F485725
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 920 | 509 | 891 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300005364|Ga0070673_101757128|Ga0070673_1017571282 |
| Length | 123 |
| Sequence | MNTVTKKMQKKRARRQSAHQRIRTRVKGSAERPRLSVYKSLKYIYAQVIDDERGVTLAAASTLEGDKSAKGADKDAAARVGALVAQRAIEKGVKDVVFDRGSYLFHGRVKALADAAREAGLNF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 9 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 10 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 11 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 12 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 13 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 14 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 15 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 16 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 17 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 18 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 19 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 20 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 21 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 22 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 23 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 24 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 25 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 26 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 27 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 28 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 29 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 30 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 33 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 34 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 35 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 37 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 122 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 123 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 124 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 142 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 216 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 217 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 233 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 234 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 238 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 264 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 265 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 268 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 269 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 270 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 271 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 272 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 273 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 274 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 275 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 276 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 277 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 278 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 279 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 280 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 281 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 282 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 283 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 284 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 285 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 286 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 287 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 288 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 289 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 290 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 291 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 292 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 293 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 294 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 377 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 378 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 379 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 380 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 381 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 382 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 385 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 386 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 387 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 388 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 389 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 390 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 391 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 392 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 393 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 394 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 395 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 396 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 397 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 398 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 399 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 427 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 428 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 429 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 430 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 431 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 432 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 435 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 443 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 444 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 445 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 446 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 447 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 448 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 449 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 450 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 451 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 452 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 453 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 454 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 455 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 456 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 457 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 458 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 459 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 460 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 461 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 462 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 463 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 464 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 465 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 466 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 467 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 469 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 470 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 472 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 473 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 474 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 475 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 476 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 478 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 480 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 482 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 483 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 485 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 486 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 487 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 488 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 489 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 490 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 491 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 492 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.72 |
| Metatranscriptomes | 4.13 |
| Isolates | 3.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.67 |
| Nodule | 0.11 |
| Rhizoplane | 4.02 |
| Rhizosphere | 69.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNBas_1000419 | 3300000531 | Bacteria | 1830 |
| 2 | JGI25153J46596_10014629 | 3300003215 | Bacteria | 3249 |
| 3 | JGI25153J46596_10015113 | 3300003215 | Bacteria | 3165 |
| 4 | rootH2_10046562 | 3300003320 | Bacteria | 2119 |
| 5 | JGI26145J50221_1021227 | 3300003371 | Bacteria | 629 |
| 6 | Ga0007427J51700_108234 | 3300003559 | Bacteria | 6325 |
| 7 | JGI25404J52841_10000285 | 3300003659 | Bacteria | 6540 |
| 8 | Ga0032354_1046771 | 3300003693 | Bacteria | 953 |
| 9 | Ga0032354_1096322 | 3300003693 | Bacteria | 751 |
| 10 | Ga0055526_1009783 | 3300003771 | Bacteria | 4557 |
| 11 | Ga0055526_1031603 | 3300003771 | Bacteria | 1513 |
| 12 | Ga0055537_1001243 | 3300003773 | Bacteria | 10661 |
| 13 | Ga0055524_1013632 | 3300003775 | Bacteria | 3059 |
| 14 | Ga0055536_1103212 | 3300003781 | Bacteria | 507 |
| 15 | Ga0055536_1103307 | 3300003781 | Bacteria | 507 |
| 16 | Ga0055534_1014923 | 3300003784 | Bacteria | 1440 |
| 17 | Ga0055528_1008934 | 3300003790 | Bacteria | 4234 |
| 18 | Ga0055530_10006621 | 3300003791 | Bacteria | 5118 |
| 19 | Ga0055530_10120956 | 3300003791 | Bacteria | 507 |
| 20 | Ga0055530_10121061 | 3300003791 | Bacteria | 507 |
| 21 | Ga0055531_10023079 | 3300003794 | Bacteria | 2347 |
| 22 | Ga0055531_10025933 | 3300003794 | Bacteria | 2109 |
| 23 | Ga0055543_1031994 | 3300004625 | Bacteria | 916 |
| 24 | Ga0065165_1027151 | 3300005262 | Bacteria | 1871 |
| 25 | Ga0065165_1098134 | 3300005262 | Bacteria | 737 |
| 26 | Ga0065715_10384206 | 3300005293 | Bacteria | 902 |
| 27 | Ga0070658_10067818 | 3300005327 | Bacteria | 2915 |
| 28 | Ga0070658_10115679 | 3300005327 | Bacteria | 2225 |
| 29 | Ga0070658_10343132 | 3300005327 | Bacteria | 1277 |
| 30 | Ga0070658_10488755 | 3300005327 | Bacteria | 1062 |
| 31 | Ga0070658_10497903 | 3300005327 | Bacteria | 1052 |
| 32 | Ga0070676_10220385 | 3300005328 | Bacteria | 1253 |
| 33 | Ga0070690_101426876 | 3300005330 | Bacteria | 558 |
| 34 | Ga0070670_100816638 | 3300005331 | Bacteria | 843 |
| 35 | Ga0070670_101418912 | 3300005331 | Bacteria | 637 |
| 36 | Ga0068869_102092514 | 3300005334 | Bacteria | 509 |
| 37 | Ga0070680_100046665 | 3300005336 | Bacteria | 3525 |
| 38 | Ga0070680_100071832 | 3300005336 | Bacteria | 2844 |
| 39 | Ga0070680_101505394 | 3300005336 | Bacteria | 583 |
| 40 | Ga0068868_100805655 | 3300005338 | Bacteria | 848 |
| 41 | Ga0070660_101025178 | 3300005339 | Bacteria | 697 |
| 42 | Ga0070660_101498559 | 3300005339 | Bacteria | 573 |
| 43 | Ga0070660_101685404 | 3300005339 | Bacteria | 540 |
| 44 | Ga0070689_100182830 | 3300005340 | Bacteria | 1704 |
| 45 | Ga0070689_101108064 | 3300005340 | Bacteria | 708 |
| 46 | Ga0070691_10035939 | 3300005341 | Bacteria | 2334 |
| 47 | Ga0070661_100466318 | 3300005344 | Bacteria | 1007 |
| 48 | Ga0070668_100002473 | 3300005347 | Bacteria | 13591 |
| 49 | Ga0070668_100025277 | 3300005347 | Bacteria | 4501 |
| 50 | Ga0070669_101507306 | 3300005353 | Bacteria | 585 |
| 51 | Ga0070669_101541865 | 3300005353 | Bacteria | 578 |
| 52 | Ga0070671_100462847 | 3300005355 | Bacteria | 1088 |
| 53 | Ga0070671_100724482 | 3300005355 | Bacteria | 864 |
| 54 | Ga0070674_100401831 | 3300005356 | Bacteria | 1120 |
| 55 | Ga0070673_101757128 | 3300005364 | Bacteria | 587 |
| 56 | Ga0070659_100623177 | 3300005366 | Bacteria | 929 |
| 57 | Ga0070667_100015939 | 3300005367 | Bacteria | 6218 |
| 58 | Ga0070667_100081570 | 3300005367 | Bacteria | 2768 |
| 59 | Ga0070713_101329443 | 3300005436 | Bacteria | 697 |
| 60 | Ga0070663_101447335 | 3300005455 | Bacteria | 610 |
| 61 | Ga0070678_100120082 | 3300005456 | Bacteria | 2071 |
| 62 | Ga0070678_100490288 | 3300005456 | Bacteria | 1083 |
| 63 | Ga0070678_100832144 | 3300005456 | Bacteria | 840 |
| 64 | Ga0070662_100014250 | 3300005457 | Bacteria | 5306 |
| 65 | Ga0070662_101677115 | 3300005457 | Bacteria | 549 |
| 66 | Ga0070681_10040928 | 3300005458 | Bacteria | 4642 |
| 67 | Ga0070685_10980944 | 3300005466 | Bacteria | 633 |
| 68 | Ga0070679_100226119 | 3300005530 | Bacteria | 1831 |
| 69 | Ga0070679_101773083 | 3300005530 | Bacteria | 566 |
| 70 | Ga0070684_101292269 | 3300005535 | Bacteria | 687 |
| 71 | Ga0070684_101387408 | 3300005535 | Bacteria | 662 |
| 72 | Ga0068853_100314964 | 3300005539 | Bacteria | 1449 |
| 73 | Ga0070672_101935612 | 3300005543 | Bacteria | 531 |
| 74 | Ga0070665_100006341 | 3300005548 | Bacteria | 12070 |
| 75 | Ga0070665_100088661 | 3300005548 | Bacteria | 3099 |
| 76 | Ga0070665_101508761 | 3300005548 | Bacteria | 681 |
| 77 | Ga0068855_100018024 | 3300005563 | Bacteria | 8484 |
| 78 | Ga0068855_101930122 | 3300005563 | Bacteria | 598 |
| 79 | Ga0070664_100499798 | 3300005564 | Bacteria | 1121 |
| 80 | Ga0068854_100662044 | 3300005578 | Bacteria | 897 |
| 81 | Ga0068854_100731759 | 3300005578 | Bacteria | 856 |
| 82 | Ga0068856_101302999 | 3300005614 | Bacteria | 742 |
| 83 | Ga0068852_100109130 | 3300005616 | Bacteria | 2512 |
| 84 | Ga0068852_100385506 | 3300005616 | Bacteria | 1376 |
| 85 | Ga0068852_100599588 | 3300005616 | Bacteria | 1106 |
| 86 | Ga0068859_100373060 | 3300005617 | Bacteria | 1522 |
| 87 | Ga0068864_100274288 | 3300005618 | Bacteria | 1572 |
| 88 | Ga0068864_100968787 | 3300005618 | Bacteria | 842 |
| 89 | Ga0068864_101168265 | 3300005618 | Bacteria | 767 |
| 90 | Ga0068861_100101512 | 3300005719 | Bacteria | 2289 |
| 91 | Ga0068861_101141762 | 3300005719 | Bacteria | 751 |
| 92 | Ga0068863_100028125 | 3300005841 | Bacteria | 5367 |
| 93 | Ga0068863_100088718 | 3300005841 | Bacteria | 2931 |
| 94 | Ga0068858_100664888 | 3300005842 | Bacteria | 1013 |
| 95 | Ga0068860_100094802 | 3300005843 | Bacteria | 2844 |
| 96 | Ga0068860_100373448 | 3300005843 | Bacteria | 1407 |
| 97 | Ga0068860_102766766 | 3300005843 | Bacteria | 509 |
| 98 | Ga0068862_100423824 | 3300005844 | Bacteria | 1249 |
| 99 | Ga0068862_100627269 | 3300005844 | Bacteria | 1035 |
| 100 | Ga0068862_101527564 | 3300005844 | Bacteria | 673 |
| 101 | Ga0081455_10041960 | 3300005937 | Bacteria | 4019 |
| 102 | Ga0081538_10001041 | 3300005981 | Bacteria | 29562 |
| 103 | Ga0081540_1001166 | 3300005983 | Bacteria | 23099 |
| 104 | Ga0070717_10364099 | 3300006028 | Bacteria | 1295 |
| 105 | Ga0070717_10690270 | 3300006028 | Bacteria | 927 |
| 106 | Ga0075365_10006324 | 3300006038 | Bacteria | 6505 |
| 107 | Ga0075368_10009546 | 3300006042 | Bacteria | 3488 |
| 108 | Ga0075368_10134923 | 3300006042 | Bacteria | 1027 |
| 109 | Ga0075363_100210193 | 3300006048 | Bacteria | 1113 |
| 110 | Ga0075363_100423989 | 3300006048 | Bacteria | 783 |
| 111 | Ga0075363_100774080 | 3300006048 | Bacteria | 582 |
| 112 | Ga0075364_10001038 | 3300006051 | Bacteria | 14772 |
| 113 | Ga0075362_10006228 | 3300006177 | Bacteria | 4435 |
| 114 | Ga0075362_10153081 | 3300006177 | Bacteria | 1107 |
| 115 | Ga0075367_10001012 | 3300006178 | Bacteria | 11557 |
| 116 | Ga0075367_10064400 | 3300006178 | Bacteria | 2193 |
| 117 | Ga0075367_10484945 | 3300006178 | Bacteria | 784 |
| 118 | Ga0075369_10020903 | 3300006186 | Bacteria | 2684 |
| 119 | Ga0075369_10157977 | 3300006186 | Bacteria | 1038 |
| 120 | Ga0075366_10007868 | 3300006195 | Bacteria | 5897 |
| 121 | Ga0075366_10060203 | 3300006195 | Bacteria | 2256 |
| 122 | Ga0075366_10065097 | 3300006195 | Bacteria | 2168 |
| 123 | Ga0075370_10019956 | 3300006353 | Bacteria | 3654 |
| 124 | Ga0075370_10048996 | 3300006353 | Bacteria | 2394 |
| 125 | Ga0075370_10091453 | 3300006353 | Bacteria | 1755 |
| 126 | Ga0075370_10113931 | 3300006353 | Bacteria | 1571 |
| 127 | Ga0075370_10567873 | 3300006353 | Bacteria | 686 |
| 128 | Ga0075370_11049969 | 3300006353 | Bacteria | 500 |
| 129 | Ga0068871_100855835 | 3300006358 | Bacteria | 841 |
| 130 | Ga0075433_11359468 | 3300006852 | Bacteria | 615 |
| 131 | Ga0068865_101083350 | 3300006881 | Bacteria | 705 |
| 132 | Ga0097620_100373031 | 3300006931 | Bacteria | 1522 |
| 133 | Ga0079104_1007846 | 3300006946 | Bacteria | 3808 |
| 134 | Ga0099795_10637870 | 3300007788 | Bacteria | 509 |
| 135 | Ga0105250_10331436 | 3300009092 | Bacteria | 663 |
| 136 | Ga0105240_10013835 | 3300009093 | Bacteria | 11052 |
| 137 | Ga0105240_10024975 | 3300009093 | Bacteria | 7865 |
| 138 | Ga0105240_10207291 | 3300009093 | Bacteria | 2293 |
| 139 | Ga0105240_10369970 | 3300009093 | Bacteria | 1621 |
| 140 | Ga0105240_10718939 | 3300009093 | Bacteria | 1088 |
| 141 | Ga0105240_11600569 | 3300009093 | Bacteria | 682 |
| 142 | Ga0105240_11998694 | 3300009093 | Bacteria | 602 |
| 143 | Ga0111539_10007802 | 3300009094 | Bacteria | 13665 |
| 144 | Ga0111539_11509417 | 3300009094 | Bacteria | 779 |
| 145 | Ga0105245_10430145 | 3300009098 | Bacteria | 1325 |
| 146 | Ga0114129_11709002 | 3300009147 | Bacteria | 768 |
| 147 | Ga0105243_10865521 | 3300009148 | Bacteria | 896 |
| 148 | Ga0105241_10166634 | 3300009174 | Bacteria | 1816 |
| 149 | Ga0105241_11013354 | 3300009174 | Bacteria | 777 |
| 150 | Ga0105241_12062280 | 3300009174 | Bacteria | 563 |
| 151 | Ga0105241_12070638 | 3300009174 | Bacteria | 562 |
| 152 | Ga0105242_10483630 | 3300009176 | Bacteria | 1174 |
| 153 | Ga0105242_10627964 | 3300009176 | Bacteria | 1042 |
| 154 | Ga0105242_10656596 | 3300009176 | Bacteria | 1021 |
| 155 | Ga0105242_13016627 | 3300009176 | Bacteria | 521 |
| 156 | Ga0105248_10168671 | 3300009177 | Bacteria | 2467 |
| 157 | Ga0105248_10178500 | 3300009177 | Bacteria | 2393 |
| 158 | Ga0105248_10180513 | 3300009177 | Bacteria | 2379 |
| 159 | Ga0105248_10563249 | 3300009177 | Bacteria | 1285 |
| 160 | Ga0105248_10678976 | 3300009177 | Bacteria | 1162 |
| 161 | Ga0105237_10869840 | 3300009545 | Bacteria | 908 |
| 162 | Ga0105237_11884773 | 3300009545 | Bacteria | 606 |
| 163 | Ga0105238_10295500 | 3300009551 | Bacteria | 1603 |
| 164 | Ga0105238_10377821 | 3300009551 | Bacteria | 1408 |
| 165 | Ga0105238_12128544 | 3300009551 | Bacteria | 595 |
| 166 | Ga0105238_12138326 | 3300009551 | Bacteria | 594 |
| 167 | Ga0105249_10100547 | 3300009553 | Bacteria | 2719 |
| 168 | Ga0105249_10200258 | 3300009553 | Bacteria | 1954 |
| 169 | Ga0105249_10229554 | 3300009553 | Bacteria | 1830 |
| 170 | Ga0105249_11177596 | 3300009553 | Bacteria | 837 |
| 171 | Ga0105239_11206744 | 3300010375 | Bacteria | 872 |
| 172 | Ga0105239_11566100 | 3300010375 | Bacteria | 762 |
| 173 | Ga0157346_1023210 | 3300012480 | Bacteria | 557 |
| 174 | Ga0157322_1044471 | 3300012490 | Bacteria | 521 |
| 175 | Ga0157347_1003217 | 3300012502 | Bacteria | 1452 |
| 176 | Ga0157342_1023982 | 3300012507 | Bacteria | 728 |
| 177 | Ga0157373_10254885 | 3300013100 | Bacteria | 1241 |
| 178 | Ga0157373_11089021 | 3300013100 | Bacteria | 599 |
| 179 | Ga0157370_10298609 | 3300013104 | Bacteria | 1487 |
| 180 | Ga0157370_10464487 | 3300013104 | Bacteria | 1163 |
| 181 | Ga0157370_11073912 | 3300013104 | Bacteria | 728 |
| 182 | Ga0157369_10099998 | 3300013105 | Bacteria | 3091 |
| 183 | Ga0157369_10665926 | 3300013105 | Bacteria | 1073 |
| 184 | Ga0157374_10473969 | 3300013296 | Bacteria | 1254 |
| 185 | Ga0157374_10619242 | 3300013296 | Bacteria | 1093 |
| 186 | Ga0157378_11032051 | 3300013297 | Bacteria | 857 |
| 187 | Ga0163162_10596522 | 3300013306 | Bacteria | 1231 |
| 188 | Ga0163162_10871031 | 3300013306 | Bacteria | 1015 |
| 189 | Ga0163162_11109394 | 3300013306 | Bacteria | 896 |
| 190 | Ga0163162_11941149 | 3300013306 | Bacteria | 674 |
| 191 | Ga0157372_10265775 | 3300013307 | Bacteria | 1992 |
| 192 | Ga0157375_10317411 | 3300013308 | Bacteria | 1723 |
| 193 | Ga0157375_11389368 | 3300013308 | Bacteria | 827 |
| 194 | Ga0157375_13436784 | 3300013308 | Bacteria | 527 |
| 195 | Ga0163163_10386778 | 3300014325 | Bacteria | 1457 |
| 196 | Ga0163163_10795390 | 3300014325 | Bacteria | 1009 |
| 197 | Ga0157380_10236356 | 3300014326 | Bacteria | 1645 |
| 198 | Ga0157380_10493550 | 3300014326 | Bacteria | 1187 |
| 199 | Ga0157380_12426291 | 3300014326 | Bacteria | 590 |
| 200 | Ga0182008_10067287 | 3300014497 | Bacteria | 1763 |
| 201 | Ga0157377_10372671 | 3300014745 | Bacteria | 964 |
| 202 | Ga0157379_10534820 | 3300014968 | Bacteria | 1089 |
| 203 | Ga0157379_11705379 | 3300014968 | Bacteria | 617 |
| 204 | Ga0157376_10359201 | 3300014969 | Bacteria | 1396 |
| 205 | Ga0157376_12085660 | 3300014969 | Bacteria | 605 |
| 206 | Ga0183365_10006 | 3300015684 | Bacteria | 225936 |
| 207 | Ga0163161_10322599 | 3300017792 | Bacteria | 1221 |
| 208 | Ga0213872_10326888 | 3300021361 | Bacteria | 632 |
| 209 | Ga0213871_10160618 | 3300021441 | Bacteria | 688 |
| 210 | Ga0209026_1029378 | 3300025250 | Bacteria | 820 |
| 211 | Ga0209148_1016525 | 3300025254 | Bacteria | 1268 |
| 212 | Ga0209233_1087506 | 3300025261 | Bacteria | 541 |
| 213 | Ga0209565_1000925 | 3300025263 | Bacteria | 15538 |
| 214 | Ga0209455_1018403 | 3300025272 | Bacteria | 1436 |
| 215 | Ga0209673_1002524 | 3300025273 | Bacteria | 12545 |
| 216 | Ga0209675_1002569 | 3300025291 | Bacteria | 9211 |
| 217 | Ga0209676_1005649 | 3300025292 | Bacteria | 6445 |
| 218 | Ga0209676_1005783 | 3300025292 | Bacteria | 6325 |
| 219 | Ga0209025_1000320 | 3300025294 | Bacteria | 106773 |
| 220 | Ga0209564_1023073 | 3300025295 | Bacteria | 2175 |
| 221 | Ga0209758_1021887 | 3300025297 | Bacteria | 2958 |
| 222 | Ga0209050_1033197 | 3300025298 | Bacteria | 1569 |
| 223 | Ga0209050_1055279 | 3300025298 | Bacteria | 974 |
| 224 | Ga0209050_1071778 | 3300025298 | Bacteria | 770 |
| 225 | Ga0209256_1003893 | 3300025299 | Bacteria | 9891 |
| 226 | Ga0209051_1000877 | 3300025303 | Bacteria | 30359 |
| 227 | Ga0209257_1000976 | 3300025304 | Bacteria | 38920 |
| 228 | Ga0209257_1001464 | 3300025304 | Bacteria | 27851 |
| 229 | Ga0209257_1010167 | 3300025304 | Bacteria | 4838 |
| 230 | Ga0207710_10257719 | 3300025900 | Bacteria | 873 |
| 231 | Ga0207680_10170751 | 3300025903 | Bacteria | 1465 |
| 232 | Ga0207685_10361678 | 3300025905 | Bacteria | 734 |
| 233 | Ga0207645_10766945 | 3300025907 | Bacteria | 656 |
| 234 | Ga0207643_10566071 | 3300025908 | Bacteria | 730 |
| 235 | Ga0207705_10109262 | 3300025909 | Bacteria | 2042 |
| 236 | Ga0207654_10728370 | 3300025911 | Bacteria | 713 |
| 237 | Ga0207654_11168726 | 3300025911 | Bacteria | 561 |
| 238 | Ga0207695_10146421 | 3300025913 | Bacteria | 2306 |
| 239 | Ga0207695_10148319 | 3300025913 | Bacteria | 2287 |
| 240 | Ga0207695_10507987 | 3300025913 | Bacteria | 1087 |
| 241 | Ga0207693_10440679 | 3300025915 | Bacteria | 1018 |
| 242 | Ga0207660_11040927 | 3300025917 | Bacteria | 667 |
| 243 | Ga0207657_11128507 | 3300025919 | Bacteria | 598 |
| 244 | Ga0207649_11133386 | 3300025920 | Bacteria | 617 |
| 245 | Ga0207649_11302256 | 3300025920 | Bacteria | 575 |
| 246 | Ga0207681_10841370 | 3300025923 | Bacteria | 767 |
| 247 | Ga0207694_10078132 | 3300025924 | Bacteria | 2594 |
| 248 | Ga0207694_10147033 | 3300025924 | Bacteria | 1897 |
| 249 | Ga0207650_10018921 | 3300025925 | Bacteria | 4839 |
| 250 | Ga0207650_10289465 | 3300025925 | Bacteria | 1335 |
| 251 | Ga0207659_10492685 | 3300025926 | Bacteria | 1037 |
| 252 | Ga0207659_11127478 | 3300025926 | Bacteria | 675 |
| 253 | Ga0207700_10124646 | 3300025928 | Bacteria | 2094 |
| 254 | Ga0207644_10071728 | 3300025931 | Bacteria | 2534 |
| 255 | Ga0207644_10438147 | 3300025931 | Bacteria | 1072 |
| 256 | Ga0207644_11211933 | 3300025931 | Bacteria | 634 |
| 257 | Ga0207690_10525613 | 3300025932 | Bacteria | 959 |
| 258 | Ga0207706_10042383 | 3300025933 | Bacteria | 4034 |
| 259 | Ga0207706_10594580 | 3300025933 | Bacteria | 951 |
| 260 | Ga0207686_10242708 | 3300025934 | Bacteria | 1312 |
| 261 | Ga0207686_10755245 | 3300025934 | Bacteria | 777 |
| 262 | Ga0207686_11149273 | 3300025934 | Bacteria | 634 |
| 263 | Ga0207686_11229117 | 3300025934 | Bacteria | 614 |
| 264 | Ga0207709_10304309 | 3300025935 | Bacteria | 1187 |
| 265 | Ga0207670_10558862 | 3300025936 | Bacteria | 936 |
| 266 | Ga0207670_10766650 | 3300025936 | Bacteria | 802 |
| 267 | Ga0207669_10338368 | 3300025937 | Bacteria | 1158 |
| 268 | Ga0207669_11317905 | 3300025937 | Bacteria | 614 |
| 269 | Ga0207704_10375369 | 3300025938 | Bacteria | 1115 |
| 270 | Ga0207704_10514856 | 3300025938 | Bacteria | 967 |
| 271 | Ga0207704_11164861 | 3300025938 | Bacteria | 656 |
| 272 | Ga0207704_11333064 | 3300025938 | Bacteria | 614 |
| 273 | Ga0207665_10055248 | 3300025939 | Bacteria | 2679 |
| 274 | Ga0207691_10240491 | 3300025940 | Bacteria | 1565 |
| 275 | Ga0207691_10641562 | 3300025940 | Bacteria | 898 |
| 276 | Ga0207711_10001469 | 3300025941 | Bacteria | 21980 |
| 277 | Ga0207711_10220646 | 3300025941 | Bacteria | 1734 |
| 278 | Ga0207711_10345144 | 3300025941 | Bacteria | 1378 |
| 279 | Ga0207711_10702239 | 3300025941 | Bacteria | 943 |
| 280 | Ga0207711_10957209 | 3300025941 | Bacteria | 795 |
| 281 | Ga0207689_11580734 | 3300025942 | Bacteria | 546 |
| 282 | Ga0207661_10339841 | 3300025944 | Bacteria | 1353 |
| 283 | Ga0207661_10720209 | 3300025944 | Bacteria | 918 |
| 284 | Ga0207667_10310503 | 3300025949 | Bacteria | 1611 |
| 285 | Ga0207667_10334516 | 3300025949 | Bacteria | 1546 |
| 286 | Ga0207651_10586891 | 3300025960 | Bacteria | 973 |
| 287 | Ga0207651_11405958 | 3300025960 | Bacteria | 628 |
| 288 | Ga0207712_10399006 | 3300025961 | Bacteria | 1155 |
| 289 | Ga0207712_10527509 | 3300025961 | Bacteria | 1013 |
| 290 | Ga0207668_10000571 | 3300025972 | Bacteria | 23129 |
| 291 | Ga0207668_10094143 | 3300025972 | Bacteria | 2208 |
| 292 | Ga0207640_10155026 | 3300025981 | Bacteria | 1687 |
| 293 | Ga0207640_10586847 | 3300025981 | Bacteria | 941 |
| 294 | Ga0207658_10010638 | 3300025986 | Bacteria | 6254 |
| 295 | Ga0207658_10576536 | 3300025986 | Bacteria | 1009 |
| 296 | Ga0207658_11972184 | 3300025986 | Bacteria | 531 |
| 297 | Ga0207703_10116717 | 3300026035 | Bacteria | 2285 |
| 298 | Ga0207703_11359513 | 3300026035 | Bacteria | 683 |
| 299 | Ga0207678_10151952 | 3300026067 | Bacteria | 1977 |
| 300 | Ga0207678_10956156 | 3300026067 | Bacteria | 758 |
| 301 | Ga0207708_10825886 | 3300026075 | Bacteria | 799 |
| 302 | Ga0207702_10527062 | 3300026078 | Bacteria | 1154 |
| 303 | Ga0207702_11932734 | 3300026078 | Bacteria | 581 |
| 304 | Ga0207641_10539690 | 3300026088 | Bacteria | 1136 |
| 305 | Ga0207641_11020111 | 3300026088 | Bacteria | 824 |
| 306 | Ga0207648_10690181 | 3300026089 | Bacteria | 946 |
| 307 | Ga0207676_10186744 | 3300026095 | Bacteria | 1820 |
| 308 | Ga0207676_10882512 | 3300026095 | Bacteria | 876 |
| 309 | Ga0207676_11284243 | 3300026095 | Bacteria | 726 |
| 310 | Ga0207676_11600591 | 3300026095 | Bacteria | 649 |
| 311 | Ga0207675_100097135 | 3300026118 | Bacteria | 2774 |
| 312 | Ga0207675_101929991 | 3300026118 | Bacteria | 609 |
| 313 | Ga0207683_10181530 | 3300026121 | Bacteria | 1908 |
| 314 | Ga0207683_10635681 | 3300026121 | Bacteria | 988 |
| 315 | Ga0207683_10653920 | 3300026121 | Bacteria | 974 |
| 316 | Ga0207683_10711715 | 3300026121 | Bacteria | 931 |
| 317 | Ga0207698_10448373 | 3300026142 | Bacteria | 1245 |
| 318 | Ga0207698_10890419 | 3300026142 | Bacteria | 897 |
| 319 | Ga0207698_11826412 | 3300026142 | Bacteria | 623 |
| 320 | Ga0209981_1000043 | 3300027378 | Bacteria | 12361 |
| 321 | Ga0209999_1001367 | 3300027543 | Bacteria | 4179 |
| 322 | Ga0209970_1050229 | 3300027614 | Bacteria | 753 |
| 323 | Ga0209813_10260203 | 3300027866 | Bacteria | 662 |
| 324 | Ga0268266_10001264 | 3300028379 | Bacteria | 30909 |
| 325 | Ga0268266_10138455 | 3300028379 | Bacteria | 2182 |
| 326 | Ga0268266_11315726 | 3300028379 | Bacteria | 698 |
| 327 | Ga0268265_10071315 | 3300028380 | Bacteria | 2705 |
| 328 | Ga0268265_10251223 | 3300028380 | Bacteria | 1566 |
| 329 | Ga0268264_10074566 | 3300028381 | Bacteria | 2883 |
| 330 | Ga0265318_10245698 | 3300028577 | Bacteria | 653 |
| 331 | Ga0307517_10256707 | 3300028786 | Bacteria | 1019 |
| 332 | Ga0307515_10186233 | 3300028794 | Bacteria | 2004 |
| 333 | Ga0307515_10273927 | 3300028794 | Bacteria | 1404 |
| 334 | Ga0307515_10489757 | 3300028794 | Bacteria | 841 |
| 335 | Ga0265338_10087400 | 3300028800 | Bacteria | 2590 |
| 336 | Ga0265338_10435271 | 3300028800 | Bacteria | 930 |
| 337 | Ga0307511_10006537 | 3300030521 | Bacteria | 11736 |
| 338 | Ga0316179_1105792 | 3300030734 | Bacteria | 587 |
| 339 | Ga0265320_10193602 | 3300031240 | Bacteria | 909 |
| 340 | Ga0265327_10452269 | 3300031251 | Bacteria | 555 |
| 341 | Ga0265316_10329492 | 3300031344 | Bacteria | 1108 |
| 342 | Ga0307513_10010515 | 3300031456 | Bacteria | 11583 |
| 343 | Ga0307513_10323519 | 3300031456 | Bacteria | 1299 |
| 344 | Ga0307513_10324480 | 3300031456 | Bacteria | 1296 |
| 345 | Ga0307513_10497209 | 3300031456 | Bacteria | 937 |
| 346 | Ga0307513_10541303 | 3300031456 | Bacteria | 878 |
| 347 | Ga0307408_100804034 | 3300031548 | Bacteria | 854 |
| 348 | Ga0307408_101155541 | 3300031548 | Bacteria | 720 |
| 349 | Ga0265313_10073033 | 3300031595 | Bacteria | 1575 |
| 350 | Ga0307508_10257921 | 3300031616 | Bacteria | 1339 |
| 351 | Ga0265314_10049643 | 3300031711 | Bacteria | 2936 |
| 352 | Ga0307516_10001565 | 3300031730 | Bacteria | 31484 |
| 353 | Ga0307405_10778948 | 3300031731 | Bacteria | 799 |
| 354 | Ga0307405_10957200 | 3300031731 | Bacteria | 728 |
| 355 | Ga0307405_11749506 | 3300031731 | Bacteria | 552 |
| 356 | Ga0307413_10101849 | 3300031824 | Bacteria | 1899 |
| 357 | Ga0307410_10302301 | 3300031852 | Bacteria | 1263 |
| 358 | Ga0307410_11457150 | 3300031852 | Bacteria | 602 |
| 359 | Ga0307412_10237387 | 3300031911 | Bacteria | 1408 |
| 360 | Ga0307412_10380730 | 3300031911 | Bacteria | 1142 |
| 361 | Ga0307412_11399718 | 3300031911 | Bacteria | 633 |
| 362 | Ga0307409_100845138 | 3300031995 | Bacteria | 926 |
| 363 | Ga0307409_101736463 | 3300031995 | Bacteria | 653 |
| 364 | Ga0307416_102566324 | 3300032002 | Bacteria | 608 |
| 365 | Ga0307416_103078228 | 3300032002 | Bacteria | 558 |
| 366 | Ga0307416_103370177 | 3300032002 | Bacteria | 535 |
| 367 | Ga0307414_10041874 | 3300032004 | Bacteria | 3106 |
| 368 | Ga0307411_10049694 | 3300032005 | Bacteria | 2727 |
| 369 | Ga0307411_11291003 | 3300032005 | Bacteria | 665 |
| 370 | Ga0307415_101658437 | 3300032126 | Bacteria | 616 |
| 371 | Ga0307510_10265336 | 3300033180 | Bacteria | 1196 |
| 372 | Ga0373950_0137025 | 3300034818 | Bacteria | 552 |
| 373 | Ga0373926_0010572 | 3300035083 | Bacteria | 3095 |
| 374 | Ga0373926_0248156 | 3300035083 | Bacteria | 690 |
| 375 | Ga0373944_0005737 | 3300035089 | Bacteria | 3277 |
| 376 | Ga0373923_0026132 | 3300035111 | Bacteria | 2321 |
| 377 | Ga0373932_0150233 | 3300035112 | Bacteria | 799 |
| 378 | Ga0373936_0004112 | 3300035113 | Bacteria | 5483 |
| 379 | Ga0373936_0084560 | 3300035113 | Bacteria | 1324 |
| 380 | Ga0373945_0003481 | 3300035116 | Bacteria | 4955 |
| 381 | Ga0373945_0108905 | 3300035116 | Bacteria | 1091 |
| 382 | Ga0373945_0417066 | 3300035116 | Bacteria | 590 |
| 383 | Ga0373954_0186112 | 3300035118 | Bacteria | 1019 |
| 384 | Ga0373954_0310753 | 3300035118 | Bacteria | 778 |
| 385 | Ga0373943_0002080 | 3300035170 | Bacteria | 9085 |
| 386 | Ga0373943_0412159 | 3300035170 | Bacteria | 781 |
| 387 | Ga0373946_0002899 | 3300035171 | Bacteria | 6083 |
| 388 | Ga0373955_0054166 | 3300035172 | Bacteria | 2193 |
| 389 | Ga0373931_0526749 | 3300035691 | Bacteria | 765 |
| 390 | Ga0373931_1248617 | 3300035691 | Bacteria | 510 |
| 391 | Ga0373935_0018438 | 3300035692 | Bacteria | 4244 |
| 392 | Ga0373935_1002066 | 3300035692 | Bacteria | 620 |
| 393 | Ga0373927_0000479 | 3300035695 | Bacteria | 30749 |
| 394 | Ga0373927_0011299 | 3300035695 | Bacteria | 5942 |
| 395 | Ga0373927_0145423 | 3300035695 | Bacteria | 1552 |
| 396 | Ga0373947_0010251 | 3300035725 | Bacteria | 5379 |
| 397 | Ga0373937_0951052 | 3300036401 | Bacteria | 808 |
| 398 | Ga0373937_1284240 | 3300036401 | Bacteria | 680 |
| 399 | Ga0373937_1881776 | 3300036401 | Bacteria | 545 |
| 400 | Ga0373925_0000023 | 3300037068 | Bacteria | 158881 |
| 401 | Ga0373925_0274946 | 3300037068 | Bacteria | 1355 |
| 402 | Ga0373925_0921167 | 3300037068 | Bacteria | 720 |
| 403 | Ga0373925_1397990 | 3300037068 | Bacteria | 573 |
| 404 | Ga0395899_0025758 | 3300037312 | Bacteria | 4439 |
| 405 | Ga0395899_0152780 | 3300037312 | Bacteria | 1635 |
| 406 | Ga0395899_0736942 | 3300037312 | Bacteria | 615 |
| 407 | Ga0395900_0058480 | 3300037418 | Bacteria | 3968 |
| 408 | Ga0395900_0069866 | 3300037418 | Bacteria | 3610 |
| 409 | Ga0395898_0118890 | 3300037466 | Bacteria | 2531 |
| 410 | Ga0395898_0712065 | 3300037466 | Bacteria | 946 |
| 411 | Ga0395905_0001028 | 3300037471 | Bacteria | 35552 |
| 412 | Ga0395905_0082872 | 3300037471 | Bacteria | 3005 |
| 413 | Ga0395905_0119007 | 3300037471 | Bacteria | 2482 |
| 414 | Ga0395905_0463395 | 3300037471 | Bacteria | 1166 |
| 415 | Ga0395905_0650545 | 3300037471 | Bacteria | 956 |
| 416 | Ga0395905_0806897 | 3300037471 | Bacteria | 841 |
| 417 | Ga0395905_0824341 | 3300037471 | Bacteria | 831 |
| 418 | Ga0395905_1764859 | 3300037471 | Bacteria | 524 |
| 419 | Ga0395901_0098100 | 3300038443 | Bacteria | 3072 |
| 420 | Ga0395901_0148822 | 3300038443 | Bacteria | 2460 |
| 421 | Ga0395901_1350935 | 3300038443 | Bacteria | 673 |
| 422 | Ga0436365_0074797 | 3300039437 | Bacteria | 4141 |
| 423 | Ga0436360_0443273 | 3300039438 | Bacteria | 928 |
| 424 | Ga0436361_0429361 | 3300039447 | Bacteria | 690 |
| 425 | Ga0436361_0953537 | 3300039447 | Bacteria | 44604 |
| 426 | Ga0436363_0053074 | 3300039450 | Bacteria | 541 |
| 427 | Ga0436362_0904387 | 3300039453 | Bacteria | 722 |
| 428 | Ga0439465_0018730 | 3300041413 | Bacteria | 2163 |
| 429 | Ga0439465_0081318 | 3300041413 | Bacteria | 1099 |
| 430 | Ga0451794_20570 | 3300041446 | Bacteria | 1046 |
| 431 | Ga0451791_0247409 | 3300041451 | Bacteria | 546 |
| 432 | Ga0451798_0341123 | 3300041458 | Bacteria | 901 |
| 433 | Ga0451833_0325122 | 3300041491 | Bacteria | 742 |
| 434 | Ga0451839_0176911 | 3300041496 | Bacteria | 749 |
| 435 | Ga0451841_1137634 | 3300041498 | Bacteria | 938 |
| 436 | Ga0451851_0179633 | 3300041507 | Bacteria | 573 |
| 437 | Ga0451853_2424685 | 3300041512 | Bacteria | 1036 |
| 438 | Ga0439437_010744 | 3300042000 | Bacteria | 1043 |
| 439 | Ga0439442_144008 | 3300042002 | Bacteria | 528 |
| 440 | Ga0439455_0005999 | 3300042012 | Bacteria | 2499 |
| 441 | Ga0439462_0046811 | 3300042015 | Bacteria | 1159 |
| 442 | Ga0450923_076713 | 3300042125 | Bacteria | 747 |
| 443 | Ga0450923_090090 | 3300042125 | Bacteria | 698 |
| 444 | Ga0450890_051224 | 3300042127 | Bacteria | 630 |
| 445 | Ga0439446_0038799 | 3300042156 | Bacteria | 1397 |
| 446 | Ga0439434_0080920 | 3300042435 | Bacteria | 1031 |
| 447 | Ga0439434_0095085 | 3300042435 | Bacteria | 956 |
| 448 | Ga0439435_0067456 | 3300042436 | Bacteria | 1053 |
| 449 | Ga0439459_0000384 | 3300042438 | Bacteria | 5522 |
| 450 | Ga0450916_041524 | 3300042530 | Bacteria | 701 |
| 451 | Ga0466969_0002862 | 3300044656 | Bacteria | 9217 |
| 452 | Ga0466972_0138769 | 3300044658 | Bacteria | 1144 |
| 453 | Ga0466965_0113070 | 3300044683 | Bacteria | 1397 |
| 454 | Ga0466965_0194551 | 3300044683 | Bacteria | 1074 |
| 455 | Ga0466965_0379500 | 3300044683 | Bacteria | 778 |
| 456 | Ga0466966_0001452 | 3300044684 | Bacteria | 15233 |
| 457 | Ga0466961_0000659 | 3300044693 | Bacteria | 21720 |
| 458 | Ga0466961_0084917 | 3300044693 | Bacteria | 2002 |
| 459 | Ga0466963_0167988 | 3300044694 | Bacteria | 1528 |
| 460 | Ga0466964_0534471 | 3300044706 | Bacteria | 634 |
| 461 | Ga0466971_0000901 | 3300044719 | Bacteria | 12185 |
| 462 | Ga0466971_0111556 | 3300044719 | Bacteria | 1262 |
| 463 | Ga0466971_0144315 | 3300044719 | Bacteria | 1109 |
| 464 | Ga0466968_0276648 | 3300044735 | Bacteria | 802 |
| 465 | Ga0466970_0004965 | 3300044765 | Bacteria | 6573 |
| 466 | Ga0466970_0350821 | 3300044765 | Bacteria | 837 |
| 467 | Ga0466957_0304632 | 3300044842 | Bacteria | 1071 |
| 468 | Ga0466960_0170736 | 3300044901 | Bacteria | 1173 |
| 469 | Ga0466959_0000162 | 3300045049 | Bacteria | 44052 |
| 470 | Ga0466959_0036896 | 3300045049 | Bacteria | 3611 |
| 471 | Ga0451576_2555345 | 3300045051 | Bacteria | 521 |
| 472 | Ga0466958_0000155 | 3300045836 | Bacteria | 24034 |
| 473 | Ga0466958_0186424 | 3300045836 | Bacteria | 1318 |
| 474 | Ga0495627_000399 | 3300046453 | Bacteria | 38947 |
| 475 | Ga0495592_0662306 | 3300046454 | Bacteria | 631 |
| 476 | Ga0495590_0003932 | 3300046457 | Bacteria | 6042 |
| 477 | Ga0495590_0269488 | 3300046457 | Bacteria | 636 |
| 478 | Ga0495629_0011151 | 3300046459 | Bacteria | 6530 |
| 479 | Ga0495629_0040236 | 3300046459 | Bacteria | 3288 |
| 480 | Ga0495629_0465940 | 3300046459 | Bacteria | 854 |
| 481 | Ga0495638_0102148 | 3300046460 | Bacteria | 1713 |
| 482 | Ga0495638_0159678 | 3300046460 | Bacteria | 1301 |
| 483 | Ga0495638_0303612 | 3300046460 | Bacteria | 859 |
| 484 | Ga0495638_0501302 | 3300046460 | Bacteria | 611 |
| 485 | Ga0495650_0000269 | 3300046471 | Bacteria | 99675 |
| 486 | Ga0495650_0096644 | 3300046471 | Bacteria | 1114 |
| 487 | Ga0495650_0114351 | 3300046471 | Bacteria | 999 |
| 488 | Ga0495580_0081838 | 3300046472 | Bacteria | 2250 |
| 489 | Ga0495582_0250444 | 3300046473 | Bacteria | 1016 |
| 490 | Ga0495605_0117281 | 3300046474 | Bacteria | 1210 |
| 491 | Ga0495605_0119117 | 3300046474 | Bacteria | 1198 |
| 492 | Ga0495662_0011694 | 3300046476 | Bacteria | 4290 |
| 493 | Ga0495662_0017825 | 3300046476 | Bacteria | 3437 |
| 494 | Ga0495662_0080231 | 3300046476 | Bacteria | 1587 |
| 495 | Ga0495584_0094537 | 3300046491 | Bacteria | 1509 |
| 496 | Ga0495585_0047175 | 3300046492 | Bacteria | 2400 |
| 497 | Ga0495585_0247812 | 3300046492 | Bacteria | 890 |
| 498 | Ga0495585_0516776 | 3300046492 | Bacteria | 566 |
| 499 | Ga0495594_0504110 | 3300046499 | Bacteria | 687 |
| 500 | Ga0495596_0192471 | 3300046500 | Bacteria | 793 |
| 501 | Ga0495607_0050892 | 3300046501 | Bacteria | 2409 |
| 502 | Ga0495583_0000650 | 3300046506 | Bacteria | 45814 |
| 503 | Ga0495583_0044333 | 3300046506 | Bacteria | 2064 |
| 504 | Ga0495583_0161456 | 3300046506 | Bacteria | 924 |
| 505 | Ga0495606_0041810 | 3300046507 | Bacteria | 3071 |
| 506 | Ga0495606_0082018 | 3300046507 | Bacteria | 2003 |
| 507 | Ga0495610_0017211 | 3300046512 | Bacteria | 4126 |
| 508 | Ga0495610_0062120 | 3300046512 | Bacteria | 1772 |
| 509 | Ga0495610_0161341 | 3300046512 | Bacteria | 947 |
| 510 | Ga0495616_0057091 | 3300046513 | Bacteria | 1926 |
| 511 | Ga0495618_0066093 | 3300046514 | Bacteria | 2298 |
| 512 | Ga0495620_0053397 | 3300046515 | Bacteria | 1711 |
| 513 | Ga0495620_0183243 | 3300046515 | Bacteria | 809 |
| 514 | Ga0495620_0265930 | 3300046515 | Bacteria | 653 |
| 515 | Ga0495630_0012248 | 3300046517 | Bacteria | 6221 |
| 516 | Ga0495630_0036759 | 3300046517 | Bacteria | 3660 |
| 517 | Ga0495631_0037496 | 3300046518 | Bacteria | 2159 |
| 518 | Ga0495637_0015304 | 3300046520 | Bacteria | 3598 |
| 519 | Ga0495637_0089253 | 3300046520 | Bacteria | 1218 |
| 520 | Ga0495643_0002864 | 3300046522 | Bacteria | 13105 |
| 521 | Ga0495644_0136868 | 3300046523 | Bacteria | 935 |
| 522 | Ga0495648_0014211 | 3300046524 | Bacteria | 5839 |
| 523 | Ga0495648_0070299 | 3300046524 | Bacteria | 2034 |
| 524 | Ga0495648_0114732 | 3300046524 | Bacteria | 1459 |
| 525 | Ga0495648_0160454 | 3300046524 | Bacteria | 1163 |
| 526 | Ga0495663_0020482 | 3300046525 | Bacteria | 1898 |
| 527 | Ga0495663_0055156 | 3300046525 | Bacteria | 1239 |
| 528 | Ga0495666_0069218 | 3300046526 | Bacteria | 1679 |
| 529 | Ga0495642_0035363 | 3300046528 | Bacteria | 2015 |
| 530 | Ga0495642_0165305 | 3300046528 | Bacteria | 960 |
| 531 | Ga0495652_0325732 | 3300046529 | Bacteria | 1108 |
| 532 | Ga0495654_0000123 | 3300046530 | Bacteria | 86159 |
| 533 | Ga0495654_0084152 | 3300046530 | Bacteria | 1486 |
| 534 | Ga0495665_0268487 | 3300046531 | Bacteria | 876 |
| 535 | Ga0495665_0511358 | 3300046531 | Bacteria | 604 |
| 536 | Ga0495640_0008684 | 3300046533 | Bacteria | 7963 |
| 537 | Ga0495640_0299190 | 3300046533 | Bacteria | 999 |
| 538 | Ga0495598_0036334 | 3300046537 | Bacteria | 1415 |
| 539 | Ga0495609_0054080 | 3300046538 | Bacteria | 1783 |
| 540 | Ga0495609_0192755 | 3300046538 | Bacteria | 854 |
| 541 | Ga0495621_0046297 | 3300046539 | Bacteria | 1543 |
| 542 | Ga0495621_0075144 | 3300046539 | Bacteria | 1251 |
| 543 | Ga0495597_0001666 | 3300046542 | Bacteria | 15467 |
| 544 | Ga0495597_0020495 | 3300046542 | Bacteria | 3078 |
| 545 | Ga0495645_0001091 | 3300046543 | Bacteria | 18367 |
| 546 | Ga0495622_0002985 | 3300046557 | Bacteria | 8042 |
| 547 | Ga0495633_0029769 | 3300046558 | Bacteria | 2655 |
| 548 | Ga0495667_0678148 | 3300046559 | Bacteria | 639 |
| 549 | Ga0495668_0001504 | 3300046616 | Bacteria | 22287 |
| 550 | Ga0495668_0010366 | 3300046616 | Bacteria | 5641 |
| 551 | Ga0495668_0010401 | 3300046616 | Bacteria | 5629 |
| 552 | Ga0495668_0015955 | 3300046616 | Bacteria | 4375 |
| 553 | Ga0495668_0025709 | 3300046616 | Bacteria | 3344 |
| 554 | Ga0495668_0097894 | 3300046616 | Bacteria | 1605 |
| 555 | Ga0495668_0360424 | 3300046616 | Bacteria | 798 |
| 556 | Ga0495634_0074683 | 3300046642 | Bacteria | 2227 |
| 557 | Ga0495634_0216890 | 3300046642 | Bacteria | 1182 |
| 558 | Ga0495611_0074940 | 3300046648 | Bacteria | 1550 |
| 559 | Ga0495625_0001925 | 3300046660 | Bacteria | 23466 |
| 560 | Ga0495625_0029168 | 3300046660 | Bacteria | 4129 |
| 561 | Ga0495625_0049607 | 3300046660 | Bacteria | 3016 |
| 562 | Ga0495625_0092672 | 3300046660 | Bacteria | 2087 |
| 563 | Ga0495625_0255297 | 3300046660 | Bacteria | 1136 |
| 564 | Ga0495625_0488581 | 3300046660 | Bacteria | 754 |
| 565 | Ga0495625_0516072 | 3300046660 | Bacteria | 728 |
| 566 | Ga0495635_0027464 | 3300046663 | Bacteria | 3958 |
| 567 | Ga0495635_0338846 | 3300046663 | Bacteria | 1004 |
| 568 | Ga0495659_0073651 | 3300046664 | Bacteria | 1284 |
| 569 | Ga0495661_0294697 | 3300046665 | Bacteria | 814 |
| 570 | Ga0495588_0065552 | 3300046674 | Bacteria | 1884 |
| 571 | Ga0495646_0248625 | 3300046680 | Bacteria | 953 |
| 572 | Ga0495647_0035871 | 3300046681 | Bacteria | 1864 |
| 573 | Ga0495658_0034091 | 3300046683 | Bacteria | 2792 |
| 574 | Ga0495658_0325523 | 3300046683 | Bacteria | 975 |
| 575 | Ga0495669_0000371 | 3300046684 | Bacteria | 22866 |
| 576 | Ga0495669_0054174 | 3300046684 | Bacteria | 1805 |
| 577 | Ga0495669_0088099 | 3300046684 | Bacteria | 1431 |
| 578 | Ga0495613_0007746 | 3300046689 | Bacteria | 7991 |
| 579 | Ga0495613_0219732 | 3300046689 | Bacteria | 1334 |
| 580 | Ga0495624_0006859 | 3300046690 | Bacteria | 8040 |
| 581 | Ga0495624_0552676 | 3300046690 | Bacteria | 687 |
| 582 | Ga0495670_0150002 | 3300046691 | Bacteria | 1222 |
| 583 | Ga0495670_0298359 | 3300046691 | Bacteria | 863 |
| 584 | Ga0495670_0728965 | 3300046691 | Bacteria | 541 |
| 585 | Ga0495671_0135611 | 3300046692 | Bacteria | 1200 |
| 586 | Ga0495671_0299871 | 3300046692 | Bacteria | 773 |
| 587 | Ga0495589_0174091 | 3300046794 | Bacteria | 1022 |
| 588 | Ga0495660_0035609 | 3300046810 | Bacteria | 2780 |
| 589 | Ga0495660_0355480 | 3300046810 | Bacteria | 650 |
| 590 | Ga0495581_0016908 | 3300047315 | Bacteria | 4239 |
| 591 | Ga0495581_0399680 | 3300047315 | Bacteria | 801 |
| 592 | Ga0495581_0780193 | 3300047315 | Bacteria | 549 |
| 593 | Ga0495636_0006624 | 3300047318 | Bacteria | 4554 |
| 594 | Ga0495674_0001453 | 3300047319 | Bacteria | 23203 |
| 595 | Ga0495672_0000439 | 3300047320 | Bacteria | 49666 |
| 596 | Ga0495672_0012941 | 3300047320 | Bacteria | 5784 |
| 597 | Ga0495672_0074113 | 3300047320 | Bacteria | 1918 |
| 598 | Ga0495676_0116645 | 3300047321 | Bacteria | 1949 |
| 599 | Ga0495676_0662790 | 3300047321 | Bacteria | 677 |
| 600 | Ga0495680_0380315 | 3300047322 | Bacteria | 978 |
| 601 | Ga0495683_0149520 | 3300047323 | Bacteria | 1088 |
| 602 | Ga0495683_0343954 | 3300047323 | Bacteria | 631 |
| 603 | Ga0495687_008468 | 3300047443 | Bacteria | 5884 |
| 604 | Ga0495677_0144107 | 3300047445 | Bacteria | 915 |
| 605 | Ga0495673_0000189 | 3300047469 | Bacteria | 99018 |
| 606 | Ga0495673_0006882 | 3300047469 | Bacteria | 6626 |
| 607 | Ga0495673_0118202 | 3300047469 | Bacteria | 1052 |
| 608 | Ga0495681_0066188 | 3300047470 | Bacteria | 1650 |
| 609 | Ga0495681_0220705 | 3300047470 | Bacteria | 760 |
| 610 | Ga0495684_0037005 | 3300047471 | Bacteria | 3741 |
| 611 | Ga0495684_0189426 | 3300047471 | Bacteria | 1521 |
| 612 | Ga0495684_0301994 | 3300047471 | Bacteria | 1149 |
| 613 | Ga0495686_0015147 | 3300047472 | Bacteria | 5280 |
| 614 | Ga0495686_0172695 | 3300047472 | Bacteria | 1256 |
| 615 | Ga0495686_0308730 | 3300047472 | Bacteria | 870 |
| 616 | Ga0495686_0348585 | 3300047472 | Bacteria | 805 |
| 617 | Ga0495686_0470956 | 3300047472 | Bacteria | 665 |
| 618 | Ga0495593_0008408 | 3300047673 | Bacteria | 6002 |
| 619 | Ga0495593_0055809 | 3300047673 | Bacteria | 2078 |
| 620 | Ga0495593_0129728 | 3300047673 | Bacteria | 1280 |
| 621 | Ga0495602_0204492 | 3300048088 | Bacteria | 1504 |
| 622 | Ga0495615_0002803 | 3300048090 | Bacteria | 2838 |
| 623 | Ga0496100_0210999 | 3300048903 | Bacteria | 1420 |
| 624 | Ga0496100_0522401 | 3300048903 | Bacteria | 916 |
| 625 | Ga0496101_0023677 | 3300048904 | Bacteria | 4244 |
| 626 | Ga0496101_0338930 | 3300048904 | Bacteria | 1181 |
| 627 | Ga0496102_0090282 | 3300048905 | Bacteria | 2835 |
| 628 | Ga0496102_0513340 | 3300048905 | Bacteria | 1121 |
| 629 | Ga0496102_1410400 | 3300048905 | Bacteria | 615 |
| 630 | Ga0496103_0121911 | 3300048906 | Bacteria | 1661 |
| 631 | Ga0496103_0797543 | 3300048906 | Bacteria | 596 |
| 632 | Ga0496104_0553724 | 3300048907 | Bacteria | 1061 |
| 633 | Ga0496104_0805091 | 3300048907 | Bacteria | 846 |
| 634 | Ga0496105_0512921 | 3300048908 | Bacteria | 940 |
| 635 | Ga0496105_0642390 | 3300048908 | Bacteria | 820 |
| 636 | Ga0496106_0028330 | 3300048909 | Bacteria | 4172 |
| 637 | Ga0496106_0278925 | 3300048909 | Bacteria | 1339 |
| 638 | Ga0496106_0537005 | 3300048909 | Bacteria | 939 |
| 639 | Ga0496106_0625688 | 3300048909 | Bacteria | 861 |
| 640 | Ga0496107_0000073 | 3300048910 | Bacteria | 48489 |
| 641 | Ga0496107_0020868 | 3300048910 | Bacteria | 4631 |
| 642 | Ga0496107_0083885 | 3300048910 | Bacteria | 2324 |
| 643 | Ga0496108_0463480 | 3300048911 | Bacteria | 1107 |
| 644 | Ga0496109_0121692 | 3300048912 | Bacteria | 2432 |
| 645 | Ga0496109_0121719 | 3300048912 | Bacteria | 2431 |
| 646 | Ga0496110_0591050 | 3300048913 | Bacteria | 1007 |
| 647 | Ga0496110_1498210 | 3300048913 | Bacteria | 584 |
| 648 | Ga0496111_0109254 | 3300048914 | Bacteria | 2036 |
| 649 | Ga0496112_0033003 | 3300048915 | Bacteria | 5027 |
| 650 | Ga0496112_0732935 | 3300048915 | Bacteria | 915 |
| 651 | Ga0496113_0035256 | 3300048916 | Bacteria | 3658 |
| 652 | Ga0496115_0003309 | 3300048918 | Bacteria | 11572 |
| 653 | Ga0496115_0085120 | 3300048918 | Bacteria | 2578 |
| 654 | Ga0496115_0270087 | 3300048918 | Bacteria | 1397 |
| 655 | Ga0496115_0348888 | 3300048918 | Bacteria | 1207 |
| 656 | Ga0496115_0854900 | 3300048918 | Bacteria | 704 |
| 657 | Ga0496117_0024468 | 3300048920 | Bacteria | 4776 |
| 658 | Ga0496118_0018740 | 3300048921 | Bacteria | 6219 |
| 659 | Ga0496119_0023935 | 3300048922 | Bacteria | 4313 |
| 660 | Ga0496120_0240672 | 3300048923 | Bacteria | 854 |
| 661 | Ga0496121_0000946 | 3300048924 | Bacteria | 52586 |
| 662 | Ga0496121_0023808 | 3300048924 | Bacteria | 5879 |
| 663 | Ga0496122_0000651 | 3300048925 | Bacteria | 70375 |
| 664 | Ga0496122_0364716 | 3300048925 | Bacteria | 748 |
| 665 | Ga0496123_0000043 | 3300048926 | Bacteria | 253752 |
| 666 | Ga0496124_0020028 | 3300048927 | Bacteria | 6197 |
| 667 | Ga0496124_0022787 | 3300048927 | Bacteria | 5733 |
| 668 | Ga0496124_0158183 | 3300048927 | Bacteria | 1769 |
| 669 | Ga0496125_0004886 | 3300048928 | Bacteria | 15201 |
| 670 | Ga0496125_0089075 | 3300048928 | Bacteria | 2322 |
| 671 | Ga0496125_0112323 | 3300048928 | Bacteria | 1969 |
| 672 | Ga0496126_0013092 | 3300048929 | Bacteria | 8462 |
| 673 | Ga0496126_0067161 | 3300048929 | Bacteria | 3204 |
| 674 | Ga0496126_0379332 | 3300048929 | Bacteria | 1151 |
| 675 | Ga0496126_0797254 | 3300048929 | Bacteria | 725 |
| 676 | Ga0501308_065762 | 3300049128 | Bacteria | 555 |
| 677 | Ga0501341_01086 | 3300049131 | Bacteria | 1306 |
| 678 | Ga0501341_16308 | 3300049131 | Bacteria | 526 |
| 679 | Ga0501307_009147 | 3300049162 | Bacteria | 1128 |
| 680 | Ga0495678_005077 | 3300049459 | Bacteria | 7394 |
| 681 | Ga0495682_0189030 | 3300049460 | Bacteria | 731 |
| 682 | Ga0501311_001352 | 3300049527 | Bacteria | 2099 |
| 683 | Ga0501311_005112 | 3300049527 | Bacteria | 1424 |
| 684 | Ga0501312_018936 | 3300049528 | Bacteria | 1007 |
| 685 | Ga0501315_030035 | 3300049531 | Bacteria | 778 |
| 686 | Ga0501317_038414 | 3300049533 | Bacteria | 722 |
| 687 | Ga0501320_007424 | 3300049536 | Bacteria | 1055 |
| 688 | Ga0501323_002862 | 3300049539 | Bacteria | 1715 |
| 689 | Ga0501324_013851 | 3300049540 | Bacteria | 768 |
| 690 | Ga0501032_0147319 | 3300049569 | Bacteria | 1549 |
| 691 | Ga0501032_0181983 | 3300049569 | Bacteria | 1376 |
| 692 | Ga0501032_0498461 | 3300049569 | Bacteria | 778 |
| 693 | Ga0501032_0886352 | 3300049569 | Bacteria | 562 |
| 694 | Ga0501033_0018681 | 3300049570 | Bacteria | 5240 |
| 695 | Ga0501033_0100089 | 3300049570 | Bacteria | 2116 |
| 696 | Ga0501033_0179594 | 3300049570 | Bacteria | 1518 |
| 697 | Ga0501033_0189684 | 3300049570 | Bacteria | 1471 |
| 698 | Ga0501033_0210011 | 3300049570 | Bacteria | 1388 |
| 699 | Ga0501033_0447220 | 3300049570 | Bacteria | 898 |
| 700 | Ga0501034_0035149 | 3300049571 | Bacteria | 5082 |
| 701 | Ga0501034_0182168 | 3300049571 | Bacteria | 2065 |
| 702 | Ga0501034_0204731 | 3300049571 | Bacteria | 1930 |
| 703 | Ga0501034_0382879 | 3300049571 | Bacteria | 1331 |
| 704 | Ga0501034_0535408 | 3300049571 | Bacteria | 1082 |
| 705 | Ga0501036_0089703 | 3300049572 | Bacteria | 2597 |
| 706 | Ga0501036_0246398 | 3300049572 | Bacteria | 1498 |
| 707 | Ga0501036_0356972 | 3300049572 | Bacteria | 1220 |
| 708 | Ga0501037_0739424 | 3300049573 | Bacteria | 652 |
| 709 | Ga0501037_0901014 | 3300049573 | Bacteria | 580 |
| 710 | Ga0501038_0094154 | 3300049574 | Bacteria | 2504 |
| 711 | Ga0501038_0221954 | 3300049574 | Bacteria | 1507 |
| 712 | Ga0501043_0038750 | 3300049579 | Bacteria | 3748 |
| 713 | Ga0501043_0147394 | 3300049579 | Bacteria | 1842 |
| 714 | Ga0501043_0161720 | 3300049579 | Bacteria | 1749 |
| 715 | Ga0501043_1268367 | 3300049579 | Bacteria | 515 |
| 716 | Ga0501046_0065839 | 3300049580 | Bacteria | 2826 |
| 717 | Ga0501047_0020305 | 3300049581 | Bacteria | 6380 |
| 718 | Ga0501047_0088409 | 3300049581 | Bacteria | 2975 |
| 719 | Ga0501047_0143792 | 3300049581 | Bacteria | 2263 |
| 720 | Ga0501047_0156023 | 3300049581 | Bacteria | 2156 |
| 721 | Ga0501047_0321913 | 3300049581 | Bacteria | 1386 |
| 722 | Ga0501047_0370072 | 3300049581 | Bacteria | 1268 |
| 723 | Ga0501047_0651263 | 3300049581 | Bacteria | 873 |
| 724 | Ga0501070_0026261 | 3300049586 | Bacteria | 4889 |
| 725 | Ga0501070_0164835 | 3300049586 | Bacteria | 1826 |
| 726 | Ga0501070_0168040 | 3300049586 | Bacteria | 1807 |
| 727 | Ga0501070_0950846 | 3300049586 | Bacteria | 668 |
| 728 | Ga0501071_1553375 | 3300049587 | Bacteria | 511 |
| 729 | Ga0501074_0241828 | 3300049590 | Bacteria | 1284 |
| 730 | Ga0501080_0296414 | 3300049742 | Bacteria | 1467 |
| 731 | Ga0501080_0989809 | 3300049742 | Bacteria | 730 |
| 732 | Ga0501080_1596111 | 3300049742 | Bacteria | 553 |
| 733 | Ga0501035_0033582 | 3300049822 | Bacteria | 4665 |
| 734 | Ga0501035_0048974 | 3300049822 | Bacteria | 3788 |
| 735 | Ga0501035_0159703 | 3300049822 | Bacteria | 1952 |
| 736 | Ga0501035_0433123 | 3300049822 | Bacteria | 1090 |
| 737 | Ga0501035_0743106 | 3300049822 | Bacteria | 788 |
| 738 | Ga0501044_0004107 | 3300049823 | Bacteria | 16325 |
| 739 | Ga0501044_0106728 | 3300049823 | Bacteria | 2812 |
| 740 | Ga0501044_0223450 | 3300049823 | Bacteria | 1833 |
| 741 | Ga0501044_0404179 | 3300049823 | Bacteria | 1278 |
| 742 | nmdc:mga03683_53024_c1 | 3300050489 | Bacteria | 1697 |
| 743 | nmdc:mga03n38_34767_c1 | 3300050490 | Bacteria | 2154 |
| 744 | nmdc:mga03n38_43132_c1 | 3300050490 | Bacteria | 1976 |
| 745 | nmdc:mga00v17_531120_c1 | 3300050491 | Bacteria | 761 |
| 746 | nmdc:mga00v17_992_c1 | 3300050491 | Bacteria | 15172 |
| 747 | nmdc:mga0k408_11918_c1 | 3300050493 | Bacteria | 4743 |
| 748 | nmdc:mga0k408_16271_c1 | 3300050493 | Bacteria | 4125 |
| 749 | nmdc:mga0k408_255511_c1 | 3300050493 | Bacteria | 1046 |
| 750 | nmdc:mga0k408_3470_c1 | 3300050493 | Bacteria | 8345 |
| 751 | nmdc:mga06z11_4918_c1 | 3300050494 | Bacteria | 5305 |
| 752 | nmdc:mga07m45_180766_c1 | 3300050496 | Bacteria | 1227 |
| 753 | nmdc:mga07m45_210264_c1 | 3300050496 | Bacteria | 1132 |
| 754 | nmdc:mga07m45_246019_c1 | 3300050496 | Bacteria | 1040 |
| 755 | nmdc:mga07m45_31868_c1 | 3300050496 | Bacteria | 2922 |
| 756 | nmdc:mga07m45_439304_c1 | 3300050496 | Bacteria | 757 |
| 757 | nmdc:mga07m45_44026_c1 | 3300050496 | Bacteria | 2504 |
| 758 | nmdc:mga07m45_561876_c1 | 3300050496 | Bacteria | 660 |
| 759 | nmdc:mga0n895_2160735_c1 | 3300050512 | Bacteria | 512 |
| 760 | nmdc:mga0a205_1151886_c1 | 3300050515 | Bacteria | 623 |
| 761 | nmdc:mga0sz30_18987_c1 | 3300050516 | Bacteria | 2757 |
| 762 | Ga0495601_0176286 | 3300053077 | Bacteria | 1397 |
| 763 | Ga0495612_0002649 | 3300053078 | Bacteria | 7384 |
| 764 | Ga0500635_0000205 | 3300053080 | Bacteria | 29287 |
| 765 | Ga0500635_0086822 | 3300053080 | Bacteria | 1132 |
| 766 | Ga0495619_0054636 | 3300053085 | Bacteria | 2643 |
| 767 | Ga0495619_0092071 | 3300053085 | Bacteria | 2053 |
| 768 | Ga0500578_0000459 | 3300053086 | Bacteria | 49572 |
| 769 | Ga0500578_0228255 | 3300053086 | Bacteria | 1129 |
| 770 | Ga0500578_0247483 | 3300053086 | Bacteria | 1075 |
| 771 | Ga0500578_0457666 | 3300053086 | Bacteria | 725 |
| 772 | Ga0500643_002694 | 3300053087 | Bacteria | 8926 |
| 773 | Ga0500643_011917 | 3300053087 | Bacteria | 3140 |
| 774 | Ga0500643_032910 | 3300053087 | Bacteria | 1570 |
| 775 | Ga0500643_050411 | 3300053087 | Bacteria | 1191 |
| 776 | Ga0500643_068551 | 3300053087 | Bacteria | 986 |
| 777 | Ga0500644_0000193 | 3300053088 | Bacteria | 37831 |
| 778 | Ga0500646_0101850 | 3300053090 | Bacteria | 903 |
| 779 | Ga0500646_0151204 | 3300053090 | Bacteria | 769 |
| 780 | Ga0500647_0003466 | 3300053091 | Bacteria | 6142 |
| 781 | Ga0500647_0164123 | 3300053091 | Bacteria | 1029 |
| 782 | Ga0500583_0043876 | 3300053092 | Bacteria | 2044 |
| 783 | Ga0500583_0167787 | 3300053092 | Bacteria | 1093 |
| 784 | Ga0500651_0003210 | 3300053093 | Bacteria | 8883 |
| 785 | Ga0500651_0119753 | 3300053093 | Bacteria | 1599 |
| 786 | Ga0500651_0350456 | 3300053093 | Bacteria | 838 |
| 787 | Ga0500566_0046745 | 3300053094 | Bacteria | 2486 |
| 788 | Ga0500566_0197498 | 3300053094 | Bacteria | 1019 |
| 789 | Ga0500641_0001231 | 3300053096 | Bacteria | 9101 |
| 790 | Ga0500641_0010127 | 3300053096 | Bacteria | 3400 |
| 791 | Ga0500641_0010509 | 3300053096 | Bacteria | 3346 |
| 792 | Ga0500650_0126436 | 3300053098 | Bacteria | 1190 |
| 793 | Ga0500554_002703 | 3300053102 | Bacteria | 3531 |
| 794 | Ga0500554_048927 | 3300053102 | Bacteria | 1324 |
| 795 | Ga0500555_000830 | 3300053103 | Bacteria | 11035 |
| 796 | Ga0500555_028108 | 3300053103 | Bacteria | 1603 |
| 797 | Ga0500555_177251 | 3300053103 | Bacteria | 516 |
| 798 | Ga0500556_0001077 | 3300053104 | Bacteria | 13785 |
| 799 | Ga0500556_0007134 | 3300053104 | Bacteria | 3194 |
| 800 | Ga0500556_0075595 | 3300053104 | Bacteria | 1265 |
| 801 | Ga0500556_0104965 | 3300053104 | Bacteria | 1091 |
| 802 | Ga0500556_0342195 | 3300053104 | Bacteria | 580 |
| 803 | Ga0500557_022790 | 3300053105 | Bacteria | 1814 |
| 804 | Ga0500562_000644 | 3300053108 | Bacteria | 8433 |
| 805 | Ga0500562_004235 | 3300053108 | Bacteria | 3627 |
| 806 | Ga0500562_017203 | 3300053108 | Bacteria | 1862 |
| 807 | Ga0500569_015492 | 3300053109 | Bacteria | 1910 |
| 808 | Ga0500569_141632 | 3300053109 | Bacteria | 809 |
| 809 | Ga0500572_000706 | 3300053111 | Bacteria | 10831 |
| 810 | Ga0500572_066165 | 3300053111 | Bacteria | 1108 |
| 811 | Ga0500591_226527 | 3300053115 | Bacteria | 610 |
| 812 | Ga0500593_036998 | 3300053117 | Bacteria | 2186 |
| 813 | Ga0500594_0004036 | 3300053118 | Bacteria | 3230 |
| 814 | Ga0500595_001651 | 3300053119 | Bacteria | 11721 |
| 815 | Ga0500595_026433 | 3300053119 | Bacteria | 2000 |
| 816 | Ga0500597_178156 | 3300053120 | Bacteria | 903 |
| 817 | Ga0500607_185706 | 3300053121 | Bacteria | 915 |
| 818 | Ga0500608_000084 | 3300053122 | Bacteria | 38834 |
| 819 | Ga0500608_000222 | 3300053122 | Bacteria | 22331 |
| 820 | Ga0500608_001997 | 3300053122 | Bacteria | 7304 |
| 821 | Ga0500614_011026 | 3300053123 | Bacteria | 1949 |
| 822 | Ga0500614_073605 | 3300053123 | Bacteria | 943 |
| 823 | Ga0500642_0098321 | 3300053130 | Bacteria | 1359 |
| 824 | Ga0500652_162658 | 3300053131 | Bacteria | 922 |
| 825 | Ga0500655_043741 | 3300053133 | Bacteria | 882 |
| 826 | Ga0500658_0000930 | 3300053134 | Bacteria | 11933 |
| 827 | Ga0500559_0001398 | 3300053136 | Bacteria | 13721 |
| 828 | Ga0500559_0011392 | 3300053136 | Bacteria | 3799 |
| 829 | Ga0500559_0021969 | 3300053136 | Bacteria | 2706 |
| 830 | Ga0500559_0179410 | 3300053136 | Bacteria | 997 |
| 831 | Ga0500559_0248740 | 3300053136 | Bacteria | 838 |
| 832 | Ga0500561_0097878 | 3300053137 | Bacteria | 876 |
| 833 | Ga0500564_031554 | 3300053138 | Bacteria | 2441 |
| 834 | Ga0500564_195496 | 3300053138 | Bacteria | 834 |
| 835 | Ga0500568_0022494 | 3300053139 | Bacteria | 2695 |
| 836 | Ga0500568_0120387 | 3300053139 | Bacteria | 978 |
| 837 | Ga0500573_0565810 | 3300053140 | Bacteria | 500 |
| 838 | Ga0500577_0007589 | 3300053142 | Bacteria | 3050 |
| 839 | Ga0500590_004741 | 3300053148 | Bacteria | 6459 |
| 840 | Ga0500603_016462 | 3300053150 | Bacteria | 1755 |
| 841 | Ga0500604_0131476 | 3300053151 | Bacteria | 842 |
| 842 | Ga0500616_0024622 | 3300053153 | Bacteria | 3342 |
| 843 | Ga0500616_0025329 | 3300053153 | Bacteria | 3291 |
| 844 | Ga0500619_109352 | 3300053154 | Bacteria | 940 |
| 845 | Ga0500619_123571 | 3300053154 | Bacteria | 882 |
| 846 | Ga0500622_0000771 | 3300053156 | Bacteria | 27846 |
| 847 | Ga0500622_0022339 | 3300053156 | Bacteria | 3354 |
| 848 | Ga0500622_0040896 | 3300053156 | Bacteria | 2413 |
| 849 | Ga0500622_0077734 | 3300053156 | Bacteria | 1666 |
| 850 | Ga0500627_0001516 | 3300053158 | Bacteria | 6534 |
| 851 | Ga0500633_0084409 | 3300053160 | Bacteria | 1153 |
| 852 | Ga0500634_0154117 | 3300053161 | Bacteria | 1070 |
| 853 | Ga0500638_122077 | 3300053162 | Bacteria | 1191 |
| 854 | Ga0500638_128492 | 3300053162 | Bacteria | 1151 |
| 855 | Ga0500637_0176033 | 3300053178 | Bacteria | 1227 |
| 856 | Ga0500576_243434 | 3300053725 | Bacteria | 567 |
| 857 | Ga0500611_014275 | 3300053727 | Bacteria | 1382 |
| 858 | Ga0500625_054205 | 3300053729 | Bacteria | 1842 |
| 859 | Ga0500645_002894 | 3300053730 | Bacteria | 7334 |
| 860 | Ga0500645_034026 | 3300053730 | Bacteria | 1523 |
| 861 | Ga0500645_058592 | 3300053730 | Bacteria | 1115 |
| 862 | Ga0500645_066541 | 3300053730 | Bacteria | 1037 |
| 863 | Ga0500645_179809 | 3300053730 | Bacteria | 575 |
| 864 | Ga0500609_000093 | 3300053731 | Bacteria | 11592 |
| 865 | Ga0500596_000363 | 3300053735 | Bacteria | 8223 |
| 866 | Ga0500661_014103 | 3300055283 | Bacteria | 1439 |
| 867 | Ga0500661_034475 | 3300055283 | Bacteria | 894 |
| 868 | Ga0587084_012531 | 3300059477 | Bacteria | 1150 |
| 869 | Ga0587093_020985 | 3300059478 | Bacteria | 874 |
| 870 | Ga0587093_085514 | 3300059478 | Bacteria | 550 |
| 871 | Ga0587066_098850 | 3300059490 | Bacteria | 660 |
| 872 | Ga0587070_033411 | 3300059491 | Bacteria | 946 |
| 873 | Ga0587070_063566 | 3300059491 | Bacteria | 770 |
| 874 | Ga0587073_0159362 | 3300059492 | Bacteria | 645 |
| 875 | Ga0587077_008542 | 3300059493 | Bacteria | 1528 |
| 876 | Ga0587077_016870 | 3300059493 | Bacteria | 1236 |
| 877 | Ga0587077_076372 | 3300059493 | Bacteria | 759 |
| 878 | Ga0587085_038004 | 3300059506 | Bacteria | 825 |
| 879 | Ga0587086_012095 | 3300059507 | Bacteria | 1068 |
| 880 | Ga0587091_064351 | 3300059511 | Bacteria | 787 |
| 881 | Ga0587101_005901 | 3300059623 | Bacteria | 1381 |
| 882 | Ga0587072_071104 | 3300059643 | Bacteria | 735 |
| 883 | Ga0587075_070140 | 3300059644 | Bacteria | 649 |
| 884 | Ga0587076_000918 | 3300059645 | Bacteria | 2764 |
| 885 | Ga0587076_006682 | 3300059645 | Bacteria | 1547 |
| 886 | Ga0587078_045938 | 3300059646 | Bacteria | 629 |
| 887 | Ga0587079_044614 | 3300059647 | Bacteria | 909 |
| 888 | Ga0587071_004686 | 3300060344 | Bacteria | 2055 |
| 889 | Ga0587111_0007029 | 3300060346 | Bacteria | 1812 |
| 890 | Ga0466962_0003721 | 3300061719 | Bacteria | 7277 |
| 891 | Ga0466962_0061720 | 3300061719 | Bacteria | 1789 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100046665 | Ga0070680_1000466655 | 88 |
| 2 | 3300005616 | Ga0068852_100109130 | Ga0068852_1001091303 | 88 |
| 3 | 3300009093 | Ga0105240_10013835 | Ga0105240_100138355 | 88 |
| 4 | 3300009093 | Ga0105240_11600569 | Ga0105240_116005692 | 90 |
| 5 | 3300013307 | Ga0157372_10265775 | Ga0157372_102657754 | 91 |
| 6 | 3300046457 | Ga0495590_0269488 | Ga0495590_0269488_59_343 | 93 |
| 7 | 3300026078 | Ga0207702_10527062 | Ga0207702_105270622 | 94 |
| 8 | 3300049528 | Ga0501312_018936 | Ga0501312_018936_661_954 | 95 |
| 9 | 3300059645 | Ga0587076_006682 | Ga0587076_006682_513_812 | 97 |
| 10 | 3300025900 | Ga0207710_10257719 | Ga0207710_102577192 | 98 |
| 11 | 3300025949 | Ga0207667_10310503 | Ga0207667_103105032 | 99 |
| 12 | 3300003371 | JGI26145J50221_1021227 | JGI26145J50221_10212271 | 100 |
| 13 | 3300005338 | Ga0068868_100805655 | Ga0068868_1008056552 | 100 |
| 14 | 3300005563 | Ga0068855_101930122 | Ga0068855_1019301222 | 100 |
| 15 | 3300025272 | Ga0209455_1018403 | Ga0209455_10184033 | 102 |
| 16 | 3300006051 | Ga0075364_10001038 | Ga0075364_100010387 | 103 |
| 17 | 3300006178 | Ga0075367_10001012 | Ga0075367_1000101219 | 103 |
| 18 | 3300035695 | Ga0373927_0145423 | Ga0373927_0145423_661_975 | 103 |
| 19 | 3300037068 | Ga0373925_1397990 | Ga0373925_1397990_202_516 | 103 |
| 20 | 3300046684 | Ga0495669_0054174 | Ga0495669_0054174_351_665 | 103 |
| 21 | 3300050491 | nmdc:mga00v17_992_c1 | nmdc:mga00v17_992_c1_529_843 | 103 |
| 22 | 3300050494 | nmdc:mga06z11_4918_c1 | nmdc:mga06z11_4918_c1_1904_2218 | 103 |
| 23 | 3300009093 | Ga0105240_10718939 | Ga0105240_107189393 | 104 |
| 24 | 3300025254 | Ga0209148_1016525 | Ga0209148_10165252 | 104 |
| 25 | 3300025913 | Ga0207695_10507987 | Ga0207695_105079873 | 104 |
| 26 | 3300025924 | Ga0207694_10147033 | Ga0207694_101470333 | 104 |
| 27 | 3300025949 | Ga0207667_10334516 | Ga0207667_103345162 | 104 |
| 28 | 3300025294 | Ga0209025_1000320 | Ga0209025_100032019 | 105 |
| 29 | 3300048920 | Ga0496117_0024468 | Ga0496117_0024468_305_667 | 105 |
| 30 | 3300048925 | Ga0496122_0000651 | Ga0496122_0000651_61480_61842 | 105 |
| 31 | 3300048926 | Ga0496123_0000043 | Ga0496123_0000043_4114_4476 | 105 |
| 32 | 3300048927 | Ga0496124_0020028 | Ga0496124_0020028_2204_2566 | 105 |
| 33 | 3300048928 | Ga0496125_0004886 | Ga0496125_0004886_8531_8893 | 105 |
| 34 | 3300048929 | Ga0496126_0013092 | Ga0496126_0013092_3420_3782 | 105 |
| 35 | 3300005327 | Ga0070658_10067818 | Ga0070658_100678183 | 106 |
| 36 | 3300026142 | Ga0207698_11826412 | Ga0207698_118264122 | 106 |
| 37 | 3300044683 | Ga0466965_0194551 | Ga0466965_0194551_273_644 | 107 |
| 38 | 3300006028 | Ga0070717_10690270 | Ga0070717_106902702 | 108 |
| 39 | 3300009177 | Ga0105248_10178500 | Ga0105248_101785005 | 108 |
| 40 | 3300025941 | Ga0207711_10001469 | Ga0207711_1000146922 | 108 |
| 41 | 3300031616 | Ga0307508_10257921 | Ga0307508_102579213 | 108 |
| 42 | 3300044735 | Ga0466968_0276648 | Ga0466968_0276648_348_710 | 108 |
| 43 | 3300035170 | Ga0373943_0412159 | Ga0373943_0412159_288_659 | 109 |
| 44 | 3300036401 | Ga0373937_1284240 | Ga0373937_1284240_120_491 | 109 |
| 45 | 3300037068 | Ga0373925_0921167 | Ga0373925_0921167_279_650 | 109 |
| 46 | 3300042125 | Ga0450923_090090 | Ga0450923_090090_85_447 | 109 |
| 47 | 3300049579 | Ga0501043_0147394 | Ga0501043_0147394_244_582 | 109 |
| 48 | 3300009148 | Ga0105243_10865521 | Ga0105243_108655212 | 110 |
| 49 | 3300013100 | Ga0157373_10254885 | Ga0157373_102548852 | 110 |
| 50 | 3300013105 | Ga0157369_10099998 | Ga0157369_100999985 | 110 |
| 51 | 3300021361 | Ga0213872_10326888 | Ga0213872_103268881 | 110 |
| 52 | 3300025938 | Ga0207704_10375369 | Ga0207704_103753692 | 110 |
| 53 | 3300025986 | Ga0207658_11972184 | Ga0207658_119721842 | 110 |
| 54 | 3300039447 | Ga0436361_0953537 | Ga0436361_0953537_25996_26355 | 110 |
| 55 | 3300048909 | Ga0496106_0278925 | Ga0496106_0278925_579_941 | 110 |
| 56 | iso_pu_bacteria | 2585428106 | 2587919520 | 111 |
| 57 | iso_pu_bacteria | 2643221640 | 2644226549 | 111 |
| 58 | iso_pu_bacteria | 2643221642 | 2644236037 | 111 |
| 59 | iso_pu_bacteria | 2791355048 | 2792463726 | 111 |
| 60 | iso_pu_bacteria | 2843744320 | 2843747100 | 111 |
| 61 | iso_pu_bacteria | 2849560528 | 2849560639 | 111 |
| 62 | iso_pu_bacteria | 2849573788 | 2849578480 | 111 |
| 63 | iso_pu_bacteria | 2851153111 | 2851154277 | 111 |
| 64 | iso_pu_bacteria | 2857504554 | 2857509532 | 111 |
| 65 | iso_pu_bacteria | 2884960567 | 2884961080 | 111 |
| 66 | iso_pu_bacteria | 2898329390 | 2898331319 | 111 |
| 67 | iso_pu_bacteria | 2928531327 | 2928535739 | 111 |
| 68 | iso_pu_bacteria | 2643221614 | 2644088893 | 112 |
| 69 | iso_pu_bacteria | 2643221661 | 2644342255 | 112 |
| 70 | iso_pu_bacteria | 2643221666 | 2644369638 | 112 |
| 71 | iso_pu_bacteria | 2510917020 | 2511120795 | 113 |
| 72 | iso_pu_bacteria | 2582581279 | 2585150065 | 113 |
| 73 | iso_pu_bacteria | 2582581280 | 2585155412 | 113 |
| 74 | iso_pu_bacteria | 2582581293 | 2585199196 | 113 |
| 75 | iso_pu_bacteria | 2643221545 | 2643747980 | 113 |
| 76 | iso_pu_bacteria | 2643221552 | 2643781693 | 113 |
| 77 | iso_pu_bacteria | 2643221583 | 2643926342 | 113 |
| 78 | iso_pu_bacteria | 2643221584 | 2643931633 | 113 |
| 79 | iso_pu_bacteria | 2643221691 | 2644507917 | 113 |
| 80 | iso_pu_bacteria | 2818991435 | 2819536849 | 113 |
| 81 | iso_pu_bacteria | 2818991454 | 2819646010 | 113 |
| 82 | iso_pu_bacteria | 2891373044 | 2891377328 | 113 |
| 83 | iso_pu_bacteria | 2919450847 | 2919456097 | 113 |
| 84 | 3300005328 | Ga0070676_10220385 | Ga0070676_102203853 | 114 |
| 85 | 3300005548 | Ga0070665_101508761 | Ga0070665_1015087612 | 114 |
| 86 | 3300025261 | Ga0209233_1087506 | Ga0209233_10875061 | 114 |
| 87 | 3300031548 | Ga0307408_101155541 | Ga0307408_1011555412 | 114 |
| 88 | 3300031852 | Ga0307410_11457150 | Ga0307410_114571501 | 114 |
| 89 | 3300039438 | Ga0436360_0443273 | Ga0436360_0443273_499_846 | 114 |
| 90 | 3300042530 | Ga0450916_041524 | Ga0450916_041524_62_409 | 114 |
| 91 | 3300047472 | Ga0495686_0470956 | Ga0495686_0470956_209_556 | 114 |
| 92 | 3300049569 | Ga0501032_0886352 | Ga0501032_0886352_119_466 | 114 |
| 93 | 3300049573 | Ga0501037_0901014 | Ga0501037_0901014_140_487 | 114 |
| 94 | 3300049581 | Ga0501047_0370072 | Ga0501047_0370072_667_1014 | 114 |
| 95 | 3300049822 | Ga0501035_0743106 | Ga0501035_0743106_64_411 | 114 |
| 96 | 3300050496 | nmdc:mga07m45_246019_c1 | nmdc:mga07m45_246019_c1_196_543 | 114 |
| 97 | 3300053111 | Ga0500572_000706 | Ga0500572_000706_5406_5753 | 114 |
| 98 | 3300053136 | Ga0500559_0248740 | Ga0500559_0248740_335_682 | 114 |
| 99 | iso_pu_bacteria | 2643221598 | 2643997899 | 114 |
| 100 | 3300003693 | Ga0032354_1096322 | Ga0032354_10963222 | 115 |
| 101 | 3300003781 | Ga0055536_1103212 | Ga0055536_11032121 | 115 |
| 102 | 3300003781 | Ga0055536_1103307 | Ga0055536_11033071 | 115 |
| 103 | 3300003791 | Ga0055530_10120956 | Ga0055530_101209561 | 115 |
| 104 | 3300003791 | Ga0055530_10121061 | Ga0055530_101210611 | 115 |
| 105 | 3300003794 | Ga0055531_10025933 | Ga0055531_100259335 | 115 |
| 106 | 3300005340 | Ga0070689_101108064 | Ga0070689_1011080642 | 115 |
| 107 | 3300005466 | Ga0070685_10980944 | Ga0070685_109809441 | 115 |
| 108 | 3300005535 | Ga0070684_101387408 | Ga0070684_1013874081 | 115 |
| 109 | 3300006048 | Ga0075363_100423989 | Ga0075363_1004239892 | 115 |
| 110 | 3300006177 | Ga0075362_10153081 | Ga0075362_101530812 | 115 |
| 111 | 3300006178 | Ga0075367_10484945 | Ga0075367_104849452 | 115 |
| 112 | 3300006186 | Ga0075369_10020903 | Ga0075369_100209032 | 115 |
| 113 | 3300006195 | Ga0075366_10065097 | Ga0075366_100650975 | 115 |
| 114 | 3300006353 | Ga0075370_10113931 | Ga0075370_101139312 | 115 |
| 115 | 3300009176 | Ga0105242_13016627 | Ga0105242_130166271 | 115 |
| 116 | 3300013306 | Ga0163162_11941149 | Ga0163162_119411492 | 115 |
| 117 | 3300014969 | Ga0157376_10359201 | Ga0157376_103592013 | 115 |
| 118 | 3300025292 | Ga0209676_1005649 | Ga0209676_10056496 | 115 |
| 119 | 3300025292 | Ga0209676_1005783 | Ga0209676_10057836 | 115 |
| 120 | 3300025298 | Ga0209050_1033197 | Ga0209050_10331972 | 115 |
| 121 | 3300025298 | Ga0209050_1071778 | Ga0209050_10717782 | 115 |
| 122 | 3300025303 | Ga0209051_1000877 | Ga0209051_10008779 | 115 |
| 123 | 3300025304 | Ga0209257_1001464 | Ga0209257_100146434 | 115 |
| 124 | 3300025934 | Ga0207686_10755245 | Ga0207686_107552452 | 115 |
| 125 | 3300025936 | Ga0207670_10558862 | Ga0207670_105588622 | 115 |
| 126 | 3300025938 | Ga0207704_11333064 | Ga0207704_113330642 | 115 |
| 127 | 3300026067 | Ga0207678_10956156 | Ga0207678_109561562 | 115 |
| 128 | 3300028577 | Ga0265318_10245698 | Ga0265318_102456982 | 115 |
| 129 | 3300028800 | Ga0265338_10087400 | Ga0265338_100874002 | 115 |
| 130 | 3300028800 | Ga0265338_10435271 | Ga0265338_104352712 | 115 |
| 131 | 3300036401 | Ga0373937_0951052 | Ga0373937_0951052_310_660 | 115 |
| 132 | 3300036401 | Ga0373937_1881776 | Ga0373937_1881776_49_399 | 115 |
| 133 | 3300037471 | Ga0395905_0806897 | Ga0395905_0806897_178_528 | 115 |
| 134 | 3300041458 | Ga0451798_0341123 | Ga0451798_0341123_69_419 | 115 |
| 135 | 3300044706 | Ga0466964_0534471 | Ga0466964_0534471_51_401 | 115 |
| 136 | 3300046460 | Ga0495638_0501302 | Ga0495638_0501302_149_499 | 115 |
| 137 | 3300046492 | Ga0495585_0516776 | Ga0495585_0516776_204_554 | 115 |
| 138 | 3300046507 | Ga0495606_0041810 | Ga0495606_0041810_1204_1554 | 115 |
| 139 | 3300046524 | Ga0495648_0160454 | Ga0495648_0160454_194_544 | 115 |
| 140 | 3300046542 | Ga0495597_0020495 | Ga0495597_0020495_1239_1589 | 115 |
| 141 | 3300046616 | Ga0495668_0010366 | Ga0495668_0010366_691_1041 | 115 |
| 142 | 3300046616 | Ga0495668_0010401 | Ga0495668_0010401_4687_5037 | 115 |
| 143 | 3300046616 | Ga0495668_0025709 | Ga0495668_0025709_1331_1681 | 115 |
| 144 | 3300046660 | Ga0495625_0029168 | Ga0495625_0029168_588_938 | 115 |
| 145 | 3300046674 | Ga0495588_0065552 | Ga0495588_0065552_798_1148 | 115 |
| 146 | 3300046684 | Ga0495669_0000371 | Ga0495669_0000371_132_482 | 115 |
| 147 | 3300047445 | Ga0495677_0144107 | Ga0495677_0144107_286_636 | 115 |
| 148 | 3300047472 | Ga0495686_0172695 | Ga0495686_0172695_170_520 | 115 |
| 149 | 3300048909 | Ga0496106_0028330 | Ga0496106_0028330_203_553 | 115 |
| 150 | 3300048918 | Ga0496115_0085120 | Ga0496115_0085120_1586_1936 | 115 |
| 151 | 3300048927 | Ga0496124_0022787 | Ga0496124_0022787_1468_1818 | 115 |
| 152 | 3300048928 | Ga0496125_0089075 | Ga0496125_0089075_1544_1894 | 115 |
| 153 | 3300048929 | Ga0496126_0067161 | Ga0496126_0067161_2344_2694 | 115 |
| 154 | 3300049128 | Ga0501308_065762 | Ga0501308_065762_117_467 | 115 |
| 155 | 3300049131 | Ga0501341_16308 | Ga0501341_16308_63_413 | 115 |
| 156 | 3300049527 | Ga0501311_001352 | Ga0501311_001352_1612_1962 | 115 |
| 157 | 3300050491 | nmdc:mga00v17_531120_c1 | nmdc:mga00v17_531120_c1_136_486 | 115 |
| 158 | 3300050493 | nmdc:mga0k408_3470_c1 | nmdc:mga0k408_3470_c1_1509_1859 | 115 |
| 159 | 3300050496 | nmdc:mga07m45_31868_c1 | nmdc:mga07m45_31868_c1_506_856 | 115 |
| 160 | 3300050516 | nmdc:mga0sz30_18987_c1 | nmdc:mga0sz30_18987_c1_57_407 | 115 |
| 161 | 3300053086 | Ga0500578_0247483 | Ga0500578_0247483_416_766 | 115 |
| 162 | 3300053087 | Ga0500643_011917 | Ga0500643_011917_149_499 | 115 |
| 163 | 3300053087 | Ga0500643_068551 | Ga0500643_068551_33_383 | 115 |
| 164 | 3300053096 | Ga0500641_0001231 | Ga0500641_0001231_1717_2067 | 115 |
| 165 | 3300053098 | Ga0500650_0126436 | Ga0500650_0126436_391_741 | 115 |
| 166 | 3300053104 | Ga0500556_0007134 | Ga0500556_0007134_1440_1790 | 115 |
| 167 | 3300053104 | Ga0500556_0104965 | Ga0500556_0104965_102_452 | 115 |
| 168 | 3300053105 | Ga0500557_022790 | Ga0500557_022790_1432_1782 | 115 |
| 169 | 3300053108 | Ga0500562_017203 | Ga0500562_017203_50_400 | 115 |
| 170 | 3300053109 | Ga0500569_141632 | Ga0500569_141632_101_451 | 115 |
| 171 | 3300053117 | Ga0500593_036998 | Ga0500593_036998_1172_1522 | 115 |
| 172 | 3300053122 | Ga0500608_000222 | Ga0500608_000222_16993_17343 | 115 |
| 173 | 3300053136 | Ga0500559_0011392 | Ga0500559_0011392_225_575 | 115 |
| 174 | 3300053139 | Ga0500568_0120387 | Ga0500568_0120387_427_777 | 115 |
| 175 | 3300053151 | Ga0500604_0131476 | Ga0500604_0131476_477_827 | 115 |
| 176 | 3300053153 | Ga0500616_0025329 | Ga0500616_0025329_1950_2300 | 115 |
| 177 | 3300053156 | Ga0500622_0022339 | Ga0500622_0022339_2148_2498 | 115 |
| 178 | 3300053156 | Ga0500622_0040896 | Ga0500622_0040896_1509_1859 | 115 |
| 179 | 3300053730 | Ga0500645_058592 | Ga0500645_058592_617_967 | 115 |
| 180 | 3300053730 | Ga0500645_179809 | Ga0500645_179809_103_453 | 115 |
| 181 | 3300003320 | rootH2_10046562 | rootH2_100465625 | 116 |
| 182 | 3300005364 | Ga0070673_101757128 | Ga0070673_1017571282 | 116 |
| 183 | 3300005456 | Ga0070678_100832144 | Ga0070678_1008321442 | 116 |
| 184 | 3300005539 | Ga0068853_100314964 | Ga0068853_1003149643 | 116 |
| 185 | 3300006353 | Ga0075370_11049969 | Ga0075370_110499692 | 116 |
| 186 | 3300006881 | Ga0068865_101083350 | Ga0068865_1010833502 | 116 |
| 187 | 3300009098 | Ga0105245_10430145 | Ga0105245_104301452 | 116 |
| 188 | 3300009174 | Ga0105241_11013354 | Ga0105241_110133541 | 116 |
| 189 | 3300009176 | Ga0105242_10483630 | Ga0105242_104836302 | 116 |
| 190 | 3300009551 | Ga0105238_12128544 | Ga0105238_121285441 | 116 |
| 191 | 3300009553 | Ga0105249_11177596 | Ga0105249_111775962 | 116 |
| 192 | 3300013100 | Ga0157373_11089021 | Ga0157373_110890211 | 116 |
| 193 | 3300013104 | Ga0157370_10298609 | Ga0157370_102986092 | 116 |
| 194 | 3300013104 | Ga0157370_10464487 | Ga0157370_104644872 | 116 |
| 195 | 3300015684 | Ga0183365_10006 | Ga0183365_1000621 | 116 |
| 196 | 3300025909 | Ga0207705_10109262 | Ga0207705_101092622 | 116 |
| 197 | 3300025911 | Ga0207654_11168726 | Ga0207654_111687262 | 116 |
| 198 | 3300025920 | Ga0207649_11302256 | Ga0207649_113022562 | 116 |
| 199 | 3300025934 | Ga0207686_11149273 | Ga0207686_111492732 | 116 |
| 200 | 3300025938 | Ga0207704_11164861 | Ga0207704_111648612 | 116 |
| 201 | 3300025944 | Ga0207661_10720209 | Ga0207661_107202092 | 116 |
| 202 | 3300025960 | Ga0207651_11405958 | Ga0207651_114059581 | 116 |
| 203 | 3300026078 | Ga0207702_11932734 | Ga0207702_119327342 | 116 |
| 204 | 3300026121 | Ga0207683_10711715 | Ga0207683_107117152 | 116 |
| 205 | 3300031240 | Ga0265320_10193602 | Ga0265320_101936022 | 116 |
| 206 | 3300031251 | Ga0265327_10452269 | Ga0265327_104522691 | 116 |
| 207 | 3300031344 | Ga0265316_10329492 | Ga0265316_103294922 | 116 |
| 208 | 3300031456 | Ga0307513_10541303 | Ga0307513_105413032 | 116 |
| 209 | 3300031711 | Ga0265314_10049643 | Ga0265314_100496432 | 116 |
| 210 | 3300032005 | Ga0307411_11291003 | Ga0307411_112910032 | 116 |
| 211 | 3300035691 | Ga0373931_0526749 | Ga0373931_0526749_333_686 | 116 |
| 212 | 3300037312 | Ga0395899_0736942 | Ga0395899_0736942_137_490 | 116 |
| 213 | 3300037471 | Ga0395905_0001028 | Ga0395905_0001028_11282_11635 | 116 |
| 214 | 3300037471 | Ga0395905_0082872 | Ga0395905_0082872_486_839 | 116 |
| 215 | 3300041496 | Ga0451839_0176911 | Ga0451839_0176911_59_415 | 116 |
| 216 | 3300041507 | Ga0451851_0179633 | Ga0451851_0179633_161_517 | 116 |
| 217 | 3300044656 | Ga0466969_0002862 | Ga0466969_0002862_2628_2981 | 116 |
| 218 | 3300044658 | Ga0466972_0138769 | Ga0466972_0138769_212_565 | 116 |
| 219 | 3300044683 | Ga0466965_0379500 | Ga0466965_0379500_284_637 | 116 |
| 220 | 3300044684 | Ga0466966_0001452 | Ga0466966_0001452_11128_11481 | 116 |
| 221 | 3300044693 | Ga0466961_0000659 | Ga0466961_0000659_14530_14883 | 116 |
| 222 | 3300044693 | Ga0466961_0084917 | Ga0466961_0084917_1008_1361 | 116 |
| 223 | 3300044694 | Ga0466963_0167988 | Ga0466963_0167988_789_1142 | 116 |
| 224 | 3300044719 | Ga0466971_0000901 | Ga0466971_0000901_11233_11586 | 116 |
| 225 | 3300044719 | Ga0466971_0144315 | Ga0466971_0144315_515_868 | 116 |
| 226 | 3300044765 | Ga0466970_0004965 | Ga0466970_0004965_3232_3585 | 116 |
| 227 | 3300044765 | Ga0466970_0350821 | Ga0466970_0350821_298_651 | 116 |
| 228 | 3300044842 | Ga0466957_0304632 | Ga0466957_0304632_534_890 | 116 |
| 229 | 3300044901 | Ga0466960_0170736 | Ga0466960_0170736_502_855 | 116 |
| 230 | 3300045049 | Ga0466959_0000162 | Ga0466959_0000162_9673_10026 | 116 |
| 231 | 3300045049 | Ga0466959_0036896 | Ga0466959_0036896_992_1345 | 116 |
| 232 | 3300045836 | Ga0466958_0000155 | Ga0466958_0000155_2256_2609 | 116 |
| 233 | 3300046539 | Ga0495621_0075144 | Ga0495621_0075144_776_1129 | 116 |
| 234 | 3300048090 | Ga0495615_0002803 | Ga0495615_0002803_1650_2003 | 116 |
| 235 | 3300048910 | Ga0496107_0020868 | Ga0496107_0020868_1308_1661 | 116 |
| 236 | 3300048928 | Ga0496125_0112323 | Ga0496125_0112323_802_1155 | 116 |
| 237 | 3300049570 | Ga0501033_0189684 | Ga0501033_0189684_320_676 | 116 |
| 238 | 3300049571 | Ga0501034_0035149 | Ga0501034_0035149_2622_2975 | 116 |
| 239 | 3300049571 | Ga0501034_0535408 | Ga0501034_0535408_63_416 | 116 |
| 240 | 3300049572 | Ga0501036_0246398 | Ga0501036_0246398_767_1123 | 116 |
| 241 | 3300049579 | Ga0501043_0038750 | Ga0501043_0038750_841_1197 | 116 |
| 242 | 3300049580 | Ga0501046_0065839 | Ga0501046_0065839_404_760 | 116 |
| 243 | 3300049581 | Ga0501047_0321913 | Ga0501047_0321913_322_675 | 116 |
| 244 | 3300049581 | Ga0501047_0651263 | Ga0501047_0651263_141_497 | 116 |
| 245 | 3300049822 | Ga0501035_0033582 | Ga0501035_0033582_2160_2516 | 116 |
| 246 | 3300049823 | Ga0501044_0404179 | Ga0501044_0404179_608_964 | 116 |
| 247 | 3300050493 | nmdc:mga0k408_255511_c1 | nmdc:mga0k408_255511_c1_190_543 | 116 |
| 248 | 3300053080 | Ga0500635_0086822 | Ga0500635_0086822_657_1010 | 116 |
| 249 | 3300053096 | Ga0500641_0010509 | Ga0500641_0010509_406_759 | 116 |
| 250 | 3300053122 | Ga0500608_000084 | Ga0500608_000084_26569_26922 | 116 |
| 251 | 3300053136 | Ga0500559_0179410 | Ga0500559_0179410_305_658 | 116 |
| 252 | 3300053730 | Ga0500645_066541 | Ga0500645_066541_263_616 | 116 |
| 253 | 3300059477 | Ga0587084_012531 | Ga0587084_012531_518_871 | 116 |
| 254 | 3300059478 | Ga0587093_020985 | Ga0587093_020985_84_440 | 116 |
| 255 | 3300059478 | Ga0587093_085514 | Ga0587093_085514_176_529 | 116 |
| 256 | 3300059490 | Ga0587066_098850 | Ga0587066_098850_18_371 | 116 |
| 257 | 3300059491 | Ga0587070_033411 | Ga0587070_033411_173_529 | 116 |
| 258 | 3300059491 | Ga0587070_063566 | Ga0587070_063566_313_666 | 116 |
| 259 | 3300059493 | Ga0587077_008542 | Ga0587077_008542_587_940 | 116 |
| 260 | 3300059493 | Ga0587077_016870 | Ga0587077_016870_436_789 | 116 |
| 261 | 3300059493 | Ga0587077_076372 | Ga0587077_076372_57_413 | 116 |
| 262 | 3300059506 | Ga0587085_038004 | Ga0587085_038004_452_805 | 116 |
| 263 | 3300059507 | Ga0587086_012095 | Ga0587086_012095_691_1047 | 116 |
| 264 | 3300059511 | Ga0587091_064351 | Ga0587091_064351_398_754 | 116 |
| 265 | 3300059623 | Ga0587101_005901 | Ga0587101_005901_552_908 | 116 |
| 266 | 3300059643 | Ga0587072_071104 | Ga0587072_071104_240_593 | 116 |
| 267 | 3300059644 | Ga0587075_070140 | Ga0587075_070140_165_521 | 116 |
| 268 | 3300059645 | Ga0587076_000918 | Ga0587076_000918_2125_2478 | 116 |
| 269 | 3300059646 | Ga0587078_045938 | Ga0587078_045938_213_566 | 116 |
| 270 | 3300059647 | Ga0587079_044614 | Ga0587079_044614_300_653 | 116 |
| 271 | 3300060344 | Ga0587071_004686 | Ga0587071_004686_1609_1965 | 116 |
| 272 | 3300060346 | Ga0587111_0007029 | Ga0587111_0007029_1345_1698 | 116 |
| 273 | 3300061719 | Ga0466962_0003721 | Ga0466962_0003721_6688_7041 | 116 |
| 274 | 3300061719 | Ga0466962_0061720 | Ga0466962_0061720_950_1303 | 116 |
| 275 | 3300003215 | JGI25153J46596_10014629 | JGI25153J46596_100146292 | 117 |
| 276 | 3300003215 | JGI25153J46596_10015113 | JGI25153J46596_100151135 | 117 |
| 277 | 3300003559 | Ga0007427J51700_108234 | Ga0007427J51700_10823414 | 117 |
| 278 | 3300003659 | JGI25404J52841_10000285 | JGI25404J52841_1000028514 | 117 |
| 279 | 3300003693 | Ga0032354_1046771 | Ga0032354_10467712 | 117 |
| 280 | 3300003771 | Ga0055526_1009783 | Ga0055526_10097833 | 117 |
| 281 | 3300003771 | Ga0055526_1031603 | Ga0055526_10316031 | 117 |
| 282 | 3300003773 | Ga0055537_1001243 | Ga0055537_100124314 | 117 |
| 283 | 3300003775 | Ga0055524_1013632 | Ga0055524_10136324 | 117 |
| 284 | 3300003784 | Ga0055534_1014923 | Ga0055534_10149232 | 117 |
| 285 | 3300003790 | Ga0055528_1008934 | Ga0055528_10089344 | 117 |
| 286 | 3300005327 | Ga0070658_10115679 | Ga0070658_101156793 | 117 |
| 287 | 3300005330 | Ga0070690_101426876 | Ga0070690_1014268762 | 117 |
| 288 | 3300005336 | Ga0070680_101505394 | Ga0070680_1015053941 | 117 |
| 289 | 3300005347 | Ga0070668_100025277 | Ga0070668_1000252771 | 117 |
| 290 | 3300005353 | Ga0070669_101507306 | Ga0070669_1015073061 | 117 |
| 291 | 3300005355 | Ga0070671_100724482 | Ga0070671_1007244822 | 117 |
| 292 | 3300005367 | Ga0070667_100015939 | Ga0070667_10001593910 | 117 |
| 293 | 3300005436 | Ga0070713_101329443 | Ga0070713_1013294431 | 117 |
| 294 | 3300005457 | Ga0070662_101677115 | Ga0070662_1016771151 | 117 |
| 295 | 3300005578 | Ga0068854_100662044 | Ga0068854_1006620442 | 117 |
| 296 | 3300005614 | Ga0068856_101302999 | Ga0068856_1013029992 | 117 |
| 297 | 3300005617 | Ga0068859_100373060 | Ga0068859_1003730602 | 117 |
| 298 | 3300005719 | Ga0068861_100101512 | Ga0068861_1001015122 | 117 |
| 299 | 3300005841 | Ga0068863_100028125 | Ga0068863_1000281254 | 117 |
| 300 | 3300005842 | Ga0068858_100664888 | Ga0068858_1006648882 | 117 |
| 301 | 3300005843 | Ga0068860_100094802 | Ga0068860_1000948024 | 117 |
| 302 | 3300005844 | Ga0068862_100423824 | Ga0068862_1004238242 | 117 |
| 303 | 3300005937 | Ga0081455_10041960 | Ga0081455_100419605 | 117 |
| 304 | 3300005981 | Ga0081538_10001041 | Ga0081538_1000104125 | 117 |
| 305 | 3300005983 | Ga0081540_1001166 | Ga0081540_10011665 | 117 |
| 306 | 3300006028 | Ga0070717_10364099 | Ga0070717_103640992 | 117 |
| 307 | 3300006038 | Ga0075365_10006324 | Ga0075365_100063245 | 117 |
| 308 | 3300006042 | Ga0075368_10134923 | Ga0075368_101349232 | 117 |
| 309 | 3300006048 | Ga0075363_100210193 | Ga0075363_1002101932 | 117 |
| 310 | 3300006048 | Ga0075363_100774080 | Ga0075363_1007740802 | 117 |
| 311 | 3300006177 | Ga0075362_10006228 | Ga0075362_100062285 | 117 |
| 312 | 3300006178 | Ga0075367_10064400 | Ga0075367_100644005 | 117 |
| 313 | 3300006186 | Ga0075369_10157977 | Ga0075369_101579771 | 117 |
| 314 | 3300006353 | Ga0075370_10048996 | Ga0075370_100489965 | 117 |
| 315 | 3300006353 | Ga0075370_10091453 | Ga0075370_100914532 | 117 |
| 316 | 3300006353 | Ga0075370_10567873 | Ga0075370_105678732 | 117 |
| 317 | 3300006852 | Ga0075433_11359468 | Ga0075433_113594682 | 117 |
| 318 | 3300006931 | Ga0097620_100373031 | Ga0097620_1003730312 | 117 |
| 319 | 3300007788 | Ga0099795_10637870 | Ga0099795_106378702 | 117 |
| 320 | 3300009093 | Ga0105240_11998694 | Ga0105240_119986942 | 117 |
| 321 | 3300009094 | Ga0111539_10007802 | Ga0111539_100078029 | 117 |
| 322 | 3300009174 | Ga0105241_10166634 | Ga0105241_101666343 | 117 |
| 323 | 3300009174 | Ga0105241_12070638 | Ga0105241_120706382 | 117 |
| 324 | 3300009177 | Ga0105248_10563249 | Ga0105248_105632492 | 117 |
| 325 | 3300009545 | Ga0105237_11884773 | Ga0105237_118847731 | 117 |
| 326 | 3300009551 | Ga0105238_10295500 | Ga0105238_102955004 | 117 |
| 327 | 3300009551 | Ga0105238_12138326 | Ga0105238_121383262 | 117 |
| 328 | 3300009553 | Ga0105249_10100547 | Ga0105249_101005475 | 117 |
| 329 | 3300010375 | Ga0105239_11566100 | Ga0105239_115661001 | 117 |
| 330 | 3300012480 | Ga0157346_1023210 | Ga0157346_10232102 | 117 |
| 331 | 3300012490 | Ga0157322_1044471 | Ga0157322_10444711 | 117 |
| 332 | 3300012502 | Ga0157347_1003217 | Ga0157347_10032173 | 117 |
| 333 | 3300012507 | Ga0157342_1023982 | Ga0157342_10239822 | 117 |
| 334 | 3300014326 | Ga0157380_10493550 | Ga0157380_104935503 | 117 |
| 335 | 3300014326 | Ga0157380_12426291 | Ga0157380_124262912 | 117 |
| 336 | 3300014497 | Ga0182008_10067287 | Ga0182008_100672874 | 117 |
| 337 | 3300014968 | Ga0157379_10534820 | Ga0157379_105348203 | 117 |
| 338 | 3300021441 | Ga0213871_10160618 | Ga0213871_101606182 | 117 |
| 339 | 3300025250 | Ga0209026_1029378 | Ga0209026_10293782 | 117 |
| 340 | 3300025263 | Ga0209565_1000925 | Ga0209565_100092516 | 117 |
| 341 | 3300025273 | Ga0209673_1002524 | Ga0209673_100252413 | 117 |
| 342 | 3300025291 | Ga0209675_1002569 | Ga0209675_100256910 | 117 |
| 343 | 3300025295 | Ga0209564_1023073 | Ga0209564_10230734 | 117 |
| 344 | 3300025297 | Ga0209758_1021887 | Ga0209758_10218874 | 117 |
| 345 | 3300025298 | Ga0209050_1055279 | Ga0209050_10552792 | 117 |
| 346 | 3300025299 | Ga0209256_1003893 | Ga0209256_100389319 | 117 |
| 347 | 3300025304 | Ga0209257_1000976 | Ga0209257_100097635 | 117 |
| 348 | 3300025903 | Ga0207680_10170751 | Ga0207680_101707511 | 117 |
| 349 | 3300025905 | Ga0207685_10361678 | Ga0207685_103616782 | 117 |
| 350 | 3300025915 | Ga0207693_10440679 | Ga0207693_104406791 | 117 |
| 351 | 3300025923 | Ga0207681_10841370 | Ga0207681_108413702 | 117 |
| 352 | 3300025924 | Ga0207694_10078132 | Ga0207694_100781326 | 117 |
| 353 | 3300025925 | Ga0207650_10018921 | Ga0207650_100189215 | 117 |
| 354 | 3300025926 | Ga0207659_10492685 | Ga0207659_104926852 | 117 |
| 355 | 3300025926 | Ga0207659_11127478 | Ga0207659_111274782 | 117 |
| 356 | 3300025928 | Ga0207700_10124646 | Ga0207700_101246465 | 117 |
| 357 | 3300025931 | Ga0207644_10438147 | Ga0207644_104381472 | 117 |
| 358 | 3300025933 | Ga0207706_10594580 | Ga0207706_105945802 | 117 |
| 359 | 3300025939 | Ga0207665_10055248 | Ga0207665_100552482 | 117 |
| 360 | 3300025941 | Ga0207711_10957209 | Ga0207711_109572092 | 117 |
| 361 | 3300025944 | Ga0207661_10339841 | Ga0207661_103398412 | 117 |
| 362 | 3300025961 | Ga0207712_10399006 | Ga0207712_103990062 | 117 |
| 363 | 3300025972 | Ga0207668_10094143 | Ga0207668_100941432 | 117 |
| 364 | 3300026035 | Ga0207703_10116717 | Ga0207703_101167172 | 117 |
| 365 | 3300026088 | Ga0207641_10539690 | Ga0207641_105396902 | 117 |
| 366 | 3300026089 | Ga0207648_10690181 | Ga0207648_106901812 | 117 |
| 367 | 3300026095 | Ga0207676_10186744 | Ga0207676_101867445 | 117 |
| 368 | 3300026095 | Ga0207676_10882512 | Ga0207676_108825122 | 117 |
| 369 | 3300026118 | Ga0207675_100097135 | Ga0207675_1000971355 | 117 |
| 370 | 3300027866 | Ga0209813_10260203 | Ga0209813_102602032 | 117 |
| 371 | 3300028380 | Ga0268265_10071315 | Ga0268265_100713153 | 117 |
| 372 | 3300028381 | Ga0268264_10074566 | Ga0268264_100745664 | 117 |
| 373 | 3300028794 | Ga0307515_10186233 | Ga0307515_101862332 | 117 |
| 374 | 3300028794 | Ga0307515_10273927 | Ga0307515_102739273 | 117 |
| 375 | 3300028794 | Ga0307515_10489757 | Ga0307515_104897572 | 117 |
| 376 | 3300030734 | Ga0316179_1105792 | Ga0316179_11057922 | 117 |
| 377 | 3300031456 | Ga0307513_10010515 | Ga0307513_1001051519 | 117 |
| 378 | 3300031456 | Ga0307513_10323519 | Ga0307513_103235192 | 117 |
| 379 | 3300031456 | Ga0307513_10497209 | Ga0307513_104972092 | 117 |
| 380 | 3300031595 | Ga0265313_10073033 | Ga0265313_100730332 | 117 |
| 381 | 3300031731 | Ga0307405_10957200 | Ga0307405_109572002 | 117 |
| 382 | 3300031731 | Ga0307405_11749506 | Ga0307405_117495061 | 117 |
| 383 | 3300031911 | Ga0307412_11399718 | Ga0307412_113997182 | 117 |
| 384 | 3300031995 | Ga0307409_101736463 | Ga0307409_1017364632 | 117 |
| 385 | 3300032002 | Ga0307416_102566324 | Ga0307416_1025663242 | 117 |
| 386 | 3300032126 | Ga0307415_101658437 | Ga0307415_1016584372 | 117 |
| 387 | 3300033180 | Ga0307510_10265336 | Ga0307510_102653362 | 117 |
| 388 | 3300034818 | Ga0373950_0137025 | Ga0373950_0137025_22_378 | 117 |
| 389 | 3300035083 | Ga0373926_0010572 | Ga0373926_0010572_224_586 | 117 |
| 390 | 3300035089 | Ga0373944_0005737 | Ga0373944_0005737_2055_2417 | 117 |
| 391 | 3300035111 | Ga0373923_0026132 | Ga0373923_0026132_191_553 | 117 |
| 392 | 3300035113 | Ga0373936_0084560 | Ga0373936_0084560_106_468 | 117 |
| 393 | 3300035116 | Ga0373945_0003481 | Ga0373945_0003481_32_394 | 117 |
| 394 | 3300035116 | Ga0373945_0417066 | Ga0373945_0417066_176_538 | 117 |
| 395 | 3300035118 | Ga0373954_0186112 | Ga0373954_0186112_347_709 | 117 |
| 396 | 3300035118 | Ga0373954_0310753 | Ga0373954_0310753_383_745 | 117 |
| 397 | 3300035170 | Ga0373943_0002080 | Ga0373943_0002080_4023_4385 | 117 |
| 398 | 3300035171 | Ga0373946_0002899 | Ga0373946_0002899_4701_5063 | 117 |
| 399 | 3300035172 | Ga0373955_0054166 | Ga0373955_0054166_908_1270 | 117 |
| 400 | 3300035691 | Ga0373931_1248617 | Ga0373931_1248617_34_396 | 117 |
| 401 | 3300035692 | Ga0373935_0018438 | Ga0373935_0018438_3281_3643 | 117 |
| 402 | 3300035692 | Ga0373935_1002066 | Ga0373935_1002066_194_556 | 117 |
| 403 | 3300035695 | Ga0373927_0011299 | Ga0373927_0011299_4939_5301 | 117 |
| 404 | 3300035725 | Ga0373947_0010251 | Ga0373947_0010251_4676_5038 | 117 |
| 405 | 3300037068 | Ga0373925_0274946 | Ga0373925_0274946_352_714 | 117 |
| 406 | 3300037312 | Ga0395899_0152780 | Ga0395899_0152780_1085_1441 | 117 |
| 407 | 3300037418 | Ga0395900_0069866 | Ga0395900_0069866_2802_3158 | 117 |
| 408 | 3300037466 | Ga0395898_0712065 | Ga0395898_0712065_284_640 | 117 |
| 409 | 3300037471 | Ga0395905_0119007 | Ga0395905_0119007_1735_2091 | 117 |
| 410 | 3300037471 | Ga0395905_0463395 | Ga0395905_0463395_83_442 | 117 |
| 411 | 3300037471 | Ga0395905_0824341 | Ga0395905_0824341_13_369 | 117 |
| 412 | 3300038443 | Ga0395901_0098100 | Ga0395901_0098100_1028_1384 | 117 |
| 413 | 3300039437 | Ga0436365_0074797 | Ga0436365_0074797_210_566 | 117 |
| 414 | 3300039447 | Ga0436361_0429361 | Ga0436361_0429361_235_597 | 117 |
| 415 | 3300039450 | Ga0436363_0053074 | Ga0436363_0053074_169_525 | 117 |
| 416 | 3300039453 | Ga0436362_0904387 | Ga0436362_0904387_248_610 | 117 |
| 417 | 3300041413 | Ga0439465_0081318 | Ga0439465_0081318_467_823 | 117 |
| 418 | 3300041446 | Ga0451794_20570 | Ga0451794_20570_609_965 | 117 |
| 419 | 3300041451 | Ga0451791_0247409 | Ga0451791_0247409_105_461 | 117 |
| 420 | 3300041491 | Ga0451833_0325122 | Ga0451833_0325122_274_630 | 117 |
| 421 | 3300041498 | Ga0451841_1137634 | Ga0451841_1137634_143_499 | 117 |
| 422 | 3300041512 | Ga0451853_2424685 | Ga0451853_2424685_460_816 | 117 |
| 423 | 3300042000 | Ga0439437_010744 | Ga0439437_010744_429_785 | 117 |
| 424 | 3300042002 | Ga0439442_144008 | Ga0439442_144008_45_401 | 117 |
| 425 | 3300042012 | Ga0439455_0005999 | Ga0439455_0005999_1796_2152 | 117 |
| 426 | 3300042015 | Ga0439462_0046811 | Ga0439462_0046811_181_537 | 117 |
| 427 | 3300042125 | Ga0450923_076713 | Ga0450923_076713_297_656 | 117 |
| 428 | 3300042127 | Ga0450890_051224 | Ga0450890_051224_236_592 | 117 |
| 429 | 3300042156 | Ga0439446_0038799 | Ga0439446_0038799_833_1189 | 117 |
| 430 | 3300042435 | Ga0439434_0095085 | Ga0439434_0095085_334_690 | 117 |
| 431 | 3300042436 | Ga0439435_0067456 | Ga0439435_0067456_249_605 | 117 |
| 432 | 3300042438 | Ga0439459_0000384 | Ga0439459_0000384_3385_3741 | 117 |
| 433 | 3300044683 | Ga0466965_0113070 | Ga0466965_0113070_65_421 | 117 |
| 434 | 3300044719 | Ga0466971_0111556 | Ga0466971_0111556_713_1081 | 117 |
| 435 | 3300046453 | Ga0495627_000399 | Ga0495627_000399_9873_10229 | 117 |
| 436 | 3300046454 | Ga0495592_0662306 | Ga0495592_0662306_153_515 | 117 |
| 437 | 3300046457 | Ga0495590_0003932 | Ga0495590_0003932_4244_4600 | 117 |
| 438 | 3300046459 | Ga0495629_0040236 | Ga0495629_0040236_1881_2243 | 117 |
| 439 | 3300046459 | Ga0495629_0465940 | Ga0495629_0465940_411_773 | 117 |
| 440 | 3300046460 | Ga0495638_0102148 | Ga0495638_0102148_646_1002 | 117 |
| 441 | 3300046460 | Ga0495638_0159678 | Ga0495638_0159678_276_632 | 117 |
| 442 | 3300046471 | Ga0495650_0000269 | Ga0495650_0000269_671_1027 | 117 |
| 443 | 3300046471 | Ga0495650_0096644 | Ga0495650_0096644_670_1026 | 117 |
| 444 | 3300046471 | Ga0495650_0114351 | Ga0495650_0114351_50_406 | 117 |
| 445 | 3300046472 | Ga0495580_0081838 | Ga0495580_0081838_955_1317 | 117 |
| 446 | 3300046473 | Ga0495582_0250444 | Ga0495582_0250444_632_994 | 117 |
| 447 | 3300046474 | Ga0495605_0119117 | Ga0495605_0119117_633_989 | 117 |
| 448 | 3300046476 | Ga0495662_0011694 | Ga0495662_0011694_50_412 | 117 |
| 449 | 3300046476 | Ga0495662_0017825 | Ga0495662_0017825_982_1344 | 117 |
| 450 | 3300046492 | Ga0495585_0047175 | Ga0495585_0047175_999_1355 | 117 |
| 451 | 3300046500 | Ga0495596_0192471 | Ga0495596_0192471_238_594 | 117 |
| 452 | 3300046501 | Ga0495607_0050892 | Ga0495607_0050892_1115_1471 | 117 |
| 453 | 3300046506 | Ga0495583_0000650 | Ga0495583_0000650_18830_19186 | 117 |
| 454 | 3300046507 | Ga0495606_0082018 | Ga0495606_0082018_133_489 | 117 |
| 455 | 3300046512 | Ga0495610_0017211 | Ga0495610_0017211_2842_3198 | 117 |
| 456 | 3300046512 | Ga0495610_0062120 | Ga0495610_0062120_618_974 | 117 |
| 457 | 3300046513 | Ga0495616_0057091 | Ga0495616_0057091_91_447 | 117 |
| 458 | 3300046514 | Ga0495618_0066093 | Ga0495618_0066093_128_490 | 117 |
| 459 | 3300046515 | Ga0495620_0183243 | Ga0495620_0183243_395_754 | 117 |
| 460 | 3300046517 | Ga0495630_0012248 | Ga0495630_0012248_2814_3176 | 117 |
| 461 | 3300046517 | Ga0495630_0036759 | Ga0495630_0036759_329_691 | 117 |
| 462 | 3300046518 | Ga0495631_0037496 | Ga0495631_0037496_466_822 | 117 |
| 463 | 3300046520 | Ga0495637_0015304 | Ga0495637_0015304_1426_1782 | 117 |
| 464 | 3300046520 | Ga0495637_0089253 | Ga0495637_0089253_302_658 | 117 |
| 465 | 3300046524 | Ga0495648_0014211 | Ga0495648_0014211_3946_4302 | 117 |
| 466 | 3300046524 | Ga0495648_0070299 | Ga0495648_0070299_1450_1806 | 117 |
| 467 | 3300046525 | Ga0495663_0020482 | Ga0495663_0020482_1269_1625 | 117 |
| 468 | 3300046526 | Ga0495666_0069218 | Ga0495666_0069218_1261_1623 | 117 |
| 469 | 3300046529 | Ga0495652_0325732 | Ga0495652_0325732_729_1091 | 117 |
| 470 | 3300046530 | Ga0495654_0000123 | Ga0495654_0000123_330_686 | 117 |
| 471 | 3300046531 | Ga0495665_0268487 | Ga0495665_0268487_329_691 | 117 |
| 472 | 3300046531 | Ga0495665_0511358 | Ga0495665_0511358_186_548 | 117 |
| 473 | 3300046533 | Ga0495640_0008684 | Ga0495640_0008684_2239_2601 | 117 |
| 474 | 3300046533 | Ga0495640_0299190 | Ga0495640_0299190_348_710 | 117 |
| 475 | 3300046538 | Ga0495609_0192755 | Ga0495609_0192755_275_631 | 117 |
| 476 | 3300046543 | Ga0495645_0001091 | Ga0495645_0001091_11770_12132 | 117 |
| 477 | 3300046558 | Ga0495633_0029769 | Ga0495633_0029769_740_1096 | 117 |
| 478 | 3300046559 | Ga0495667_0678148 | Ga0495667_0678148_158_520 | 117 |
| 479 | 3300046616 | Ga0495668_0001504 | Ga0495668_0001504_4116_4472 | 117 |
| 480 | 3300046616 | Ga0495668_0360424 | Ga0495668_0360424_298_654 | 117 |
| 481 | 3300046642 | Ga0495634_0074683 | Ga0495634_0074683_1596_1958 | 117 |
| 482 | 3300046642 | Ga0495634_0216890 | Ga0495634_0216890_314_676 | 117 |
| 483 | 3300046660 | Ga0495625_0001925 | Ga0495625_0001925_4558_4914 | 117 |
| 484 | 3300046660 | Ga0495625_0255297 | Ga0495625_0255297_147_503 | 117 |
| 485 | 3300046660 | Ga0495625_0488581 | Ga0495625_0488581_310_666 | 117 |
| 486 | 3300046660 | Ga0495625_0516072 | Ga0495625_0516072_319_675 | 117 |
| 487 | 3300046663 | Ga0495635_0027464 | Ga0495635_0027464_61_423 | 117 |
| 488 | 3300046663 | Ga0495635_0338846 | Ga0495635_0338846_329_691 | 117 |
| 489 | 3300046664 | Ga0495659_0073651 | Ga0495659_0073651_47_403 | 117 |
| 490 | 3300046680 | Ga0495646_0248625 | Ga0495646_0248625_164_526 | 117 |
| 491 | 3300046681 | Ga0495647_0035871 | Ga0495647_0035871_386_748 | 117 |
| 492 | 3300046683 | Ga0495658_0034091 | Ga0495658_0034091_1235_1597 | 117 |
| 493 | 3300046689 | Ga0495613_0007746 | Ga0495613_0007746_238_600 | 117 |
| 494 | 3300046689 | Ga0495613_0219732 | Ga0495613_0219732_178_540 | 117 |
| 495 | 3300046690 | Ga0495624_0006859 | Ga0495624_0006859_3995_4357 | 117 |
| 496 | 3300046690 | Ga0495624_0552676 | Ga0495624_0552676_173_535 | 117 |
| 497 | 3300046691 | Ga0495670_0150002 | Ga0495670_0150002_756_1112 | 117 |
| 498 | 3300046692 | Ga0495671_0299871 | Ga0495671_0299871_28_384 | 117 |
| 499 | 3300046794 | Ga0495589_0174091 | Ga0495589_0174091_593_949 | 117 |
| 500 | 3300046810 | Ga0495660_0035609 | Ga0495660_0035609_1647_2003 | 117 |
| 501 | 3300046810 | Ga0495660_0355480 | Ga0495660_0355480_220_576 | 117 |
| 502 | 3300047315 | Ga0495581_0016908 | Ga0495581_0016908_2855_3217 | 117 |
| 503 | 3300047315 | Ga0495581_0399680 | Ga0495581_0399680_130_492 | 117 |
| 504 | 3300047315 | Ga0495581_0780193 | Ga0495581_0780193_16_378 | 117 |
| 505 | 3300047319 | Ga0495674_0001453 | Ga0495674_0001453_19812_20174 | 117 |
| 506 | 3300047320 | Ga0495672_0000439 | Ga0495672_0000439_38474_38830 | 117 |
| 507 | 3300047320 | Ga0495672_0012941 | Ga0495672_0012941_3793_4155 | 117 |
| 508 | 3300047321 | Ga0495676_0116645 | Ga0495676_0116645_1061_1423 | 117 |
| 509 | 3300047322 | Ga0495680_0380315 | Ga0495680_0380315_81_443 | 117 |
| 510 | 3300047323 | Ga0495683_0149520 | Ga0495683_0149520_714_1070 | 117 |
| 511 | 3300047469 | Ga0495673_0000189 | Ga0495673_0000189_92011_92367 | 117 |
| 512 | 3300047469 | Ga0495673_0006882 | Ga0495673_0006882_4819_5175 | 117 |
| 513 | 3300047469 | Ga0495673_0118202 | Ga0495673_0118202_634_990 | 117 |
| 514 | 3300047470 | Ga0495681_0220705 | Ga0495681_0220705_256_612 | 117 |
| 515 | 3300047471 | Ga0495684_0037005 | Ga0495684_0037005_3028_3390 | 117 |
| 516 | 3300047471 | Ga0495684_0189426 | Ga0495684_0189426_927_1289 | 117 |
| 517 | 3300047471 | Ga0495684_0301994 | Ga0495684_0301994_603_965 | 117 |
| 518 | 3300047472 | Ga0495686_0015147 | Ga0495686_0015147_648_1004 | 117 |
| 519 | 3300047472 | Ga0495686_0308730 | Ga0495686_0308730_82_438 | 117 |
| 520 | 3300047673 | Ga0495593_0055809 | Ga0495593_0055809_155_517 | 117 |
| 521 | 3300047673 | Ga0495593_0129728 | Ga0495593_0129728_48_410 | 117 |
| 522 | 3300048903 | Ga0496100_0522401 | Ga0496100_0522401_346_708 | 117 |
| 523 | 3300048904 | Ga0496101_0338930 | Ga0496101_0338930_756_1118 | 117 |
| 524 | 3300048905 | Ga0496102_0513340 | Ga0496102_0513340_301_663 | 117 |
| 525 | 3300048907 | Ga0496104_0805091 | Ga0496104_0805091_385_747 | 117 |
| 526 | 3300048908 | Ga0496105_0512921 | Ga0496105_0512921_276_638 | 117 |
| 527 | 3300048909 | Ga0496106_0537005 | Ga0496106_0537005_463_825 | 117 |
| 528 | 3300048910 | Ga0496107_0000073 | Ga0496107_0000073_41417_41773 | 117 |
| 529 | 3300048912 | Ga0496109_0121692 | Ga0496109_0121692_1207_1569 | 117 |
| 530 | 3300048913 | Ga0496110_1498210 | Ga0496110_1498210_82_444 | 117 |
| 531 | 3300048915 | Ga0496112_0732935 | Ga0496112_0732935_443_805 | 117 |
| 532 | 3300048918 | Ga0496115_0348888 | Ga0496115_0348888_120_476 | 117 |
| 533 | 3300048924 | Ga0496121_0023808 | Ga0496121_0023808_4007_4363 | 117 |
| 534 | 3300048925 | Ga0496122_0364716 | Ga0496122_0364716_210_566 | 117 |
| 535 | 3300048927 | Ga0496124_0158183 | Ga0496124_0158183_638_994 | 117 |
| 536 | 3300048929 | Ga0496126_0379332 | Ga0496126_0379332_209_565 | 117 |
| 537 | 3300049131 | Ga0501341_01086 | Ga0501341_01086_145_501 | 117 |
| 538 | 3300049162 | Ga0501307_009147 | Ga0501307_009147_673_1029 | 117 |
| 539 | 3300049459 | Ga0495678_005077 | Ga0495678_005077_3427_3783 | 117 |
| 540 | 3300049527 | Ga0501311_005112 | Ga0501311_005112_947_1303 | 117 |
| 541 | 3300049531 | Ga0501315_030035 | Ga0501315_030035_151_510 | 117 |
| 542 | 3300049536 | Ga0501320_007424 | Ga0501320_007424_50_406 | 117 |
| 543 | 3300049539 | Ga0501323_002862 | Ga0501323_002862_677_1033 | 117 |
| 544 | 3300049540 | Ga0501324_013851 | Ga0501324_013851_76_432 | 117 |
| 545 | 3300049569 | Ga0501032_0181983 | Ga0501032_0181983_809_1171 | 117 |
| 546 | 3300049569 | Ga0501032_0498461 | Ga0501032_0498461_393_755 | 117 |
| 547 | 3300049570 | Ga0501033_0018681 | Ga0501033_0018681_4428_4790 | 117 |
| 548 | 3300049570 | Ga0501033_0447220 | Ga0501033_0447220_232_588 | 117 |
| 549 | 3300049571 | Ga0501034_0182168 | Ga0501034_0182168_1628_1984 | 117 |
| 550 | 3300049571 | Ga0501034_0382879 | Ga0501034_0382879_898_1260 | 117 |
| 551 | 3300049572 | Ga0501036_0089703 | Ga0501036_0089703_925_1287 | 117 |
| 552 | 3300049572 | Ga0501036_0356972 | Ga0501036_0356972_431_793 | 117 |
| 553 | 3300049574 | Ga0501038_0094154 | Ga0501038_0094154_632_994 | 117 |
| 554 | 3300049574 | Ga0501038_0221954 | Ga0501038_0221954_948_1310 | 117 |
| 555 | 3300049579 | Ga0501043_0161720 | Ga0501043_0161720_632_994 | 117 |
| 556 | 3300049579 | Ga0501043_1268367 | Ga0501043_1268367_91_450 | 117 |
| 557 | 3300049581 | Ga0501047_0088409 | Ga0501047_0088409_1374_1736 | 117 |
| 558 | 3300049581 | Ga0501047_0156023 | Ga0501047_0156023_848_1210 | 117 |
| 559 | 3300049586 | Ga0501070_0026261 | Ga0501070_0026261_1008_1370 | 117 |
| 560 | 3300049586 | Ga0501070_0164835 | Ga0501070_0164835_256_618 | 117 |
| 561 | 3300049587 | Ga0501071_1553375 | Ga0501071_1553375_125_487 | 117 |
| 562 | 3300049590 | Ga0501074_0241828 | Ga0501074_0241828_750_1112 | 117 |
| 563 | 3300049742 | Ga0501080_0296414 | Ga0501080_0296414_893_1255 | 117 |
| 564 | 3300049742 | Ga0501080_1596111 | Ga0501080_1596111_135_497 | 117 |
| 565 | 3300049822 | Ga0501035_0048974 | Ga0501035_0048974_1014_1376 | 117 |
| 566 | 3300049822 | Ga0501035_0433123 | Ga0501035_0433123_395_751 | 117 |
| 567 | 3300049823 | Ga0501044_0106728 | Ga0501044_0106728_1377_1739 | 117 |
| 568 | 3300050489 | nmdc:mga03683_53024_c1 | nmdc:mga03683_53024_c1_378_734 | 117 |
| 569 | 3300050490 | nmdc:mga03n38_43132_c1 | nmdc:mga03n38_43132_c1_550_906 | 117 |
| 570 | 3300050496 | nmdc:mga07m45_210264_c1 | nmdc:mga07m45_210264_c1_437_796 | 117 |
| 571 | 3300050496 | nmdc:mga07m45_439304_c1 | nmdc:mga07m45_439304_c1_183_539 | 117 |
| 572 | 3300050496 | nmdc:mga07m45_44026_c1 | nmdc:mga07m45_44026_c1_1432_1788 | 117 |
| 573 | 3300050496 | nmdc:mga07m45_561876_c1 | nmdc:mga07m45_561876_c1_98_454 | 117 |
| 574 | 3300050512 | nmdc:mga0n895_2160735_c1 | nmdc:mga0n895_2160735_c1_87_443 | 117 |
| 575 | 3300050515 | nmdc:mga0a205_1151886_c1 | nmdc:mga0a205_1151886_c1_57_419 | 117 |
| 576 | 3300053077 | Ga0495601_0176286 | Ga0495601_0176286_26_388 | 117 |
| 577 | 3300053078 | Ga0495612_0002649 | Ga0495612_0002649_3244_3606 | 117 |
| 578 | 3300053085 | Ga0495619_0054636 | Ga0495619_0054636_276_638 | 117 |
| 579 | 3300053085 | Ga0495619_0092071 | Ga0495619_0092071_455_817 | 117 |
| 580 | 3300053086 | Ga0500578_0000459 | Ga0500578_0000459_29115_29471 | 117 |
| 581 | 3300053086 | Ga0500578_0457666 | Ga0500578_0457666_164_520 | 117 |
| 582 | 3300053087 | Ga0500643_032910 | Ga0500643_032910_448_804 | 117 |
| 583 | 3300053088 | Ga0500644_0000193 | Ga0500644_0000193_19902_20258 | 117 |
| 584 | 3300053090 | Ga0500646_0101850 | Ga0500646_0101850_206_562 | 117 |
| 585 | 3300053090 | Ga0500646_0151204 | Ga0500646_0151204_195_551 | 117 |
| 586 | 3300053091 | Ga0500647_0003466 | Ga0500647_0003466_4673_5032 | 117 |
| 587 | 3300053092 | Ga0500583_0167787 | Ga0500583_0167787_118_474 | 117 |
| 588 | 3300053093 | Ga0500651_0119753 | Ga0500651_0119753_349_705 | 117 |
| 589 | 3300053093 | Ga0500651_0350456 | Ga0500651_0350456_205_561 | 117 |
| 590 | 3300053096 | Ga0500641_0010127 | Ga0500641_0010127_2405_2761 | 117 |
| 591 | 3300053102 | Ga0500554_002703 | Ga0500554_002703_2611_2967 | 117 |
| 592 | 3300053103 | Ga0500555_177251 | Ga0500555_177251_52_408 | 117 |
| 593 | 3300053104 | Ga0500556_0001077 | Ga0500556_0001077_8796_9152 | 117 |
| 594 | 3300053108 | Ga0500562_004235 | Ga0500562_004235_2829_3185 | 117 |
| 595 | 3300053118 | Ga0500594_0004036 | Ga0500594_0004036_2026_2382 | 117 |
| 596 | 3300053120 | Ga0500597_178156 | Ga0500597_178156_58_414 | 117 |
| 597 | 3300053123 | Ga0500614_011026 | Ga0500614_011026_1244_1600 | 117 |
| 598 | 3300053123 | Ga0500614_073605 | Ga0500614_073605_194_553 | 117 |
| 599 | 3300053131 | Ga0500652_162658 | Ga0500652_162658_249_605 | 117 |
| 600 | 3300053133 | Ga0500655_043741 | Ga0500655_043741_199_555 | 117 |
| 601 | 3300053134 | Ga0500658_0000930 | Ga0500658_0000930_7948_8304 | 117 |
| 602 | 3300053136 | Ga0500559_0001398 | Ga0500559_0001398_7783_8139 | 117 |
| 603 | 3300053137 | Ga0500561_0097878 | Ga0500561_0097878_229_585 | 117 |
| 604 | 3300053138 | Ga0500564_031554 | Ga0500564_031554_1658_2014 | 117 |
| 605 | 3300053139 | Ga0500568_0022494 | Ga0500568_0022494_1326_1688 | 117 |
| 606 | 3300053142 | Ga0500577_0007589 | Ga0500577_0007589_43_399 | 117 |
| 607 | 3300053153 | Ga0500616_0024622 | Ga0500616_0024622_1666_2022 | 117 |
| 608 | 3300053154 | Ga0500619_123571 | Ga0500619_123571_217_576 | 117 |
| 609 | 3300053156 | Ga0500622_0000771 | Ga0500622_0000771_3589_3945 | 117 |
| 610 | 3300053156 | Ga0500622_0077734 | Ga0500622_0077734_788_1144 | 117 |
| 611 | 3300053158 | Ga0500627_0001516 | Ga0500627_0001516_2489_2845 | 117 |
| 612 | 3300053160 | Ga0500633_0084409 | Ga0500633_0084409_434_790 | 117 |
| 613 | 3300053161 | Ga0500634_0154117 | Ga0500634_0154117_503_859 | 117 |
| 614 | 3300053162 | Ga0500638_122077 | Ga0500638_122077_71_430 | 117 |
| 615 | 3300053727 | Ga0500611_014275 | Ga0500611_014275_242_598 | 117 |
| 616 | 3300053730 | Ga0500645_002894 | Ga0500645_002894_1202_1558 | 117 |
| 617 | 3300053731 | Ga0500609_000093 | Ga0500609_000093_10409_10765 | 117 |
| 618 | 3300055283 | Ga0500661_014103 | Ga0500661_014103_802_1158 | 117 |
| 619 | 3300000531 | CNBas_1000419 | CNBas_10004193 | 118 |
| 620 | 3300003791 | Ga0055530_10006621 | Ga0055530_100066213 | 118 |
| 621 | 3300003794 | Ga0055531_10023079 | Ga0055531_100230794 | 118 |
| 622 | 3300004625 | Ga0055543_1031994 | Ga0055543_10319942 | 118 |
| 623 | 3300005262 | Ga0065165_1027151 | Ga0065165_10271515 | 118 |
| 624 | 3300005262 | Ga0065165_1098134 | Ga0065165_10981342 | 118 |
| 625 | 3300005293 | Ga0065715_10384206 | Ga0065715_103842062 | 118 |
| 626 | 3300005327 | Ga0070658_10343132 | Ga0070658_103431322 | 118 |
| 627 | 3300005327 | Ga0070658_10488755 | Ga0070658_104887552 | 118 |
| 628 | 3300005327 | Ga0070658_10497903 | Ga0070658_104979032 | 118 |
| 629 | 3300005331 | Ga0070670_100816638 | Ga0070670_1008166382 | 118 |
| 630 | 3300005331 | Ga0070670_101418912 | Ga0070670_1014189121 | 118 |
| 631 | 3300005334 | Ga0068869_102092514 | Ga0068869_1020925141 | 118 |
| 632 | 3300005336 | Ga0070680_100071832 | Ga0070680_1000718323 | 118 |
| 633 | 3300005339 | Ga0070660_101025178 | Ga0070660_1010251782 | 118 |
| 634 | 3300005339 | Ga0070660_101498559 | Ga0070660_1014985591 | 118 |
| 635 | 3300005339 | Ga0070660_101685404 | Ga0070660_1016854041 | 118 |
| 636 | 3300005340 | Ga0070689_100182830 | Ga0070689_1001828302 | 118 |
| 637 | 3300005341 | Ga0070691_10035939 | Ga0070691_100359392 | 118 |
| 638 | 3300005344 | Ga0070661_100466318 | Ga0070661_1004663182 | 118 |
| 639 | 3300005347 | Ga0070668_100002473 | Ga0070668_1000024737 | 118 |
| 640 | 3300005353 | Ga0070669_101541865 | Ga0070669_1015418651 | 118 |
| 641 | 3300005355 | Ga0070671_100462847 | Ga0070671_1004628472 | 118 |
| 642 | 3300005356 | Ga0070674_100401831 | Ga0070674_1004018312 | 118 |
| 643 | 3300005366 | Ga0070659_100623177 | Ga0070659_1006231771 | 118 |
| 644 | 3300005367 | Ga0070667_100081570 | Ga0070667_1000815705 | 118 |
| 645 | 3300005455 | Ga0070663_101447335 | Ga0070663_1014473352 | 118 |
| 646 | 3300005456 | Ga0070678_100120082 | Ga0070678_1001200824 | 118 |
| 647 | 3300005456 | Ga0070678_100490288 | Ga0070678_1004902882 | 118 |
| 648 | 3300005457 | Ga0070662_100014250 | Ga0070662_10001425010 | 118 |
| 649 | 3300005458 | Ga0070681_10040928 | Ga0070681_1004092811 | 118 |
| 650 | 3300005530 | Ga0070679_100226119 | Ga0070679_1002261193 | 118 |
| 651 | 3300005530 | Ga0070679_101773083 | Ga0070679_1017730831 | 118 |
| 652 | 3300005535 | Ga0070684_101292269 | Ga0070684_1012922691 | 118 |
| 653 | 3300005543 | Ga0070672_101935612 | Ga0070672_1019356121 | 118 |
| 654 | 3300005548 | Ga0070665_100006341 | Ga0070665_10000634111 | 118 |
| 655 | 3300005548 | Ga0070665_100088661 | Ga0070665_1000886614 | 118 |
| 656 | 3300005563 | Ga0068855_100018024 | Ga0068855_10001802414 | 118 |
| 657 | 3300005564 | Ga0070664_100499798 | Ga0070664_1004997983 | 118 |
| 658 | 3300005578 | Ga0068854_100731759 | Ga0068854_1007317592 | 118 |
| 659 | 3300005616 | Ga0068852_100385506 | Ga0068852_1003855062 | 118 |
| 660 | 3300005616 | Ga0068852_100599588 | Ga0068852_1005995882 | 118 |
| 661 | 3300005618 | Ga0068864_100274288 | Ga0068864_1002742881 | 118 |
| 662 | 3300005618 | Ga0068864_100968787 | Ga0068864_1009687871 | 118 |
| 663 | 3300005618 | Ga0068864_101168265 | Ga0068864_1011682652 | 118 |
| 664 | 3300005719 | Ga0068861_101141762 | Ga0068861_1011417622 | 118 |
| 665 | 3300005841 | Ga0068863_100088718 | Ga0068863_1000887183 | 118 |
| 666 | 3300005843 | Ga0068860_100373448 | Ga0068860_1003734483 | 118 |
| 667 | 3300005843 | Ga0068860_102766766 | Ga0068860_1027667662 | 118 |
| 668 | 3300005844 | Ga0068862_100627269 | Ga0068862_1006272692 | 118 |
| 669 | 3300005844 | Ga0068862_101527564 | Ga0068862_1015275642 | 118 |
| 670 | 3300006042 | Ga0075368_10009546 | Ga0075368_100095462 | 118 |
| 671 | 3300006195 | Ga0075366_10007868 | Ga0075366_1000786811 | 118 |
| 672 | 3300006195 | Ga0075366_10060203 | Ga0075366_100602032 | 118 |
| 673 | 3300006353 | Ga0075370_10019956 | Ga0075370_100199565 | 118 |
| 674 | 3300006358 | Ga0068871_100855835 | Ga0068871_1008558352 | 118 |
| 675 | 3300006946 | Ga0079104_1007846 | Ga0079104_10078465 | 118 |
| 676 | 3300009092 | Ga0105250_10331436 | Ga0105250_103314362 | 118 |
| 677 | 3300009093 | Ga0105240_10024975 | Ga0105240_100249751 | 118 |
| 678 | 3300009093 | Ga0105240_10207291 | Ga0105240_102072913 | 118 |
| 679 | 3300009093 | Ga0105240_10369970 | Ga0105240_103699703 | 118 |
| 680 | 3300009094 | Ga0111539_11509417 | Ga0111539_115094171 | 118 |
| 681 | 3300009147 | Ga0114129_11709002 | Ga0114129_117090022 | 118 |
| 682 | 3300009174 | Ga0105241_12062280 | Ga0105241_120622802 | 118 |
| 683 | 3300009176 | Ga0105242_10627964 | Ga0105242_106279642 | 118 |
| 684 | 3300009176 | Ga0105242_10656596 | Ga0105242_106565962 | 118 |
| 685 | 3300009177 | Ga0105248_10168671 | Ga0105248_101686713 | 118 |
| 686 | 3300009177 | Ga0105248_10180513 | Ga0105248_101805135 | 118 |
| 687 | 3300009177 | Ga0105248_10678976 | Ga0105248_106789762 | 118 |
| 688 | 3300009545 | Ga0105237_10869840 | Ga0105237_108698402 | 118 |
| 689 | 3300009551 | Ga0105238_10377821 | Ga0105238_103778212 | 118 |
| 690 | 3300009553 | Ga0105249_10200258 | Ga0105249_102002582 | 118 |
| 691 | 3300009553 | Ga0105249_10229554 | Ga0105249_102295544 | 118 |
| 692 | 3300010375 | Ga0105239_11206744 | Ga0105239_112067442 | 118 |
| 693 | 3300013104 | Ga0157370_11073912 | Ga0157370_110739121 | 118 |
| 694 | 3300013105 | Ga0157369_10665926 | Ga0157369_106659262 | 118 |
| 695 | 3300013296 | Ga0157374_10473969 | Ga0157374_104739692 | 118 |
| 696 | 3300013296 | Ga0157374_10619242 | Ga0157374_106192422 | 118 |
| 697 | 3300013297 | Ga0157378_11032051 | Ga0157378_110320512 | 118 |
| 698 | 3300013306 | Ga0163162_10596522 | Ga0163162_105965222 | 118 |
| 699 | 3300013306 | Ga0163162_10871031 | Ga0163162_108710312 | 118 |
| 700 | 3300013306 | Ga0163162_11109394 | Ga0163162_111093941 | 118 |
| 701 | 3300013308 | Ga0157375_10317411 | Ga0157375_103174112 | 118 |
| 702 | 3300013308 | Ga0157375_11389368 | Ga0157375_113893682 | 118 |
| 703 | 3300013308 | Ga0157375_13436784 | Ga0157375_134367842 | 118 |
| 704 | 3300014325 | Ga0163163_10386778 | Ga0163163_103867781 | 118 |
| 705 | 3300014325 | Ga0163163_10795390 | Ga0163163_107953902 | 118 |
| 706 | 3300014326 | Ga0157380_10236356 | Ga0157380_102363563 | 118 |
| 707 | 3300014745 | Ga0157377_10372671 | Ga0157377_103726712 | 118 |
| 708 | 3300014968 | Ga0157379_11705379 | Ga0157379_117053791 | 118 |
| 709 | 3300014969 | Ga0157376_12085660 | Ga0157376_120856602 | 118 |
| 710 | 3300017792 | Ga0163161_10322599 | Ga0163161_103225992 | 118 |
| 711 | 3300025304 | Ga0209257_1010167 | Ga0209257_10101672 | 118 |
| 712 | 3300025907 | Ga0207645_10766945 | Ga0207645_107669452 | 118 |
| 713 | 3300025908 | Ga0207643_10566071 | Ga0207643_105660712 | 118 |
| 714 | 3300025911 | Ga0207654_10728370 | Ga0207654_107283702 | 118 |
| 715 | 3300025913 | Ga0207695_10146421 | Ga0207695_101464213 | 118 |
| 716 | 3300025913 | Ga0207695_10148319 | Ga0207695_101483195 | 118 |
| 717 | 3300025917 | Ga0207660_11040927 | Ga0207660_110409271 | 118 |
| 718 | 3300025919 | Ga0207657_11128507 | Ga0207657_111285072 | 118 |
| 719 | 3300025920 | Ga0207649_11133386 | Ga0207649_111333862 | 118 |
| 720 | 3300025925 | Ga0207650_10289465 | Ga0207650_102894652 | 118 |
| 721 | 3300025931 | Ga0207644_10071728 | Ga0207644_100717282 | 118 |
| 722 | 3300025931 | Ga0207644_11211933 | Ga0207644_112119332 | 118 |
| 723 | 3300025932 | Ga0207690_10525613 | Ga0207690_105256132 | 118 |
| 724 | 3300025933 | Ga0207706_10042383 | Ga0207706_100423835 | 118 |
| 725 | 3300025934 | Ga0207686_10242708 | Ga0207686_102427083 | 118 |
| 726 | 3300025934 | Ga0207686_11229117 | Ga0207686_112291172 | 118 |
| 727 | 3300025935 | Ga0207709_10304309 | Ga0207709_103043092 | 118 |
| 728 | 3300025936 | Ga0207670_10766650 | Ga0207670_107666502 | 118 |
| 729 | 3300025937 | Ga0207669_10338368 | Ga0207669_103383682 | 118 |
| 730 | 3300025937 | Ga0207669_11317905 | Ga0207669_113179051 | 118 |
| 731 | 3300025938 | Ga0207704_10514856 | Ga0207704_105148562 | 118 |
| 732 | 3300025940 | Ga0207691_10240491 | Ga0207691_102404911 | 118 |
| 733 | 3300025940 | Ga0207691_10641562 | Ga0207691_106415622 | 118 |
| 734 | 3300025941 | Ga0207711_10220646 | Ga0207711_102206463 | 118 |
| 735 | 3300025941 | Ga0207711_10345144 | Ga0207711_103451443 | 118 |
| 736 | 3300025941 | Ga0207711_10702239 | Ga0207711_107022392 | 118 |
| 737 | 3300025942 | Ga0207689_11580734 | Ga0207689_115807342 | 118 |
| 738 | 3300025960 | Ga0207651_10586891 | Ga0207651_105868912 | 118 |
| 739 | 3300025961 | Ga0207712_10527509 | Ga0207712_105275092 | 118 |
| 740 | 3300025972 | Ga0207668_10000571 | Ga0207668_1000057119 | 118 |
| 741 | 3300025981 | Ga0207640_10155026 | Ga0207640_101550262 | 118 |
| 742 | 3300025981 | Ga0207640_10586847 | Ga0207640_105868472 | 118 |
| 743 | 3300025986 | Ga0207658_10010638 | Ga0207658_100106384 | 118 |
| 744 | 3300025986 | Ga0207658_10576536 | Ga0207658_105765362 | 118 |
| 745 | 3300026035 | Ga0207703_11359513 | Ga0207703_113595132 | 118 |
| 746 | 3300026067 | Ga0207678_10151952 | Ga0207678_101519522 | 118 |
| 747 | 3300026075 | Ga0207708_10825886 | Ga0207708_108258861 | 118 |
| 748 | 3300026088 | Ga0207641_11020111 | Ga0207641_110201112 | 118 |
| 749 | 3300026095 | Ga0207676_11284243 | Ga0207676_112842431 | 118 |
| 750 | 3300026095 | Ga0207676_11600591 | Ga0207676_116005912 | 118 |
| 751 | 3300026118 | Ga0207675_101929991 | Ga0207675_1019299912 | 118 |
| 752 | 3300026121 | Ga0207683_10181530 | Ga0207683_101815302 | 118 |
| 753 | 3300026121 | Ga0207683_10635681 | Ga0207683_106356812 | 118 |
| 754 | 3300026121 | Ga0207683_10653920 | Ga0207683_106539202 | 118 |
| 755 | 3300026142 | Ga0207698_10448373 | Ga0207698_104483732 | 118 |
| 756 | 3300026142 | Ga0207698_10890419 | Ga0207698_108904192 | 118 |
| 757 | 3300027378 | Ga0209981_1000043 | Ga0209981_10000435 | 118 |
| 758 | 3300027543 | Ga0209999_1001367 | Ga0209999_10013679 | 118 |
| 759 | 3300027614 | Ga0209970_1050229 | Ga0209970_10502292 | 118 |
| 760 | 3300028379 | Ga0268266_10001264 | Ga0268266_100012645 | 118 |
| 761 | 3300028379 | Ga0268266_10138455 | Ga0268266_101384554 | 118 |
| 762 | 3300028379 | Ga0268266_11315726 | Ga0268266_113157262 | 118 |
| 763 | 3300028380 | Ga0268265_10251223 | Ga0268265_102512232 | 118 |
| 764 | 3300028786 | Ga0307517_10256707 | Ga0307517_102567072 | 118 |
| 765 | 3300030521 | Ga0307511_10006537 | Ga0307511_1000653720 | 118 |
| 766 | 3300031456 | Ga0307513_10324480 | Ga0307513_103244803 | 118 |
| 767 | 3300031548 | Ga0307408_100804034 | Ga0307408_1008040342 | 118 |
| 768 | 3300031730 | Ga0307516_10001565 | Ga0307516_1000156527 | 118 |
| 769 | 3300031731 | Ga0307405_10778948 | Ga0307405_107789482 | 118 |
| 770 | 3300031824 | Ga0307413_10101849 | Ga0307413_101018492 | 118 |
| 771 | 3300031852 | Ga0307410_10302301 | Ga0307410_103023012 | 118 |
| 772 | 3300031911 | Ga0307412_10237387 | Ga0307412_102373872 | 118 |
| 773 | 3300031911 | Ga0307412_10380730 | Ga0307412_103807302 | 118 |
| 774 | 3300031995 | Ga0307409_100845138 | Ga0307409_1008451382 | 118 |
| 775 | 3300032002 | Ga0307416_103078228 | Ga0307416_1030782282 | 118 |
| 776 | 3300032002 | Ga0307416_103370177 | Ga0307416_1033701771 | 118 |
| 777 | 3300032004 | Ga0307414_10041874 | Ga0307414_100418745 | 118 |
| 778 | 3300032005 | Ga0307411_10049694 | Ga0307411_100496944 | 118 |
| 779 | 3300035083 | Ga0373926_0248156 | Ga0373926_0248156_36_395 | 118 |
| 780 | 3300035112 | Ga0373932_0150233 | Ga0373932_0150233_38_397 | 118 |
| 781 | 3300035113 | Ga0373936_0004112 | Ga0373936_0004112_2755_3114 | 118 |
| 782 | 3300035116 | Ga0373945_0108905 | Ga0373945_0108905_347_706 | 118 |
| 783 | 3300035695 | Ga0373927_0000479 | Ga0373927_0000479_22406_22765 | 118 |
| 784 | 3300037068 | Ga0373925_0000023 | Ga0373925_0000023_8501_8860 | 118 |
| 785 | 3300037312 | Ga0395899_0025758 | Ga0395899_0025758_1055_1417 | 118 |
| 786 | 3300037418 | Ga0395900_0058480 | Ga0395900_0058480_3151_3513 | 118 |
| 787 | 3300037466 | Ga0395898_0118890 | Ga0395898_0118890_1906_2268 | 118 |
| 788 | 3300037471 | Ga0395905_0650545 | Ga0395905_0650545_152_511 | 118 |
| 789 | 3300037471 | Ga0395905_1764859 | Ga0395905_1764859_52_414 | 118 |
| 790 | 3300038443 | Ga0395901_0148822 | Ga0395901_0148822_838_1200 | 118 |
| 791 | 3300038443 | Ga0395901_1350935 | Ga0395901_1350935_83_445 | 118 |
| 792 | 3300041413 | Ga0439465_0018730 | Ga0439465_0018730_173_535 | 118 |
| 793 | 3300042435 | Ga0439434_0080920 | Ga0439434_0080920_292_654 | 118 |
| 794 | 3300045051 | Ga0451576_2555345 | Ga0451576_2555345_93_452 | 118 |
| 795 | 3300045836 | Ga0466958_0186424 | Ga0466958_0186424_473_841 | 118 |
| 796 | 3300046459 | Ga0495629_0011151 | Ga0495629_0011151_2107_2463 | 118 |
| 797 | 3300046460 | Ga0495638_0303612 | Ga0495638_0303612_278_637 | 118 |
| 798 | 3300046474 | Ga0495605_0117281 | Ga0495605_0117281_508_867 | 118 |
| 799 | 3300046476 | Ga0495662_0080231 | Ga0495662_0080231_1149_1508 | 118 |
| 800 | 3300046491 | Ga0495584_0094537 | Ga0495584_0094537_75_431 | 118 |
| 801 | 3300046492 | Ga0495585_0247812 | Ga0495585_0247812_110_469 | 118 |
| 802 | 3300046499 | Ga0495594_0504110 | Ga0495594_0504110_41_397 | 118 |
| 803 | 3300046506 | Ga0495583_0044333 | Ga0495583_0044333_1370_1726 | 118 |
| 804 | 3300046506 | Ga0495583_0161456 | Ga0495583_0161456_532_891 | 118 |
| 805 | 3300046512 | Ga0495610_0161341 | Ga0495610_0161341_364_720 | 118 |
| 806 | 3300046515 | Ga0495620_0053397 | Ga0495620_0053397_700_1056 | 118 |
| 807 | 3300046515 | Ga0495620_0265930 | Ga0495620_0265930_94_453 | 118 |
| 808 | 3300046522 | Ga0495643_0002864 | Ga0495643_0002864_2617_2973 | 118 |
| 809 | 3300046523 | Ga0495644_0136868 | Ga0495644_0136868_82_441 | 118 |
| 810 | 3300046524 | Ga0495648_0114732 | Ga0495648_0114732_230_589 | 118 |
| 811 | 3300046525 | Ga0495663_0055156 | Ga0495663_0055156_583_942 | 118 |
| 812 | 3300046528 | Ga0495642_0035363 | Ga0495642_0035363_1624_1983 | 118 |
| 813 | 3300046528 | Ga0495642_0165305 | Ga0495642_0165305_51_410 | 118 |
| 814 | 3300046530 | Ga0495654_0084152 | Ga0495654_0084152_884_1240 | 118 |
| 815 | 3300046537 | Ga0495598_0036334 | Ga0495598_0036334_679_1041 | 118 |
| 816 | 3300046538 | Ga0495609_0054080 | Ga0495609_0054080_65_424 | 118 |
| 817 | 3300046539 | Ga0495621_0046297 | Ga0495621_0046297_919_1281 | 118 |
| 818 | 3300046542 | Ga0495597_0001666 | Ga0495597_0001666_9753_10109 | 118 |
| 819 | 3300046557 | Ga0495622_0002985 | Ga0495622_0002985_515_871 | 118 |
| 820 | 3300046616 | Ga0495668_0015955 | Ga0495668_0015955_400_756 | 118 |
| 821 | 3300046616 | Ga0495668_0097894 | Ga0495668_0097894_756_1115 | 118 |
| 822 | 3300046648 | Ga0495611_0074940 | Ga0495611_0074940_1169_1528 | 118 |
| 823 | 3300046660 | Ga0495625_0049607 | Ga0495625_0049607_605_964 | 118 |
| 824 | 3300046660 | Ga0495625_0092672 | Ga0495625_0092672_278_634 | 118 |
| 825 | 3300046665 | Ga0495661_0294697 | Ga0495661_0294697_134_493 | 118 |
| 826 | 3300046683 | Ga0495658_0325523 | Ga0495658_0325523_137_496 | 118 |
| 827 | 3300046684 | Ga0495669_0088099 | Ga0495669_0088099_125_484 | 118 |
| 828 | 3300046691 | Ga0495670_0298359 | Ga0495670_0298359_383_742 | 118 |
| 829 | 3300046691 | Ga0495670_0728965 | Ga0495670_0728965_75_431 | 118 |
| 830 | 3300046692 | Ga0495671_0135611 | Ga0495671_0135611_595_954 | 118 |
| 831 | 3300047318 | Ga0495636_0006624 | Ga0495636_0006624_435_794 | 118 |
| 832 | 3300047320 | Ga0495672_0074113 | Ga0495672_0074113_852_1211 | 118 |
| 833 | 3300047321 | Ga0495676_0662790 | Ga0495676_0662790_126_482 | 118 |
| 834 | 3300047323 | Ga0495683_0343954 | Ga0495683_0343954_74_433 | 118 |
| 835 | 3300047443 | Ga0495687_008468 | Ga0495687_008468_167_526 | 118 |
| 836 | 3300047470 | Ga0495681_0066188 | Ga0495681_0066188_293_652 | 118 |
| 837 | 3300047472 | Ga0495686_0348585 | Ga0495686_0348585_386_745 | 118 |
| 838 | 3300047673 | Ga0495593_0008408 | Ga0495593_0008408_1158_1514 | 118 |
| 839 | 3300048088 | Ga0495602_0204492 | Ga0495602_0204492_1013_1369 | 118 |
| 840 | 3300048903 | Ga0496100_0210999 | Ga0496100_0210999_315_674 | 118 |
| 841 | 3300048904 | Ga0496101_0023677 | Ga0496101_0023677_2250_2609 | 118 |
| 842 | 3300048905 | Ga0496102_0090282 | Ga0496102_0090282_1947_2306 | 118 |
| 843 | 3300048905 | Ga0496102_1410400 | Ga0496102_1410400_107_466 | 118 |
| 844 | 3300048906 | Ga0496103_0121911 | Ga0496103_0121911_63_422 | 118 |
| 845 | 3300048906 | Ga0496103_0797543 | Ga0496103_0797543_118_477 | 118 |
| 846 | 3300048907 | Ga0496104_0553724 | Ga0496104_0553724_14_373 | 118 |
| 847 | 3300048908 | Ga0496105_0642390 | Ga0496105_0642390_311_670 | 118 |
| 848 | 3300048909 | Ga0496106_0625688 | Ga0496106_0625688_322_681 | 118 |
| 849 | 3300048910 | Ga0496107_0083885 | Ga0496107_0083885_905_1264 | 118 |
| 850 | 3300048911 | Ga0496108_0463480 | Ga0496108_0463480_101_460 | 118 |
| 851 | 3300048912 | Ga0496109_0121719 | Ga0496109_0121719_1922_2281 | 118 |
| 852 | 3300048913 | Ga0496110_0591050 | Ga0496110_0591050_192_551 | 118 |
| 853 | 3300048914 | Ga0496111_0109254 | Ga0496111_0109254_1341_1700 | 118 |
| 854 | 3300048915 | Ga0496112_0033003 | Ga0496112_0033003_2184_2543 | 118 |
| 855 | 3300048916 | Ga0496113_0035256 | Ga0496113_0035256_1821_2180 | 118 |
| 856 | 3300048918 | Ga0496115_0003309 | Ga0496115_0003309_9900_10259 | 118 |
| 857 | 3300048918 | Ga0496115_0270087 | Ga0496115_0270087_746_1105 | 118 |
| 858 | 3300048918 | Ga0496115_0854900 | Ga0496115_0854900_101_460 | 118 |
| 859 | 3300048921 | Ga0496118_0018740 | Ga0496118_0018740_1438_1797 | 118 |
| 860 | 3300048922 | Ga0496119_0023935 | Ga0496119_0023935_2274_2633 | 118 |
| 861 | 3300048923 | Ga0496120_0240672 | Ga0496120_0240672_222_581 | 118 |
| 862 | 3300048924 | Ga0496121_0000946 | Ga0496121_0000946_23976_24335 | 118 |
| 863 | 3300048929 | Ga0496126_0797254 | Ga0496126_0797254_175_537 | 118 |
| 864 | 3300049460 | Ga0495682_0189030 | Ga0495682_0189030_128_484 | 118 |
| 865 | 3300049533 | Ga0501317_038414 | Ga0501317_038414_10_372 | 118 |
| 866 | 3300049569 | Ga0501032_0147319 | Ga0501032_0147319_140_499 | 118 |
| 867 | 3300049570 | Ga0501033_0100089 | Ga0501033_0100089_193_555 | 118 |
| 868 | 3300049570 | Ga0501033_0179594 | Ga0501033_0179594_706_1065 | 118 |
| 869 | 3300049570 | Ga0501033_0210011 | Ga0501033_0210011_691_1050 | 118 |
| 870 | 3300049571 | Ga0501034_0204731 | Ga0501034_0204731_786_1148 | 118 |
| 871 | 3300049573 | Ga0501037_0739424 | Ga0501037_0739424_53_415 | 118 |
| 872 | 3300049581 | Ga0501047_0020305 | Ga0501047_0020305_5896_6255 | 118 |
| 873 | 3300049581 | Ga0501047_0143792 | Ga0501047_0143792_463_822 | 118 |
| 874 | 3300049586 | Ga0501070_0168040 | Ga0501070_0168040_768_1130 | 118 |
| 875 | 3300049586 | Ga0501070_0950846 | Ga0501070_0950846_11_370 | 118 |
| 876 | 3300049742 | Ga0501080_0989809 | Ga0501080_0989809_153_515 | 118 |
| 877 | 3300049822 | Ga0501035_0159703 | Ga0501035_0159703_1363_1722 | 118 |
| 878 | 3300049823 | Ga0501044_0004107 | Ga0501044_0004107_15348_15707 | 118 |
| 879 | 3300049823 | Ga0501044_0223450 | Ga0501044_0223450_491_853 | 118 |
| 880 | 3300050490 | nmdc:mga03n38_34767_c1 | nmdc:mga03n38_34767_c1_303_662 | 118 |
| 881 | 3300050493 | nmdc:mga0k408_11918_c1 | nmdc:mga0k408_11918_c1_3978_4337 | 118 |
| 882 | 3300050493 | nmdc:mga0k408_16271_c1 | nmdc:mga0k408_16271_c1_1790_2149 | 118 |
| 883 | 3300050496 | nmdc:mga07m45_180766_c1 | nmdc:mga07m45_180766_c1_69_428 | 118 |
| 884 | 3300053080 | Ga0500635_0000205 | Ga0500635_0000205_19479_19835 | 118 |
| 885 | 3300053086 | Ga0500578_0228255 | Ga0500578_0228255_481_837 | 118 |
| 886 | 3300053087 | Ga0500643_002694 | Ga0500643_002694_7628_7990 | 118 |
| 887 | 3300053087 | Ga0500643_050411 | Ga0500643_050411_139_498 | 118 |
| 888 | 3300053091 | Ga0500647_0164123 | Ga0500647_0164123_324_680 | 118 |
| 889 | 3300053092 | Ga0500583_0043876 | Ga0500583_0043876_1404_1760 | 118 |
| 890 | 3300053093 | Ga0500651_0003210 | Ga0500651_0003210_7521_7877 | 118 |
| 891 | 3300053094 | Ga0500566_0046745 | Ga0500566_0046745_477_833 | 118 |
| 892 | 3300053094 | Ga0500566_0197498 | Ga0500566_0197498_439_798 | 118 |
| 893 | 3300053102 | Ga0500554_048927 | Ga0500554_048927_139_495 | 118 |
| 894 | 3300053103 | Ga0500555_000830 | Ga0500555_000830_2633_2992 | 118 |
| 895 | 3300053103 | Ga0500555_028108 | Ga0500555_028108_114_473 | 118 |
| 896 | 3300053104 | Ga0500556_0075595 | Ga0500556_0075595_830_1189 | 118 |
| 897 | 3300053104 | Ga0500556_0342195 | Ga0500556_0342195_182_538 | 118 |
| 898 | 3300053108 | Ga0500562_000644 | Ga0500562_000644_7000_7359 | 118 |
| 899 | 3300053109 | Ga0500569_015492 | Ga0500569_015492_301_657 | 118 |
| 900 | 3300053111 | Ga0500572_066165 | Ga0500572_066165_69_425 | 118 |
| 901 | 3300053115 | Ga0500591_226527 | Ga0500591_226527_94_450 | 118 |
| 902 | 3300053119 | Ga0500595_001651 | Ga0500595_001651_1797_2153 | 118 |
| 903 | 3300053119 | Ga0500595_026433 | Ga0500595_026433_1444_1806 | 118 |
| 904 | 3300053121 | Ga0500607_185706 | Ga0500607_185706_230_586 | 118 |
| 905 | 3300053122 | Ga0500608_001997 | Ga0500608_001997_2030_2386 | 118 |
| 906 | 3300053130 | Ga0500642_0098321 | Ga0500642_0098321_891_1247 | 118 |
| 907 | 3300053136 | Ga0500559_0021969 | Ga0500559_0021969_656_1012 | 118 |
| 908 | 3300053138 | Ga0500564_195496 | Ga0500564_195496_410_766 | 118 |
| 909 | 3300053140 | Ga0500573_0565810 | Ga0500573_0565810_78_440 | 118 |
| 910 | 3300053148 | Ga0500590_004741 | Ga0500590_004741_5571_5927 | 118 |
| 911 | 3300053150 | Ga0500603_016462 | Ga0500603_016462_69_425 | 118 |
| 912 | 3300053154 | Ga0500619_109352 | Ga0500619_109352_288_644 | 118 |
| 913 | 3300053162 | Ga0500638_128492 | Ga0500638_128492_94_450 | 118 |
| 914 | 3300053178 | Ga0500637_0176033 | Ga0500637_0176033_578_934 | 118 |
| 915 | 3300053725 | Ga0500576_243434 | Ga0500576_243434_120_479 | 118 |
| 916 | 3300053729 | Ga0500625_054205 | Ga0500625_054205_1036_1392 | 118 |
| 917 | 3300053730 | Ga0500645_034026 | Ga0500645_034026_336_692 | 118 |
| 918 | 3300053735 | Ga0500596_000363 | Ga0500596_000363_815_1171 | 118 |
| 919 | 3300055283 | Ga0500661_034475 | Ga0500661_034475_235_591 | 118 |
| 920 | 3300059492 | Ga0587073_0159362 | Ga0587073_0159362_272_631 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b4v-assembly1.cif.gz_P | antibiotic blasticidin s and e. coli release factor 1 bound to the 70s ribosome | 0.9053 | 2 | 118 |
| 4w2e-assembly1.cif.gz_S | crystal structure of elongation factor 4 (ef4/lepa) bound to the thermus thermophilus 70s ribosome | 0.9035 | 2 | 118 |
| 4v9r-assembly2.cif.gz_DS | crystal structure of antibiotic dityromycin bound to 70s ribosome | 0.9029 | 2 | 118 |
| 7a0r-assembly1.cif.gz_L | 50s deinococcus radiodurans ribosome bounded with mycinamicin i | 0.901 | 13 | 115 |
| 4v95-assembly1.cif.gz_BS | crystal structure of yaej bound to the 70s ribosome | 0.8983 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ddga01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9612 | 29 | 118 | 3.30.420.100 |
| 5zetP01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9237 | 26 | 118 | 3.30.420.100 |
| 5xymO01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9123 | 25 | 118 | 3.30.420.100 |
| 4dhcS01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9106 | 17 | 118 | 3.30.420.100 |
| 6ddga01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9077 | 29 | 118 | 3.30.420.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F5KL99-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9566 | 26 | 118 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0008097 GO:1990904 |
| AF-A0A1F5AYM9-F1-model_v4 | Large ribosomal subunit protein uL18 (50S ribosomal protein L18) | 0.9556 | 28 | 118 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0008097 GO:1990904 |
| AF-A0A6J6GJA3-F1-model_v4 | Unannotated protein | 0.9522 | 27 | 118 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A2M8L376-F1-model_v4 | Large ribosomal subunit protein uL18 | 0.9517 | 28 | 118 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A143WPI5-F1-model_v4 | 50S ribosomal protein L18 | 0.9495 | 27 | 118 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar