733_385_1266 275
773 3300048909 Ga0496106_0000363 Ga0496106_0000363_18322_19209 275
774 3300048909 Ga0496106_0002373 Ga0496106_0002373_10882_11754 275
775 3300048909 Ga0496106_0018324 Ga0496106_0018324_3308_4180 275
776 3300048909 Ga0496106_0071551 Ga0496106_0071551_459_1331 275
777 3300048909 Ga0496106_0140522 Ga0496106_0140522_706_1578 275
778 3300048910 Ga0496107_0004064 Ga0496107_0004064_2869_3741 275
779 3300048910 Ga0496107_0288385 Ga0496107_0288385_326_1207 275
780 3300048911 Ga0496108_0001361 Ga0496108_0001361_3706_4578 275
781 3300048911 Ga0496108_0053812 Ga0496108_0053812_940_1812 275
782 3300048911 Ga0496108_0248371 Ga0496108_0248371_248_1129 275
783 3300048911 Ga0496108_0271839 Ga0496108_0271839_325_1206 275
784 3300048912 Ga0496109_0000909 Ga0496109_0000909_18299_19171 275
785 3300048912 Ga0496109_0078162 Ga0496109_0078162_2107_2979 275
786 3300048912 Ga0496109_0094294 Ga0496109_0094294_171_1043 275
787 3300048912 Ga0496109_0199666 Ga0496109_0199666_763_1638 275
788 3300048913 Ga0496110_0174928 Ga0496110_0174928_47_928 275
789 3300048913 Ga0496110_0449639 Ga0496110_0449639_105_986 275
790 3300048914 Ga0496111_0035156 Ga0496111_0035156_2448_3320 275
791 3300048914 Ga0496111_0046548 Ga0496111_0046548_1706_2578 275
792 3300048914 Ga0496111_0222257 Ga0496111_0222257_25_906 275
793 3300048915 Ga0496112_0022560 Ga0496112_0022560_802_1683 275
794 3300048915 Ga0496112_0124984 Ga0496112_0124984_959_1831 275
795 3300048915 Ga0496112_0139351 Ga0496112_0139351_1166_2047 275
796 3300048916 Ga0496113_0046939 Ga0496113_0046939_650_1522 275
797 3300048916 Ga0496113_0072569 Ga0496113_0072569_344_1216 275
798 3300048916 Ga0496113_0211950 Ga0496113_0211950_203_1084 275
799 3300048916 Ga0496113_0236834 Ga0496113_0236834_334_1215 275
800 3300048917 Ga0496114_0008017 Ga0496114_0008017_7307_8179 275
801 3300048917 Ga0496114_0047001 Ga0496114_0047001_2052_2924 275
802 3300048917 Ga0496114_0331126 Ga0496114_0331126_174_1055 275
803 3300048918 Ga0496115_0000713 Ga0496115_0000713_11251_12123 275
804 3300048918 Ga0496115_0221328 Ga0496115_0221328_319_1191 275
805 3300048919 Ga0496116_0001984 Ga0496116_0001984_5913_6800 275
806 3300048919 Ga0496116_0090520 Ga0496116_0090520_209_1087 275
807 3300048919 Ga0496116_0094575 Ga0496116_0094575_305_1189 275
808 3300048919 Ga0496116_0144228 Ga0496116_0144228_323_1204 275
809 3300048920 Ga0496117_0031332 Ga0496117_0031332_383_1270 275
810 3300048920 Ga0496117_0116874 Ga0496117_0116874_488_1369 275
811 3300048921 Ga0496118_0002080 Ga0496118_0002080_19160_20047 275
812 3300048921 Ga0496118_0036790 Ga0496118_0036790_496_1380 275
813 3300048922 Ga0496119_0034349 Ga0496119_0034349_640_1524 275
814 3300048922 Ga0496119_0064294 Ga0496119_0064294_939_1820 275
815 3300048922 Ga0496119_0070653 Ga0496119_0070653_799_1689 275
816 3300048922 Ga0496119_0083315 Ga0496119_0083315_781_1668 275
817 3300048923 Ga0496120_0103576 Ga0496120_0103576_111_1001 275
818 3300048924 Ga0496121_0000183 Ga0496121_0000183_80183_81070 275
819 3300048924 Ga0496121_0023725 Ga0496121_0023725_2728_3612 275
820 3300048924 Ga0496121_0048678 Ga0496121_0048678_1142_2014 275
821 3300048924 Ga0496121_0092384 Ga0496121_0092384_186_1073 275
822 3300048924 Ga0496121_0213735 Ga0496121_0213735_408_1280 275
823 3300048925 Ga0496122_0096872 Ga0496122_0096872_608_1486 275
824 3300048926 Ga0496123_0035502 Ga0496123_0035502_1585_2463 275
825 3300048927 Ga0496124_0054405 Ga0496124_0054405_2401_3273 275
826 3300048927 Ga0496124_0141584 Ga0496124_0141584_662_1534 275
827 3300048928 Ga0496125_0001713 Ga0496125_0001713_15331_16209 275
828 3300048928 Ga0496125_0045885 Ga0496125_0045885_789_1676 275
829 3300048928 Ga0496125_0082701 Ga0496125_0082701_497_1378 275
830 3300048928 Ga0496125_0090461 Ga0496125_0090461_1167_2051 275
