F485712
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 919 | 400 | 916 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300046452|Ga0495617_008876|Ga0495617_008876_2007_2696 |
| Length | 229 |
| Sequence | MVSLSPVDSQSQLNVLFQSIFQMAEKTLQWHLIDTQPHEETTMSLINTQVKPFKATAYHNGKFIDLSEESLKGKWSVFMFYPADFTFVCPTELEDLADFQPEFAKMGVDVYGISTDTHFAHKAWHDTSDAIKKVNYPLIGDPTGALSRNFEVMIEEEGLALRGTFVINPEGQIKVMEVHDNGIGRDASELMRKVKAAQYVAAHPGEVCPAKWTEGAATLTPSLDLVGKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 2 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 3 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003160 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003288 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 27 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 33 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 183 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 184 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 204 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 205 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 206 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 207 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 208 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 209 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 322 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 323 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 324 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 325 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 326 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 327 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 328 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 347 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 348 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 349 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 350 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 351 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 352 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 353 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 369 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 370 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 372 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 373 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 374 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059602 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 15R_AD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.25 |
| Metatranscriptomes | 6.42 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.97 |
| Nodule | 0.33 |
| Rhizoplane | 1.31 |
| Rhizosphere | 82.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000750 | 3300002704 | Bacteria | 5474 |
| 2 | JGI25156J39149_1000185 | 3300002705 | Bacteria | 45133 |
| 3 | JGI25162J39368_1000038 | 3300002737 | Bacteria | 179049 |
| 4 | JGI25162J39368_1004094 | 3300002737 | Bacteria | 3622 |
| 5 | JGI25154J39366_1001907 | 3300002738 | Bacteria | 6306 |
| 6 | JGI25154J39366_1004938 | 3300002738 | Bacteria | 2244 |
| 7 | JGI25157J39369_1000284 | 3300002741 | Bacteria | 36859 |
| 8 | JGI25157J39369_1000431 | 3300002741 | Bacteria | 27316 |
| 9 | JGI25164J39214_1001783 | 3300002772 | Bacteria | 4184 |
| 10 | JGI25150J39212_1001795 | 3300002774 | Bacteria | 5713 |
| 11 | JGI25150J39212_1009348 | 3300002774 | Bacteria | 1871 |
| 12 | Ga0006763J43179_101775 | 3300002870 | Bacteria | 1439 |
| 13 | Ga0006762J43184_105387 | 3300002872 | Bacteria | 612 |
| 14 | JGI25159J45721_1004023 | 3300002987 | Bacteria | 5005 |
| 15 | Ga0006760J45825_103373 | 3300003158 | Bacteria | 614 |
| 16 | Ga0006779J45831_107007 | 3300003160 | Bacteria | 620 |
| 17 | Ga0006765J45826_104465 | 3300003161 | Bacteria | 613 |
| 18 | Ga0006778J45830_1018011 | 3300003162 | Bacteria | 614 |
| 19 | Ga0006778J45830_1046945 | 3300003162 | Bacteria | 880 |
| 20 | Ga0006759J45824_1004153 | 3300003163 | Bacteria | 2393 |
| 21 | Ga0006759J45824_1006275 | 3300003163 | Bacteria | 614 |
| 22 | JGI25165J46597_1000045 | 3300003214 | Bacteria | 257539 |
| 23 | JGI25153J46596_10021708 | 3300003215 | Bacteria | 2386 |
| 24 | Ga0007428J48920_101749 | 3300003288 | Bacteria | 1082 |
| 25 | Ga0006758J48902_1014592 | 3300003300 | Bacteria | 1147 |
| 26 | Ga0006770J48903_1023283 | 3300003305 | Bacteria | 642 |
| 27 | Ga0006770J48903_1026315 | 3300003305 | Bacteria | 603 |
| 28 | Ga0006777J48905_1017375 | 3300003308 | Bacteria | 1106 |
| 29 | Ga0006777J48905_1020868 | 3300003308 | Bacteria | 659 |
| 30 | JGI25160J50197_1008040 | 3300003354 | Bacteria | 4054 |
| 31 | JGI25161J50226_1018534 | 3300003374 | Bacteria | 721 |
| 32 | Ga0007417J51691_1010995 | 3300003544 | Bacteria | 1487 |
| 33 | Ga0006781J51513_1014323 | 3300003568 | Bacteria | 611 |
| 34 | Ga0007410J51695_1033499 | 3300003574 | Bacteria | 1392 |
| 35 | Ga0007416J51690_1088669 | 3300003577 | Bacteria | 891 |
| 36 | Ga0032354_1015485 | 3300003693 | Bacteria | 2390 |
| 37 | Ga0006780_1008912 | 3300003735 | Bacteria | 1121 |
| 38 | Ga0055538_1000022 | 3300003751 | Bacteria | 257539 |
| 39 | Ga0055538_1000085 | 3300003751 | Bacteria | 81616 |
| 40 | Ga0055539_1000028 | 3300003752 | Bacteria | 257539 |
| 41 | Ga0055539_1000126 | 3300003752 | Bacteria | 81616 |
| 42 | Ga0055533_1000036 | 3300003756 | Bacteria | 257539 |
| 43 | Ga0055533_1000133 | 3300003756 | Bacteria | 81616 |
| 44 | Ga0055532_1000044 | 3300003758 | Bacteria | 191110 |
| 45 | Ga0055525_1000071 | 3300003759 | Bacteria | 182624 |
| 46 | Ga0055525_1000174 | 3300003759 | Bacteria | 81616 |
| 47 | Ga0055535_1006579 | 3300003761 | Bacteria | 2329 |
| 48 | Ga0055529_1000015 | 3300003763 | Bacteria | 366950 |
| 49 | Ga0055526_1000007 | 3300003771 | Bacteria | 321998 |
| 50 | Ga0055526_1000037 | 3300003771 | Bacteria | 134834 |
| 51 | Ga0055526_1002076 | 3300003771 | Bacteria | 13758 |
| 52 | Ga0055526_1003417 | 3300003771 | Bacteria | 10082 |
| 53 | Ga0055537_1000236 | 3300003773 | Bacteria | 40412 |
| 54 | Ga0055537_1020993 | 3300003773 | Bacteria | 979 |
| 55 | Ga0055524_1022725 | 3300003775 | Bacteria | 2040 |
| 56 | Ga0055534_1000544 | 3300003784 | Bacteria | 20117 |
| 57 | Ga0055534_1003580 | 3300003784 | Bacteria | 4828 |
| 58 | Ga0055528_1000136 | 3300003790 | Bacteria | 58873 |
| 59 | Ga0055528_1005295 | 3300003790 | Bacteria | 6037 |
| 60 | Ga0055530_10004518 | 3300003791 | Bacteria | 7125 |
| 61 | Ga0055530_10013523 | 3300003791 | Bacteria | 2779 |
| 62 | Ga0055531_10079968 | 3300003794 | Bacteria | 723 |
| 63 | Ga0055541_1000037 | 3300003841 | Bacteria | 182624 |
| 64 | Ga0055541_1000085 | 3300003841 | Bacteria | 81616 |
| 65 | Ga0065165_1001295 | 3300005262 | Bacteria | 28121 |
| 66 | Ga0068869_100665581 | 3300005334 | Bacteria | 885 |
| 67 | Ga0070680_100256296 | 3300005336 | Bacteria | 1480 |
| 68 | Ga0070680_100305247 | 3300005336 | Bacteria | 1350 |
| 69 | Ga0068868_101190880 | 3300005338 | Bacteria | 704 |
| 70 | Ga0070661_100033803 | 3300005344 | Bacteria | 3706 |
| 71 | Ga0070661_100867724 | 3300005344 | Bacteria | 743 |
| 72 | Ga0070668_100390125 | 3300005347 | Bacteria | 1187 |
| 73 | Ga0070673_101084580 | 3300005364 | Bacteria | 748 |
| 74 | Ga0070667_100022285 | 3300005367 | Bacteria | 5255 |
| 75 | Ga0070663_100267735 | 3300005455 | Bacteria | 1357 |
| 76 | Ga0070662_100288682 | 3300005457 | Bacteria | 1329 |
| 77 | Ga0070681_10091379 | 3300005458 | Bacteria | 2994 |
| 78 | Ga0068867_100136338 | 3300005459 | Bacteria | 1914 |
| 79 | Ga0070684_100482892 | 3300005535 | Bacteria | 1147 |
| 80 | Ga0070697_100056747 | 3300005536 | Bacteria | 3186 |
| 81 | Ga0068853_100278514 | 3300005539 | Bacteria | 1542 |
| 82 | Ga0070672_100451704 | 3300005543 | Bacteria | 1107 |
| 83 | Ga0070696_100033584 | 3300005546 | Bacteria | 3526 |
| 84 | Ga0070665_100137461 | 3300005548 | Bacteria | 2447 |
| 85 | Ga0068855_100005477 | 3300005563 | Bacteria | 15488 |
| 86 | Ga0070664_100024751 | 3300005564 | Bacteria | 4970 |
| 87 | Ga0070664_100218481 | 3300005564 | Bacteria | 1705 |
| 88 | Ga0068857_100145949 | 3300005577 | Bacteria | 2141 |
| 89 | Ga0068854_100008400 | 3300005578 | Bacteria | 6636 |
| 90 | Ga0068852_100000490 | 3300005616 | Bacteria | 25825 |
| 91 | Ga0068852_100435513 | 3300005616 | Bacteria | 1295 |
| 92 | Ga0068851_10042392 | 3300005834 | Bacteria | 2291 |
| 93 | Ga0068851_10093296 | 3300005834 | Bacteria | 1588 |
| 94 | Ga0068860_100299709 | 3300005843 | Bacteria | 1574 |
| 95 | Ga0070717_10118214 | 3300006028 | Bacteria | 2268 |
| 96 | Ga0075364_10230283 | 3300006051 | Bacteria | 1258 |
| 97 | Ga0075362_10001657 | 3300006177 | Bacteria | 7222 |
| 98 | Ga0075362_10017122 | 3300006177 | Bacteria | 2981 |
| 99 | Ga0075362_10083266 | 3300006177 | Bacteria | 1477 |
| 100 | Ga0075367_10012290 | 3300006178 | Bacteria | 4559 |
| 101 | Ga0075369_10146400 | 3300006186 | Bacteria | 1078 |
| 102 | Ga0075366_10019177 | 3300006195 | Bacteria | 3954 |
| 103 | Ga0097621_100176540 | 3300006237 | Bacteria | 1844 |
| 104 | Ga0075370_10053243 | 3300006353 | Bacteria | 2297 |
| 105 | Ga0075370_10302848 | 3300006353 | Bacteria | 951 |
| 106 | Ga0068871_100076765 | 3300006358 | Bacteria | 2760 |
| 107 | Ga0075428_100172309 | 3300006844 | Bacteria | 2345 |
| 108 | Ga0075430_100127705 | 3300006846 | Bacteria | 2120 |
| 109 | Ga0075431_100300244 | 3300006847 | Unclassified | 1622 |
| 110 | Ga0075431_100450548 | 3300006847 | Bacteria | 1283 |
| 111 | Ga0075434_100055035 | 3300006871 | Unclassified | 3953 |
| 112 | Ga0075429_100219007 | 3300006880 | Bacteria | 1668 |
| 113 | Ga0068865_100233324 | 3300006881 | Bacteria | 1445 |
| 114 | Ga0075436_100173885 | 3300006914 | Unclassified | 1521 |
| 115 | Ga0079104_1017411 | 3300006946 | Bacteria | 2065 |
| 116 | Ga0075435_100058404 | 3300007076 | Bacteria | 3124 |
| 117 | Ga0105244_10000395 | 3300009036 | Bacteria | 40415 |
| 118 | Ga0105244_10001280 | 3300009036 | Bacteria | 20628 |
| 119 | Ga0105244_10038887 | 3300009036 | Bacteria | 2479 |
| 120 | Ga0105244_10145558 | 3300009036 | Bacteria | 1137 |
| 121 | Ga0105244_10147050 | 3300009036 | Bacteria | 1130 |
| 122 | Ga0105240_10000523 | 3300009093 | Bacteria | 70721 |
| 123 | Ga0105240_10212001 | 3300009093 | Bacteria | 2263 |
| 124 | Ga0105240_10429712 | 3300009093 | Bacteria | 1482 |
| 125 | Ga0105240_10449723 | 3300009093 | Bacteria | 1442 |
| 126 | Ga0111539_10137917 | 3300009094 | Bacteria | 2857 |
| 127 | Ga0114129_11106162 | 3300009147 | Bacteria | 992 |
| 128 | Ga0105243_10246701 | 3300009148 | Bacteria | 1592 |
| 129 | Ga0105241_10011217 | 3300009174 | Bacteria | 6569 |
| 130 | Ga0105241_10865216 | 3300009174 | Bacteria | 837 |
| 131 | Ga0105242_10093084 | 3300009176 | Bacteria | 2540 |
| 132 | Ga0105242_10209812 | 3300009176 | Unclassified | 1735 |
| 133 | Ga0105237_10041411 | 3300009545 | Bacteria | 4645 |
| 134 | Ga0105237_10244489 | 3300009545 | Bacteria | 1796 |
| 135 | Ga0105238_10000038 | 3300009551 | Bacteria | 162920 |
| 136 | Ga0105238_10097218 | 3300009551 | Bacteria | 2930 |
| 137 | Ga0105238_10527717 | 3300009551 | Bacteria | 1183 |
| 138 | Ga0105249_11364383 | 3300009553 | Bacteria | 781 |
| 139 | Ga0105239_10003685 | 3300010375 | Bacteria | 18679 |
| 140 | Ga0105246_10265641 | 3300011119 | Bacteria | 1369 |
| 141 | Ga0157373_10131749 | 3300013100 | Bacteria | 1758 |
| 142 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 143 | Ga0157369_10314670 | 3300013105 | Bacteria | 1628 |
| 144 | Ga0157374_10122216 | 3300013296 | Bacteria | 2514 |
| 145 | Ga0157378_10031139 | 3300013297 | Bacteria | 4711 |
| 146 | Ga0163162_10128902 | 3300013306 | Bacteria | 2638 |
| 147 | Ga0157372_10336753 | 3300013307 | Bacteria | 1757 |
| 148 | Ga0157372_10856653 | 3300013307 | Bacteria | 1055 |
| 149 | Ga0157372_11445283 | 3300013307 | Bacteria | 792 |
| 150 | Ga0157375_10033594 | 3300013308 | Bacteria | 4876 |
| 151 | Ga0157380_10926951 | 3300014326 | Unclassified | 899 |
| 152 | Ga0182008_10010891 | 3300014497 | Bacteria | 4851 |
| 153 | Ga0157379_10107876 | 3300014968 | Bacteria | 2500 |
| 154 | Ga0182006_1000023 | 3300015261 | Bacteria | 275031 |
| 155 | Ga0182006_1002148 | 3300015261 | Bacteria | 10942 |
| 156 | Ga0182006_1042983 | 3300015261 | Bacteria | 1768 |
| 157 | Ga0182006_1070123 | 3300015261 | Bacteria | 1302 |
| 158 | Ga0182006_1084355 | 3300015261 | Bacteria | 1154 |
| 159 | Ga0182007_10007368 | 3300015262 | Bacteria | 4620 |
| 160 | Ga0182007_10016147 | 3300015262 | Bacteria | 2763 |
| 161 | Ga0182007_10068862 | 3300015262 | Bacteria | 1159 |
| 162 | Ga0182007_10215338 | 3300015262 | Bacteria | 677 |
| 163 | Ga0182005_1000154 | 3300015265 | Bacteria | 48125 |
| 164 | Ga0182005_1001032 | 3300015265 | Bacteria | 11797 |
| 165 | Ga0163161_10005395 | 3300017792 | Bacteria | 8879 |
| 166 | Ga0197907_10354872 | 3300020069 | Bacteria | 707 |
| 167 | Ga0206356_10412366 | 3300020070 | Bacteria | 999 |
| 168 | Ga0206356_10770575 | 3300020070 | Bacteria | 671 |
| 169 | Ga0206351_10185510 | 3300020077 | Bacteria | 791 |
| 170 | Ga0213872_10000024 | 3300021361 | Bacteria | 155437 |
| 171 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 172 | Ga0209436_101397 | 3300025208 | Bacteria | 8519 |
| 173 | Ga0209436_109773 | 3300025208 | Bacteria | 1799 |
| 174 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 175 | Ga0209784_100036 | 3300025224 | Bacteria | 263689 |
| 176 | Ga0209566_100039 | 3300025225 | Bacteria | 303368 |
| 177 | Ga0209566_100044 | 3300025225 | Bacteria | 263689 |
| 178 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 179 | Ga0209674_100065 | 3300025226 | Bacteria | 263689 |
| 180 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 181 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 182 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 183 | Ga0209563_100063 | 3300025230 | Bacteria | 263689 |
| 184 | Ga0207427_101732 | 3300025231 | Bacteria | 7176 |
| 185 | Ga0209437_100082 | 3300025233 | Bacteria | 263689 |
| 186 | Ga0209437_100282 | 3300025233 | Bacteria | 74881 |
| 187 | Ga0209258_100421 | 3300025242 | Bacteria | 50393 |
| 188 | Ga0207425_1000009 | 3300025245 | Bacteria | 593135 |
| 189 | Ga0207425_1005726 | 3300025245 | Bacteria | 3502 |
| 190 | Ga0209646_1000125 | 3300025246 | Bacteria | 135847 |
| 191 | Ga0209646_1000149 | 3300025246 | Bacteria | 100004 |
| 192 | Ga0209026_1000409 | 3300025250 | Bacteria | 37382 |
| 193 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 194 | Ga0209677_100038 | 3300025253 | Bacteria | 263689 |
| 195 | Ga0209677_102916 | 3300025253 | Bacteria | 5986 |
| 196 | Ga0209148_1000760 | 3300025254 | Bacteria | 24607 |
| 197 | Ga0209759_1000182 | 3300025256 | Bacteria | 102836 |
| 198 | Ga0209129_1000198 | 3300025258 | Bacteria | 78327 |
| 199 | Ga0209233_1000109 | 3300025261 | Bacteria | 263689 |
| 200 | Ga0209565_1000082 | 3300025263 | Bacteria | 154452 |
| 201 | Ga0209565_1000493 | 3300025263 | Bacteria | 28875 |
| 202 | Ga0209565_1004404 | 3300025263 | Bacteria | 4290 |
| 203 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 204 | Ga0209455_1002933 | 3300025272 | Bacteria | 6286 |
| 205 | Ga0209673_1000381 | 3300025273 | Bacteria | 80068 |
| 206 | Ga0209673_1007566 | 3300025273 | Bacteria | 4975 |
| 207 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 208 | Ga0209130_1005385 | 3300025284 | Bacteria | 4457 |
| 209 | Ga0209675_1000166 | 3300025291 | Bacteria | 80138 |
| 210 | Ga0209675_1008144 | 3300025291 | Bacteria | 3901 |
| 211 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 212 | Ga0209564_1000042 | 3300025295 | Bacteria | 392805 |
| 213 | Ga0209564_1000959 | 3300025295 | Bacteria | 36638 |
| 214 | Ga0209564_1001111 | 3300025295 | Bacteria | 31685 |
| 215 | Ga0209564_1001315 | 3300025295 | Bacteria | 26597 |
| 216 | Ga0209564_1021895 | 3300025295 | Bacteria | 2279 |
| 217 | Ga0209758_1000054 | 3300025297 | Bacteria | 337655 |
| 218 | Ga0209758_1001194 | 3300025297 | Bacteria | 32812 |
| 219 | Ga0209050_1000086 | 3300025298 | Bacteria | 262009 |
| 220 | Ga0209050_1018392 | 3300025298 | Bacteria | 2717 |