831 3300048928 Ga0496125_0149418 Ga0496125_0149418_258_1145 275
832 3300048928 Ga0496125_0237108 Ga0496125_0237108_266_1147 275
833 3300048929 Ga0496126_0001554 Ga0496126_0001554_27419_28303 275
834 3300048929 Ga0496126_0008974 Ga0496126_0008974_5558_6445 275
835 3300048929 Ga0496126_0043018 Ga0496126_0043018_1254_2138 275
836 3300048929 Ga0496126_0049954 Ga0496126_0049954_2625_3497 275
837 3300048929 Ga0496126_0057751 Ga0496126_0057751_2571_3443 275
838 3300048929 Ga0496126_0123540 Ga0496126_0123540_366_1247 275
839 3300048929 Ga0496126_0180188 Ga0496126_0180188_344_1225 275
840 3300048929 Ga0496126_0222329 Ga0496126_0222329_228_1109 275
841 3300048929 Ga0496126_0305602 Ga0496126_0305602_117_1001 275
842 3300048929 Ga0496126_0329531 Ga0496126_0329531_262_1143 275
843 3300049580 Ga0501046_0175110 Ga0501046_0175110_269_1144 275
844 3300049581 Ga0501047_0007147 Ga0501047_0007147_1960_2835 275
845 3300049586 Ga0501070_0185250 Ga0501070_0185250_219_1094 275
846 3300049590 Ga0501074_0013775 Ga0501074_0013775_2087_2962 275
847 3300049742 Ga0501080_0031077 Ga0501080_0031077_1343_2218 275
848 3300049823 Ga0501044_0100775 Ga0501044_0100775_1316_2191 275
849 3300050492 nmdc:mga0yw44_171584_c1 nmdc:mga0yw44_171584_c1_414_1295 275
850 3300050492 nmdc:mga0yw44_24388_c1 nmdc:mga0yw44_24388_c1_1421_2302 275
851 3300050492 nmdc:mga0yw44_3414_c1 nmdc:mga0yw44_3414_c1_726_1604 275
852 3300050496 nmdc:mga07m45_185483_c1 nmdc:mga07m45_185483_c1_123_1004 275
853 3300050511 nmdc:mga08y16_461879_c1 nmdc:mga08y16_461879_c1_407_1279 275
854 3300050512 nmdc:mga0n895_59753_c1 nmdc:mga0n895_59753_c1_731_1603 275
855 3300050516 nmdc:mga0sz30_161223_c1 nmdc:mga0sz30_161223_c1_26_907 275
856 3300050516 nmdc:mga0sz30_40090_c1 nmdc:mga0sz30_40090_c1_690_1577 275
857 3300053077 Ga0495601_0085798 Ga0495601_0085798_504_1376 275
858 3300053083 Ga0495655_0014809 Ga0495655_0014809_417_1298 275
859 3300053084 Ga0495595_0004910 Ga0495595_0004910_4459_5331 275
860 3300053085 Ga0495619_0000111 Ga0495619_0000111_24632_25504 275
861 3300053086 Ga0500578_0046581 Ga0500578_0046581_37_918 275
862 3300053086 Ga0500578_0092145 Ga0500578_0092145_930_1820 275
863 3300053087 Ga0500643_000015 Ga0500643_000015_115602_116483 275
864 3300053090 Ga0500646_0011629 Ga0500646_0011629_1185_2075 275
865 3300053091 Ga0500647_0079290 Ga0500647_0079290_585_1457 275
866 3300053091 Ga0500647_0148107 Ga0500647_0148107_31_918 275
867 3300053092 Ga0500583_0135099 Ga0500583_0135099_136_1008 275
868 3300053093 Ga0500651_0061510 Ga0500651_0061510_320_1198 275
869 3300053093 Ga0500651_0142764 Ga0500651_0142764_114_986 275
870 3300053094 Ga0500566_0000028 Ga0500566_0000028_53445_54317 275
871 3300053094 Ga0500566_0000249 Ga0500566_0000249_10502_11383 275
872 3300053095 Ga0500640_004300 Ga0500640_004300_4124_4996 275
873 3300053098 Ga0500650_0019054 Ga0500650_0019054_728_1618 275
874 3300053098 Ga0500650_0156994 Ga0500650_0156994_101_973 275
875 3300053103 Ga0500555_003873 Ga0500555_003873_2168_3040 275
876 3300053104 Ga0500556_0018026 Ga0500556_0018026_286_1167 275
877 3300053105 Ga0500557_000110 Ga0500557_000110_20863_21744 275
878 3300053109 Ga0500569_002795 Ga0500569_002795_1992_2873 275
879 3300053111 Ga0500572_000420 Ga0500572_000420_1910_2782 275
880 3300053111 Ga0500572_001411 Ga0500572_001411_3794_4666 275
881 3300053111 Ga0500572_052979 Ga0500572_052979_31_912 275
882 3300053116 Ga0500592_002327 Ga0500592_002327_1330_2220 275
883 3300053119 Ga0500595_021757 Ga0500595_021757_1145_2026 275
884 3300053119 Ga0500595_034855 Ga0500595_034855_706_1587 275
885 3300053119 Ga0500595_047635 Ga0500595_047635_237_1124 275
886 3300053122 Ga0500608_040527 Ga0500608_040527_15_887 275
887 3300053123 Ga0500614_007020 Ga0500614_007020_957_1829 275
888 3300053130 Ga0500642_0000036 Ga0500642_0000036_81683_82561 275
889 3300053130 Ga0500642_0000086 Ga0500642_0000086_23997_24878 275
890 3300053130 Ga0500642_0091684 Ga0500642_0091684_452_1333 275
891 3300053131 Ga0500652_000837 Ga0500652_000837_8883_9773 275
892 3300053136 Ga0500559_0000154 Ga0500559_0000154_50685_51557 275
893 3300053136 Ga0500559_0004402 Ga0500559_0004402_1320_2192 275
894 3300053136 Ga0500559_0141887 Ga0500559_0141887_162_1043 275
895 3300053139 Ga0500568_0000599 Ga0500568_0000599_15127_16017 275
896 3300053139 Ga0500568_0003668 Ga0500568_0003668_3046_3918 275
897 3300053139 Ga0500568_0008132 Ga0500568_0008132_41_913 275
898 3300053144 Ga0500585_060742 Ga0500585_060742_157_1038 275
899 3300053145 Ga0500586_003626 Ga0500586_003626_1170_2057 275
900 3300053148 Ga0500590_031546 Ga0500590_031546_360_1232 275
901 3300053150 Ga0500603_001125 Ga0500603_001125_4024_4896 275
902 3300053153 Ga0500616_0000014 Ga0500616_0000014_336145_337023 275
903 3300053158 Ga0500627_0019326 Ga0500627_0019326_92_964 275
904 3300053159 Ga0500630_005371 Ga0500630_005371_4795_5667 275
905 3300053161 Ga0500634_0031888 Ga0500634_0031888_743_1621 275
906 3300053163 Ga0500639_000001 Ga0500639_000001_137824_138696 275
907 3300053163 Ga0500639_065528 Ga0500639_065528_90_962 275
908 3300053177 Ga0500636_0000151 Ga0500636_0000151_31877_32758 275
909 3300053177 Ga0500636_0044785 Ga0500636_0044785_766_1638 275
910 3300053177 Ga0500636_0080452 Ga0500636_0080452_660_1547 275
911 3300053178 Ga0500637_0105194 Ga0500637_0105194_569_1456 275
912 3300053725 Ga0500576_052240 Ga0500576_052240_356_1228 275
913 3300053729 Ga0500625_004369 Ga0500625_004369_4043_4924 275
914 3300053729 Ga0500625_088820 Ga0500625_088820_421_1302 275
915 3300053730 Ga0500645_040559 Ga0500645_040559_130_1008 275
916 3300053731 Ga0500609_003486 Ga0500609_003486_1061_1942 275
917 3300053735 Ga0500596_000667 Ga0500596_000667_890_1762 275
918 3300053735 Ga0500596_002168 Ga0500596_002168_2277_3149 275
919 3300053736 Ga0500599_004427 Ga0500599_004427_711_1592 275
920 3300053737 Ga0500601_000098 Ga0500601_000098_4756_5637 275
921 iso_pu_bacteria 2893066018 2893071333 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

3

166

0.98

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

3

74

0.88

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

164

285

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.9553 1 30
6lkd-assembly1.cif.gz_A in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor 0.9416 2 30
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9289 1 271
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9254 1 273
6lke-assembly1.cif.gz_B in meso full-length rat kmo in complex with an inhibitor identified via dna-encoded chemical library screening 0.9195 2 30
ID Description Score Start End Superfamily
3ckyD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.95 50 147 3.40.50.720
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9387 2 30 3.50.50.60
af_P0A9V8_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9239 1 143 3.40.50.720
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9221 2 149 3.40.50.720
af_A0A1D6LWN3_490_603_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9192 150 258 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A7X6ISJ6-F1-model_v4 deleted 0.9693 50 159
AF-A0A352NJE8-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9685 57 162 GO:0016616
GO:0050661
AF-A0A183U7X3-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) 0.9588 70 155 GO:0005739
GO:0006574
GO:0008442
GO:0050661
AF-A0A352S2Q2-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9585 57 144 GO:0050661
AF-A0A4R3T858-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.952 3 271 GO:0016054
GO:0016491
GO:0050661
GO:0051287

Feature Viewer

pLDDT pTM Quality
89.37 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map