| 221 | Ga0209256_1000380 | 3300025299 | Bacteria | 70995 |
| 222 | Ga0209256_1016020 | 3300025299 | Bacteria | 2582 |
| 223 | Ga0207426_1001363 | 3300025302 | Bacteria | 20709 |
| 224 | Ga0209051_1036875 | 3300025303 | Bacteria | 1800 |
| 225 | Ga0209257_1000087 | 3300025304 | Bacteria | 282503 |
| 226 | Ga0207656_10122449 | 3300025321 | Bacteria | 1212 |
| 227 | Ga0207655_1005987 | 3300025728 | Bacteria | 8137 |
| 228 | Ga0207655_1009515 | 3300025728 | Bacteria | 6023 |
| 229 | Ga0207655_1114016 | 3300025728 | Bacteria | 907 |
| 230 | Ga0207642_10164971 | 3300025899 | Unclassified | 1193 |
| 231 | Ga0207647_10462323 | 3300025904 | Bacteria | 710 |
| 232 | Ga0207705_10030888 | 3300025909 | Bacteria | 3823 |
| 233 | Ga0207654_10003822 | 3300025911 | Bacteria | 7591 |
| 234 | Ga0207695_10001573 | 3300025913 | Bacteria | 37174 |
| 235 | Ga0207695_10004969 | 3300025913 | Bacteria | 17900 |
| 236 | Ga0207695_10129096 | 3300025913 | Bacteria | 2486 |
| 237 | Ga0207695_10437674 | 3300025913 | Bacteria | 1191 |
| 238 | Ga0207671_10006537 | 3300025914 | Bacteria | 10360 |
| 239 | Ga0207671_10394232 | 3300025914 | Bacteria | 1101 |
| 240 | Ga0207671_10708886 | 3300025914 | Bacteria | 800 |
| 241 | Ga0207660_10121190 | 3300025917 | Bacteria | 1981 |
| 242 | Ga0207660_10268426 | 3300025917 | Bacteria | 1351 |
| 243 | Ga0207694_10000069 | 3300025924 | Bacteria | 124500 |
| 244 | Ga0207706_10368648 | 3300025933 | Bacteria | 1247 |
| 245 | Ga0207686_10135781 | 3300025934 | Bacteria | 1693 |
| 246 | Ga0207704_10308452 | 3300025938 | Bacteria | 1215 |
| 247 | Ga0207691_10413066 | 3300025940 | Bacteria | 1150 |
| 248 | Ga0207711_10517522 | 3300025941 | Bacteria | 1112 |
| 249 | Ga0207689_10290865 | 3300025942 | Bacteria | 1353 |
| 250 | Ga0207679_10019920 | 3300025945 | Bacteria | 4518 |
| 251 | Ga0207679_10228086 | 3300025945 | Bacteria | 1571 |
| 252 | Ga0207679_10230672 | 3300025945 | Bacteria | 1563 |
| 253 | Ga0207667_10000043 | 3300025949 | Bacteria | 261426 |
| 254 | Ga0207667_10096117 | 3300025949 | Bacteria | 3057 |
| 255 | Ga0207640_10587851 | 3300025981 | Bacteria | 941 |
| 256 | Ga0207658_10015319 | 3300025986 | Bacteria | 5260 |
| 257 | Ga0207677_10250407 | 3300026023 | Bacteria | 1438 |
| 258 | Ga0207702_10171311 | 3300026078 | Bacteria | 1991 |
| 259 | Ga0207702_10590972 | 3300026078 | Bacteria | 1089 |
| 260 | Ga0207683_10189622 | 3300026121 | Bacteria | 1866 |
| 261 | Ga0207698_10004855 | 3300026142 | Bacteria | 8238 |
| 262 | Ga0209281_1005985 | 3300027111 | Bacteria | 3247 |
| 263 | Ga0209281_1023398 | 3300027111 | Bacteria | 1172 |
| 264 | Ga0268266_10102650 | 3300028379 | Bacteria | 2523 |
| 265 | Ga0268264_10147278 | 3300028381 | Bacteria | 2107 |
| 266 | Ga0307515_10073112 | 3300028794 | Bacteria | 4614 |
| 267 | Ga0316181_1164203 | 3300030744 | Bacteria | 2209 |
| 268 | Ga0265332_10036377 | 3300031238 | Bacteria | 2137 |
| 269 | Ga0307509_10007371 | 3300031507 | Bacteria | 14396 |
| 270 | Ga0307516_10467000 | 3300031730 | Bacteria | 917 |
| 271 | Ga0307518_10006545 | 3300031838 | Bacteria | 8362 |
| 272 | Ga0307406_10453065 | 3300031901 | Bacteria | 1030 |
| 273 | Ga0307416_100000420 | 3300032002 | Bacteria | 21577 |
| 274 | Ga0307416_100941845 | 3300032002 | Bacteria | 965 |
| 275 | Ga0307414_10048175 | 3300032004 | Bacteria | 2938 |
| 276 | Ga0316596_1166449 | 3300033541 | Bacteria | 608 |
| 277 | Ga0373926_0082278 | 3300035083 | Unclassified | 1192 |
| 278 | Ga0373932_0063100 | 3300035112 | Bacteria | 1131 |
| 279 | Ga0373936_0338617 | 3300035113 | Bacteria | 684 |
| 280 | Ga0316574_0235938 | 3300035398 | Bacteria | 1170 |
| 281 | Ga0395899_0000028 | 3300037312 | Bacteria | 334378 |
| 282 | Ga0395900_0000349 | 3300037418 | Bacteria | 67520 |
| 283 | Ga0395900_0051074 | 3300037418 | Bacteria | 4259 |
| 284 | Ga0395898_0351504 | 3300037466 | Bacteria | 1405 |
| 285 | Ga0395898_0390193 | 3300037466 | Bacteria | 1327 |
| 286 | Ga0395898_0933006 | 3300037466 | Bacteria | 805 |
| 287 | Ga0395905_0346467 | 3300037471 | Bacteria | 1377 |
| 288 | Ga0395901_0000123 | 3300038443 | Bacteria | 99904 |
| 289 | Ga0400489_02039 | 3300039093 | Bacteria | 6950 |
| 290 | Ga0400489_25670 | 3300039093 | Archaea | 46327 |
| 291 | Ga0436361_0224368 | 3300039447 | Bacteria | 99317 |
| 292 | Ga0451787_231606 | 3300041441 | Bacteria | 730 |
| 293 | Ga0439448_0095177 | 3300042005 | Bacteria | 1008 |
| 294 | Ga0439448_0203634 | 3300042005 | Bacteria | 694 |
| 295 | Ga0439449_0021318 | 3300042007 | Bacteria | 2426 |
| 296 | Ga0439450_003650 | 3300042008 | Bacteria | 2566 |
| 297 | Ga0439455_0002195 | 3300042012 | Bacteria | 3492 |
| 298 | Ga0450919_005688 | 3300042121 | Bacteria | 1491 |
| 299 | Ga0450891_013123 | 3300042129 | Bacteria | 776 |
| 300 | Ga0450904_000892 | 3300042139 | Bacteria | 4836 |
| 301 | Ga0450918_000815 | 3300042531 | Bacteria | 6539 |
| 302 | Ga0451577_0000552 | 3300042876 | Bacteria | 61090 |
| 303 | Ga0451577_0004172 | 3300042876 | Bacteria | 15444 |
| 304 | Ga0451577_0019726 | 3300042876 | Bacteria | 6197 |
| 305 | Ga0451577_0068112 | 3300042876 | Bacteria | 3175 |
| 306 | Ga0451577_0649713 | 3300042876 | Unclassified | 956 |
| 307 | Ga0466972_0015994 | 3300044658 | Bacteria | 3750 |
| 308 | Ga0453683_0000281 | 3300044673 | Bacteria | 66440 |
| 309 | Ga0453683_0010844 | 3300044673 | Bacteria | 6031 |
| 310 | Ga0453683_0289311 | 3300044673 | Unclassified | 1047 |
| 311 | Ga0466965_0029343 | 3300044683 | Bacteria | 2676 |
| 312 | Ga0466965_0198819 | 3300044683 | Bacteria | 1062 |
| 313 | Ga0466965_0413048 | 3300044683 | Bacteria | 747 |
| 314 | Ga0466966_0082484 | 3300044684 | Bacteria | 2001 |
| 315 | Ga0466961_0031725 | 3300044693 | Bacteria | 3397 |
| 316 | Ga0466963_0024119 | 3300044694 | Bacteria | 3871 |
| 317 | Ga0466964_0000242 | 3300044706 | Bacteria | 15752 |
| 318 | Ga0466964_0001121 | 3300044706 | Bacteria | 9005 |
| 319 | Ga0453684_0000008 | 3300044712 | Bacteria | 1200052 |
| 320 | Ga0453684_0000009 | 3300044712 | Bacteria | 1139914 |
| 321 | Ga0453684_0000135 | 3300044712 | Bacteria | 324341 |
| 322 | Ga0453684_0000423 | 3300044712 | Bacteria | 172550 |
| 323 | Ga0453684_0001387 | 3300044712 | Bacteria | 70112 |
| 324 | Ga0453684_0004817 | 3300044712 | Bacteria | 27748 |
| 325 | Ga0453684_0028098 | 3300044712 | Bacteria | 8042 |
| 326 | Ga0453684_0187659 | 3300044712 | Bacteria | 2421 |
| 327 | Ga0453684_0685564 | 3300044712 | Bacteria | 1115 |
| 328 | Ga0466971_0033767 | 3300044719 | Bacteria | 2292 |
| 329 | Ga0466971_0037630 | 3300044719 | Bacteria | 2169 |
| 330 | Ga0466968_0003991 | 3300044735 | Bacteria | 5483 |
| 331 | Ga0466968_0125330 | 3300044735 | Bacteria | 1165 |
| 332 | Ga0466968_0221906 | 3300044735 | Bacteria | 890 |
| 333 | Ga0466970_0243609 | 3300044765 | Bacteria | 1006 |
| 334 | Ga0466957_0034706 | 3300044842 | Bacteria | 3025 |
| 335 | Ga0466959_0229032 | 3300045049 | Bacteria | 1287 |
| 336 | Ga0451576_0000062 | 3300045051 | Bacteria | 284262 |
| 337 | Ga0451576_0000154 | 3300045051 | Bacteria | 175525 |
| 338 | Ga0451576_0066973 | 3300045051 | Bacteria | 3738 |
| 339 | Ga0451576_0217332 | 3300045051 | Bacteria | 1996 |
| 340 | Ga0451576_0312378 | 3300045051 | Bacteria | 1644 |
| 341 | Ga0451576_0664722 | 3300045051 | Bacteria | 1095 |
| 342 | Ga0466958_0102810 | 3300045836 | Bacteria | 1778 |
| 343 | Ga0466958_0224251 | 3300045836 | Bacteria | 1199 |
| 344 | Ga0466967_0178373 | 3300045976 | Bacteria | 2002 |
| 345 | Ga0495617_000008 | 3300046452 | Bacteria | 340369 |
| 346 | Ga0495617_000020 | 3300046452 | Bacteria | 230257 |
| 347 | Ga0495617_000153 | 3300046452 | Bacteria | 44371 |
| 348 | Ga0495617_000232 | 3300046452 | Bacteria | 33751 |
| 349 | Ga0495617_008876 | 3300046452 | Bacteria | 3459 |
| 350 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 351 | Ga0495627_000490 | 3300046453 | Bacteria | 33194 |
| 352 | Ga0495627_018393 | 3300046453 | Bacteria | 2357 |
| 353 | Ga0495603_0002723 | 3300046455 | Bacteria | 10420 |
| 354 | Ga0495603_0081925 | 3300046455 | Bacteria | 1890 |
| 355 | Ga0495603_0515566 | 3300046455 | Bacteria | 685 |
| 356 | Ga0495590_0000039 | 3300046457 | Bacteria | 126693 |
| 357 | Ga0495590_0000047 | 3300046457 | Bacteria | 117260 |
| 358 | Ga0495590_0006258 | 3300046457 | Bacteria | 4658 |
| 359 | Ga0495590_0026792 | 3300046457 | Bacteria | 2022 |
| 360 | Ga0495591_000091 | 3300046458 | Bacteria | 101618 |
| 361 | Ga0495629_0012836 | 3300046459 | Bacteria | 6060 |
| 362 | Ga0495629_0035893 | 3300046459 | Bacteria | 3502 |
| 363 | Ga0495629_0041206 | 3300046459 | Bacteria | 3249 |
| 364 | Ga0495638_0000407 | 3300046460 | Bacteria | 52515 |
| 365 | Ga0495638_0004498 | 3300046460 | Bacteria | 10563 |
| 366 | Ga0495638_0030712 | 3300046460 | Bacteria | 3456 |
| 367 | Ga0495638_0081596 | 3300046460 | Bacteria | 1963 |
| 368 | Ga0495651_0048412 | 3300046462 | Bacteria | 3283 |
| 369 | Ga0495651_0052558 | 3300046462 | Bacteria | 3137 |
| 370 | Ga0495653_0000035 | 3300046463 | Bacteria | 129875 |
| 371 | Ga0495653_0023979 | 3300046463 | Bacteria | 4922 |
| 372 | Ga0495653_0024510 | 3300046463 | Bacteria | 4860 |
| 373 | Ga0495653_0034641 | 3300046463 | Bacteria | 3990 |
| 374 | Ga0495650_0000128 | 3300046471 | Bacteria | 177256 |
| 375 | Ga0495650_0000157 | 3300046471 | Bacteria | 155023 |
| 376 | Ga0495650_0000261 | 3300046471 | Bacteria | 101830 |
| 377 | Ga0495650_0000576 | 3300046471 | Bacteria | 51317 |
| 378 | Ga0495650_0000650 | 3300046471 | Bacteria | 45757 |
| 379 | Ga0495650_0000970 | 3300046471 | Bacteria | 32845 |
| 380 | Ga0495650_0007876 | 3300046471 | Bacteria | 6326 |
| 381 | Ga0495650_0026596 | 3300046471 | Bacteria | 2688 |
| 382 | Ga0495580_0153631 | 3300046472 | Bacteria | 1594 |
| 383 | Ga0495582_0003440 | 3300046473 | Bacteria | 8923 |
| 384 | Ga0495582_0007750 | 3300046473 | Bacteria | 5936 |
| 385 | Ga0495582_0196839 | 3300046473 | Bacteria | 1150 |
| 386 | Ga0495605_0000096 | 3300046474 | Bacteria | 111460 |
| 387 | Ga0495605_0000239 | 3300046474 | Bacteria | 65496 |
| 388 | Ga0495605_0005839 | 3300046474 | Bacteria | 7118 |
| 389 | Ga0495605_0037164 | 3300046474 | Bacteria | 2451 |
| 390 | Ga0495605_0042662 | 3300046474 | Bacteria | 2253 |
| 391 | Ga0495605_0046257 | 3300046474 | Bacteria | 2140 |
| 392 | Ga0495605_0049462 | 3300046474 | Bacteria | 2054 |
| 393 | Ga0495605_0050603 | 3300046474 | Bacteria | 2026 |
| 394 | Ga0495605_0066793 | 3300046474 | Bacteria | 1707 |
| 395 | Ga0495605_0146157 | 3300046474 | Bacteria | 1057 |
| 396 | Ga0495605_0157745 | 3300046474 | Bacteria | 1008 |
| 397 | Ga0495605_0223725 | 3300046474 | Bacteria | 812 |
| 398 | Ga0495584_0000008 | 3300046491 | Bacteria | 283067 |
| 399 | Ga0495584_0000085 | 3300046491 | Bacteria | 65081 |
| 400 | Ga0495584_0000661 | 3300046491 | Bacteria | 22906 |
| 401 | Ga0495584_0000702 | 3300046491 | Bacteria | 22129 |
| 402 | Ga0495584_0007961 | 3300046491 | Bacteria | 5507 |
| 403 | Ga0495584_0018702 | 3300046491 | Bacteria | 3522 |
| 404 | Ga0495584_0021242 | 3300046491 | Bacteria | 3297 |
| 405 | Ga0495584_0028932 | 3300046491 | Bacteria | 2808 |
| 406 | Ga0495584_0074750 | 3300046491 | Bacteria | 1703 |
| 407 | Ga0495585_0000175 | 3300046492 | Bacteria | 69100 |
| 408 | Ga0495585_0000410 | 3300046492 | Bacteria | 41579 |
| 409 | Ga0495585_0000558 | 3300046492 | Bacteria | 35206 |
| 410 | Ga0495585_0000739 | 3300046492 | Bacteria | 29079 |
| 411 | Ga0495585_0001146 | 3300046492 | Bacteria | 21646 |
| 412 | Ga0495585_0002326 | 3300046492 | Bacteria | 13689 |
| 413 | Ga0495585_0004740 | 3300046492 | Bacteria | 8753 |
| 414 | Ga0495585_0006142 | 3300046492 | Bacteria | 7495 |
| 415 | Ga0495585_0006680 | 3300046492 | Bacteria | 7127 |
| 416 | Ga0495585_0012864 | 3300046492 | Bacteria | 4918 |
| 417 | Ga0495585_0021010 | 3300046492 | Bacteria | 3749 |
| 418 | Ga0495585_0021598 | 3300046492 | Bacteria | 3695 |
| 419 | Ga0495585_0025762 | 3300046492 | Bacteria | 3365 |
| 420 | Ga0495585_0029234 | 3300046492 | Bacteria | 3138 |
| 421 | Ga0495585_0044924 | 3300046492 | Bacteria | 2466 |
| 422 | Ga0495585_0053045 | 3300046492 | Bacteria | 2244 |
| 423 | Ga0495585_0086112 | 3300046492 | Bacteria | 1697 |
| 424 | Ga0495585_0086515 | 3300046492 | Bacteria | 1693 |
| 425 | Ga0495585_0132041 | 3300046492 | Bacteria | 1313 |
| 426 | Ga0495585_0176218 | 3300046492 | Bacteria | 1101 |
| 427 | Ga0495594_0006303 | 3300046499 | Bacteria | 6102 |
| 428 | Ga0495594_0013500 | 3300046499 | Bacteria | 4267 |
| 429 | Ga0495594_0034800 | 3300046499 | Bacteria | 2741 |
| 430 | Ga0495594_0068173 | 3300046499 | Bacteria | 1975 |
| 431 | Ga0495594_0141171 | 3300046499 | Bacteria | 1366 |
| 432 | Ga0495596_0000646 | 3300046500 | Bacteria | 21880 |
| 433 | Ga0495596_0001510 | 3300046500 | Bacteria | 13308 |
| 434 | Ga0495596_0002243 | 3300046500 | Bacteria | 10519 |
| 435 | Ga0495596_0012883 | 3300046500 | Bacteria | 3565 |
| 436 | Ga0495596_0020544 | 3300046500 | Bacteria | 2702 |
| 437 | Ga0495596_0035281 | 3300046500 | Bacteria | 1983 |
| 438 | Ga0495596_0079897 | 3300046500 | Bacteria | 1269 |
| 439 | Ga0495607_0000554 | 3300046501 | Bacteria | 36542 |
| 440 | Ga0495607_0000669 | 3300046501 | Bacteria | 33225 |
| 441 | Ga0495607_0005056 | 3300046501 | Bacteria | 9559 |
| 442 | Ga0495607_0005864 | 3300046501 | Bacteria | 8727 |
| 443 | Ga0495607_0008086 | 3300046501 | Bacteria | 7219 |
| 444 | Ga0495607_0012656 | 3300046501 | Bacteria | 5559 |
| 445 | Ga0495607_0012665 | 3300046501 | Bacteria | 5557 |
| 446 | Ga0495607_0016637 | 3300046501 | Bacteria | 4743 |
| 447 | Ga0495607_0055955 | 3300046501 | Bacteria | 2266 |
| 448 | Ga0495607_0159208 | 3300046501 | Bacteria | 1148 |
| 449 | Ga0495607_0263473 | 3300046501 | Bacteria | 824 |
| 450 | Ga0495583_0000115 | 3300046506 | Bacteria | 135762 |
| 451 | Ga0495583_0000141 | 3300046506 | Bacteria | 121899 |
| 452 | Ga0495583_0000981 | 3300046506 | Bacteria | 32711 |
| 453 | Ga0495583_0001163 | 3300046506 | Bacteria | 28607 |
| 454 | Ga0495583_0001485 | 3300046506 | Bacteria | 23452 |
| 455 | Ga0495583_0030694 | 3300046506 | Bacteria | 2613 |
| 456 | Ga0495583_0037677 | 3300046506 | Bacteria | 2290 |
| 457 | Ga0495583_0068455 | 3300046506 | Bacteria | 1565 |
| 458 | Ga0495606_0000180 | 3300046507 | Bacteria | 111330 |
| 459 | Ga0495606_0000228 | 3300046507 | Bacteria | 99761 |
| 460 | Ga0495606_0000512 | 3300046507 | Bacteria | 63012 |
| 461 | Ga0495606_0000828 | 3300046507 | Bacteria | 46954 |
| 462 | Ga0495606_0000829 | 3300046507 | Bacteria | 46771 |
| 463 | Ga0495606_0000850 | 3300046507 | Bacteria | 45884 |
| 464 | Ga0495606_0001374 | 3300046507 | Bacteria | 32916 |
| 465 | Ga0495606_0002886 | 3300046507 | Bacteria | 19000 |
| 466 | Ga0495606_0003647 | 3300046507 | Bacteria | 16153 |
| 467 | Ga0495606_0006698 | 3300046507 | Bacteria | 10556 |
| 468 | Ga0495606_0030597 | 3300046507 | Bacteria | 3758 |
| 469 | Ga0495606_0042288 | 3300046507 | Bacteria | 3048 |
| 470 | Ga0495606_0050086 | 3300046507 | Bacteria | 2734 |
| 471 | Ga0495606_0084295 | 3300046507 | Bacteria | 1968 |
| 472 | Ga0495606_0180206 | 3300046507 | Bacteria | 1218 |
| 473 | Ga0495608_0033832 | 3300046511 | Bacteria | 3452 |
| 474 | Ga0495610_0003299 | 3300046512 | Bacteria | 12699 |
| 475 | Ga0495610_0003645 | 3300046512 | Bacteria | 11860 |
| 476 | Ga0495610_0009819 | 3300046512 | Bacteria | 5999 |
| 477 | Ga0495610_0017488 | 3300046512 | Bacteria | 4085 |
| 478 | Ga0495610_0085695 | 3300046512 | Bacteria | 1437 |
| 479 | Ga0495616_0000120 | 3300046513 | Bacteria | 68995 |
| 480 | Ga0495616_0000990 | 3300046513 | Bacteria | 20371 |
| 481 | Ga0495616_0001050 | 3300046513 | Bacteria | 19718 |
| 482 | Ga0495616_0004042 | 3300046513 | Bacteria | 9317 |
| 483 | Ga0495616_0004864 | 3300046513 | Bacteria | 8402 |
| 484 | Ga0495616_0008919 | 3300046513 | Bacteria | 5892 |
| 485 | Ga0495616_0017909 | 3300046513 | Bacteria | 3902 |
| 486 | Ga0495616_0029802 | 3300046513 | Bacteria | 2876 |
| 487 | Ga0495616_0044553 | 3300046513 | Bacteria | 2249 |
| 488 | Ga0495616_0049234 | 3300046513 | Bacteria | 2113 |
| 489 | Ga0495616_0053260 | 3300046513 | Bacteria | 2011 |
| 490 | Ga0495620_0011899 | 3300046515 | Bacteria | 4521 |
| 491 | Ga0495631_0000300 | 3300046518 | Bacteria | 34686 |
| 492 | Ga0495631_0003792 | 3300046518 | Bacteria | 8223 |
| 493 | Ga0495631_0005692 | 3300046518 | Bacteria | 6500 |
| 494 | Ga0495631_0008274 | 3300046518 | Bacteria | 5244 |
| 495 | Ga0495631_0024426 | 3300046518 | Bacteria | 2790 |
| 496 | Ga0495631_0039073 | 3300046518 | Bacteria | 2107 |
| 497 | Ga0495631_0063056 | 3300046518 | Bacteria | 1605 |
| 498 | Ga0495631_0070367 | 3300046518 | Bacteria | 1512 |
| 499 | Ga0495632_0000094 | 3300046519 | Bacteria | 90132 |
| 500 | Ga0495632_0000141 | 3300046519 | Bacteria | 73806 |
| 501 | Ga0495632_0000456 | 3300046519 | Bacteria | 38959 |
| 502 | Ga0495632_0000458 | 3300046519 | Bacteria | 38853 |
| 503 | Ga0495632_0002459 | 3300046519 | Bacteria | 14095 |
| 504 | Ga0495632_0030953 | 3300046519 | Bacteria | 2771 |
| 505 | Ga0495637_0000004 | 3300046520 | Bacteria | 589740 |
| 506 | Ga0495637_0000142 | 3300046520 | Bacteria | 54212 |
| 507 | Ga0495637_0001262 | 3300046520 | Bacteria | 15277 |
| 508 | Ga0495637_0012374 | 3300046520 | Bacteria | 4083 |
| 509 | Ga0495637_0054858 | 3300046520 | Bacteria | 1654 |
| 510 | Ga0495643_0000082 | 3300046522 | Bacteria | 159651 |
| 511 | Ga0495643_0000160 | 3300046522 | Bacteria | 107502 |
| 512 | Ga0495643_0000822 | 3300046522 | Bacteria | 33822 |
| 513 | Ga0495643_0005425 | 3300046522 | Bacteria | 8627 |
| 514 | Ga0495643_0044587 | 3300046522 | Bacteria | 2409 |
| 515 | Ga0495643_0093163 | 3300046522 | Bacteria | 1551 |
| 516 | Ga0495644_0002967 | 3300046523 | Bacteria | 6724 |
| 517 | Ga0495644_0007916 | 3300046523 | Bacteria | 4090 |
| 518 | Ga0495644_0009102 | 3300046523 | Bacteria | 3824 |
| 519 | Ga0495644_0015551 | 3300046523 | Bacteria | 2914 |
| 520 | Ga0495644_0027834 | 3300046523 | Bacteria | 2140 |
| 521 | Ga0495644_0041211 | 3300046523 | Bacteria | 1739 |
| 522 | Ga0495644_0042956 | 3300046523 | Bacteria | 1701 |
| 523 | Ga0495644_0083888 | 3300046523 | Bacteria | 1201 |
| 524 | Ga0495644_0101265 | 3300046523 | Bacteria | 1090 |
| 525 | Ga0495648_0000019 | 3300046524 | Bacteria | 276407 |
| 526 | Ga0495648_0000030 | 3300046524 | Bacteria | 216178 |
| 527 | Ga0495648_0001166 | 3300046524 | Bacteria | 26539 |
| 528 | Ga0495648_0007615 | 3300046524 | Bacteria | 8643 |
| 529 | Ga0495648_0007994 | 3300046524 | Bacteria | 8387 |
| 530 | Ga0495648_0016105 | 3300046524 | Bacteria | 5395 |
| 531 | Ga0495648_0162972 | 3300046524 | Bacteria | 1150 |
| 532 | Ga0495663_0015304 | 3300046525 | Bacteria | 2160 |
| 533 | Ga0495663_0022922 | 3300046525 | Bacteria | 1806 |
| 534 | Ga0495663_0033891 | 3300046525 | Bacteria | 1526 |
| 535 | Ga0495666_0002786 | 3300046526 | Bacteria | 8735 |
| 536 | Ga0495666_0008506 | 3300046526 | Bacteria | 5146 |
| 537 | Ga0495666_0056067 | 3300046526 | Bacteria | 1888 |
| 538 | Ga0495642_0000271 | 3300046528 | Bacteria | 29218 |
| 539 | Ga0495642_0000806 | 3300046528 | Bacteria | 15208 |
| 540 | Ga0495642_0010238 | 3300046528 | Bacteria | 3591 |
| 541 | Ga0495642_0020073 | 3300046528 | Bacteria | 2621 |
| 542 | Ga0495642_0031119 | 3300046528 | Bacteria | 2139 |
| 543 | Ga0495642_0033364 | 3300046528 | Bacteria | 2069 |
| 544 | Ga0495642_0034743 | 3300046528 | Bacteria | 2032 |
| 545 | Ga0495642_0040216 | 3300046528 | Bacteria | 1898 |
| 546 | Ga0495652_0132760 | 3300046529 | Bacteria | 1968 |
| 547 | Ga0495652_0177819 | 3300046529 | Bacteria | 1636 |
| 548 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 549 | Ga0495654_0011998 | 3300046530 | Bacteria | 4668 |
| 550 | Ga0495654_0035958 | 3300046530 | Bacteria | 2491 |
| 551 | Ga0495654_0052510 | 3300046530 | Bacteria | 1984 |
| 552 | Ga0495665_0048107 | 3300046531 | Bacteria | 2261 |
| 553 | Ga0495640_0258966 | 3300046533 | Bacteria | 1087 |
| 554 | Ga0495586_0011018 | 3300046535 | Bacteria | 4803 |
| 555 | Ga0495586_0151531 | 3300046535 | Bacteria | 1304 |
| 556 | Ga0495587_0007968 | 3300046536 | Bacteria | 6844 |
| 557 | Ga0495587_0123277 | 3300046536 | Bacteria | 1483 |
| 558 | Ga0495609_0000021 | 3300046538 | Bacteria | 281770 |
| 559 | Ga0495609_0000813 | 3300046538 | Bacteria | 23272 |
| 560 | Ga0495609_0002273 | 3300046538 | Bacteria | 11979 |
| 561 | Ga0495609_0006554 | 3300046538 | Bacteria | 5931 |
| 562 | Ga0495609_0006887 | 3300046538 | Bacteria | 5741 |
| 563 | Ga0495609_0040246 | 3300046538 | Bacteria | 2103 |
| 564 | Ga0495609_0055718 | 3300046538 | Bacteria | 1753 |
| 565 | Ga0495609_0165475 | 3300046538 | Bacteria | 935 |
| 566 | Ga0495597_0000364 | 3300046542 | Bacteria | 40081 |
| 567 | Ga0495597_0000544 | 3300046542 | Bacteria | 31260 |
| 568 | Ga0495597_0001183 | 3300046542 | Bacteria | 19572 |
| 569 | Ga0495597_0002172 | 3300046542 | Bacteria | 12873 |
| 570 | Ga0495597_0005834 | 3300046542 | Bacteria | 6441 |
| 571 | Ga0495597_0029465 | 3300046542 | Bacteria | 2505 |
| 572 | Ga0495597_0042859 | 3300046542 | Bacteria | 2016 |
| 573 | Ga0495597_0049952 | 3300046542 | Bacteria | 1847 |
| 574 | Ga0495645_0258422 | 3300046543 | Bacteria | 1154 |
| 575 | Ga0495622_0000034 | 3300046557 | Bacteria | 123671 |
| 576 | Ga0495622_0000071 | 3300046557 | Bacteria | 89071 |
| 577 | Ga0495622_0003694 | 3300046557 | Bacteria | 7166 |
| 578 | Ga0495622_0104216 | 3300046557 | Bacteria | 1299 |
| 579 | Ga0495622_0111315 | 3300046557 | Bacteria | 1253 |
| 580 | Ga0495622_0132976 | 3300046557 | Bacteria | 1132 |
| 581 | Ga0495633_0000077 | 3300046558 | Bacteria | 129051 |
| 582 | Ga0495633_0000100 | 3300046558 | Bacteria | 116284 |
| 583 | Ga0495633_0000764 | 3300046558 | Bacteria | 28938 |
| 584 | Ga0495633_0003422 | 3300046558 | Bacteria | 10566 |
| 585 | Ga0495633_0004475 | 3300046558 | Bacteria | 8872 |
| 586 | Ga0495633_0006936 | 3300046558 | Bacteria | 6622 |
| 587 | Ga0495633_0007251 | 3300046558 | Bacteria | 6416 |
| 588 | Ga0495633_0038051 | 3300046558 | Bacteria | 2299 |
| 589 | Ga0495633_0064906 | 3300046558 | Bacteria | 1706 |
| 590 | Ga0495633_0096202 | 3300046558 | Bacteria | 1375 |
| 591 | Ga0495633_0136701 | 3300046558 | Bacteria | 1133 |
| 592 | Ga0495633_0240248 | 3300046558 | Bacteria | 827 |
| 593 | Ga0495656_0000543 | 3300046615 | Bacteria | 12320 |
| 594 | Ga0495656_0105001 | 3300046615 | Bacteria | 1312 |
| 595 | Ga0495668_0000220 | 3300046616 | Bacteria | 83065 |
| 596 | Ga0495668_0000231 | 3300046616 | Bacteria | 79433 |
| 597 | Ga0495668_0000308 | 3300046616 | Bacteria | 67599 |
| 598 | Ga0495668_0000351 | 3300046616 | Bacteria | 61353 |
| 599 | Ga0495668_0000481 | 3300046616 | Bacteria | 50057 |
| 600 | Ga0495668_0000602 | 3300046616 | Bacteria | 43544 |
| 601 | Ga0495668_0011582 | 3300046616 | Bacteria | 5273 |
| 602 | Ga0495668_0029703 | 3300046616 | Bacteria | 3088 |
| 603 | Ga0495668_0056336 | 3300046616 | Bacteria | 2169 |
| 604 | Ga0495668_0060496 | 3300046616 | Bacteria | 2089 |
| 605 | Ga0495668_0063701 | 3300046616 | Bacteria | 2030 |
| 606 | Ga0495668_0070764 | 3300046616 | Bacteria | 1918 |
| 607 | Ga0495668_0407178 | 3300046616 | Bacteria | 747 |
| 608 | Ga0495634_0015257 | 3300046642 | Bacteria | 5524 |
| 609 | Ga0495611_0000503 | 3300046648 | Bacteria | 23232 |
| 610 | Ga0495611_0000909 | 3300046648 | Bacteria | 16011 |
| 611 | Ga0495611_0024824 | 3300046648 | Bacteria | 2608 |
| 612 | Ga0495611_0028021 | 3300046648 | Bacteria | 2466 |
| 613 | Ga0495611_0044133 | 3300046648 | Bacteria | 1993 |
| 614 | Ga0495611_0061386 | 3300046648 | Bacteria | 1708 |
| 615 | Ga0495611_0072854 | 3300046648 | Bacteria | 1572 |
| 616 | Ga0495611_0095972 | 3300046648 | Bacteria | 1372 |
| 617 | Ga0495611_0147461 | 3300046648 | Bacteria | 1098 |
| 618 | Ga0495625_0001111 | 3300046660 | Bacteria | 34888 |
| 619 | Ga0495625_0005276 | 3300046660 | Bacteria | 11861 |
| 620 | Ga0495625_0007701 | 3300046660 | Bacteria | 9322 |
| 621 | Ga0495625_0009390 | 3300046660 | Bacteria | 8188 |
| 622 | Ga0495625_0015253 | 3300046660 | Bacteria | 6094 |
| 623 | Ga0495625_0025935 | 3300046660 | Bacteria | 4435 |
| 624 | Ga0495625_0039518 | 3300046660 | Bacteria | 3444 |
| 625 | Ga0495625_0057433 | 3300046660 | Bacteria | 2767 |
| 626 | Ga0495625_0071775 | 3300046660 | Bacteria | 2429 |
| 627 | Ga0495625_0348237 | 3300046660 | Bacteria | 937 |
| 628 | Ga0495635_0004579 | 3300046663 | Bacteria | 9592 |
| 629 | Ga0495635_0059679 | 3300046663 | Bacteria | 2623 |
| 630 | Ga0495659_0000049 | 3300046664 | Bacteria | 52682 |
| 631 | Ga0495659_0003870 | 3300046664 | Bacteria | 4753 |
| 632 | Ga0495659_0330252 | 3300046664 | Bacteria | 649 |
| 633 | Ga0495661_0000091 | 3300046665 | Bacteria | 110008 |
| 634 | Ga0495661_0000798 | 3300046665 | Bacteria | 29791 |
| 635 | Ga0495661_0001154 | 3300046665 | Bacteria | 23052 |
| 636 | Ga0495661_0001188 | 3300046665 | Bacteria | 22605 |
| 637 | Ga0495661_0002171 | 3300046665 | Bacteria | 15317 |
| 638 | Ga0495661_0009106 | 3300046665 | Bacteria | 6826 |
| 639 | Ga0495661_0010564 | 3300046665 | Bacteria | 6295 |
| 640 | Ga0495661_0027413 | 3300046665 | Bacteria | 3657 |
| 641 | Ga0495661_0039244 | 3300046665 | Bacteria | 2943 |
| 642 | Ga0495661_0049487 | 3300046665 | Bacteria | 2548 |
| 643 | Ga0495661_0051007 | 3300046665 | Bacteria | 2500 |
| 644 | Ga0495661_0052095 | 3300046665 | Bacteria | 2467 |
| 645 | Ga0495661_0062056 | 3300046665 | Bacteria | 2215 |
| 646 | Ga0495661_0093967 | 3300046665 | Bacteria | 1700 |
| 647 | Ga0495661_0094514 | 3300046665 | Bacteria | 1694 |
| 648 | Ga0495661_0172683 | 3300046665 | Bacteria | 1151 |
| 649 | Ga0495588_0000083 | 3300046674 | Bacteria | 197018 |
| 650 | Ga0495588_0067699 | 3300046674 | Bacteria | 1853 |
| 651 | Ga0495588_0072611 | 3300046674 | Bacteria | 1790 |
| 652 | Ga0495588_0076325 | 3300046674 | Bacteria | 1746 |
| 653 | Ga0495588_0107813 | 3300046674 | Bacteria | 1466 |
| 654 | Ga0495599_0007003 | 3300046678 | Bacteria | 6820 |
| 655 | Ga0495623_0047900 | 3300046679 | Bacteria | 2712 |
| 656 | Ga0495623_0127018 | 3300046679 | Bacteria | 1530 |
| 657 | Ga0495646_0031412 | 3300046680 | Bacteria | 3309 |
| 658 | Ga0495646_0045634 | 3300046680 | Bacteria | 2676 |
| 659 | Ga0495669_0000085 | 3300046684 | Bacteria | 62167 |
| 660 | Ga0495669_0005609 | 3300046684 | Bacteria | 5237 |
| 661 | Ga0495669_0005856 | 3300046684 | Bacteria | 5125 |
| 662 | Ga0495669_0033307 | 3300046684 | Bacteria | 2267 |
| 663 | Ga0495669_0325855 | 3300046684 | Bacteria | 741 |
| 664 | Ga0495613_0021032 | 3300046689 | Bacteria | 4864 |
| 665 | Ga0495613_0056539 | 3300046689 | Bacteria | 2881 |
| 666 | Ga0495624_0081358 | 3300046690 | Bacteria | 2006 |
| 667 | Ga0495624_0279646 | 3300046690 | Bacteria | 1008 |
| 668 | Ga0495670_0001905 | 3300046691 | Bacteria | 10284 |
| 669 | Ga0495670_0002678 | 3300046691 | Bacteria | 8787 |
| 670 | Ga0495670_0022660 | 3300046691 | Bacteria | 3101 |
| 671 | Ga0495670_0030121 | 3300046691 | Bacteria | 2695 |
| 672 | Ga0495670_0199846 | 3300046691 | Bacteria | 1058 |
| 673 | Ga0495670_0229699 | 3300046691 | Bacteria | 986 |
| 674 | Ga0495671_0000005 | 3300046692 | Bacteria | 509397 |
| 675 | Ga0495671_0004998 | 3300046692 | Bacteria | 7814 |
| 676 | Ga0495671_0006502 | 3300046692 | Bacteria | 6747 |
| 677 | Ga0495671_0113779 | 3300046692 | Bacteria | 1321 |
| 678 | Ga0495671_0147805 | 3300046692 | Bacteria | 1144 |
| 679 | Ga0495649_0005036 | 3300046694 | Bacteria | 8496 |
| 680 | Ga0495649_0044619 | 3300046694 | Bacteria | 2420 |
| 681 | Ga0495589_0000012 | 3300046794 | Bacteria | 248641 |
| 682 | Ga0495589_0000022 | 3300046794 | Bacteria | 196021 |
| 683 | Ga0495589_0000420 | 3300046794 | Bacteria | 31618 |
| 684 | Ga0495589_0007242 | 3300046794 | Bacteria | 5811 |
| 685 | Ga0495589_0014059 | 3300046794 | Bacteria | 4126 |
| 686 | Ga0495589_0024520 | 3300046794 | Bacteria | 3066 |
| 687 | Ga0495589_0025436 | 3300046794 | Bacteria | 3004 |
| 688 | Ga0495589_0036258 | 3300046794 | Bacteria | 2472 |
| 689 | Ga0495589_0041314 | 3300046794 | Bacteria | 2301 |
| 690 | Ga0495589_0047066 | 3300046794 | Bacteria | 2138 |
| 691 | Ga0495589_0072549 | 3300046794 | Bacteria | 1681 |
| 692 | Ga0495600_0014283 | 3300046809 | Bacteria | 5002 |
| 693 | Ga0495600_0072949 | 3300046809 | Bacteria | 2241 |
| 694 | Ga0495600_0146470 | 3300046809 | Bacteria | 1530 |
| 695 | Ga0495660_0000192 | 3300046810 | Bacteria | 64339 |
| 696 | Ga0495660_0000203 | 3300046810 | Bacteria | 62255 |
| 697 | Ga0495660_0000514 | 3300046810 | Bacteria | 31796 |
| 698 | Ga0495660_0002004 | 3300046810 | Bacteria | 13240 |
| 699 | Ga0495660_0004348 | 3300046810 | Bacteria | 8578 |
| 700 | Ga0495660_0004732 | 3300046810 | Bacteria | 8217 |
| 701 | Ga0495660_0065327 | 3300046810 | Bacteria | 1942 |
| 702 | Ga0495660_0264645 | 3300046810 | Bacteria | 792 |
| 703 | Ga0495581_0006379 | 3300047315 | Bacteria | 6844 |
| 704 | Ga0495581_0007089 | 3300047315 | Bacteria | 6490 |
| 705 | Ga0495581_0010263 | 3300047315 | Bacteria | 5416 |
| 706 | Ga0495581_0030890 | 3300047315 | Bacteria | 3103 |
| 707 | Ga0495604_0007352 | 3300047317 | Bacteria | 8725 |
| 708 | Ga0495604_0063363 | 3300047317 | Bacteria | 2820 |
| 709 | Ga0495604_0090489 | 3300047317 | Bacteria | 2272 |
| 710 | Ga0495636_0000698 | 3300047318 | Bacteria | 12302 |
| 711 | Ga0495636_0011290 | 3300047318 | Bacteria | 3534 |
| 712 | Ga0495674_0010761 | 3300047319 | Bacteria | 8652 |
| 713 | Ga0495674_0511242 | 3300047319 | Bacteria | 960 |
| 714 | Ga0495672_0000026 | 3300047320 | Bacteria | 340319 |
| 715 | Ga0495672_0000081 | 3300047320 | Bacteria | 159863 |
| 716 | Ga0495672_0000523 | 3300047320 | Bacteria | 43871 |
| 717 | Ga0495672_0000861 | 3300047320 | Bacteria | 31983 |
| 718 | Ga0495672_0003857 | 3300047320 | Bacteria | 12610 |
| 719 | Ga0495672_0021590 | 3300047320 | Bacteria | 4197 |
| 720 | Ga0495672_0120382 | 3300047320 | Bacteria | 1396 |
| 721 | Ga0495676_0000214 | 3300047321 | Bacteria | 46256 |
| 722 | Ga0495676_0018769 | 3300047321 | Bacteria | 6096 |
| 723 | Ga0495676_0061566 | 3300047321 | Bacteria | 2935 |
| 724 | Ga0495683_0000035 | 3300047323 | Bacteria | 146394 |
| 725 | Ga0495683_0001320 | 3300047323 | Bacteria | 16652 |
| 726 | Ga0495683_0003892 | 3300047323 | Bacteria | 8588 |
| 727 | Ga0495683_0008357 | 3300047323 | Bacteria | 5545 |
| 728 | Ga0495683_0009395 | 3300047323 | Bacteria | 5210 |
| 729 | Ga0495683_0016977 | 3300047323 | Bacteria | 3775 |
| 730 | Ga0495683_0048269 | 3300047323 | Bacteria | 2134 |
| 731 | Ga0495683_0055938 | 3300047323 | Bacteria | 1963 |
| 732 | Ga0495683_0099472 | 3300047323 | Bacteria | 1400 |
| 733 | Ga0495687_000063 | 3300047443 | Bacteria | 169101 |
| 734 | Ga0495687_000151 | 3300047443 | Bacteria | 105607 |
| 735 | Ga0495687_000214 | 3300047443 | Bacteria | 83035 |
| 736 | Ga0495687_000284 | 3300047443 | Bacteria | 66578 |
| 737 | Ga0495687_000671 | 3300047443 | Bacteria | 38945 |
| 738 | Ga0495687_001571 | 3300047443 | Bacteria | 20729 |
| 739 | Ga0495687_008516 | 3300047443 | Bacteria | 5865 |
| 740 | Ga0495687_013290 | 3300047443 | Bacteria | 4308 |
| 741 | Ga0495675_0004016 | 3300047444 | Bacteria | 8915 |
| 742 | Ga0495675_0298116 | 3300047444 | Bacteria | 958 |
| 743 | Ga0495677_0000046 | 3300047445 | Bacteria | 73466 |
| 744 | Ga0495677_0007225 | 3300047445 | Bacteria | 4155 |
| 745 | Ga0495677_0012550 | 3300047445 | Bacteria | 3089 |
| 746 | Ga0495677_0018812 | 3300047445 | Bacteria | 2504 |
| 747 | Ga0495677_0026974 | 3300047445 | Bacteria | 2083 |
| 748 | Ga0495677_0032228 | 3300047445 | Bacteria | 1908 |
| 749 | Ga0495677_0117014 | 3300047445 | Bacteria | 1015 |
| 750 | Ga0495679_004467 | 3300047446 | Bacteria | 6437 |
| 751 | Ga0495679_024697 | 3300047446 | Bacteria | 2021 |
| 752 | Ga0495685_000084 | 3300047447 | Bacteria | 34726 |
| 753 | Ga0495685_024820 | 3300047447 | Bacteria | 2063 |
| 754 | Ga0495685_061356 | 3300047447 | Bacteria | 1266 |
| 755 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 756 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 757 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 758 | Ga0495681_0000334 | 3300047470 | Bacteria | 37186 |
| 759 | Ga0495681_0006521 | 3300047470 | Bacteria | 7654 |
| 760 | Ga0495681_0017619 | 3300047470 | Bacteria | 3958 |
| 761 | Ga0495681_0040387 | 3300047470 | Bacteria | 2272 |
| 762 | Ga0495681_0051071 | 3300047470 | Bacteria | 1946 |
| 763 | Ga0495681_0103795 | 3300047470 | Bacteria | 1239 |
| 764 | Ga0495681_0106784 | 3300047470 | Bacteria | 1217 |
| 765 | Ga0495681_0183436 | 3300047470 | Bacteria | 858 |
| 766 | Ga0495686_0000328 | 3300047472 | Bacteria | 78155 |
| 767 | Ga0495686_0000348 | 3300047472 | Bacteria | 75868 |
| 768 | Ga0495686_0005295 | 3300047472 | Bacteria | 10226 |
| 769 | Ga0495686_0010068 | 3300047472 | Bacteria | 6753 |
| 770 | Ga0495686_0014249 | 3300047472 | Bacteria | 5479 |
| 771 | Ga0495686_0064102 | 3300047472 | Bacteria | 2275 |
| 772 | Ga0495593_0006069 | 3300047673 | Bacteria | 7106 |
| 773 | Ga0495593_0009789 | 3300047673 | Bacteria | 5560 |
| 774 | Ga0495593_0192943 | 3300047673 | Bacteria | 1024 |
| 775 | Ga0495602_0013467 | 3300048088 | Bacteria | 8359 |
| 776 | Ga0495602_0176287 | 3300048088 | Bacteria | 1653 |
| 777 | Ga0495614_0005972 | 3300048089 | Bacteria | 5485 |
| 778 | Ga0495614_0016163 | 3300048089 | Bacteria | 3249 |
| 779 | Ga0495614_0344157 | 3300048089 | Bacteria | 694 |
| 780 | Ga0495615_0028374 | 3300048090 | Bacteria | 1321 |
| 781 | Ga0495615_0031127 | 3300048090 | Bacteria | 1278 |
| 782 | Ga0495626_0000021 | 3300048091 | Bacteria | 217213 |
| 783 | Ga0495626_0000122 | 3300048091 | Bacteria | 101672 |
| 784 | Ga0495626_0000793 | 3300048091 | Bacteria | 28672 |
| 785 | Ga0495626_0004338 | 3300048091 | Bacteria | 8746 |
| 786 | Ga0495626_0004682 | 3300048091 | Bacteria | 8300 |
| 787 | Ga0495626_0006948 | 3300048091 | Bacteria | 6372 |
| 788 | Ga0495626_0008530 | 3300048091 | Bacteria | 5608 |
| 789 | Ga0495626_0018719 | 3300048091 | Bacteria | 3470 |
| 790 | Ga0495626_0029526 | 3300048091 | Bacteria | 2653 |
| 791 | Ga0495626_0031152 | 3300048091 | Bacteria | 2568 |
| 792 | Ga0495626_0067550 | 3300048091 | Bacteria | 1614 |
| 793 | Ga0495626_0160534 | 3300048091 | Bacteria | 942 |
| 794 | Ga0496100_0062388 | 3300048903 | Bacteria | 2459 |
| 795 | Ga0496101_0068401 | 3300048904 | Bacteria | 2596 |
| 796 | Ga0496102_0067868 | 3300048905 | Bacteria | 3271 |
| 797 | Ga0496102_0167241 | 3300048905 | Bacteria | 2069 |
| 798 | Ga0496103_0002721 | 3300048906 | Bacteria | 11025 |
| 799 | Ga0496103_0619770 | 3300048906 | Bacteria | 688 |
| 800 | Ga0496105_0024042 | 3300048908 | Bacteria | 4949 |
| 801 | Ga0496106_0017162 | 3300048909 | Bacteria | 5360 |
| 802 | Ga0496110_0000085 | 3300048913 | Bacteria | 49001 |
| 803 | Ga0496114_0086866 | 3300048917 | Bacteria | 2651 |
| 804 | Ga0496115_0376539 | 3300048918 | Bacteria | 1155 |
| 805 | Ga0496116_0045416 | 3300048919 | Bacteria | 2974 |
| 806 | Ga0496118_0184939 | 3300048921 | Bacteria | 1254 |
| 807 | Ga0496121_0083984 | 3300048924 | Bacteria | 2512 |
| 808 | Ga0496121_0147384 | 3300048924 | Bacteria | 1737 |
| 809 | Ga0496122_0000432 | 3300048925 | Bacteria | 87744 |
| 810 | Ga0496122_0015889 | 3300048925 | Bacteria | 7167 |
| 811 | Ga0496122_0038127 | 3300048925 | Bacteria | 3856 |
| 812 | Ga0496122_0052986 | 3300048925 | Bacteria | 3063 |
| 813 | Ga0496123_0000916 | 3300048926 | Bacteria | 46316 |
| 814 | Ga0496123_0028342 | 3300048926 | Bacteria | 4148 |
| 815 | Ga0496124_0006076 | 3300048927 | Bacteria | 13280 |
| 816 | Ga0496124_0022498 | 3300048927 | Bacteria | 5776 |
| 817 | Ga0496124_0069882 | 3300048927 | Bacteria | 2914 |
| 818 | Ga0496124_0096751 | 3300048927 | Bacteria | 2398 |
| 819 | Ga0496124_0432291 | 3300048927 | Bacteria | 903 |
| 820 | Ga0496125_0004178 | 3300048928 | Bacteria | 16832 |
| 821 | Ga0496125_0176876 | 3300048928 | Bacteria | 1426 |
| 822 | Ga0496126_0010059 | 3300048929 | Bacteria | 9979 |
| 823 | Ga0496126_0794417 | 3300048929 | Bacteria | 727 |
| 824 | Ga0501309_045099 | 3300049129 | Bacteria | 682 |
| 825 | Ga0501341_04867 | 3300049131 | Bacteria | 792 |
| 826 | Ga0495678_000027 | 3300049459 | Bacteria | 222075 |
| 827 | Ga0495678_000074 | 3300049459 | Bacteria | 125964 |
| 828 | Ga0495678_000123 | 3300049459 | Bacteria | 90881 |
| 829 | Ga0495678_000629 | 3300049459 | Bacteria | 32776 |
| 830 | Ga0495678_000758 | 3300049459 | Bacteria | 29313 |
| 831 | Ga0495678_001070 | 3300049459 | Bacteria | 23187 |
| 832 | Ga0495678_035865 | 3300049459 | Bacteria | 2029 |
| 833 | Ga0495682_0005477 | 3300049460 | Bacteria | 5265 |
| 834 | Ga0495682_0005610 | 3300049460 | Bacteria | 5192 |
| 835 | Ga0495682_0010310 | 3300049460 | Bacteria | 3622 |
| 836 | Ga0495682_0016584 | 3300049460 | Bacteria | 2787 |
| 837 | Ga0501311_013327 | 3300049527 | Bacteria | 1036 |
| 838 | Ga0501312_052893 | 3300049528 | Bacteria | 688 |
| 839 | Ga0501323_038762 | 3300049539 | Bacteria | 692 |
| 840 | Ga0501324_007101 | 3300049540 | Bacteria | 959 |
| 841 | Ga0501334_11282 | 3300049550 | Bacteria | 653 |
| 842 | Ga0501031_0007119 | 3300049568 | Bacteria | 7300 |
| 843 | Ga0501033_0002135 | 3300049570 | Bacteria | 17104 |
| 844 | Ga0501033_0008896 | 3300049570 | Bacteria | 7756 |
| 845 | Ga0501034_0024529 | 3300049571 | Bacteria | 6135 |
| 846 | Ga0501034_0067425 | 3300049571 | Bacteria | 3591 |
| 847 | Ga0501036_0001322 | 3300049572 | Bacteria | 19039 |
| 848 | Ga0501037_0009574 | 3300049573 | Bacteria | 7111 |
| 849 | Ga0501037_0024614 | 3300049573 | Bacteria | 4451 |
| 850 | Ga0501039_0207665 | 3300049575 | Unclassified | 1540 |
| 851 | Ga0501043_0032180 | 3300049579 | Bacteria | 4122 |
| 852 | Ga0501046_0051025 | 3300049580 | Bacteria | 3266 |
| 853 | Ga0501046_0633988 | 3300049580 | Bacteria | 756 |
| 854 | Ga0501047_0400985 | 3300049581 | Bacteria | 1204 |
| 855 | Ga0501211_004776 | 3300049658 | Bacteria | 1371 |
| 856 | Ga0501222_002410 | 3300049662 | Bacteria | 2595 |
| 857 | Ga0501227_001086 | 3300049665 | Bacteria | 6052 |
| 858 | Ga0501238_009063 | 3300049671 | Bacteria | 1315 |
| 859 | Ga0501249_014752 | 3300049679 | Bacteria | 1667 |
| 860 | Ga0501252_003309 | 3300049682 | Bacteria | 1653 |
| 861 | Ga0501269_000005 | 3300049766 | Bacteria | 77832 |
| 862 | Ga0501279_006482 | 3300049775 | Bacteria | 1547 |
| 863 | Ga0501035_0023268 | 3300049822 | Bacteria | 5682 |
| 864 | Ga0501035_0030003 | 3300049822 | Bacteria | 4959 |
| 865 | Ga0501044_0002016 | 3300049823 | Bacteria | 23415 |
| 866 | Ga0501044_0123595 | 3300049823 | Bacteria | 2586 |
| 867 | nmdc:mga03683_134594_c1 | 3300050489 | Bacteria | 1108 |
| 868 | nmdc:mga03n38_66912_c1 | 3300050490 | Bacteria | 1652 |
| 869 | nmdc:mga00v17_281508_c1 | 3300050491 | Bacteria | 1080 |
| 870 | nmdc:mga0yw44_287106_c1 | 3300050492 | Bacteria | 1101 |
| 871 | nmdc:mga07m45_97008_c1 | 3300050496 | Bacteria | 1692 |
| 872 | nmdc:mga05p37_188254_c1 | 3300050507 | Bacteria | 2508 |
| 873 | nmdc:mga09592_124568_c1 | 3300050508 | Bacteria | 2215 |
| 874 | nmdc:mga0qj67_193520_c1 | 3300050509 | Bacteria | 1652 |
| 875 | nmdc:mga06r32_56772_c1 | 3300050510 | Bacteria | 3759 |
| 876 | nmdc:mga06r32_84819_c1 | 3300050510 | Bacteria | 3088 |
| 877 | nmdc:mga0n895_201011_c1 | 3300050512 | Unclassified | 2024 |
| 878 | nmdc:mga08x19_28573_c1 | 3300050514 | Bacteria | 3493 |
| 879 | nmdc:mga0a205_494475_c1 | 3300050515 | Unclassified | 1080 |
| 880 | nmdc:mga0a205_81512_c1 | 3300050515 | Bacteria | 3126 |
| 881 | Ga0500557_076903 | 3300053105 | Bacteria | 1099 |
| 882 | Ga0500594_0003538 | 3300053118 | Bacteria | 3437 |
| 883 | Ga0500618_000170 | 3300053125 | Bacteria | 54570 |
| 884 | Ga0500618_004583 | 3300053125 | Bacteria | 4365 |
| 885 | Ga0500618_016008 | 3300053125 | Bacteria | 1884 |
| 886 | Ga0500574_020631 | 3300053141 | Bacteria | 1657 |
| 887 | Ga0500586_000124 | 3300053145 | Bacteria | 13969 |
| 888 | Ga0500645_008848 | 3300053730 | Bacteria | 3410 |
| 889 | Ga0587084_023889 | 3300059477 | Bacteria | 937 |
| 890 | Ga0587093_011893 | 3300059478 | Bacteria | 1048 |
| 891 | Ga0587066_104437 | 3300059490 | Bacteria | 649 |
| 892 | Ga0587070_010639 | 3300059491 | Bacteria | 1360 |
| 893 | Ga0587077_020918 | 3300059493 | Bacteria | 1155 |
| 894 | Ga0587082_021985 | 3300059504 | Bacteria | 1046 |
| 895 | Ga0587085_007423 | 3300059506 | Bacteria | 1368 |
| 896 | Ga0587086_012158 | 3300059507 | Bacteria | 1066 |
| 897 | Ga0587088_010905 | 3300059508 | Bacteria | 1342 |
| 898 | Ga0587089_011846 | 3300059509 | Bacteria | 1106 |
| 899 | Ga0587090_013564 | 3300059510 | Bacteria | 1180 |
| 900 | Ga0587091_011376 | 3300059511 | Bacteria | 1387 |
| 901 | Ga0587092_030021 | 3300059512 | Bacteria | 894 |
| 902 | Ga0587094_033948 | 3300059513 | Bacteria | 804 |
| 903 | Ga0587074_02287 | 3300059602 | Bacteria | 639 |
| 904 | Ga0587106_027761 | 3300059605 | Bacteria | 888 |
| 905 | Ga0587125_006728 | 3300059607 | Bacteria | 1097 |
| 906 | Ga0587067_048078 | 3300059640 | Bacteria | 854 |
| 907 | Ga0587068_005455 | 3300059641 | Bacteria | 1736 |
| 908 | Ga0587069_003311 | 3300059642 | Bacteria | 1728 |
| 909 | Ga0587076_058884 | 3300059645 | Bacteria | 769 |
| 910 | Ga0587078_028399 | 3300059646 | Bacteria | 743 |
| 911 | Ga0587104_004414 | 3300059650 | Bacteria | 900 |
| 912 | Ga0587107_026556 | 3300059652 | Bacteria | 851 |
| 913 | Ga0587071_106542 | 3300060344 | Bacteria | 655 |
| 914 | Ga0587111_0053327 | 3300060346 | Bacteria | 899 |
| 915 | Ga0466962_0025287 | 3300061719 | Bacteria | 2851 |
| 916 | Ga0466962_0103455 | 3300061719 | Bacteria | 1368 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2690315857 | 2691332389 | 184 |
| 2 | iso_pu_bacteria | 2919534386 | 2919538269 | 184 |
| 3 | iso_pu_bacteria | 2919688452 | 2919692303 | 184 |
| 4 | 3300044706 | Ga0466964_0000242 | Ga0466964_0000242_8773_9330 | 185 |
| 5 | 3300039093 | Ga0400489_25670 | Ga0400489_25670_44176_44736 | 186 |
| 6 | 3300042876 | Ga0451577_0019726 | Ga0451577_0019726_4059_4625 | 186 |
| 7 | 3300044712 | Ga0453684_0685564 | Ga0453684_0685564_377_943 | 186 |
| 8 | 3300045051 | Ga0451576_0217332 | Ga0451576_0217332_634_1200 | 186 |
| 9 | 3300002704 | JGI25155J39150_1000750 | JGI25155J39150_10007502 | 187 |
| 10 | 3300002705 | JGI25156J39149_1000185 | JGI25156J39149_100018526 | 187 |
| 11 | 3300002737 | JGI25162J39368_1000038 | JGI25162J39368_100003849 | 187 |
| 12 | 3300002737 | JGI25162J39368_1004094 | JGI25162J39368_10040943 | 187 |
| 13 | 3300002738 | JGI25154J39366_1001907 | JGI25154J39366_10019072 | 187 |
| 14 | 3300002738 | JGI25154J39366_1004938 | JGI25154J39366_10049383 | 187 |
| 15 | 3300002741 | JGI25157J39369_1000284 | JGI25157J39369_100028413 | 187 |
| 16 | 3300002741 | JGI25157J39369_1000431 | JGI25157J39369_100043123 | 187 |
| 17 | 3300002772 | JGI25164J39214_1001783 | JGI25164J39214_10017832 | 187 |
| 18 | 3300002774 | JGI25150J39212_1001795 | JGI25150J39212_10017954 | 187 |
| 19 | 3300002774 | JGI25150J39212_1009348 | JGI25150J39212_10093482 | 187 |
| 20 | 3300002870 | Ga0006763J43179_101775 | Ga0006763J43179_1017751 | 187 |
| 21 | 3300002872 | Ga0006762J43184_105387 | Ga0006762J43184_1053871 | 187 |
| 22 | 3300002987 | JGI25159J45721_1004023 | JGI25159J45721_10040232 | 187 |
| 23 | 3300003158 | Ga0006760J45825_103373 | Ga0006760J45825_1033731 | 187 |
| 24 | 3300003160 | Ga0006779J45831_107007 | Ga0006779J45831_1070071 | 187 |
| 25 | 3300003161 | Ga0006765J45826_104465 | Ga0006765J45826_1044651 | 187 |
| 26 | 3300003162 | Ga0006778J45830_1018011 | Ga0006778J45830_10180111 | 187 |
| 27 | 3300003162 | Ga0006778J45830_1046945 | Ga0006778J45830_10469451 | 187 |
| 28 | 3300003163 | Ga0006759J45824_1004153 | Ga0006759J45824_10041531 | 187 |
| 29 | 3300003163 | Ga0006759J45824_1006275 | Ga0006759J45824_10062751 | 187 |
| 30 | 3300003214 | JGI25165J46597_1000045 | JGI25165J46597_100004549 | 187 |
| 31 | 3300003215 | JGI25153J46596_10021708 | JGI25153J46596_100217082 | 187 |
| 32 | 3300003288 | Ga0007428J48920_101749 | Ga0007428J48920_1017491 | 187 |
| 33 | 3300003300 | Ga0006758J48902_1014592 | Ga0006758J48902_10145921 | 187 |
| 34 | 3300003305 | Ga0006770J48903_1023283 | Ga0006770J48903_10232831 | 187 |
| 35 | 3300003305 | Ga0006770J48903_1026315 | Ga0006770J48903_10263151 | 187 |
| 36 | 3300003308 | Ga0006777J48905_1017375 | Ga0006777J48905_10173751 | 187 |
| 37 | 3300003308 | Ga0006777J48905_1020868 | Ga0006777J48905_10208681 | 187 |
| 38 | 3300003354 | JGI25160J50197_1008040 | JGI25160J50197_10080404 | 187 |
| 39 | 3300003374 | JGI25161J50226_1018534 | JGI25161J50226_10185341 | 187 |
| 40 | 3300003544 | Ga0007417J51691_1010995 | Ga0007417J51691_10109951 | 187 |
| 41 | 3300003568 | Ga0006781J51513_1014323 | Ga0006781J51513_10143231 | 187 |
| 42 | 3300003574 | Ga0007410J51695_1033499 | Ga0007410J51695_10334991 | 187 |
| 43 | 3300003577 | Ga0007416J51690_1088669 | Ga0007416J51690_10886691 | 187 |
| 44 | 3300003693 | Ga0032354_1015485 | Ga0032354_10154851 | 187 |
| 45 | 3300003735 | Ga0006780_1008912 | Ga0006780_10089121 | 187 |
| 46 | 3300003751 | Ga0055538_1000022 | Ga0055538_100002249 | 187 |
| 47 | 3300003751 | Ga0055538_1000085 | Ga0055538_100008551 | 187 |
| 48 | 3300003752 | Ga0055539_1000028 | Ga0055539_100002849 | 187 |
| 49 | 3300003752 | Ga0055539_1000126 | Ga0055539_100012651 | 187 |
| 50 | 3300003756 | Ga0055533_1000036 | Ga0055533_100003649 | 187 |
| 51 | 3300003756 | Ga0055533_1000133 | Ga0055533_100013351 | 187 |
| 52 | 3300003758 | Ga0055532_1000044 | Ga0055532_1000044173 | 187 |
| 53 | 3300003759 | Ga0055525_1000071 | Ga0055525_1000071115 | 187 |
| 54 | 3300003759 | Ga0055525_1000174 | Ga0055525_100017451 | 187 |
| 55 | 3300003761 | Ga0055535_1006579 | Ga0055535_10065792 | 187 |
| 56 | 3300003763 | Ga0055529_1000015 | Ga0055529_100001555 | 187 |
| 57 | 3300003771 | Ga0055526_1000007 | Ga0055526_100000757 | 187 |
| 58 | 3300003771 | Ga0055526_1000037 | Ga0055526_100003763 | 187 |
| 59 | 3300003771 | Ga0055526_1002076 | Ga0055526_100207615 | 187 |
| 60 | 3300003771 | Ga0055526_1003417 | Ga0055526_10034174 | 187 |
| 61 | 3300003773 | Ga0055537_1000236 | Ga0055537_10002364 | 187 |
| 62 | 3300003773 | Ga0055537_1020993 | Ga0055537_10209931 | 187 |
| 63 | 3300003775 | Ga0055524_1022725 | Ga0055524_10227252 | 187 |
| 64 | 3300003784 | Ga0055534_1000544 | Ga0055534_10005446 | 187 |
| 65 | 3300003784 | Ga0055534_1003580 | Ga0055534_10035804 | 187 |
| 66 | 3300003790 | Ga0055528_1000136 | Ga0055528_100013652 | 187 |
| 67 | 3300003790 | Ga0055528_1005295 | Ga0055528_10052956 | 187 |
| 68 | 3300003791 | Ga0055530_10004518 | Ga0055530_100045182 | 187 |
| 69 | 3300003791 | Ga0055530_10013523 | Ga0055530_100135232 | 187 |
| 70 | 3300003794 | Ga0055531_10079968 | Ga0055531_100799681 | 187 |
| 71 | 3300003841 | Ga0055541_1000037 | Ga0055541_1000037115 | 187 |
| 72 | 3300003841 | Ga0055541_1000085 | Ga0055541_100008526 | 187 |
| 73 | 3300005262 | Ga0065165_1001295 | Ga0065165_10012959 | 187 |
| 74 | 3300005334 | Ga0068869_100665581 | Ga0068869_1006655812 | 187 |
| 75 | 3300005336 | Ga0070680_100256296 | Ga0070680_1002562962 | 187 |
| 76 | 3300005336 | Ga0070680_100305247 | Ga0070680_1003052472 | 187 |
| 77 | 3300005338 | Ga0068868_101190880 | Ga0068868_1011908801 | 187 |
| 78 | 3300005344 | Ga0070661_100033803 | Ga0070661_1000338034 | 187 |
| 79 | 3300005344 | Ga0070661_100867724 | Ga0070661_1008677241 | 187 |
| 80 | 3300005347 | Ga0070668_100390125 | Ga0070668_1003901252 | 187 |
| 81 | 3300005364 | Ga0070673_101084580 | Ga0070673_1010845801 | 187 |
| 82 | 3300005367 | Ga0070667_100022285 | Ga0070667_1000222856 | 187 |
| 83 | 3300005455 | Ga0070663_100267735 | Ga0070663_1002677352 | 187 |
| 84 | 3300005457 | Ga0070662_100288682 | Ga0070662_1002886821 | 187 |
| 85 | 3300005458 | Ga0070681_10091379 | Ga0070681_100913792 | 187 |
| 86 | 3300005459 | Ga0068867_100136338 | Ga0068867_1001363381 | 187 |
| 87 | 3300005535 | Ga0070684_100482892 | Ga0070684_1004828921 | 187 |
| 88 | 3300005536 | Ga0070697_100056747 | Ga0070697_1000567476 | 187 |
| 89 | 3300005539 | Ga0068853_100278514 | Ga0068853_1002785141 | 187 |
| 90 | 3300005543 | Ga0070672_100451704 | Ga0070672_1004517042 | 187 |
| 91 | 3300005546 | Ga0070696_100033584 | Ga0070696_1000335843 | 187 |
| 92 | 3300005548 | Ga0070665_100137461 | Ga0070665_1001374612 | 187 |
| 93 | 3300005563 | Ga0068855_100005477 | Ga0068855_10000547716 | 187 |
| 94 | 3300005564 | Ga0070664_100024751 | Ga0070664_1000247515 | 187 |
| 95 | 3300005564 | Ga0070664_100218481 | Ga0070664_1002184812 | 187 |
| 96 | 3300005577 | Ga0068857_100145949 | Ga0068857_1001459492 | 187 |
| 97 | 3300005578 | Ga0068854_100008400 | Ga0068854_1000084002 | 187 |
| 98 | 3300005616 | Ga0068852_100000490 | Ga0068852_10000049012 | 187 |
| 99 | 3300005616 | Ga0068852_100435513 | Ga0068852_1004355132 | 187 |
| 100 | 3300005834 | Ga0068851_10042392 | Ga0068851_100423922 | 187 |
| 101 | 3300005834 | Ga0068851_10093296 | Ga0068851_100932962 | 187 |
| 102 | 3300005843 | Ga0068860_100299709 | Ga0068860_1002997091 | 187 |
| 103 | 3300006028 | Ga0070717_10118214 | Ga0070717_101182141 | 187 |
| 104 | 3300006051 | Ga0075364_10230283 | Ga0075364_102302832 | 187 |
| 105 | 3300006177 | Ga0075362_10001657 | Ga0075362_100016575 | 187 |
| 106 | 3300006177 | Ga0075362_10017122 | Ga0075362_100171223 | 187 |
| 107 | 3300006177 | Ga0075362_10083266 | Ga0075362_100832662 | 187 |
| 108 | 3300006178 | Ga0075367_10012290 | Ga0075367_100122902 | 187 |
| 109 | 3300006186 | Ga0075369_10146400 | Ga0075369_101464001 | 187 |
| 110 | 3300006195 | Ga0075366_10019177 | Ga0075366_100191773 | 187 |
| 111 | 3300006237 | Ga0097621_100176540 | Ga0097621_1001765402 | 187 |
| 112 | 3300006353 | Ga0075370_10053243 | Ga0075370_100532431 | 187 |
| 113 | 3300006353 | Ga0075370_10302848 | Ga0075370_103028481 | 187 |
| 114 | 3300006358 | Ga0068871_100076765 | Ga0068871_1000767652 | 187 |
| 115 | 3300006844 | Ga0075428_100172309 | Ga0075428_1001723091 | 187 |
| 116 | 3300006846 | Ga0075430_100127705 | Ga0075430_1001277052 | 187 |
| 117 | 3300006847 | Ga0075431_100300244 | Ga0075431_1003002443 | 187 |
| 118 | 3300006847 | Ga0075431_100450548 | Ga0075431_1004505481 | 187 |
| 119 | 3300006871 | Ga0075434_100055035 | Ga0075434_1000550356 | 187 |
| 120 | 3300006880 | Ga0075429_100219007 | Ga0075429_1002190073 | 187 |
| 121 | 3300006881 | Ga0068865_100233324 | Ga0068865_1002333242 | 187 |
| 122 | 3300006914 | Ga0075436_100173885 | Ga0075436_1001738852 | 187 |
| 123 | 3300006946 | Ga0079104_1017411 | Ga0079104_10174112 | 187 |
| 124 | 3300007076 | Ga0075435_100058404 | Ga0075435_1000584045 | 187 |
| 125 | 3300009036 | Ga0105244_10000395 | Ga0105244_100003958 | 187 |
| 126 | 3300009036 | Ga0105244_10001280 | Ga0105244_1000128018 | 187 |
| 127 | 3300009036 | Ga0105244_10038887 | Ga0105244_100388872 | 187 |
| 128 | 3300009036 | Ga0105244_10145558 | Ga0105244_101455581 | 187 |
| 129 | 3300009036 | Ga0105244_10147050 | Ga0105244_101470502 | 187 |
| 130 | 3300009093 | Ga0105240_10000523 | Ga0105240_100005232 | 187 |
| 131 | 3300009093 | Ga0105240_10212001 | Ga0105240_102120013 | 187 |
| 132 | 3300009093 | Ga0105240_10429712 | Ga0105240_104297122 | 187 |
| 133 | 3300009093 | Ga0105240_10449723 | Ga0105240_104497232 | 187 |
| 134 | 3300009094 | Ga0111539_10137917 | Ga0111539_101379172 | 187 |
| 135 | 3300009147 | Ga0114129_11106162 | Ga0114129_111061621 | 187 |
| 136 | 3300009148 | Ga0105243_10246701 | Ga0105243_102467012 | 187 |
| 137 | 3300009174 | Ga0105241_10011217 | Ga0105241_100112175 | 187 |
| 138 | 3300009174 | Ga0105241_10865216 | Ga0105241_108652161 | 187 |
| 139 | 3300009176 | Ga0105242_10093084 | Ga0105242_100930842 | 187 |
| 140 | 3300009176 | Ga0105242_10209812 | Ga0105242_102098122 | 187 |
| 141 | 3300009545 | Ga0105237_10041411 | Ga0105237_100414111 | 187 |
| 142 | 3300009545 | Ga0105237_10244489 | Ga0105237_102444892 | 187 |
| 143 | 3300009551 | Ga0105238_10000038 | Ga0105238_1000003852 | 187 |
| 144 | 3300009551 | Ga0105238_10097218 | Ga0105238_100972181 | 187 |
| 145 | 3300009551 | Ga0105238_10527717 | Ga0105238_105277172 | 187 |
| 146 | 3300009553 | Ga0105249_11364383 | Ga0105249_113643831 | 187 |
| 147 | 3300010375 | Ga0105239_10003685 | Ga0105239_1000368510 | 187 |
| 148 | 3300011119 | Ga0105246_10265641 | Ga0105246_102656411 | 187 |
| 149 | 3300013100 | Ga0157373_10131749 | Ga0157373_101317493 | 187 |
| 150 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001316 | 187 |
| 151 | 3300013105 | Ga0157369_10314670 | Ga0157369_103146702 | 187 |
| 152 | 3300013296 | Ga0157374_10122216 | Ga0157374_101222162 | 187 |
| 153 | 3300013297 | Ga0157378_10031139 | Ga0157378_100311392 | 187 |
| 154 | 3300013306 | Ga0163162_10128902 | Ga0163162_101289022 | 187 |
| 155 | 3300013307 | Ga0157372_10336753 | Ga0157372_103367532 | 187 |
| 156 | 3300013307 | Ga0157372_10856653 | Ga0157372_108566531 | 187 |
| 157 | 3300013307 | Ga0157372_11445283 | Ga0157372_114452831 | 187 |
| 158 | 3300013308 | Ga0157375_10033594 | Ga0157375_100335944 | 187 |
| 159 | 3300014326 | Ga0157380_10926951 | Ga0157380_109269512 | 187 |
| 160 | 3300014497 | Ga0182008_10010891 | Ga0182008_100108914 | 187 |
| 161 | 3300014968 | Ga0157379_10107876 | Ga0157379_101078762 | 187 |
| 162 | 3300015261 | Ga0182006_1000023 | Ga0182006_100002337 | 187 |
| 163 | 3300015261 | Ga0182006_1002148 | Ga0182006_100214812 | 187 |
| 164 | 3300015261 | Ga0182006_1042983 | Ga0182006_10429832 | 187 |
| 165 | 3300015261 | Ga0182006_1070123 | Ga0182006_10701233 | 187 |
| 166 | 3300015261 | Ga0182006_1084355 | Ga0182006_10843551 | 187 |
| 167 | 3300015262 | Ga0182007_10007368 | Ga0182007_100073682 | 187 |
| 168 | 3300015262 | Ga0182007_10016147 | Ga0182007_100161472 | 187 |
| 169 | 3300015262 | Ga0182007_10068862 | Ga0182007_100688622 | 187 |
| 170 | 3300015262 | Ga0182007_10215338 | Ga0182007_102153381 | 187 |
| 171 | 3300015265 | Ga0182005_1000154 | Ga0182005_10001547 | 187 |
| 172 | 3300015265 | Ga0182005_1001032 | Ga0182005_10010325 | 187 |
| 173 | 3300017792 | Ga0163161_10005395 | Ga0163161_100053955 | 187 |
| 174 | 3300020069 | Ga0197907_10354872 | Ga0197907_103548721 | 187 |
| 175 | 3300020070 | Ga0206356_10412366 | Ga0206356_104123661 | 187 |
| 176 | 3300020070 | Ga0206356_10770575 | Ga0206356_107705751 | 187 |
| 177 | 3300020077 | Ga0206351_10185510 | Ga0206351_101855101 | 187 |
| 178 | 3300021361 | Ga0213872_10000024 | Ga0213872_100000247 | 187 |
| 179 | 3300025206 | Ga0209435_100004 | Ga0209435_100004582 | 187 |
| 180 | 3300025208 | Ga0209436_101397 | Ga0209436_1013971 | 187 |
| 181 | 3300025208 | Ga0209436_109773 | Ga0209436_1097732 | 187 |
| 182 | 3300025224 | Ga0209784_100021 | Ga0209784_10002156 | 187 |
| 183 | 3300025224 | Ga0209784_100036 | Ga0209784_100036185 | 187 |
| 184 | 3300025225 | Ga0209566_100039 | Ga0209566_10003957 | 187 |
| 185 | 3300025225 | Ga0209566_100044 | Ga0209566_100044185 | 187 |
| 186 | 3300025226 | Ga0209674_100036 | Ga0209674_10003656 | 187 |
| 187 | 3300025226 | Ga0209674_100065 | Ga0209674_100065185 | 187 |
| 188 | 3300025229 | Ga0209147_100011 | Ga0209147_100011651 | 187 |
| 189 | 3300025230 | Ga0209563_100007 | Ga0209563_1000071099 | 187 |
| 190 | 3300025230 | Ga0209563_100040 | Ga0209563_10004056 | 187 |
| 191 | 3300025230 | Ga0209563_100063 | Ga0209563_100063185 | 187 |
| 192 | 3300025231 | Ga0207427_101732 | Ga0207427_1017326 | 187 |
| 193 | 3300025233 | Ga0209437_100082 | Ga0209437_100082185 | 187 |
| 194 | 3300025233 | Ga0209437_100282 | Ga0209437_10028267 | 187 |
| 195 | 3300025242 | Ga0209258_100421 | Ga0209258_10042126 | 187 |
| 196 | 3300025245 | Ga0207425_1000009 | Ga0207425_100000940 | 187 |
| 197 | 3300025245 | Ga0207425_1005726 | Ga0207425_10057262 | 187 |
| 198 | 3300025246 | Ga0209646_1000125 | Ga0209646_100012513 | 187 |
| 199 | 3300025246 | Ga0209646_1000149 | Ga0209646_100014924 | 187 |
| 200 | 3300025250 | Ga0209026_1000409 | Ga0209026_100040926 | 187 |
| 201 | 3300025253 | Ga0209677_100023 | Ga0209677_10002356 | 187 |
| 202 | 3300025253 | Ga0209677_100038 | Ga0209677_100038185 | 187 |
| 203 | 3300025253 | Ga0209677_102916 | Ga0209677_1029165 | 187 |
| 204 | 3300025254 | Ga0209148_1000760 | Ga0209148_100076011 | 187 |
| 205 | 3300025256 | Ga0209759_1000182 | Ga0209759_100018272 | 187 |
| 206 | 3300025258 | Ga0209129_1000198 | Ga0209129_100019839 | 187 |
| 207 | 3300025261 | Ga0209233_1000109 | Ga0209233_1000109185 | 187 |
| 208 | 3300025263 | Ga0209565_1000082 | Ga0209565_100008275 | 187 |
| 209 | 3300025263 | Ga0209565_1000493 | Ga0209565_10004934 | 187 |
| 210 | 3300025263 | Ga0209565_1004404 | Ga0209565_10044043 | 187 |
| 211 | 3300025272 | Ga0209455_1000031 | Ga0209455_100003156 | 187 |
| 212 | 3300025272 | Ga0209455_1002933 | Ga0209455_10029333 | 187 |
| 213 | 3300025273 | Ga0209673_1000381 | Ga0209673_100038161 | 187 |
| 214 | 3300025273 | Ga0209673_1007566 | Ga0209673_10075662 | 187 |
| 215 | 3300025284 | Ga0209130_1000016 | Ga0209130_1000016215 | 187 |
| 216 | 3300025284 | Ga0209130_1005385 | Ga0209130_10053854 | 187 |
| 217 | 3300025291 | Ga0209675_1000166 | Ga0209675_100016613 | 187 |
| 218 | 3300025291 | Ga0209675_1008144 | Ga0209675_10081442 | 187 |
| 219 | 3300025295 | Ga0209564_1000010 | Ga0209564_1000010620 | 187 |
| 220 | 3300025295 | Ga0209564_1000042 | Ga0209564_1000042196 | 187 |
| 221 | 3300025295 | Ga0209564_1000959 | Ga0209564_100095924 | 187 |
| 222 | 3300025295 | Ga0209564_1001111 | Ga0209564_100111113 | 187 |
| 223 | 3300025295 | Ga0209564_1001315 | Ga0209564_10013155 | 187 |
| 224 | 3300025295 | Ga0209564_1021895 | Ga0209564_10218951 | 187 |
| 225 | 3300025297 | Ga0209758_1000054 | Ga0209758_100005440 | 187 |
| 226 | 3300025297 | Ga0209758_1001194 | Ga0209758_10011946 | 187 |
| 227 | 3300025298 | Ga0209050_1000086 | Ga0209050_1000086111 | 187 |
| 228 | 3300025298 | Ga0209050_1018392 | Ga0209050_10183924 | 187 |
| 229 | 3300025299 | Ga0209256_1000380 | Ga0209256_100038061 | 187 |
| 230 | 3300025299 | Ga0209256_1016020 | Ga0209256_10160202 | 187 |
| 231 | 3300025302 | Ga0207426_1001363 | Ga0207426_100136319 | 187 |
| 232 | 3300025303 | Ga0209051_1036875 | Ga0209051_10368752 | 187 |
| 233 | 3300025304 | Ga0209257_1000087 | Ga0209257_1000087156 | 187 |
| 234 | 3300025321 | Ga0207656_10122449 | Ga0207656_101224491 | 187 |
| 235 | 3300025728 | Ga0207655_1005987 | Ga0207655_10059875 | 187 |
| 236 | 3300025728 | Ga0207655_1009515 | Ga0207655_10095155 | 187 |
| 237 | 3300025728 | Ga0207655_1114016 | Ga0207655_11140162 | 187 |
| 238 | 3300025899 | Ga0207642_10164971 | Ga0207642_101649712 | 187 |
| 239 | 3300025904 | Ga0207647_10462323 | Ga0207647_104623231 | 187 |
| 240 | 3300025909 | Ga0207705_10030888 | Ga0207705_100308882 | 187 |
| 241 | 3300025911 | Ga0207654_10003822 | Ga0207654_100038225 | 187 |
| 242 | 3300025913 | Ga0207695_10001573 | Ga0207695_1000157316 | 187 |
| 243 | 3300025913 | Ga0207695_10004969 | Ga0207695_1000496916 | 187 |
| 244 | 3300025913 | Ga0207695_10129096 | Ga0207695_101290962 | 187 |
| 245 | 3300025913 | Ga0207695_10437674 | Ga0207695_104376742 | 187 |
| 246 | 3300025914 | Ga0207671_10006537 | Ga0207671_100065373 | 187 |
| 247 | 3300025914 | Ga0207671_10394232 | Ga0207671_103942322 | 187 |
| 248 | 3300025914 | Ga0207671_10708886 | Ga0207671_107088861 | 187 |
| 249 | 3300025917 | Ga0207660_10121190 | Ga0207660_101211901 | 187 |
| 250 | 3300025917 | Ga0207660_10268426 | Ga0207660_102684262 | 187 |
| 251 | 3300025924 | Ga0207694_10000069 | Ga0207694_1000006955 | 187 |
| 252 | 3300025933 | Ga0207706_10368648 | Ga0207706_103686481 | 187 |
| 253 | 3300025934 | Ga0207686_10135781 | Ga0207686_101357811 | 187 |
| 254 | 3300025938 | Ga0207704_10308452 | Ga0207704_103084522 | 187 |
| 255 | 3300025940 | Ga0207691_10413066 | Ga0207691_104130662 | 187 |
| 256 | 3300025941 | Ga0207711_10517522 | Ga0207711_105175221 | 187 |
| 257 | 3300025942 | Ga0207689_10290865 | Ga0207689_102908652 | 187 |
| 258 | 3300025945 | Ga0207679_10019920 | Ga0207679_100199204 | 187 |
| 259 | 3300025945 | Ga0207679_10228086 | Ga0207679_102280862 | 187 |
| 260 | 3300025945 | Ga0207679_10230672 | Ga0207679_102306721 | 187 |
| 261 | 3300025949 | Ga0207667_10000043 | Ga0207667_10000043248 | 187 |
| 262 | 3300025949 | Ga0207667_10096117 | Ga0207667_100961172 | 187 |
| 263 | 3300025981 | Ga0207640_10587851 | Ga0207640_105878512 | 187 |
| 264 | 3300025986 | Ga0207658_10015319 | Ga0207658_100153191 | 187 |
| 265 | 3300026023 | Ga0207677_10250407 | Ga0207677_102504072 | 187 |
| 266 | 3300026078 | Ga0207702_10171311 | Ga0207702_101713112 | 187 |
| 267 | 3300026078 | Ga0207702_10590972 | Ga0207702_105909721 | 187 |
| 268 | 3300026121 | Ga0207683_10189622 | Ga0207683_101896222 | 187 |
| 269 | 3300026142 | Ga0207698_10004855 | Ga0207698_100048552 | 187 |
| 270 | 3300027111 | Ga0209281_1005985 | Ga0209281_10059855 | 187 |
| 271 | 3300027111 | Ga0209281_1023398 | Ga0209281_10233982 | 187 |
| 272 | 3300028379 | Ga0268266_10102650 | Ga0268266_101026502 | 187 |
| 273 | 3300028381 | Ga0268264_10147278 | Ga0268264_101472782 | 187 |
| 274 | 3300028794 | Ga0307515_10073112 | Ga0307515_100731123 | 187 |
| 275 | 3300030744 | Ga0316181_1164203 | Ga0316181_11642032 | 187 |
| 276 | 3300031238 | Ga0265332_10036377 | Ga0265332_100363773 | 187 |
| 277 | 3300031507 | Ga0307509_10007371 | Ga0307509_1000737114 | 187 |
| 278 | 3300031730 | Ga0307516_10467000 | Ga0307516_104670002 | 187 |
| 279 | 3300031838 | Ga0307518_10006545 | Ga0307518_100065453 | 187 |
| 280 | 3300031901 | Ga0307406_10453065 | Ga0307406_104530651 | 187 |
| 281 | 3300032002 | Ga0307416_100000420 | Ga0307416_10000042013 | 187 |
| 282 | 3300032002 | Ga0307416_100941845 | Ga0307416_1009418451 | 187 |
| 283 | 3300032004 | Ga0307414_10048175 | Ga0307414_100481754 | 187 |
| 284 | 3300033541 | Ga0316596_1166449 | Ga0316596_11664491 | 187 |
| 285 | 3300035083 | Ga0373926_0082278 | Ga0373926_0082278_63_689 | 187 |
| 286 | 3300035112 | Ga0373932_0063100 | Ga0373932_0063100_464_1027 | 187 |
| 287 | 3300035113 | Ga0373936_0338617 | Ga0373936_0338617_99_662 | 187 |
| 288 | 3300035398 | Ga0316574_0235938 | Ga0316574_0235938_371_934 | 187 |
| 289 | 3300037312 | Ga0395899_0000028 | Ga0395899_0000028_85293_85856 | 187 |
| 290 | 3300037418 | Ga0395900_0000349 | Ga0395900_0000349_10364_10927 | 187 |
| 291 | 3300037418 | Ga0395900_0051074 | Ga0395900_0051074_783_1346 | 187 |
| 292 | 3300037466 | Ga0395898_0351504 | Ga0395898_0351504_826_1389 | 187 |
| 293 | 3300037466 | Ga0395898_0390193 | Ga0395898_0390193_709_1272 | 187 |
| 294 | 3300037466 | Ga0395898_0933006 | Ga0395898_0933006_21_584 | 187 |
| 295 | 3300037471 | Ga0395905_0346467 | Ga0395905_0346467_315_878 | 187 |
| 296 | 3300038443 | Ga0395901_0000123 | Ga0395901_0000123_42747_43310 | 187 |
| 297 | 3300039093 | Ga0400489_02039 | Ga0400489_02039_646_1233 | 187 |
| 298 | 3300039447 | Ga0436361_0224368 | Ga0436361_0224368_94311_94874 | 187 |
| 299 | 3300041441 | Ga0451787_231606 | Ga0451787_231606_153_716 | 187 |
| 300 | 3300042005 | Ga0439448_0095177 | Ga0439448_0095177_391_954 | 187 |
| 301 | 3300042005 | Ga0439448_0203634 | Ga0439448_0203634_83_646 | 187 |
| 302 | 3300042007 | Ga0439449_0021318 | Ga0439449_0021318_1746_2309 | 187 |
| 303 | 3300042008 | Ga0439450_003650 | Ga0439450_003650_10_573 | 187 |
| 304 | 3300042012 | Ga0439455_0002195 | Ga0439455_0002195_368_931 | 187 |
| 305 | 3300042121 | Ga0450919_005688 | Ga0450919_005688_675_1238 | 187 |
| 306 | 3300042129 | Ga0450891_013123 | Ga0450891_013123_133_696 | 187 |
| 307 | 3300042139 | Ga0450904_000892 | Ga0450904_000892_2459_3022 | 187 |
| 308 | 3300042531 | Ga0450918_000815 | Ga0450918_000815_545_1108 | 187 |
| 309 | 3300042876 | Ga0451577_0000552 | Ga0451577_0000552_43088_43651 | 187 |
| 310 | 3300042876 | Ga0451577_0004172 | Ga0451577_0004172_4245_4808 | 187 |
| 311 | 3300042876 | Ga0451577_0068112 | Ga0451577_0068112_1468_2127 | 187 |
| 312 | 3300042876 | Ga0451577_0649713 | Ga0451577_0649713_225_788 | 187 |
| 313 | 3300044658 | Ga0466972_0015994 | Ga0466972_0015994_505_1068 | 187 |
| 314 | 3300044673 | Ga0453683_0000281 | Ga0453683_0000281_3446_4009 | 187 |
| 315 | 3300044673 | Ga0453683_0010844 | Ga0453683_0010844_4877_5440 | 187 |
| 316 | 3300044673 | Ga0453683_0289311 | Ga0453683_0289311_172_735 | 187 |
| 317 | 3300044683 | Ga0466965_0029343 | Ga0466965_0029343_1609_2172 | 187 |
| 318 | 3300044683 | Ga0466965_0198819 | Ga0466965_0198819_463_1026 | 187 |
| 319 | 3300044683 | Ga0466965_0413048 | Ga0466965_0413048_147_710 | 187 |
| 320 | 3300044684 | Ga0466966_0082484 | Ga0466966_0082484_178_741 | 187 |
| 321 | 3300044693 | Ga0466961_0031725 | Ga0466961_0031725_1397_1960 | 187 |
| 322 | 3300044694 | Ga0466963_0024119 | Ga0466963_0024119_396_965 | 187 |
| 323 | 3300044706 | Ga0466964_0001121 | Ga0466964_0001121_6161_6724 | 187 |
| 324 | 3300044712 | Ga0453684_0000008 | Ga0453684_0000008_1043444_1044007 | 187 |
| 325 | 3300044712 | Ga0453684_0000009 | Ga0453684_0000009_977301_977864 | 187 |
| 326 | 3300044712 | Ga0453684_0000135 | Ga0453684_0000135_162127_162690 | 187 |
| 327 | 3300044712 | Ga0453684_0000423 | Ga0453684_0000423_38253_38819 | 187 |
| 328 | 3300044712 | Ga0453684_0001387 | Ga0453684_0001387_1278_1844 | 187 |
| 329 | 3300044712 | Ga0453684_0004817 | Ga0453684_0004817_11386_11949 | 187 |
| 330 | 3300044712 | Ga0453684_0028098 | Ga0453684_0028098_6801_7367 | 187 |
| 331 | 3300044712 | Ga0453684_0187659 | Ga0453684_0187659_191_757 | 187 |
| 332 | 3300044719 | Ga0466971_0033767 | Ga0466971_0033767_265_828 | 187 |
| 333 | 3300044719 | Ga0466971_0037630 | Ga0466971_0037630_1488_2051 | 187 |
| 334 | 3300044735 | Ga0466968_0003991 | Ga0466968_0003991_2769_3332 | 187 |
| 335 | 3300044735 | Ga0466968_0125330 | Ga0466968_0125330_341_904 | 187 |
| 336 | 3300044735 | Ga0466968_0221906 | Ga0466968_0221906_106_669 | 187 |
| 337 | 3300044765 | Ga0466970_0243609 | Ga0466970_0243609_122_685 | 187 |
| 338 | 3300044842 | Ga0466957_0034706 | Ga0466957_0034706_1075_1638 | 187 |
| 339 | 3300045049 | Ga0466959_0229032 | Ga0466959_0229032_458_1027 | 187 |
| 340 | 3300045051 | Ga0451576_0000062 | Ga0451576_0000062_142041_142700 | 187 |
| 341 | 3300045051 | Ga0451576_0000154 | Ga0451576_0000154_130446_131009 | 187 |
| 342 | 3300045051 | Ga0451576_0066973 | Ga0451576_0066973_1069_1632 | 187 |
| 343 | 3300045051 | Ga0451576_0312378 | Ga0451576_0312378_656_1219 | 187 |
| 344 | 3300045051 | Ga0451576_0664722 | Ga0451576_0664722_473_1039 | 187 |
| 345 | 3300045836 | Ga0466958_0102810 | Ga0466958_0102810_167_736 | 187 |
| 346 | 3300045836 | Ga0466958_0224251 | Ga0466958_0224251_380_943 | 187 |
| 347 | 3300045976 | Ga0466967_0178373 | Ga0466967_0178373_1407_1970 | 187 |
| 348 | 3300046452 | Ga0495617_000008 | Ga0495617_000008_275849_276412 | 187 |
| 349 | 3300046452 | Ga0495617_000020 | Ga0495617_000020_31557_32120 | 187 |
| 350 | 3300046452 | Ga0495617_000153 | Ga0495617_000153_13758_14381 | 187 |
| 351 | 3300046452 | Ga0495617_000232 | Ga0495617_000232_29196_29759 | 187 |
| 352 | 3300046452 | Ga0495617_008876 | Ga0495617_008876_2007_2696 | 187 |
| 353 | 3300046453 | Ga0495627_000004 | Ga0495627_000004_120880_121443 | 187 |
| 354 | 3300046453 | Ga0495627_000490 | Ga0495627_000490_12440_13003 | 187 |
| 355 | 3300046453 | Ga0495627_018393 | Ga0495627_018393_1633_2196 | 187 |
| 356 | 3300046455 | Ga0495603_0002723 | Ga0495603_0002723_5528_6091 | 187 |
| 357 | 3300046455 | Ga0495603_0081925 | Ga0495603_0081925_922_1485 | 187 |
| 358 | 3300046455 | Ga0495603_0515566 | Ga0495603_0515566_101_664 | 187 |
| 359 | 3300046457 | Ga0495590_0000039 | Ga0495590_0000039_30171_30734 | 187 |
| 360 | 3300046457 | Ga0495590_0000047 | Ga0495590_0000047_48302_48865 | 187 |
| 361 | 3300046457 | Ga0495590_0006258 | Ga0495590_0006258_327_890 | 187 |
| 362 | 3300046457 | Ga0495590_0026792 | Ga0495590_0026792_1432_1995 | 187 |
| 363 | 3300046458 | Ga0495591_000091 | Ga0495591_000091_18506_19069 | 187 |
| 364 | 3300046459 | Ga0495629_0012836 | Ga0495629_0012836_1925_2488 | 187 |
| 365 | 3300046459 | Ga0495629_0035893 | Ga0495629_0035893_1488_2051 | 187 |
| 366 | 3300046459 | Ga0495629_0041206 | Ga0495629_0041206_494_1057 | 187 |
| 367 | 3300046460 | Ga0495638_0000407 | Ga0495638_0000407_1104_1667 | 187 |
| 368 | 3300046460 | Ga0495638_0004498 | Ga0495638_0004498_4325_4888 | 187 |
| 369 | 3300046460 | Ga0495638_0030712 | Ga0495638_0030712_1719_2408 | 187 |
| 370 | 3300046460 | Ga0495638_0081596 | Ga0495638_0081596_870_1433 | 187 |
| 371 | 3300046462 | Ga0495651_0048412 | Ga0495651_0048412_2677_3240 | 187 |
| 372 | 3300046462 | Ga0495651_0052558 | Ga0495651_0052558_676_1239 | 187 |
| 373 | 3300046463 | Ga0495653_0000035 | Ga0495653_0000035_21095_21688 | 187 |
| 374 | 3300046463 | Ga0495653_0023979 | Ga0495653_0023979_1748_2311 | 187 |
| 375 | 3300046463 | Ga0495653_0024510 | Ga0495653_0024510_1148_1711 | 187 |
| 376 | 3300046463 | Ga0495653_0034641 | Ga0495653_0034641_2703_3266 | 187 |
| 377 | 3300046471 | Ga0495650_0000128 | Ga0495650_0000128_21044_21607 | 187 |
| 378 | 3300046471 | Ga0495650_0000157 | Ga0495650_0000157_107385_107948 | 187 |
| 379 | 3300046471 | Ga0495650_0000261 | Ga0495650_0000261_45486_46049 | 187 |
| 380 | 3300046471 | Ga0495650_0000576 | Ga0495650_0000576_25173_25736 | 187 |
| 381 | 3300046471 | Ga0495650_0000650 | Ga0495650_0000650_2476_3039 | 187 |
| 382 | 3300046471 | Ga0495650_0000970 | Ga0495650_0000970_4534_5097 | 187 |
| 383 | 3300046471 | Ga0495650_0007876 | Ga0495650_0007876_3369_3932 | 187 |
| 384 | 3300046471 | Ga0495650_0026596 | Ga0495650_0026596_2007_2570 | 187 |
| 385 | 3300046472 | Ga0495580_0153631 | Ga0495580_0153631_417_980 | 187 |
| 386 | 3300046473 | Ga0495582_0003440 | Ga0495582_0003440_794_1357 | 187 |
| 387 | 3300046473 | Ga0495582_0007750 | Ga0495582_0007750_5351_5914 | 187 |
| 388 | 3300046473 | Ga0495582_0196839 | Ga0495582_0196839_233_796 | 187 |
| 389 | 3300046474 | Ga0495605_0000096 | Ga0495605_0000096_63958_64521 | 187 |
| 390 | 3300046474 | Ga0495605_0000239 | Ga0495605_0000239_30280_30843 | 187 |
| 391 | 3300046474 | Ga0495605_0005839 | Ga0495605_0005839_396_959 | 187 |
| 392 | 3300046474 | Ga0495605_0037164 | Ga0495605_0037164_486_1049 | 187 |
| 393 | 3300046474 | Ga0495605_0042662 | Ga0495605_0042662_1267_1830 | 187 |
| 394 | 3300046474 | Ga0495605_0046257 | Ga0495605_0046257_809_1372 | 187 |
| 395 | 3300046474 | Ga0495605_0049462 | Ga0495605_0049462_705_1394 | 187 |
| 396 | 3300046474 | Ga0495605_0050603 | Ga0495605_0050603_1235_1798 | 187 |
| 397 | 3300046474 | Ga0495605_0066793 | Ga0495605_0066793_481_1044 | 187 |
| 398 | 3300046474 | Ga0495605_0146157 | Ga0495605_0146157_231_794 | 187 |
| 399 | 3300046474 | Ga0495605_0157745 | Ga0495605_0157745_205_768 | 187 |
| 400 | 3300046474 | Ga0495605_0223725 | Ga0495605_0223725_56_619 | 187 |
| 401 | 3300046491 | Ga0495584_0000008 | Ga0495584_0000008_112765_113328 | 187 |
| 402 | 3300046491 | Ga0495584_0000085 | Ga0495584_0000085_49917_50480 | 187 |
| 403 | 3300046491 | Ga0495584_0000661 | Ga0495584_0000661_15954_16643 | 187 |
| 404 | 3300046491 | Ga0495584_0000702 | Ga0495584_0000702_19096_19659 | 187 |
| 405 | 3300046491 | Ga0495584_0007961 | Ga0495584_0007961_1412_1975 | 187 |
| 406 | 3300046491 | Ga0495584_0018702 | Ga0495584_0018702_1893_2456 | 187 |
| 407 | 3300046491 | Ga0495584_0021242 | Ga0495584_0021242_1989_2552 | 187 |
| 408 | 3300046491 | Ga0495584_0028932 | Ga0495584_0028932_1818_2381 | 187 |
| 409 | 3300046491 | Ga0495584_0074750 | Ga0495584_0074750_1046_1609 | 187 |
| 410 | 3300046492 | Ga0495585_0000175 | Ga0495585_0000175_32714_33277 | 187 |
| 411 | 3300046492 | Ga0495585_0000410 | Ga0495585_0000410_26368_26931 | 187 |
| 412 | 3300046492 | Ga0495585_0000558 | Ga0495585_0000558_18221_18784 | 187 |
| 413 | 3300046492 | Ga0495585_0000739 | Ga0495585_0000739_12794_13357 | 187 |
| 414 | 3300046492 | Ga0495585_0001146 | Ga0495585_0001146_3819_4382 | 187 |
| 415 | 3300046492 | Ga0495585_0002326 | Ga0495585_0002326_7895_8458 | 187 |
| 416 | 3300046492 | Ga0495585_0004740 | Ga0495585_0004740_5998_6561 | 187 |
| 417 | 3300046492 | Ga0495585_0006142 | Ga0495585_0006142_1842_2405 | 187 |
| 418 | 3300046492 | Ga0495585_0006680 | Ga0495585_0006680_6475_7038 | 187 |
| 419 | 3300046492 | Ga0495585_0012864 | Ga0495585_0012864_3252_3815 | 187 |
| 420 | 3300046492 | Ga0495585_0021010 | Ga0495585_0021010_1997_2560 | 187 |
| 421 | 3300046492 | Ga0495585_0021598 | Ga0495585_0021598_1340_1903 | 187 |
| 422 | 3300046492 | Ga0495585_0025762 | Ga0495585_0025762_2736_3299 | 187 |
| 423 | 3300046492 | Ga0495585_0029234 | Ga0495585_0029234_213_776 | 187 |
| 424 | 3300046492 | Ga0495585_0044924 | Ga0495585_0044924_56_619 | 187 |
| 425 | 3300046492 | Ga0495585_0053045 | Ga0495585_0053045_454_1017 | 187 |
| 426 | 3300046492 | Ga0495585_0086112 | Ga0495585_0086112_724_1287 | 187 |
| 427 | 3300046492 | Ga0495585_0086515 | Ga0495585_0086515_530_1093 | 187 |
| 428 | 3300046492 | Ga0495585_0132041 | Ga0495585_0132041_642_1205 | 187 |
| 429 | 3300046492 | Ga0495585_0176218 | Ga0495585_0176218_164_727 | 187 |
| 430 | 3300046499 | Ga0495594_0006303 | Ga0495594_0006303_2103_2666 | 187 |
| 431 | 3300046499 | Ga0495594_0013500 | Ga0495594_0013500_3545_4108 | 187 |
| 432 | 3300046499 | Ga0495594_0034800 | Ga0495594_0034800_1423_1986 | 187 |
| 433 | 3300046499 | Ga0495594_0068173 | Ga0495594_0068173_248_811 | 187 |
| 434 | 3300046499 | Ga0495594_0141171 | Ga0495594_0141171_576_1139 | 187 |
| 435 | 3300046500 | Ga0495596_0000646 | Ga0495596_0000646_10063_10626 | 187 |
| 436 | 3300046500 | Ga0495596_0001510 | Ga0495596_0001510_391_954 | 187 |
| 437 | 3300046500 | Ga0495596_0002243 | Ga0495596_0002243_1050_1613 | 187 |
| 438 | 3300046500 | Ga0495596_0012883 | Ga0495596_0012883_1641_2204 | 187 |
| 439 | 3300046500 | Ga0495596_0020544 | Ga0495596_0020544_1323_1886 | 187 |
| 440 | 3300046500 | Ga0495596_0035281 | Ga0495596_0035281_1312_1875 | 187 |
| 441 | 3300046500 | Ga0495596_0079897 | Ga0495596_0079897_437_1000 | 187 |
| 442 | 3300046501 | Ga0495607_0000554 | Ga0495607_0000554_16461_17024 | 187 |
| 443 | 3300046501 | Ga0495607_0000669 | Ga0495607_0000669_24921_25484 | 187 |
| 444 | 3300046501 | Ga0495607_0005056 | Ga0495607_0005056_4037_4600 | 187 |
| 445 | 3300046501 | Ga0495607_0005864 | Ga0495607_0005864_4923_5486 | 187 |
| 446 | 3300046501 | Ga0495607_0008086 | Ga0495607_0008086_5428_5991 | 187 |
| 447 | 3300046501 | Ga0495607_0012656 | Ga0495607_0012656_1189_1752 | 187 |
| 448 | 3300046501 | Ga0495607_0012665 | Ga0495607_0012665_2633_3196 | 187 |
| 449 | 3300046501 | Ga0495607_0016637 | Ga0495607_0016637_3469_4032 | 187 |
| 450 | 3300046501 | Ga0495607_0055955 | Ga0495607_0055955_1088_1651 | 187 |
| 451 | 3300046501 | Ga0495607_0159208 | Ga0495607_0159208_26_589 | 187 |
| 452 | 3300046501 | Ga0495607_0263473 | Ga0495607_0263473_218_781 | 187 |
| 453 | 3300046506 | Ga0495583_0000115 | Ga0495583_0000115_112178_112867 | 187 |
| 454 | 3300046506 | Ga0495583_0000141 | Ga0495583_0000141_37387_37950 | 187 |
| 455 | 3300046506 | Ga0495583_0000981 | Ga0495583_0000981_13425_13988 | 187 |
| 456 | 3300046506 | Ga0495583_0001163 | Ga0495583_0001163_1259_1822 | 187 |
| 457 | 3300046506 | Ga0495583_0001485 | Ga0495583_0001485_6157_6720 | 187 |
| 458 | 3300046506 | Ga0495583_0030694 | Ga0495583_0030694_1989_2552 | 187 |
| 459 | 3300046506 | Ga0495583_0037677 | Ga0495583_0037677_776_1339 | 187 |
| 460 | 3300046506 | Ga0495583_0068455 | Ga0495583_0068455_740_1303 | 187 |
| 461 | 3300046507 | Ga0495606_0000180 | Ga0495606_0000180_36046_36609 | 187 |
| 462 | 3300046507 | Ga0495606_0000228 | Ga0495606_0000228_44036_44659 | 187 |
| 463 | 3300046507 | Ga0495606_0000512 | Ga0495606_0000512_51372_51965 | 187 |
| 464 | 3300046507 | Ga0495606_0000828 | Ga0495606_0000828_46338_46901 | 187 |
| 465 | 3300046507 | Ga0495606_0000829 | Ga0495606_0000829_43423_43986 | 187 |
| 466 | 3300046507 | Ga0495606_0000850 | Ga0495606_0000850_36059_36682 | 187 |
| 467 | 3300046507 | Ga0495606_0001374 | Ga0495606_0001374_10710_11273 | 187 |
| 468 | 3300046507 | Ga0495606_0002886 | Ga0495606_0002886_5882_6445 | 187 |
| 469 | 3300046507 | Ga0495606_0003647 | Ga0495606_0003647_9255_9818 | 187 |
| 470 | 3300046507 | Ga0495606_0006698 | Ga0495606_0006698_9585_10148 | 187 |
| 471 | 3300046507 | Ga0495606_0030597 | Ga0495606_0030597_585_1148 | 187 |
| 472 | 3300046507 | Ga0495606_0042288 | Ga0495606_0042288_253_816 | 187 |
| 473 | 3300046507 | Ga0495606_0050086 | Ga0495606_0050086_1478_2041 | 187 |
| 474 | 3300046507 | Ga0495606_0084295 | Ga0495606_0084295_295_858 | 187 |
| 475 | 3300046507 | Ga0495606_0180206 | Ga0495606_0180206_64_627 | 187 |
| 476 | 3300046511 | Ga0495608_0033832 | Ga0495608_0033832_2167_2730 | 187 |
| 477 | 3300046512 | Ga0495610_0003299 | Ga0495610_0003299_1385_1948 | 187 |
| 478 | 3300046512 | Ga0495610_0003645 | Ga0495610_0003645_3727_4290 | 187 |
| 479 | 3300046512 | Ga0495610_0009819 | Ga0495610_0009819_4246_4809 | 187 |
| 480 | 3300046512 | Ga0495610_0017488 | Ga0495610_0017488_1907_2530 | 187 |
| 481 | 3300046512 | Ga0495610_0085695 | Ga0495610_0085695_639_1202 | 187 |
| 482 | 3300046513 | Ga0495616_0000120 | Ga0495616_0000120_17715_18278 | 187 |
| 483 | 3300046513 | Ga0495616_0000990 | Ga0495616_0000990_19416_19979 | 187 |
| 484 | 3300046513 | Ga0495616_0001050 | Ga0495616_0001050_4180_4743 | 187 |
| 485 | 3300046513 | Ga0495616_0004042 | Ga0495616_0004042_4901_5464 | 187 |
| 486 | 3300046513 | Ga0495616_0004864 | Ga0495616_0004864_577_1140 | 187 |
| 487 | 3300046513 | Ga0495616_0008919 | Ga0495616_0008919_1104_1667 | 187 |
| 488 | 3300046513 | Ga0495616_0017909 | Ga0495616_0017909_2347_2910 | 187 |
| 489 | 3300046513 | Ga0495616_0029802 | Ga0495616_0029802_114_677 | 187 |
| 490 | 3300046513 | Ga0495616_0044553 | Ga0495616_0044553_1246_1809 | 187 |
| 491 | 3300046513 | Ga0495616_0049234 | Ga0495616_0049234_1237_1800 | 187 |
| 492 | 3300046513 | Ga0495616_0053260 | Ga0495616_0053260_50_613 | 187 |
| 493 | 3300046515 | Ga0495620_0011899 | Ga0495620_0011899_1062_1625 | 187 |
| 494 | 3300046518 | Ga0495631_0000300 | Ga0495631_0000300_14492_15055 | 187 |
| 495 | 3300046518 | Ga0495631_0003792 | Ga0495631_0003792_6403_6966 | 187 |
| 496 | 3300046518 | Ga0495631_0005692 | Ga0495631_0005692_1310_1873 | 187 |
| 497 | 3300046518 | Ga0495631_0008274 | Ga0495631_0008274_2615_3178 | 187 |
| 498 | 3300046518 | Ga0495631_0024426 | Ga0495631_0024426_1726_2289 | 187 |
| 499 | 3300046518 | Ga0495631_0039073 | Ga0495631_0039073_283_846 | 187 |
| 500 | 3300046518 | Ga0495631_0063056 | Ga0495631_0063056_268_831 | 187 |
| 501 | 3300046518 | Ga0495631_0070367 | Ga0495631_0070367_77_640 | 187 |
| 502 | 3300046519 | Ga0495632_0000094 | Ga0495632_0000094_45776_46339 | 187 |
| 503 | 3300046519 | Ga0495632_0000141 | Ga0495632_0000141_44118_44681 | 187 |
| 504 | 3300046519 | Ga0495632_0000456 | Ga0495632_0000456_23169_23732 | 187 |
| 505 | 3300046519 | Ga0495632_0000458 | Ga0495632_0000458_16705_17268 | 187 |
| 506 | 3300046519 | Ga0495632_0002459 | Ga0495632_0002459_8810_9373 | 187 |
| 507 | 3300046519 | Ga0495632_0030953 | Ga0495632_0030953_980_1543 | 187 |
| 508 | 3300046520 | Ga0495637_0000004 | Ga0495637_0000004_72591_73154 | 187 |
| 509 | 3300046520 | Ga0495637_0000142 | Ga0495637_0000142_1749_2372 | 187 |
| 510 | 3300046520 | Ga0495637_0001262 | Ga0495637_0001262_3915_4538 | 187 |
| 511 | 3300046520 | Ga0495637_0012374 | Ga0495637_0012374_2006_2569 | 187 |
| 512 | 3300046520 | Ga0495637_0054858 | Ga0495637_0054858_1036_1599 | 187 |
| 513 | 3300046522 | Ga0495643_0000082 | Ga0495643_0000082_89266_89829 | 187 |
| 514 | 3300046522 | Ga0495643_0000160 | Ga0495643_0000160_62349_62912 | 187 |
| 515 | 3300046522 | Ga0495643_0000822 | Ga0495643_0000822_21307_21870 | 187 |
| 516 | 3300046522 | Ga0495643_0005425 | Ga0495643_0005425_4840_5403 | 187 |
| 517 | 3300046522 | Ga0495643_0044587 | Ga0495643_0044587_1318_1881 | 187 |
| 518 | 3300046522 | Ga0495643_0093163 | Ga0495643_0093163_928_1491 | 187 |
| 519 | 3300046523 | Ga0495644_0002967 | Ga0495644_0002967_5193_5756 | 187 |
| 520 | 3300046523 | Ga0495644_0007916 | Ga0495644_0007916_3076_3639 | 187 |
| 521 | 3300046523 | Ga0495644_0009102 | Ga0495644_0009102_1067_1630 | 187 |
| 522 | 3300046523 | Ga0495644_0015551 | Ga0495644_0015551_1087_1650 | 187 |
| 523 | 3300046523 | Ga0495644_0027834 | Ga0495644_0027834_1428_2117 | 187 |
| 524 | 3300046523 | Ga0495644_0041211 | Ga0495644_0041211_321_884 | 187 |
| 525 | 3300046523 | Ga0495644_0042956 | Ga0495644_0042956_733_1296 | 187 |
| 526 | 3300046523 | Ga0495644_0083888 | Ga0495644_0083888_94_657 | 187 |
| 527 | 3300046523 | Ga0495644_0101265 | Ga0495644_0101265_469_1032 | 187 |
| 528 | 3300046524 | Ga0495648_0000019 | Ga0495648_0000019_50756_51319 | 187 |
| 529 | 3300046524 | Ga0495648_0000030 | Ga0495648_0000030_87642_88205 | 187 |
| 530 | 3300046524 | Ga0495648_0001166 | Ga0495648_0001166_3020_3709 | 187 |
| 531 | 3300046524 | Ga0495648_0007615 | Ga0495648_0007615_1352_1915 | 187 |
| 532 | 3300046524 | Ga0495648_0007994 | Ga0495648_0007994_2597_3160 | 187 |
| 533 | 3300046524 | Ga0495648_0016105 | Ga0495648_0016105_2755_3318 | 187 |
| 534 | 3300046524 | Ga0495648_0162972 | Ga0495648_0162972_438_1001 | 187 |
| 535 | 3300046525 | Ga0495663_0015304 | Ga0495663_0015304_1435_1998 | 187 |
| 536 | 3300046525 | Ga0495663_0022922 | Ga0495663_0022922_1193_1756 | 187 |
| 537 | 3300046525 | Ga0495663_0033891 | Ga0495663_0033891_309_872 | 187 |
| 538 | 3300046526 | Ga0495666_0002786 | Ga0495666_0002786_6144_6707 | 187 |
| 539 | 3300046526 | Ga0495666_0008506 | Ga0495666_0008506_3323_3886 | 187 |
| 540 | 3300046526 | Ga0495666_0056067 | Ga0495666_0056067_802_1365 | 187 |
| 541 | 3300046528 | Ga0495642_0000271 | Ga0495642_0000271_11793_12356 | 187 |
| 542 | 3300046528 | Ga0495642_0000806 | Ga0495642_0000806_7871_8434 | 187 |
| 543 | 3300046528 | Ga0495642_0010238 | Ga0495642_0010238_1428_1991 | 187 |
| 544 | 3300046528 | Ga0495642_0020073 | Ga0495642_0020073_1407_1970 | 187 |
| 545 | 3300046528 | Ga0495642_0031119 | Ga0495642_0031119_481_1044 | 187 |
| 546 | 3300046528 | Ga0495642_0033364 | Ga0495642_0033364_587_1150 | 187 |
| 547 | 3300046528 | Ga0495642_0034743 | Ga0495642_0034743_1446_2009 | 187 |
| 548 | 3300046528 | Ga0495642_0040216 | Ga0495642_0040216_680_1243 | 187 |
| 549 | 3300046529 | Ga0495652_0132760 | Ga0495652_0132760_895_1458 | 187 |
| 550 | 3300046529 | Ga0495652_0177819 | Ga0495652_0177819_120_683 | 187 |
| 551 | 3300046530 | Ga0495654_0000014 | Ga0495654_0000014_170306_170929 | 187 |
| 552 | 3300046530 | Ga0495654_0011998 | Ga0495654_0011998_843_1406 | 187 |
| 553 | 3300046530 | Ga0495654_0035958 | Ga0495654_0035958_1862_2425 | 187 |
| 554 | 3300046530 | Ga0495654_0052510 | Ga0495654_0052510_23_586 | 187 |
| 555 | 3300046531 | Ga0495665_0048107 | Ga0495665_0048107_1345_1908 | 187 |
| 556 | 3300046533 | Ga0495640_0258966 | Ga0495640_0258966_316_879 | 187 |
| 557 | 3300046535 | Ga0495586_0011018 | Ga0495586_0011018_3640_4203 | 187 |
| 558 | 3300046535 | Ga0495586_0151531 | Ga0495586_0151531_205_768 | 187 |
| 559 | 3300046536 | Ga0495587_0007968 | Ga0495587_0007968_4035_4598 | 187 |
| 560 | 3300046536 | Ga0495587_0123277 | Ga0495587_0123277_228_791 | 187 |
| 561 | 3300046538 | Ga0495609_0000021 | Ga0495609_0000021_201449_202012 | 187 |
| 562 | 3300046538 | Ga0495609_0000813 | Ga0495609_0000813_1344_1907 | 187 |
| 563 | 3300046538 | Ga0495609_0002273 | Ga0495609_0002273_8008_8571 | 187 |
| 564 | 3300046538 | Ga0495609_0006554 | Ga0495609_0006554_4866_5429 | 187 |
| 565 | 3300046538 | Ga0495609_0006887 | Ga0495609_0006887_83_646 | 187 |
| 566 | 3300046538 | Ga0495609_0040246 | Ga0495609_0040246_667_1230 | 187 |
| 567 | 3300046538 | Ga0495609_0055718 | Ga0495609_0055718_87_650 | 187 |
| 568 | 3300046538 | Ga0495609_0165475 | Ga0495609_0165475_327_890 | 187 |
| 569 | 3300046542 | Ga0495597_0000364 | Ga0495597_0000364_7183_7746 | 187 |
| 570 | 3300046542 | Ga0495597_0000544 | Ga0495597_0000544_9327_9890 | 187 |
| 571 | 3300046542 | Ga0495597_0001183 | Ga0495597_0001183_9188_9751 | 187 |
| 572 | 3300046542 | Ga0495597_0002172 | Ga0495597_0002172_5727_6290 | 187 |
| 573 | 3300046542 | Ga0495597_0005834 | Ga0495597_0005834_1358_1921 | 187 |
| 574 | 3300046542 | Ga0495597_0029465 | Ga0495597_0029465_449_1012 | 187 |
| 575 | 3300046542 | Ga0495597_0042859 | Ga0495597_0042859_169_732 | 187 |
| 576 | 3300046542 | Ga0495597_0049952 | Ga0495597_0049952_751_1314 | 187 |
| 577 | 3300046543 | Ga0495645_0258422 | Ga0495645_0258422_342_905 | 187 |
| 578 | 3300046557 | Ga0495622_0000034 | Ga0495622_0000034_61799_62362 | 187 |
| 579 | 3300046557 | Ga0495622_0000071 | Ga0495622_0000071_52752_53315 | 187 |
| 580 | 3300046557 | Ga0495622_0003694 | Ga0495622_0003694_3730_4293 | 187 |
| 581 | 3300046557 | Ga0495622_0104216 | Ga0495622_0104216_546_1109 | 187 |
| 582 | 3300046557 | Ga0495622_0111315 | Ga0495622_0111315_180_743 | 187 |
| 583 | 3300046557 | Ga0495622_0132976 | Ga0495622_0132976_399_962 | 187 |
| 584 | 3300046558 | Ga0495633_0000077 | Ga0495633_0000077_47688_48251 | 187 |
| 585 | 3300046558 | Ga0495633_0000100 | Ga0495633_0000100_72913_73536 | 187 |
| 586 | 3300046558 | Ga0495633_0000764 | Ga0495633_0000764_17803_18366 | 187 |
| 587 | 3300046558 | Ga0495633_0003422 | Ga0495633_0003422_9555_10118 | 187 |
| 588 | 3300046558 | Ga0495633_0004475 | Ga0495633_0004475_8213_8776 | 187 |
| 589 | 3300046558 | Ga0495633_0006936 | Ga0495633_0006936_2863_3426 | 187 |
| 590 | 3300046558 | Ga0495633_0007251 | Ga0495633_0007251_4017_4580 | 187 |
| 591 | 3300046558 | Ga0495633_0038051 | Ga0495633_0038051_733_1296 | 187 |
| 592 | 3300046558 | Ga0495633_0064906 | Ga0495633_0064906_218_907 | 187 |
| 593 | 3300046558 | Ga0495633_0096202 | Ga0495633_0096202_530_1093 | 187 |
| 594 | 3300046558 | Ga0495633_0136701 | Ga0495633_0136701_214_777 | 187 |
| 595 | 3300046558 | Ga0495633_0240248 | Ga0495633_0240248_44_607 | 187 |
| 596 | 3300046615 | Ga0495656_0000543 | Ga0495656_0000543_1269_1832 | 187 |
| 597 | 3300046615 | Ga0495656_0105001 | Ga0495656_0105001_473_1162 | 187 |
| 598 | 3300046616 | Ga0495668_0000220 | Ga0495668_0000220_38483_39046 | 187 |
| 599 | 3300046616 | Ga0495668_0000231 | Ga0495668_0000231_25231_25794 | 187 |
| 600 | 3300046616 | Ga0495668_0000308 | Ga0495668_0000308_11350_11913 | 187 |
| 601 | 3300046616 | Ga0495668_0000351 | Ga0495668_0000351_31384_31947 | 187 |
| 602 | 3300046616 | Ga0495668_0000481 | Ga0495668_0000481_17141_17704 | 187 |
| 603 | 3300046616 | Ga0495668_0000602 | Ga0495668_0000602_8059_8622 | 187 |
| 604 | 3300046616 | Ga0495668_0011582 | Ga0495668_0011582_3858_4481 | 187 |
| 605 | 3300046616 | Ga0495668_0029703 | Ga0495668_0029703_89_652 | 187 |
| 606 | 3300046616 | Ga0495668_0056336 | Ga0495668_0056336_924_1487 | 187 |
| 607 | 3300046616 | Ga0495668_0060496 | Ga0495668_0060496_1229_1792 | 187 |
| 608 | 3300046616 | Ga0495668_0063701 | Ga0495668_0063701_221_784 | 187 |
| 609 | 3300046616 | Ga0495668_0070764 | Ga0495668_0070764_1332_1895 | 187 |
| 610 | 3300046616 | Ga0495668_0407178 | Ga0495668_0407178_157_720 | 187 |
| 611 | 3300046642 | Ga0495634_0015257 | Ga0495634_0015257_71_634 | 187 |
| 612 | 3300046648 | Ga0495611_0000503 | Ga0495611_0000503_20619_21182 | 187 |
| 613 | 3300046648 | Ga0495611_0000909 | Ga0495611_0000909_11483_12046 | 187 |
| 614 | 3300046648 | Ga0495611_0024824 | Ga0495611_0024824_2006_2569 | 187 |
| 615 | 3300046648 | Ga0495611_0028021 | Ga0495611_0028021_1270_1833 | 187 |
| 616 | 3300046648 | Ga0495611_0044133 | Ga0495611_0044133_357_920 | 187 |
| 617 | 3300046648 | Ga0495611_0061386 | Ga0495611_0061386_12_575 | 187 |
| 618 | 3300046648 | Ga0495611_0072854 | Ga0495611_0072854_434_997 | 187 |
| 619 | 3300046648 | Ga0495611_0095972 | Ga0495611_0095972_404_967 | 187 |
| 620 | 3300046648 | Ga0495611_0147461 | Ga0495611_0147461_308_871 | 187 |
| 621 | 3300046660 | Ga0495625_0001111 | Ga0495625_0001111_21641_22204 | 187 |
| 622 | 3300046660 | Ga0495625_0005276 | Ga0495625_0005276_136_759 | 187 |
| 623 | 3300046660 | Ga0495625_0007701 | Ga0495625_0007701_1285_1848 | 187 |
| 624 | 3300046660 | Ga0495625_0009390 | Ga0495625_0009390_4503_5096 | 187 |
| 625 | 3300046660 | Ga0495625_0015253 | Ga0495625_0015253_5337_5900 | 187 |
| 626 | 3300046660 | Ga0495625_0025935 | Ga0495625_0025935_1734_2423 | 187 |
| 627 | 3300046660 | Ga0495625_0039518 | Ga0495625_0039518_825_1388 | 187 |
| 628 | 3300046660 | Ga0495625_0057433 | Ga0495625_0057433_1943_2506 | 187 |
| 629 | 3300046660 | Ga0495625_0071775 | Ga0495625_0071775_1853_2416 | 187 |
| 630 | 3300046660 | Ga0495625_0348237 | Ga0495625_0348237_69_632 | 187 |
| 631 | 3300046663 | Ga0495635_0004579 | Ga0495635_0004579_1372_1935 | 187 |
| 632 | 3300046663 | Ga0495635_0059679 | Ga0495635_0059679_26_589 | 187 |
| 633 | 3300046664 | Ga0495659_0000049 | Ga0495659_0000049_46537_47160 | 187 |
| 634 | 3300046664 | Ga0495659_0003870 | Ga0495659_0003870_1930_2619 | 187 |
| 635 | 3300046664 | Ga0495659_0330252 | Ga0495659_0330252_16_636 | 187 |
| 636 | 3300046665 | Ga0495661_0000091 | Ga0495661_0000091_85947_86510 | 187 |
| 637 | 3300046665 | Ga0495661_0000798 | Ga0495661_0000798_21073_21636 | 187 |
| 638 | 3300046665 | Ga0495661_0001154 | Ga0495661_0001154_18671_19234 | 187 |
| 639 | 3300046665 | Ga0495661_0001188 | Ga0495661_0001188_833_1396 | 187 |
| 640 | 3300046665 | Ga0495661_0002171 | Ga0495661_0002171_1423_1986 | 187 |
| 641 | 3300046665 | Ga0495661_0009106 | Ga0495661_0009106_4949_5512 | 187 |
| 642 | 3300046665 | Ga0495661_0010564 | Ga0495661_0010564_3896_4459 | 187 |
| 643 | 3300046665 | Ga0495661_0027413 | Ga0495661_0027413_886_1449 | 187 |
| 644 | 3300046665 | Ga0495661_0039244 | Ga0495661_0039244_1903_2466 | 187 |
| 645 | 3300046665 | Ga0495661_0049487 | Ga0495661_0049487_1482_2045 | 187 |
| 646 | 3300046665 | Ga0495661_0051007 | Ga0495661_0051007_61_624 | 187 |
| 647 | 3300046665 | Ga0495661_0052095 | Ga0495661_0052095_831_1394 | 187 |
| 648 | 3300046665 | Ga0495661_0062056 | Ga0495661_0062056_12_575 | 187 |
| 649 | 3300046665 | Ga0495661_0093967 | Ga0495661_0093967_840_1403 | 187 |
| 650 | 3300046665 | Ga0495661_0094514 | Ga0495661_0094514_1099_1662 | 187 |
| 651 | 3300046665 | Ga0495661_0172683 | Ga0495661_0172683_69_632 | 187 |
| 652 | 3300046674 | Ga0495588_0000083 | Ga0495588_0000083_101054_101617 | 187 |
| 653 | 3300046674 | Ga0495588_0067699 | Ga0495588_0067699_285_848 | 187 |
| 654 | 3300046674 | Ga0495588_0072611 | Ga0495588_0072611_513_1076 | 187 |
| 655 | 3300046674 | Ga0495588_0076325 | Ga0495588_0076325_406_969 | 187 |
| 656 | 3300046674 | Ga0495588_0107813 | Ga0495588_0107813_656_1219 | 187 |
| 657 | 3300046678 | Ga0495599_0007003 | Ga0495599_0007003_4505_5068 | 187 |
| 658 | 3300046679 | Ga0495623_0047900 | Ga0495623_0047900_2107_2670 | 187 |
| 659 | 3300046679 | Ga0495623_0127018 | Ga0495623_0127018_410_973 | 187 |
| 660 | 3300046680 | Ga0495646_0031412 | Ga0495646_0031412_983_1546 | 187 |
| 661 | 3300046680 | Ga0495646_0045634 | Ga0495646_0045634_2005_2568 | 187 |
| 662 | 3300046684 | Ga0495669_0000085 | Ga0495669_0000085_40431_40994 | 187 |
| 663 | 3300046684 | Ga0495669_0005609 | Ga0495669_0005609_1942_2505 | 187 |
| 664 | 3300046684 | Ga0495669_0005856 | Ga0495669_0005856_4310_4873 | 187 |
| 665 | 3300046684 | Ga0495669_0033307 | Ga0495669_0033307_56_619 | 187 |
| 666 | 3300046684 | Ga0495669_0325855 | Ga0495669_0325855_161_724 | 187 |
| 667 | 3300046689 | Ga0495613_0021032 | Ga0495613_0021032_704_1267 | 187 |
| 668 | 3300046689 | Ga0495613_0056539 | Ga0495613_0056539_661_1224 | 187 |
| 669 | 3300046690 | Ga0495624_0081358 | Ga0495624_0081358_1015_1578 | 187 |
| 670 | 3300046690 | Ga0495624_0279646 | Ga0495624_0279646_55_618 | 187 |
| 671 | 3300046691 | Ga0495670_0001905 | Ga0495670_0001905_8893_9456 | 187 |
| 672 | 3300046691 | Ga0495670_0002678 | Ga0495670_0002678_43_606 | 187 |
| 673 | 3300046691 | Ga0495670_0022660 | Ga0495670_0022660_1861_2424 | 187 |
| 674 | 3300046691 | Ga0495670_0030121 | Ga0495670_0030121_406_969 | 187 |
| 675 | 3300046691 | Ga0495670_0199846 | Ga0495670_0199846_362_925 | 187 |
| 676 | 3300046691 | Ga0495670_0229699 | Ga0495670_0229699_40_603 | 187 |
| 677 | 3300046692 | Ga0495671_0000005 | Ga0495671_0000005_222575_223168 | 187 |
| 678 | 3300046692 | Ga0495671_0004998 | Ga0495671_0004998_2738_3301 | 187 |
| 679 | 3300046692 | Ga0495671_0006502 | Ga0495671_0006502_554_1117 | 187 |
| 680 | 3300046692 | Ga0495671_0113779 | Ga0495671_0113779_107_670 | 187 |
| 681 | 3300046692 | Ga0495671_0147805 | Ga0495671_0147805_94_657 | 187 |
| 682 | 3300046694 | Ga0495649_0005036 | Ga0495649_0005036_1019_1582 | 187 |
| 683 | 3300046694 | Ga0495649_0044619 | Ga0495649_0044619_1076_1639 | 187 |
| 684 | 3300046794 | Ga0495589_0000012 | Ga0495589_0000012_201288_201851 | 187 |
| 685 | 3300046794 | Ga0495589_0000022 | Ga0495589_0000022_28564_29127 | 187 |
| 686 | 3300046794 | Ga0495589_0000420 | Ga0495589_0000420_11977_12540 | 187 |
| 687 | 3300046794 | Ga0495589_0007242 | Ga0495589_0007242_5133_5696 | 187 |
| 688 | 3300046794 | Ga0495589_0014059 | Ga0495589_0014059_3161_3724 | 187 |
| 689 | 3300046794 | Ga0495589_0024520 | Ga0495589_0024520_1100_1663 | 187 |
| 690 | 3300046794 | Ga0495589_0025436 | Ga0495589_0025436_1888_2451 | 187 |
| 691 | 3300046794 | Ga0495589_0036258 | Ga0495589_0036258_770_1333 | 187 |
| 692 | 3300046794 | Ga0495589_0041314 | Ga0495589_0041314_962_1525 | 187 |
| 693 | 3300046794 | Ga0495589_0047066 | Ga0495589_0047066_1447_2010 | 187 |
| 694 | 3300046794 | Ga0495589_0072549 | Ga0495589_0072549_511_1074 | 187 |
| 695 | 3300046809 | Ga0495600_0014283 | Ga0495600_0014283_2697_3260 | 187 |
| 696 | 3300046809 | Ga0495600_0072949 | Ga0495600_0072949_1141_1704 | 187 |
| 697 | 3300046809 | Ga0495600_0146470 | Ga0495600_0146470_454_1017 | 187 |
| 698 | 3300046810 | Ga0495660_0000192 | Ga0495660_0000192_2626_3189 | 187 |
| 699 | 3300046810 | Ga0495660_0000203 | Ga0495660_0000203_53905_54468 | 187 |
| 700 | 3300046810 | Ga0495660_0000514 | Ga0495660_0000514_4281_4904 | 187 |
| 701 | 3300046810 | Ga0495660_0002004 | Ga0495660_0002004_11380_11943 | 187 |
| 702 | 3300046810 | Ga0495660_0004348 | Ga0495660_0004348_5250_5813 | 187 |
| 703 | 3300046810 | Ga0495660_0004732 | Ga0495660_0004732_2294_2857 | 187 |
| 704 | 3300046810 | Ga0495660_0065327 | Ga0495660_0065327_649_1212 | 187 |
| 705 | 3300046810 | Ga0495660_0264645 | Ga0495660_0264645_122_685 | 187 |
| 706 | 3300047315 | Ga0495581_0006379 | Ga0495581_0006379_1426_1989 | 187 |
| 707 | 3300047315 | Ga0495581_0007089 | Ga0495581_0007089_355_918 | 187 |
| 708 | 3300047315 | Ga0495581_0010263 | Ga0495581_0010263_4207_4770 | 187 |
| 709 | 3300047315 | Ga0495581_0030890 | Ga0495581_0030890_1295_1858 | 187 |
| 710 | 3300047317 | Ga0495604_0007352 | Ga0495604_0007352_4473_5036 | 187 |
| 711 | 3300047317 | Ga0495604_0063363 | Ga0495604_0063363_788_1351 | 187 |
| 712 | 3300047317 | Ga0495604_0090489 | Ga0495604_0090489_475_1038 | 187 |
| 713 | 3300047318 | Ga0495636_0000698 | Ga0495636_0000698_4525_5214 | 187 |
| 714 | 3300047318 | Ga0495636_0011290 | Ga0495636_0011290_405_968 | 187 |
| 715 | 3300047319 | Ga0495674_0010761 | Ga0495674_0010761_4667_5230 | 187 |
| 716 | 3300047319 | Ga0495674_0511242 | Ga0495674_0511242_159_722 | 187 |
| 717 | 3300047320 | Ga0495672_0000026 | Ga0495672_0000026_10140_10763 | 187 |
| 718 | 3300047320 | Ga0495672_0000081 | Ga0495672_0000081_69445_70008 | 187 |
| 719 | 3300047320 | Ga0495672_0000523 | Ga0495672_0000523_40827_41390 | 187 |
| 720 | 3300047320 | Ga0495672_0000861 | Ga0495672_0000861_8227_8790 | 187 |
| 721 | 3300047320 | Ga0495672_0003857 | Ga0495672_0003857_9852_10415 | 187 |
| 722 | 3300047320 | Ga0495672_0021590 | Ga0495672_0021590_3118_3807 | 187 |
| 723 | 3300047320 | Ga0495672_0120382 | Ga0495672_0120382_107_670 | 187 |
| 724 | 3300047321 | Ga0495676_0000214 | Ga0495676_0000214_19727_20290 | 187 |
| 725 | 3300047321 | Ga0495676_0018769 | Ga0495676_0018769_3321_3884 | 187 |
| 726 | 3300047321 | Ga0495676_0061566 | Ga0495676_0061566_11_574 | 187 |
| 727 | 3300047323 | Ga0495683_0000035 | Ga0495683_0000035_21085_21648 | 187 |
| 728 | 3300047323 | Ga0495683_0001320 | Ga0495683_0001320_8723_9286 | 187 |
| 729 | 3300047323 | Ga0495683_0003892 | Ga0495683_0003892_4433_4996 | 187 |
| 730 | 3300047323 | Ga0495683_0008357 | Ga0495683_0008357_4534_5097 | 187 |
| 731 | 3300047323 | Ga0495683_0009395 | Ga0495683_0009395_2498_3061 | 187 |
| 732 | 3300047323 | Ga0495683_0016977 | Ga0495683_0016977_732_1295 | 187 |
| 733 | 3300047323 | Ga0495683_0048269 | Ga0495683_0048269_773_1462 | 187 |
| 734 | 3300047323 | Ga0495683_0055938 | Ga0495683_0055938_843_1406 | 187 |
| 735 | 3300047323 | Ga0495683_0099472 | Ga0495683_0099472_645_1208 | 187 |
| 736 | 3300047443 | Ga0495687_000063 | Ga0495687_000063_39487_40050 | 187 |
| 737 | 3300047443 | Ga0495687_000151 | Ga0495687_000151_23507_24070 | 187 |
| 738 | 3300047443 | Ga0495687_000214 | Ga0495687_000214_45822_46385 | 187 |
| 739 | 3300047443 | Ga0495687_000284 | Ga0495687_000284_23234_23797 | 187 |
| 740 | 3300047443 | Ga0495687_000671 | Ga0495687_000671_12675_13238 | 187 |
| 741 | 3300047443 | Ga0495687_001571 | Ga0495687_001571_7089_7778 | 187 |
| 742 | 3300047443 | Ga0495687_008516 | Ga0495687_008516_459_1022 | 187 |
| 743 | 3300047443 | Ga0495687_013290 | Ga0495687_013290_447_1010 | 187 |
| 744 | 3300047444 | Ga0495675_0004016 | Ga0495675_0004016_7080_7643 | 187 |
| 745 | 3300047444 | Ga0495675_0298116 | Ga0495675_0298116_330_893 | 187 |
| 746 | 3300047445 | Ga0495677_0000046 | Ga0495677_0000046_26584_27147 | 187 |
| 747 | 3300047445 | Ga0495677_0007225 | Ga0495677_0007225_1813_2376 | 187 |
| 748 | 3300047445 | Ga0495677_0012550 | Ga0495677_0012550_1911_2600 | 187 |
| 749 | 3300047445 | Ga0495677_0018812 | Ga0495677_0018812_1535_2098 | 187 |
| 750 | 3300047445 | Ga0495677_0026974 | Ga0495677_0026974_1237_1800 | 187 |
| 751 | 3300047445 | Ga0495677_0032228 | Ga0495677_0032228_1028_1591 | 187 |
| 752 | 3300047445 | Ga0495677_0117014 | Ga0495677_0117014_404_967 | 187 |
| 753 | 3300047446 | Ga0495679_004467 | Ga0495679_004467_4071_4634 | 187 |
| 754 | 3300047446 | Ga0495679_024697 | Ga0495679_024697_980_1543 | 187 |
| 755 | 3300047447 | Ga0495685_000084 | Ga0495685_000084_17675_18364 | 187 |
| 756 | 3300047447 | Ga0495685_024820 | Ga0495685_024820_355_918 | 187 |
| 757 | 3300047447 | Ga0495685_061356 | Ga0495685_061356_11_574 | 187 |
| 758 | 3300047469 | Ga0495673_0000008 | Ga0495673_0000008_636205_636828 | 187 |
| 759 | 3300047469 | Ga0495673_0000009 | Ga0495673_0000009_566211_566774 | 187 |
| 760 | 3300047469 | Ga0495673_0000012 | Ga0495673_0000012_451053_451616 | 187 |
| 761 | 3300047470 | Ga0495681_0000334 | Ga0495681_0000334_16978_17541 | 187 |
| 762 | 3300047470 | Ga0495681_0006521 | Ga0495681_0006521_1102_1665 | 187 |
| 763 | 3300047470 | Ga0495681_0017619 | Ga0495681_0017619_3245_3808 | 187 |
| 764 | 3300047470 | Ga0495681_0040387 | Ga0495681_0040387_1429_1992 | 187 |
| 765 | 3300047470 | Ga0495681_0051071 | Ga0495681_0051071_1227_1790 | 187 |
| 766 | 3300047470 | Ga0495681_0103795 | Ga0495681_0103795_306_869 | 187 |
| 767 | 3300047470 | Ga0495681_0106784 | Ga0495681_0106784_31_594 | 187 |
| 768 | 3300047470 | Ga0495681_0183436 | Ga0495681_0183436_180_743 | 187 |
| 769 | 3300047472 | Ga0495686_0000328 | Ga0495686_0000328_6851_7414 | 187 |
| 770 | 3300047472 | Ga0495686_0000348 | Ga0495686_0000348_39198_39761 | 187 |
| 771 | 3300047472 | Ga0495686_0005295 | Ga0495686_0005295_2146_2709 | 187 |
| 772 | 3300047472 | Ga0495686_0010068 | Ga0495686_0010068_4970_5533 | 187 |
| 773 | 3300047472 | Ga0495686_0014249 | Ga0495686_0014249_4855_5418 | 187 |
| 774 | 3300047472 | Ga0495686_0064102 | Ga0495686_0064102_204_767 | 187 |
| 775 | 3300047673 | Ga0495593_0006069 | Ga0495593_0006069_6222_6785 | 187 |
| 776 | 3300047673 | Ga0495593_0009789 | Ga0495593_0009789_4006_4569 | 187 |
| 777 | 3300047673 | Ga0495593_0192943 | Ga0495593_0192943_267_830 | 187 |
| 778 | 3300048088 | Ga0495602_0013467 | Ga0495602_0013467_3232_3795 | 187 |
| 779 | 3300048088 | Ga0495602_0176287 | Ga0495602_0176287_871_1434 | 187 |
| 780 | 3300048089 | Ga0495614_0005972 | Ga0495614_0005972_4497_5060 | 187 |
| 781 | 3300048089 | Ga0495614_0016163 | Ga0495614_0016163_1742_2305 | 187 |
| 782 | 3300048089 | Ga0495614_0344157 | Ga0495614_0344157_121_684 | 187 |
| 783 | 3300048090 | Ga0495615_0028374 | Ga0495615_0028374_643_1206 | 187 |
| 784 | 3300048090 | Ga0495615_0031127 | Ga0495615_0031127_76_639 | 187 |
| 785 | 3300048091 | Ga0495626_0000021 | Ga0495626_0000021_184529_185092 | 187 |
| 786 | 3300048091 | Ga0495626_0000122 | Ga0495626_0000122_38999_39562 | 187 |
| 787 | 3300048091 | Ga0495626_0000793 | Ga0495626_0000793_2103_2666 | 187 |
| 788 | 3300048091 | Ga0495626_0004338 | Ga0495626_0004338_6462_7025 | 187 |
| 789 | 3300048091 | Ga0495626_0004682 | Ga0495626_0004682_6225_6788 | 187 |
| 790 | 3300048091 | Ga0495626_0006948 | Ga0495626_0006948_158_721 | 187 |
| 791 | 3300048091 | Ga0495626_0008530 | Ga0495626_0008530_987_1550 | 187 |
| 792 | 3300048091 | Ga0495626_0018719 | Ga0495626_0018719_745_1308 | 187 |
| 793 | 3300048091 | Ga0495626_0029526 | Ga0495626_0029526_250_813 | 187 |
| 794 | 3300048091 | Ga0495626_0031152 | Ga0495626_0031152_696_1259 | 187 |
| 795 | 3300048091 | Ga0495626_0067550 | Ga0495626_0067550_133_696 | 187 |
| 796 | 3300048091 | Ga0495626_0160534 | Ga0495626_0160534_41_604 | 187 |
| 797 | 3300048903 | Ga0496100_0062388 | Ga0496100_0062388_818_1381 | 187 |
| 798 | 3300048904 | Ga0496101_0068401 | Ga0496101_0068401_1898_2461 | 187 |
| 799 | 3300048905 | Ga0496102_0067868 | Ga0496102_0067868_1035_1598 | 187 |
| 800 | 3300048905 | Ga0496102_0167241 | Ga0496102_0167241_642_1205 | 187 |
| 801 | 3300048906 | Ga0496103_0002721 | Ga0496103_0002721_1128_1721 | 187 |
| 802 | 3300048906 | Ga0496103_0619770 | Ga0496103_0619770_37_600 | 187 |
| 803 | 3300048908 | Ga0496105_0024042 | Ga0496105_0024042_494_1057 | 187 |
| 804 | 3300048909 | Ga0496106_0017162 | Ga0496106_0017162_3222_3785 | 187 |
| 805 | 3300048913 | Ga0496110_0000085 | Ga0496110_0000085_31380_31943 | 187 |
| 806 | 3300048917 | Ga0496114_0086866 | Ga0496114_0086866_1984_2577 | 187 |
| 807 | 3300048918 | Ga0496115_0376539 | Ga0496115_0376539_214_777 | 187 |
| 808 | 3300048919 | Ga0496116_0045416 | Ga0496116_0045416_504_1067 | 187 |
| 809 | 3300048921 | Ga0496118_0184939 | Ga0496118_0184939_549_1112 | 187 |
| 810 | 3300048924 | Ga0496121_0083984 | Ga0496121_0083984_554_1117 | 187 |
| 811 | 3300048924 | Ga0496121_0147384 | Ga0496121_0147384_144_707 | 187 |
| 812 | 3300048925 | Ga0496122_0000432 | Ga0496122_0000432_42452_43015 | 187 |
| 813 | 3300048925 | Ga0496122_0015889 | Ga0496122_0015889_6196_6759 | 187 |
| 814 | 3300048925 | Ga0496122_0038127 | Ga0496122_0038127_64_627 | 187 |
| 815 | 3300048925 | Ga0496122_0052986 | Ga0496122_0052986_766_1329 | 187 |
| 816 | 3300048926 | Ga0496123_0000916 | Ga0496123_0000916_43795_44358 | 187 |
| 817 | 3300048926 | Ga0496123_0028342 | Ga0496123_0028342_3362_3925 | 187 |
| 818 | 3300048927 | Ga0496124_0006076 | Ga0496124_0006076_2686_3249 | 187 |
| 819 | 3300048927 | Ga0496124_0022498 | Ga0496124_0022498_2777_3340 | 187 |
| 820 | 3300048927 | Ga0496124_0069882 | Ga0496124_0069882_710_1273 | 187 |
| 821 | 3300048927 | Ga0496124_0096751 | Ga0496124_0096751_999_1562 | 187 |
| 822 | 3300048927 | Ga0496124_0432291 | Ga0496124_0432291_48_611 | 187 |
| 823 | 3300048928 | Ga0496125_0004178 | Ga0496125_0004178_746_1309 | 187 |
| 824 | 3300048928 | Ga0496125_0176876 | Ga0496125_0176876_250_813 | 187 |
| 825 | 3300048929 | Ga0496126_0010059 | Ga0496126_0010059_6101_6664 | 187 |
| 826 | 3300048929 | Ga0496126_0794417 | Ga0496126_0794417_16_579 | 187 |
| 827 | 3300049129 | Ga0501309_045099 | Ga0501309_045099_100_663 | 187 |
| 828 | 3300049131 | Ga0501341_04867 | Ga0501341_04867_154_747 | 187 |
| 829 | 3300049459 | Ga0495678_000027 | Ga0495678_000027_125454_126017 | 187 |
| 830 | 3300049459 | Ga0495678_000074 | Ga0495678_000074_35501_36064 | 187 |
| 831 | 3300049459 | Ga0495678_000123 | Ga0495678_000123_48058_48621 | 187 |
| 832 | 3300049459 | Ga0495678_000629 | Ga0495678_000629_24230_24793 | 187 |
| 833 | 3300049459 | Ga0495678_000758 | Ga0495678_000758_26598_27161 | 187 |
| 834 | 3300049459 | Ga0495678_001070 | Ga0495678_001070_21130_21693 | 187 |
| 835 | 3300049459 | Ga0495678_035865 | Ga0495678_035865_434_1123 | 187 |
| 836 | 3300049460 | Ga0495682_0005477 | Ga0495682_0005477_2571_3260 | 187 |
| 837 | 3300049460 | Ga0495682_0005610 | Ga0495682_0005610_2007_2696 | 187 |
| 838 | 3300049460 | Ga0495682_0010310 | Ga0495682_0010310_458_1021 | 187 |
| 839 | 3300049460 | Ga0495682_0016584 | Ga0495682_0016584_1959_2522 | 187 |
| 840 | 3300049527 | Ga0501311_013327 | Ga0501311_013327_361_924 | 187 |
| 841 | 3300049528 | Ga0501312_052893 | Ga0501312_052893_106_669 | 187 |
| 842 | 3300049539 | Ga0501323_038762 | Ga0501323_038762_82_645 | 187 |
| 843 | 3300049540 | Ga0501324_007101 | Ga0501324_007101_229_792 | 187 |
| 844 | 3300049550 | Ga0501334_11282 | Ga0501334_11282_79_642 | 187 |
| 845 | 3300049568 | Ga0501031_0007119 | Ga0501031_0007119_5399_5962 | 187 |
| 846 | 3300049570 | Ga0501033_0002135 | Ga0501033_0002135_14950_15513 | 187 |
| 847 | 3300049570 | Ga0501033_0008896 | Ga0501033_0008896_3036_3698 | 187 |
| 848 | 3300049571 | Ga0501034_0024529 | Ga0501034_0024529_1328_1891 | 187 |
| 849 | 3300049571 | Ga0501034_0067425 | Ga0501034_0067425_1136_1699 | 187 |
| 850 | 3300049572 | Ga0501036_0001322 | Ga0501036_0001322_3623_4186 | 187 |
| 851 | 3300049573 | Ga0501037_0009574 | Ga0501037_0009574_5264_5827 | 187 |
| 852 | 3300049573 | Ga0501037_0024614 | Ga0501037_0024614_2061_2624 | 187 |
| 853 | 3300049575 | Ga0501039_0207665 | Ga0501039_0207665_243_806 | 187 |
| 854 | 3300049579 | Ga0501043_0032180 | Ga0501043_0032180_92_655 | 187 |
| 855 | 3300049580 | Ga0501046_0051025 | Ga0501046_0051025_1890_2453 | 187 |
| 856 | 3300049580 | Ga0501046_0633988 | Ga0501046_0633988_92_655 | 187 |
| 857 | 3300049581 | Ga0501047_0400985 | Ga0501047_0400985_440_1003 | 187 |
| 858 | 3300049658 | Ga0501211_004776 | Ga0501211_004776_796_1359 | 187 |
| 859 | 3300049662 | Ga0501222_002410 | Ga0501222_002410_499_1062 | 187 |
| 860 | 3300049665 | Ga0501227_001086 | Ga0501227_001086_3056_3619 | 187 |
| 861 | 3300049671 | Ga0501238_009063 | Ga0501238_009063_387_950 | 187 |
| 862 | 3300049679 | Ga0501249_014752 | Ga0501249_014752_1067_1630 | 187 |
| 863 | 3300049682 | Ga0501252_003309 | Ga0501252_003309_458_1021 | 187 |
| 864 | 3300049766 | Ga0501269_000005 | Ga0501269_000005_10960_11523 | 187 |
| 865 | 3300049775 | Ga0501279_006482 | Ga0501279_006482_45_809 | 187 |
| 866 | 3300049822 | Ga0501035_0023268 | Ga0501035_0023268_3248_3811 | 187 |
| 867 | 3300049822 | Ga0501035_0030003 | Ga0501035_0030003_3291_3854 | 187 |
| 868 | 3300049823 | Ga0501044_0002016 | Ga0501044_0002016_3734_4297 | 187 |
| 869 | 3300049823 | Ga0501044_0123595 | Ga0501044_0123595_1753_2316 | 187 |
| 870 | 3300050489 | nmdc:mga03683_134594_c1 | nmdc:mga03683_134594_c1_338_931 | 187 |
| 871 | 3300050490 | nmdc:mga03n38_66912_c1 | nmdc:mga03n38_66912_c1_229_792 | 187 |
| 872 | 3300050491 | nmdc:mga00v17_281508_c1 | nmdc:mga00v17_281508_c1_437_1000 | 187 |
| 873 | 3300050492 | nmdc:mga0yw44_287106_c1 | nmdc:mga0yw44_287106_c1_102_665 | 187 |
| 874 | 3300050496 | nmdc:mga07m45_97008_c1 | nmdc:mga07m45_97008_c1_370_933 | 187 |
| 875 | 3300050507 | nmdc:mga05p37_188254_c1 | nmdc:mga05p37_188254_c1_52_615 | 187 |
| 876 | 3300050508 | nmdc:mga09592_124568_c1 | nmdc:mga09592_124568_c1_1437_2000 | 187 |
| 877 | 3300050509 | nmdc:mga0qj67_193520_c1 | nmdc:mga0qj67_193520_c1_514_1140 | 187 |
| 878 | 3300050510 | nmdc:mga06r32_56772_c1 | nmdc:mga06r32_56772_c1_746_1309 | 187 |
| 879 | 3300050510 | nmdc:mga06r32_84819_c1 | nmdc:mga06r32_84819_c1_2226_2852 | 187 |
| 880 | 3300050512 | nmdc:mga0n895_201011_c1 | nmdc:mga0n895_201011_c1_991_1554 | 187 |
| 881 | 3300050514 | nmdc:mga08x19_28573_c1 | nmdc:mga08x19_28573_c1_2858_3481 | 187 |
| 882 | 3300050515 | nmdc:mga0a205_494475_c1 | nmdc:mga0a205_494475_c1_235_846 | 187 |
| 883 | 3300050515 | nmdc:mga0a205_81512_c1 | nmdc:mga0a205_81512_c1_699_1262 | 187 |
| 884 | 3300053105 | Ga0500557_076903 | Ga0500557_076903_354_977 | 187 |
| 885 | 3300053118 | Ga0500594_0003538 | Ga0500594_0003538_527_1090 | 187 |
| 886 | 3300053125 | Ga0500618_000170 | Ga0500618_000170_1858_2481 | 187 |
| 887 | 3300053125 | Ga0500618_004583 | Ga0500618_004583_2564_3127 | 187 |
| 888 | 3300053125 | Ga0500618_016008 | Ga0500618_016008_588_1151 | 187 |
| 889 | 3300053141 | Ga0500574_020631 | Ga0500574_020631_767_1330 | 187 |
| 890 | 3300053145 | Ga0500586_000124 | Ga0500586_000124_9500_10063 | 187 |
| 891 | 3300053730 | Ga0500645_008848 | Ga0500645_008848_1774_2337 | 187 |
| 892 | 3300059477 | Ga0587084_023889 | Ga0587084_023889_253_816 | 187 |
| 893 | 3300059478 | Ga0587093_011893 | Ga0587093_011893_475_1038 | 187 |
| 894 | 3300059490 | Ga0587066_104437 | Ga0587066_104437_29_592 | 187 |
| 895 | 3300059491 | Ga0587070_010639 | Ga0587070_010639_558_1121 | 187 |
| 896 | 3300059493 | Ga0587077_020918 | Ga0587077_020918_428_991 | 187 |
| 897 | 3300059504 | Ga0587082_021985 | Ga0587082_021985_335_898 | 187 |
| 898 | 3300059506 | Ga0587085_007423 | Ga0587085_007423_671_1234 | 187 |
| 899 | 3300059507 | Ga0587086_012158 | Ga0587086_012158_382_945 | 187 |
| 900 | 3300059508 | Ga0587088_010905 | Ga0587088_010905_110_673 | 187 |
| 901 | 3300059509 | Ga0587089_011846 | Ga0587089_011846_102_665 | 187 |
| 902 | 3300059510 | Ga0587090_013564 | Ga0587090_013564_451_1014 | 187 |
| 903 | 3300059511 | Ga0587091_011376 | Ga0587091_011376_161_724 | 187 |
| 904 | 3300059512 | Ga0587092_030021 | Ga0587092_030021_141_704 | 187 |
| 905 | 3300059513 | Ga0587094_033948 | Ga0587094_033948_117_680 | 187 |
| 906 | 3300059602 | Ga0587074_02287 | Ga0587074_02287_19_582 | 187 |
| 907 | 3300059605 | Ga0587106_027761 | Ga0587106_027761_246_809 | 187 |
| 908 | 3300059607 | Ga0587125_006728 | Ga0587125_006728_389_952 | 187 |
| 909 | 3300059640 | Ga0587067_048078 | Ga0587067_048078_137_700 | 187 |
| 910 | 3300059641 | Ga0587068_005455 | Ga0587068_005455_381_944 | 187 |
| 911 | 3300059642 | Ga0587069_003311 | Ga0587069_003311_463_1026 | 187 |
| 912 | 3300059645 | Ga0587076_058884 | Ga0587076_058884_127_690 | 187 |
| 913 | 3300059646 | Ga0587078_028399 | Ga0587078_028399_82_645 | 187 |
| 914 | 3300059650 | Ga0587104_004414 | Ga0587104_004414_215_778 | 187 |
| 915 | 3300059652 | Ga0587107_026556 | Ga0587107_026556_198_761 | 187 |
| 916 | 3300060344 | Ga0587071_106542 | Ga0587071_106542_82_645 | 187 |
| 917 | 3300060346 | Ga0587111_0053327 | Ga0587111_0053327_188_751 | 187 |
| 918 | 3300061719 | Ga0466962_0025287 | Ga0466962_0025287_2059_2622 | 187 |
| 919 | 3300061719 | Ga0466962_0103455 | Ga0466962_0103455_199_768 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xrd-assembly1.cif.gz_C-2 | salmonella typhimurium ahpc w169f mutant | 0.9866 | 2 | 172 |
| 5uka-assembly1.cif.gz_B | salmonella typhimurium ahpc e49q mutant | 0.9837 | 2 | 165 |
| 3emp-assembly1.cif.gz_D-2 | crystal structure of the s-acetanilide modified form of c165s ahpc | 0.9824 | 2 | 163 |
| 4xrd-assembly1.cif.gz_C-2 | salmonella typhimurium ahpc w169f mutant | 0.981 | 2 | 172 |
| 4xts-assembly2.cif.gz_T | salmonella typhimurium ahpc t43a mutant | 0.9803 | 2 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4J2P7_61_260_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9568 | 1 | 183 | 3.40.30.10 |
| 5b8aJ00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9505 | 1 | 170 | 3.40.30.10 |
| 5b8aJ00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.945 | 1 | 170 | 3.40.30.10 |
| af_Q7JX87_151_219_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.942 | 144 | 178 | 3.30.1020.10 |
| 5dvbA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9413 | 4 | 182 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I1J208-F1-model_v4 | deleted | 0.9948 | 15 | 163 |
|
| AF-A0A7H4LXI5-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) | 0.9922 | 48 | 171 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A7S1HFU1-F1-model_v4 | Thioredoxin domain-containing protein | 0.9903 | 1 | 132 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A1H6CQD9-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) (Thioredoxin peroxidase) | 0.9894 | 4 | 163 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 GO:0102039 |
| AF-B1B6S9-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) (Thioredoxin peroxidase) | 0.9893 | 8 | 179 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 GO:0102039 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar