F485712

General Info

Members Datasets Scaffolds Average Seq Length
919 400 916 189

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_008876|Ga0495617_008876_2007_2696
Length 229
Sequence MVSLSPVDSQSQLNVLFQSIFQMAEKTLQWHLIDTQPHEETTMSLINTQVKPFKATAYHNGKFIDLSEESLKGKWSVFMFYPADFTFVCPTELEDLADFQPEFAKMGVDVYGISTDTHFAHKAWHDTSDAIKKVNYPLIGDPTGALSRNFEVMIEEEGLALRGTFVINPEGQIKVMEVHDNGIGRDASELMRKVKAAQYVAAHPGEVCPAKWTEGAATLTPSLDLVGKI

Samples

Sample ID Description Type Environment
1 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
2 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
3 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
27 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
34 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
37 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
40 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
123 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
206 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
207 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
208 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
227 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
230 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
239 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
277 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
301 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
310 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
347 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
348 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
349 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
350 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
351 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
352 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
353 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
369 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
370 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
371 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
372 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
373 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
374 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059602 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 15R_AD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.25
Metatranscriptomes 6.42
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.97
Nodule 0.33
Rhizoplane 1.31
Rhizosphere 82.15
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000750 3300002704 Bacteria 5474
2 JGI25156J39149_1000185 3300002705 Bacteria 45133
3 JGI25162J39368_1000038 3300002737 Bacteria 179049
4 JGI25162J39368_1004094 3300002737 Bacteria 3622
5 JGI25154J39366_1001907 3300002738 Bacteria 6306
6 JGI25154J39366_1004938 3300002738 Bacteria 2244
7 JGI25157J39369_1000284 3300002741 Bacteria 36859
8 JGI25157J39369_1000431 3300002741 Bacteria 27316
9 JGI25164J39214_1001783 3300002772 Bacteria 4184
10 JGI25150J39212_1001795 3300002774 Bacteria 5713
11 JGI25150J39212_1009348 3300002774 Bacteria 1871
12 Ga0006763J43179_101775 3300002870 Bacteria 1439
13 Ga0006762J43184_105387 3300002872 Bacteria 612
14 JGI25159J45721_1004023 3300002987 Bacteria 5005
15 Ga0006760J45825_103373 3300003158 Bacteria 614
16 Ga0006779J45831_107007 3300003160 Bacteria 620
17 Ga0006765J45826_104465 3300003161 Bacteria 613
18 Ga0006778J45830_1018011 3300003162 Bacteria 614
19 Ga0006778J45830_1046945 3300003162 Bacteria 880
20 Ga0006759J45824_1004153 3300003163 Bacteria 2393
21 Ga0006759J45824_1006275 3300003163 Bacteria 614
22 JGI25165J46597_1000045 3300003214 Bacteria 257539
23 JGI25153J46596_10021708 3300003215 Bacteria 2386
24 Ga0007428J48920_101749 3300003288 Bacteria 1082
25 Ga0006758J48902_1014592 3300003300 Bacteria 1147
26 Ga0006770J48903_1023283 3300003305 Bacteria 642
27 Ga0006770J48903_1026315 3300003305 Bacteria 603
28 Ga0006777J48905_1017375 3300003308 Bacteria 1106
29 Ga0006777J48905_1020868 3300003308 Bacteria 659
30 JGI25160J50197_1008040 3300003354 Bacteria 4054
31 JGI25161J50226_1018534 3300003374 Bacteria 721
32 Ga0007417J51691_1010995 3300003544 Bacteria 1487
33 Ga0006781J51513_1014323 3300003568 Bacteria 611
34 Ga0007410J51695_1033499 3300003574 Bacteria 1392
35 Ga0007416J51690_1088669 3300003577 Bacteria 891
36 Ga0032354_1015485 3300003693 Bacteria 2390
37 Ga0006780_1008912 3300003735 Bacteria 1121
38 Ga0055538_1000022 3300003751 Bacteria 257539
39 Ga0055538_1000085 3300003751 Bacteria 81616
40 Ga0055539_1000028 3300003752 Bacteria 257539
41 Ga0055539_1000126 3300003752 Bacteria 81616
42 Ga0055533_1000036 3300003756 Bacteria 257539
43 Ga0055533_1000133 3300003756 Bacteria 81616
44 Ga0055532_1000044 3300003758 Bacteria 191110
45 Ga0055525_1000071 3300003759 Bacteria 182624
46 Ga0055525_1000174 3300003759 Bacteria 81616
47 Ga0055535_1006579 3300003761 Bacteria 2329
48 Ga0055529_1000015 3300003763 Bacteria 366950
49 Ga0055526_1000007 3300003771 Bacteria 321998
50 Ga0055526_1000037 3300003771 Bacteria 134834
51 Ga0055526_1002076 3300003771 Bacteria 13758
52 Ga0055526_1003417 3300003771 Bacteria 10082
53 Ga0055537_1000236 3300003773 Bacteria 40412
54 Ga0055537_1020993 3300003773 Bacteria 979
55 Ga0055524_1022725 3300003775 Bacteria 2040
56 Ga0055534_1000544 3300003784 Bacteria 20117
57 Ga0055534_1003580 3300003784 Bacteria 4828
58 Ga0055528_1000136 3300003790 Bacteria 58873
59 Ga0055528_1005295 3300003790 Bacteria 6037
60 Ga0055530_10004518 3300003791 Bacteria 7125
61 Ga0055530_10013523 3300003791 Bacteria 2779
62 Ga0055531_10079968 3300003794 Bacteria 723
63 Ga0055541_1000037 3300003841 Bacteria 182624
64 Ga0055541_1000085 3300003841 Bacteria 81616
65 Ga0065165_1001295 3300005262 Bacteria 28121
66 Ga0068869_100665581 3300005334 Bacteria 885
67 Ga0070680_100256296 3300005336 Bacteria 1480
68 Ga0070680_100305247 3300005336 Bacteria 1350
69 Ga0068868_101190880 3300005338 Bacteria 704
70 Ga0070661_100033803 3300005344 Bacteria 3706
71 Ga0070661_100867724 3300005344 Bacteria 743
72 Ga0070668_100390125 3300005347 Bacteria 1187
73 Ga0070673_101084580 3300005364 Bacteria 748
74 Ga0070667_100022285 3300005367 Bacteria 5255
75 Ga0070663_100267735 3300005455 Bacteria 1357
76 Ga0070662_100288682 3300005457 Bacteria 1329
77 Ga0070681_10091379 3300005458 Bacteria 2994
78 Ga0068867_100136338 3300005459 Bacteria 1914
79 Ga0070684_100482892 3300005535 Bacteria 1147
80 Ga0070697_100056747 3300005536 Bacteria 3186
81 Ga0068853_100278514 3300005539 Bacteria 1542
82 Ga0070672_100451704 3300005543 Bacteria 1107
83 Ga0070696_100033584 3300005546 Bacteria 3526
84 Ga0070665_100137461 3300005548 Bacteria 2447
85 Ga0068855_100005477 3300005563 Bacteria 15488
86 Ga0070664_100024751 3300005564 Bacteria 4970
87 Ga0070664_100218481 3300005564 Bacteria 1705
88 Ga0068857_100145949 3300005577 Bacteria 2141
89 Ga0068854_100008400 3300005578 Bacteria 6636
90 Ga0068852_100000490 3300005616 Bacteria 25825
91 Ga0068852_100435513 3300005616 Bacteria 1295
92 Ga0068851_10042392 3300005834 Bacteria 2291
93 Ga0068851_10093296 3300005834 Bacteria 1588
94 Ga0068860_100299709 3300005843 Bacteria 1574
95 Ga0070717_10118214 3300006028 Bacteria 2268
96 Ga0075364_10230283 3300006051 Bacteria 1258
97 Ga0075362_10001657 3300006177 Bacteria 7222
98 Ga0075362_10017122 3300006177 Bacteria 2981
99 Ga0075362_10083266 3300006177 Bacteria 1477
100 Ga0075367_10012290 3300006178 Bacteria 4559
101 Ga0075369_10146400 3300006186 Bacteria 1078
102 Ga0075366_10019177 3300006195 Bacteria 3954
103 Ga0097621_100176540 3300006237 Bacteria 1844
104 Ga0075370_10053243 3300006353 Bacteria 2297
105 Ga0075370_10302848 3300006353 Bacteria 951
106 Ga0068871_100076765 3300006358 Bacteria 2760
107 Ga0075428_100172309 3300006844 Bacteria 2345
108 Ga0075430_100127705 3300006846 Bacteria 2120
109 Ga0075431_100300244 3300006847 Unclassified 1622
110 Ga0075431_100450548 3300006847 Bacteria 1283
111 Ga0075434_100055035 3300006871 Unclassified 3953
112 Ga0075429_100219007 3300006880 Bacteria 1668
113 Ga0068865_100233324 3300006881 Bacteria 1445
114 Ga0075436_100173885 3300006914 Unclassified 1521
115 Ga0079104_1017411 3300006946 Bacteria 2065
116 Ga0075435_100058404 3300007076 Bacteria 3124
117 Ga0105244_10000395 3300009036 Bacteria 40415
118 Ga0105244_10001280 3300009036 Bacteria 20628
119 Ga0105244_10038887 3300009036 Bacteria 2479
120 Ga0105244_10145558 3300009036 Bacteria 1137
121 Ga0105244_10147050 3300009036 Bacteria 1130
122 Ga0105240_10000523 3300009093 Bacteria 70721
123 Ga0105240_10212001 3300009093 Bacteria 2263
124 Ga0105240_10429712 3300009093 Bacteria 1482
125 Ga0105240_10449723 3300009093 Bacteria 1442
126 Ga0111539_10137917 3300009094 Bacteria 2857
127 Ga0114129_11106162 3300009147 Bacteria 992
128 Ga0105243_10246701 3300009148 Bacteria 1592
129 Ga0105241_10011217 3300009174 Bacteria 6569
130 Ga0105241_10865216 3300009174 Bacteria 837
131 Ga0105242_10093084 3300009176 Bacteria 2540
132 Ga0105242_10209812 3300009176 Unclassified 1735
133 Ga0105237_10041411 3300009545 Bacteria 4645
134 Ga0105237_10244489 3300009545 Bacteria 1796
135 Ga0105238_10000038 3300009551 Bacteria 162920
136 Ga0105238_10097218 3300009551 Bacteria 2930
137 Ga0105238_10527717 3300009551 Bacteria 1183
138 Ga0105249_11364383 3300009553 Bacteria 781
139 Ga0105239_10003685 3300010375 Bacteria 18679
140 Ga0105246_10265641 3300011119 Bacteria 1369
141 Ga0157373_10131749 3300013100 Bacteria 1758
142 Ga0157371_10000001 3300013102 Bacteria 1162285
143 Ga0157369_10314670 3300013105 Bacteria 1628
144 Ga0157374_10122216 3300013296 Bacteria 2514
145 Ga0157378_10031139 3300013297 Bacteria 4711
146 Ga0163162_10128902 3300013306 Bacteria 2638
147 Ga0157372_10336753 3300013307 Bacteria 1757
148 Ga0157372_10856653 3300013307 Bacteria 1055
149 Ga0157372_11445283 3300013307 Bacteria 792
150 Ga0157375_10033594 3300013308 Bacteria 4876
151 Ga0157380_10926951 3300014326 Unclassified 899
152 Ga0182008_10010891 3300014497 Bacteria 4851
153 Ga0157379_10107876 3300014968 Bacteria 2500
154 Ga0182006_1000023 3300015261 Bacteria 275031
155 Ga0182006_1002148 3300015261 Bacteria 10942
156 Ga0182006_1042983 3300015261 Bacteria 1768
157 Ga0182006_1070123 3300015261 Bacteria 1302
158 Ga0182006_1084355 3300015261 Bacteria 1154
159 Ga0182007_10007368 3300015262 Bacteria 4620
160 Ga0182007_10016147 3300015262 Bacteria 2763
161 Ga0182007_10068862 3300015262 Bacteria 1159
162 Ga0182007_10215338 3300015262 Bacteria 677
163 Ga0182005_1000154 3300015265 Bacteria 48125
164 Ga0182005_1001032 3300015265 Bacteria 11797
165 Ga0163161_10005395 3300017792 Bacteria 8879
166 Ga0197907_10354872 3300020069 Bacteria 707
167 Ga0206356_10412366 3300020070 Bacteria 999
168 Ga0206356_10770575 3300020070 Bacteria 671
169 Ga0206351_10185510 3300020077 Bacteria 791
170 Ga0213872_10000024 3300021361 Bacteria 155437
171 Ga0209435_100004 3300025206 Bacteria 633417
172 Ga0209436_101397 3300025208 Bacteria 8519
173 Ga0209436_109773 3300025208 Bacteria 1799
174 Ga0209784_100021 3300025224 Bacteria 408534
175 Ga0209784_100036 3300025224 Bacteria 263689
176 Ga0209566_100039 3300025225 Bacteria 303368
177 Ga0209566_100044 3300025225 Bacteria 263689
178 Ga0209674_100036 3300025226 Bacteria 408534
179 Ga0209674_100065 3300025226 Bacteria 263689
180 Ga0209147_100011 3300025229 Bacteria 702140
181 Ga0209563_100007 3300025230 Bacteria 1579402
182 Ga0209563_100040 3300025230 Bacteria 408534
183 Ga0209563_100063 3300025230 Bacteria 263689
184 Ga0207427_101732 3300025231 Bacteria 7176
185 Ga0209437_100082 3300025233 Bacteria 263689
186 Ga0209437_100282 3300025233 Bacteria 74881
187 Ga0209258_100421 3300025242 Bacteria 50393
188 Ga0207425_1000009 3300025245 Bacteria 593135
189 Ga0207425_1005726 3300025245 Bacteria 3502
190 Ga0209646_1000125 3300025246 Bacteria 135847
191 Ga0209646_1000149 3300025246 Bacteria 100004
192 Ga0209026_1000409 3300025250 Bacteria 37382
193 Ga0209677_100023 3300025253 Bacteria 408534
194 Ga0209677_100038 3300025253 Bacteria 263689
195 Ga0209677_102916 3300025253 Bacteria 5986
196 Ga0209148_1000760 3300025254 Bacteria 24607
197 Ga0209759_1000182 3300025256 Bacteria 102836
198 Ga0209129_1000198 3300025258 Bacteria 78327
199 Ga0209233_1000109 3300025261 Bacteria 263689
200 Ga0209565_1000082 3300025263 Bacteria 154452
201 Ga0209565_1000493 3300025263 Bacteria 28875
202 Ga0209565_1004404 3300025263 Bacteria 4290
203 Ga0209455_1000031 3300025272 Bacteria 519952
204 Ga0209455_1002933 3300025272 Bacteria 6286
205 Ga0209673_1000381 3300025273 Bacteria 80068
206 Ga0209673_1007566 3300025273 Bacteria 4975
207 Ga0209130_1000016 3300025284 Bacteria 395540
208 Ga0209130_1005385 3300025284 Bacteria 4457
209 Ga0209675_1000166 3300025291 Bacteria 80138
210 Ga0209675_1008144 3300025291 Bacteria 3901
211 Ga0209564_1000010 3300025295 Bacteria 885399
212 Ga0209564_1000042 3300025295 Bacteria 392805
213 Ga0209564_1000959 3300025295 Bacteria 36638
214 Ga0209564_1001111 3300025295 Bacteria 31685
215 Ga0209564_1001315 3300025295 Bacteria 26597
216 Ga0209564_1021895 3300025295 Bacteria 2279
217 Ga0209758_1000054 3300025297 Bacteria 337655
218 Ga0209758_1001194 3300025297 Bacteria 32812
219 Ga0209050_1000086 3300025298 Bacteria 262009
220 Ga0209050_1018392 3300025298 Bacteria 2717
221 Ga0209256_1000380 3300025299 Bacteria 70995
222 Ga0209256_1016020 3300025299 Bacteria 2582
223 Ga0207426_1001363 3300025302 Bacteria 20709
224 Ga0209051_1036875 3300025303 Bacteria 1800
225 Ga0209257_1000087 3300025304 Bacteria 282503
226 Ga0207656_10122449 3300025321 Bacteria 1212
227 Ga0207655_1005987 3300025728 Bacteria 8137
228 Ga0207655_1009515 3300025728 Bacteria 6023
229 Ga0207655_1114016 3300025728 Bacteria 907
230 Ga0207642_10164971 3300025899 Unclassified 1193
231 Ga0207647_10462323 3300025904 Bacteria 710
232 Ga0207705_10030888 3300025909 Bacteria 3823
233 Ga0207654_10003822 3300025911 Bacteria 7591
234 Ga0207695_10001573 3300025913 Bacteria 37174
235 Ga0207695_10004969 3300025913 Bacteria 17900
236 Ga0207695_10129096 3300025913 Bacteria 2486
237 Ga0207695_10437674 3300025913 Bacteria 1191
238 Ga0207671_10006537 3300025914 Bacteria 10360
239 Ga0207671_10394232 3300025914 Bacteria 1101
240 Ga0207671_10708886 3300025914 Bacteria 800
241 Ga0207660_10121190 3300025917 Bacteria 1981
242 Ga0207660_10268426 3300025917 Bacteria 1351
243 Ga0207694_10000069 3300025924 Bacteria 124500
244 Ga0207706_10368648 3300025933 Bacteria 1247
245 Ga0207686_10135781 3300025934 Bacteria 1693
246 Ga0207704_10308452 3300025938 Bacteria 1215
247 Ga0207691_10413066 3300025940 Bacteria 1150
248 Ga0207711_10517522 3300025941 Bacteria 1112
249 Ga0207689_10290865 3300025942 Bacteria 1353
250 Ga0207679_10019920 3300025945 Bacteria 4518
251 Ga0207679_10228086 3300025945 Bacteria 1571
252 Ga0207679_10230672 3300025945 Bacteria 1563
253 Ga0207667_10000043 3300025949 Bacteria 261426
254 Ga0207667_10096117 3300025949 Bacteria 3057
255 Ga0207640_10587851 3300025981 Bacteria 941
256 Ga0207658_10015319 3300025986 Bacteria 5260
257 Ga0207677_10250407 3300026023 Bacteria 1438
258 Ga0207702_10171311 3300026078 Bacteria 1991
259 Ga0207702_10590972 3300026078 Bacteria 1089
260 Ga0207683_10189622 3300026121 Bacteria 1866
261 Ga0207698_10004855 3300026142 Bacteria 8238
262 Ga0209281_1005985 3300027111 Bacteria 3247
263 Ga0209281_1023398 3300027111 Bacteria 1172
264 Ga0268266_10102650 3300028379 Bacteria 2523
265 Ga0268264_10147278 3300028381 Bacteria 2107
266 Ga0307515_10073112 3300028794 Bacteria 4614
267 Ga0316181_1164203 3300030744 Bacteria 2209
268 Ga0265332_10036377 3300031238 Bacteria 2137
269 Ga0307509_10007371 3300031507 Bacteria 14396
270 Ga0307516_10467000 3300031730 Bacteria 917
271 Ga0307518_10006545 3300031838 Bacteria 8362
272 Ga0307406_10453065 3300031901 Bacteria 1030
273 Ga0307416_100000420 3300032002 Bacteria 21577
274 Ga0307416_100941845 3300032002 Bacteria 965
275 Ga0307414_10048175 3300032004 Bacteria 2938
276 Ga0316596_1166449 3300033541 Bacteria 608
277 Ga0373926_0082278 3300035083 Unclassified 1192
278 Ga0373932_0063100 3300035112 Bacteria 1131
279 Ga0373936_0338617 3300035113 Bacteria 684
280 Ga0316574_0235938 3300035398 Bacteria 1170
281 Ga0395899_0000028 3300037312 Bacteria 334378
282 Ga0395900_0000349 3300037418 Bacteria 67520
283 Ga0395900_0051074 3300037418 Bacteria 4259
284 Ga0395898_0351504 3300037466 Bacteria 1405
285 Ga0395898_0390193 3300037466 Bacteria 1327
286 Ga0395898_0933006 3300037466 Bacteria 805
287 Ga0395905_0346467 3300037471 Bacteria 1377
288 Ga0395901_0000123 3300038443 Bacteria 99904
289 Ga0400489_02039 3300039093 Bacteria 6950
290 Ga0400489_25670 3300039093 Archaea 46327
291 Ga0436361_0224368 3300039447 Bacteria 99317
292 Ga0451787_231606 3300041441 Bacteria 730
293 Ga0439448_0095177 3300042005 Bacteria 1008
294 Ga0439448_0203634 3300042005 Bacteria 694
295 Ga0439449_0021318 3300042007 Bacteria 2426
296 Ga0439450_003650 3300042008 Bacteria 2566
297 Ga0439455_0002195 3300042012 Bacteria 3492
298 Ga0450919_005688 3300042121 Bacteria 1491
299 Ga0450891_013123 3300042129 Bacteria 776
300 Ga0450904_000892 3300042139 Bacteria 4836
301 Ga0450918_000815 3300042531 Bacteria 6539
302 Ga0451577_0000552 3300042876 Bacteria 61090
303 Ga0451577_0004172 3300042876 Bacteria 15444
304 Ga0451577_0019726 3300042876 Bacteria 6197
305 Ga0451577_0068112 3300042876 Bacteria 3175
306 Ga0451577_0649713 3300042876 Unclassified 956
307 Ga0466972_0015994 3300044658 Bacteria 3750
308 Ga0453683_0000281 3300044673 Bacteria 66440
309 Ga0453683_0010844 3300044673 Bacteria 6031
310 Ga0453683_0289311 3300044673 Unclassified 1047
311 Ga0466965_0029343 3300044683 Bacteria 2676
312 Ga0466965_0198819 3300044683 Bacteria 1062
313 Ga0466965_0413048 3300044683 Bacteria 747
314 Ga0466966_0082484 3300044684 Bacteria 2001
315 Ga0466961_0031725 3300044693 Bacteria 3397
316 Ga0466963_0024119 3300044694 Bacteria 3871
317 Ga0466964_0000242 3300044706 Bacteria 15752
318 Ga0466964_0001121 3300044706 Bacteria 9005
319 Ga0453684_0000008 3300044712 Bacteria 1200052
320 Ga0453684_0000009 3300044712 Bacteria 1139914
321 Ga0453684_0000135 3300044712 Bacteria 324341
322 Ga0453684_0000423 3300044712 Bacteria 172550
323 Ga0453684_0001387 3300044712 Bacteria 70112
324 Ga0453684_0004817 3300044712 Bacteria 27748
325 Ga0453684_0028098 3300044712 Bacteria 8042
326 Ga0453684_0187659 3300044712 Bacteria 2421
327 Ga0453684_0685564 3300044712 Bacteria 1115
328 Ga0466971_0033767 3300044719 Bacteria 2292
329 Ga0466971_0037630 3300044719 Bacteria 2169
330 Ga0466968_0003991 3300044735 Bacteria 5483
331 Ga0466968_0125330 3300044735 Bacteria 1165
332 Ga0466968_0221906 3300044735 Bacteria 890
333 Ga0466970_0243609 3300044765 Bacteria 1006
334 Ga0466957_0034706 3300044842 Bacteria 3025
335 Ga0466959_0229032 3300045049 Bacteria 1287
336 Ga0451576_0000062 3300045051 Bacteria 284262
337 Ga0451576_0000154 3300045051 Bacteria 175525
338 Ga0451576_0066973 3300045051 Bacteria 3738
339 Ga0451576_0217332 3300045051 Bacteria 1996
340 Ga0451576_0312378 3300045051 Bacteria 1644
341 Ga0451576_0664722 3300045051 Bacteria 1095
342 Ga0466958_0102810 3300045836 Bacteria 1778
343 Ga0466958_0224251 3300045836 Bacteria 1199
344 Ga0466967_0178373 3300045976 Bacteria 2002
345 Ga0495617_000008 3300046452 Bacteria 340369
346 Ga0495617_000020 3300046452 Bacteria 230257
347 Ga0495617_000153 3300046452 Bacteria 44371
348 Ga0495617_000232 3300046452 Bacteria 33751
349 Ga0495617_008876 3300046452 Bacteria 3459
350 Ga0495627_000004 3300046453 Bacteria 640612
351 Ga0495627_000490 3300046453 Bacteria 33194
352 Ga0495627_018393 3300046453 Bacteria 2357
353 Ga0495603_0002723 3300046455 Bacteria 10420
354 Ga0495603_0081925 3300046455 Bacteria 1890
355 Ga0495603_0515566 3300046455 Bacteria 685
356 Ga0495590_0000039 3300046457 Bacteria 126693
357 Ga0495590_0000047 3300046457 Bacteria 117260
358 Ga0495590_0006258 3300046457 Bacteria 4658
359 Ga0495590_0026792 3300046457 Bacteria 2022
360 Ga0495591_000091 3300046458 Bacteria 101618
361 Ga0495629_0012836 3300046459 Bacteria 6060
362 Ga0495629_0035893 3300046459 Bacteria 3502
363 Ga0495629_0041206 3300046459 Bacteria 3249
364 Ga0495638_0000407 3300046460 Bacteria 52515
365 Ga0495638_0004498 3300046460 Bacteria 10563
366 Ga0495638_0030712 3300046460 Bacteria 3456
367 Ga0495638_0081596 3300046460 Bacteria 1963
368 Ga0495651_0048412 3300046462 Bacteria 3283
369 Ga0495651_0052558 3300046462 Bacteria 3137
370 Ga0495653_0000035 3300046463 Bacteria 129875
371 Ga0495653_0023979 3300046463 Bacteria 4922
372 Ga0495653_0024510 3300046463 Bacteria 4860
373 Ga0495653_0034641 3300046463 Bacteria 3990
374 Ga0495650_0000128 3300046471 Bacteria 177256
375 Ga0495650_0000157 3300046471 Bacteria 155023
376 Ga0495650_0000261 3300046471 Bacteria 101830
377 Ga0495650_0000576 3300046471 Bacteria 51317
378 Ga0495650_0000650 3300046471 Bacteria 45757
379 Ga0495650_0000970 3300046471 Bacteria 32845
380 Ga0495650_0007876 3300046471 Bacteria 6326
381 Ga0495650_0026596 3300046471 Bacteria 2688
382 Ga0495580_0153631 3300046472 Bacteria 1594
383 Ga0495582_0003440 3300046473 Bacteria 8923
384 Ga0495582_0007750 3300046473 Bacteria 5936
385 Ga0495582_0196839 3300046473 Bacteria 1150
386 Ga0495605_0000096 3300046474 Bacteria 111460
387 Ga0495605_0000239 3300046474 Bacteria 65496
388 Ga0495605_0005839 3300046474 Bacteria 7118
389 Ga0495605_0037164 3300046474 Bacteria 2451
390 Ga0495605_0042662 3300046474 Bacteria 2253
391 Ga0495605_0046257 3300046474 Bacteria 2140
392 Ga0495605_0049462 3300046474 Bacteria 2054
393 Ga0495605_0050603 3300046474 Bacteria 2026
394 Ga0495605_0066793 3300046474 Bacteria 1707
395 Ga0495605_0146157 3300046474 Bacteria 1057
396 Ga0495605_0157745 3300046474 Bacteria 1008
397 Ga0495605_0223725 3300046474 Bacteria 812
398 Ga0495584_0000008 3300046491 Bacteria 283067
399 Ga0495584_0000085 3300046491 Bacteria 65081
400 Ga0495584_0000661 3300046491 Bacteria 22906
401 Ga0495584_0000702 3300046491 Bacteria 22129
402 Ga0495584_0007961 3300046491 Bacteria 5507
403 Ga0495584_0018702 3300046491 Bacteria 3522
404 Ga0495584_0021242 3300046491 Bacteria 3297
405 Ga0495584_0028932 3300046491 Bacteria 2808
406 Ga0495584_0074750 3300046491 Bacteria 1703
407 Ga0495585_0000175 3300046492 Bacteria 69100
408 Ga0495585_0000410 3300046492 Bacteria 41579
409 Ga0495585_0000558 3300046492 Bacteria 35206
410 Ga0495585_0000739 3300046492 Bacteria 29079
411 Ga0495585_0001146 3300046492 Bacteria 21646
412 Ga0495585_0002326 3300046492 Bacteria 13689
413 Ga0495585_0004740 3300046492 Bacteria 8753
414 Ga0495585_0006142 3300046492 Bacteria 7495
415 Ga0495585_0006680 3300046492 Bacteria 7127
416 Ga0495585_0012864 3300046492 Bacteria 4918
417 Ga0495585_0021010 3300046492 Bacteria 3749
418 Ga0495585_0021598 3300046492 Bacteria 3695
419 Ga0495585_0025762 3300046492 Bacteria 3365
420 Ga0495585_0029234 3300046492 Bacteria 3138
421 Ga0495585_0044924 3300046492 Bacteria 2466
422 Ga0495585_0053045 3300046492 Bacteria 2244
423 Ga0495585_0086112 3300046492 Bacteria 1697
424 Ga0495585_0086515 3300046492 Bacteria 1693
425 Ga0495585_0132041 3300046492 Bacteria 1313
426 Ga0495585_0176218 3300046492 Bacteria 1101
427 Ga0495594_0006303 3300046499 Bacteria 6102
428 Ga0495594_0013500 3300046499 Bacteria 4267
429 Ga0495594_0034800 3300046499 Bacteria 2741
430 Ga0495594_0068173 3300046499 Bacteria 1975
431 Ga0495594_0141171 3300046499 Bacteria 1366
432 Ga0495596_0000646 3300046500 Bacteria 21880
433 Ga0495596_0001510 3300046500 Bacteria 13308
434 Ga0495596_0002243 3300046500 Bacteria 10519
435 Ga0495596_0012883 3300046500 Bacteria 3565
436 Ga0495596_0020544 3300046500 Bacteria 2702
437 Ga0495596_0035281 3300046500 Bacteria 1983
438 Ga0495596_0079897 3300046500 Bacteria 1269
439 Ga0495607_0000554 3300046501 Bacteria 36542
440 Ga0495607_0000669 3300046501 Bacteria 33225
441 Ga0495607_0005056 3300046501 Bacteria 9559
442 Ga0495607_0005864 3300046501 Bacteria 8727
443 Ga0495607_0008086 3300046501 Bacteria 7219
444 Ga0495607_0012656 3300046501 Bacteria 5559
445 Ga0495607_0012665 3300046501 Bacteria 5557
446 Ga0495607_0016637 3300046501 Bacteria 4743
447 Ga0495607_0055955 3300046501 Bacteria 2266
448 Ga0495607_0159208 3300046501 Bacteria 1148
449 Ga0495607_0263473 3300046501 Bacteria 824
450 Ga0495583_0000115 3300046506 Bacteria 135762
451 Ga0495583_0000141 3300046506 Bacteria 121899
452 Ga0495583_0000981 3300046506 Bacteria 32711
453 Ga0495583_0001163 3300046506 Bacteria 28607
454 Ga0495583_0001485 3300046506 Bacteria 23452
455 Ga0495583_0030694 3300046506 Bacteria 2613
456 Ga0495583_0037677 3300046506 Bacteria 2290
457 Ga0495583_0068455 3300046506 Bacteria 1565
458 Ga0495606_0000180 3300046507 Bacteria 111330
459 Ga0495606_0000228 3300046507 Bacteria 99761
460 Ga0495606_0000512 3300046507 Bacteria 63012
461 Ga0495606_0000828 3300046507 Bacteria 46954
462 Ga0495606_0000829 3300046507 Bacteria 46771
463 Ga0495606_0000850 3300046507 Bacteria 45884
464 Ga0495606_0001374 3300046507 Bacteria 32916
465 Ga0495606_0002886 3300046507 Bacteria 19000
466 Ga0495606_0003647 3300046507 Bacteria 16153
467 Ga0495606_0006698 3300046507 Bacteria 10556
468 Ga0495606_0030597 3300046507 Bacteria 3758
469 Ga0495606_0042288 3300046507 Bacteria 3048
470 Ga0495606_0050086 3300046507 Bacteria 2734
471 Ga0495606_0084295 3300046507 Bacteria 1968
472 Ga0495606_0180206 3300046507 Bacteria 1218
473 Ga0495608_0033832 3300046511 Bacteria 3452
474 Ga0495610_0003299 3300046512 Bacteria 12699
475 Ga0495610_0003645 3300046512 Bacteria 11860
476 Ga0495610_0009819 3300046512 Bacteria 5999
477 Ga0495610_0017488 3300046512 Bacteria 4085
478 Ga0495610_0085695 3300046512 Bacteria 1437
479 Ga0495616_0000120 3300046513 Bacteria 68995
480 Ga0495616_0000990 3300046513 Bacteria 20371
481 Ga0495616_0001050 3300046513 Bacteria 19718
482 Ga0495616_0004042 3300046513 Bacteria 9317
483 Ga0495616_0004864 3300046513 Bacteria 8402
484 Ga0495616_0008919 3300046513 Bacteria 5892
485 Ga0495616_0017909 3300046513 Bacteria 3902
486 Ga0495616_0029802 3300046513 Bacteria 2876
487 Ga0495616_0044553 3300046513 Bacteria 2249
488 Ga0495616_0049234 3300046513 Bacteria 2113
489 Ga0495616_0053260 3300046513 Bacteria 2011
490 Ga0495620_0011899 3300046515 Bacteria 4521
491 Ga0495631_0000300 3300046518 Bacteria 34686
492 Ga0495631_0003792 3300046518 Bacteria 8223
493 Ga0495631_0005692 3300046518 Bacteria 6500
494 Ga0495631_0008274 3300046518 Bacteria 5244
495 Ga0495631_0024426 3300046518 Bacteria 2790
496 Ga0495631_0039073 3300046518 Bacteria 2107
497 Ga0495631_0063056 3300046518 Bacteria 1605
498 Ga0495631_0070367 3300046518 Bacteria 1512
499 Ga0495632_0000094 3300046519 Bacteria 90132
500 Ga0495632_0000141 3300046519 Bacteria 73806
501 Ga0495632_0000456 3300046519 Bacteria 38959
502 Ga0495632_0000458 3300046519 Bacteria 38853
503 Ga0495632_0002459 3300046519 Bacteria 14095
504 Ga0495632_0030953 3300046519 Bacteria 2771
505 Ga0495637_0000004 3300046520 Bacteria 589740
506 Ga0495637_0000142 3300046520 Bacteria 54212
507 Ga0495637_0001262 3300046520 Bacteria 15277
508 Ga0495637_0012374 3300046520 Bacteria 4083
509 Ga0495637_0054858 3300046520 Bacteria 1654
510 Ga0495643_0000082 3300046522 Bacteria 159651
511 Ga0495643_0000160 3300046522 Bacteria 107502
512 Ga0495643_0000822 3300046522 Bacteria 33822
513 Ga0495643_0005425 3300046522 Bacteria 8627
514 Ga0495643_0044587 3300046522 Bacteria 2409
515 Ga0495643_0093163 3300046522 Bacteria 1551
516 Ga0495644_0002967 3300046523 Bacteria 6724
517 Ga0495644_0007916 3300046523 Bacteria 4090
518 Ga0495644_0009102 3300046523 Bacteria 3824
519 Ga0495644_0015551 3300046523 Bacteria 2914
520 Ga0495644_0027834 3300046523 Bacteria 2140
521 Ga0495644_0041211 3300046523 Bacteria 1739
522 Ga0495644_0042956 3300046523 Bacteria 1701
523 Ga0495644_0083888 3300046523 Bacteria 1201
524 Ga0495644_0101265 3300046523 Bacteria 1090
525 Ga0495648_0000019 3300046524 Bacteria 276407
526 Ga0495648_0000030 3300046524 Bacteria 216178
527 Ga0495648_0001166 3300046524 Bacteria 26539
528 Ga0495648_0007615 3300046524 Bacteria 8643
529 Ga0495648_0007994 3300046524 Bacteria 8387
530 Ga0495648_0016105 3300046524 Bacteria 5395
531 Ga0495648_0162972 3300046524 Bacteria 1150
532 Ga0495663_0015304 3300046525 Bacteria 2160
533 Ga0495663_0022922 3300046525 Bacteria 1806
534 Ga0495663_0033891 3300046525 Bacteria 1526
535 Ga0495666_0002786 3300046526 Bacteria 8735
536 Ga0495666_0008506 3300046526 Bacteria 5146
537 Ga0495666_0056067 3300046526 Bacteria 1888
538 Ga0495642_0000271 3300046528 Bacteria 29218
539 Ga0495642_0000806 3300046528 Bacteria 15208
540 Ga0495642_0010238 3300046528 Bacteria 3591
541 Ga0495642_0020073 3300046528 Bacteria 2621
542 Ga0495642_0031119 3300046528 Bacteria 2139
543 Ga0495642_0033364 3300046528 Bacteria 2069
544 Ga0495642_0034743 3300046528 Bacteria 2032
545 Ga0495642_0040216 3300046528 Bacteria 1898
546 Ga0495652_0132760 3300046529 Bacteria 1968
547 Ga0495652_0177819 3300046529 Bacteria 1636
548 Ga0495654_0000014 3300046530 Bacteria 312126
549 Ga0495654_0011998 3300046530 Bacteria 4668
550 Ga0495654_0035958 3300046530 Bacteria 2491
551 Ga0495654_0052510 3300046530 Bacteria 1984
552 Ga0495665_0048107 3300046531 Bacteria 2261
553 Ga0495640_0258966 3300046533 Bacteria 1087
554 Ga0495586_0011018 3300046535 Bacteria 4803
555 Ga0495586_0151531 3300046535 Bacteria 1304
556 Ga0495587_0007968 3300046536 Bacteria 6844
557 Ga0495587_0123277 3300046536 Bacteria 1483
558 Ga0495609_0000021 3300046538 Bacteria 281770
559 Ga0495609_0000813 3300046538 Bacteria 23272
560 Ga0495609_0002273 3300046538 Bacteria 11979
561 Ga0495609_0006554 3300046538 Bacteria 5931
562 Ga0495609_0006887 3300046538 Bacteria 5741
563 Ga0495609_0040246 3300046538 Bacteria 2103
564 Ga0495609_0055718 3300046538 Bacteria 1753
565 Ga0495609_0165475 3300046538 Bacteria 935
566 Ga0495597_0000364 3300046542 Bacteria 40081
567 Ga0495597_0000544 3300046542 Bacteria 31260
568 Ga0495597_0001183 3300046542 Bacteria 19572
569 Ga0495597_0002172 3300046542 Bacteria 12873
570 Ga0495597_0005834 3300046542 Bacteria 6441
571 Ga0495597_0029465 3300046542 Bacteria 2505
572 Ga0495597_0042859 3300046542 Bacteria 2016
573 Ga0495597_0049952 3300046542 Bacteria 1847
574 Ga0495645_0258422 3300046543 Bacteria 1154
575 Ga0495622_0000034 3300046557 Bacteria 123671
576 Ga0495622_0000071 3300046557 Bacteria 89071
577 Ga0495622_0003694 3300046557 Bacteria 7166
578 Ga0495622_0104216 3300046557 Bacteria 1299
579 Ga0495622_0111315 3300046557 Bacteria 1253
580 Ga0495622_0132976 3300046557 Bacteria 1132
581 Ga0495633_0000077 3300046558 Bacteria 129051
582 Ga0495633_0000100 3300046558 Bacteria 116284
583 Ga0495633_0000764 3300046558 Bacteria 28938
584 Ga0495633_0003422 3300046558 Bacteria 10566
585 Ga0495633_0004475 3300046558 Bacteria 8872
586 Ga0495633_0006936 3300046558 Bacteria 6622
587 Ga0495633_0007251 3300046558 Bacteria 6416
588 Ga0495633_0038051 3300046558 Bacteria 2299
589 Ga0495633_0064906 3300046558 Bacteria 1706
590 Ga0495633_0096202 3300046558 Bacteria 1375
591 Ga0495633_0136701 3300046558 Bacteria 1133
592 Ga0495633_0240248 3300046558 Bacteria 827
593 Ga0495656_0000543 3300046615 Bacteria 12320
594 Ga0495656_0105001 3300046615 Bacteria 1312
595 Ga0495668_0000220 3300046616 Bacteria 83065
596 Ga0495668_0000231 3300046616 Bacteria 79433
597 Ga0495668_0000308 3300046616 Bacteria 67599
598 Ga0495668_0000351 3300046616 Bacteria 61353
599 Ga0495668_0000481 3300046616 Bacteria 50057
600 Ga0495668_0000602 3300046616 Bacteria 43544
601 Ga0495668_0011582 3300046616 Bacteria 5273
602 Ga0495668_0029703 3300046616 Bacteria 3088
603 Ga0495668_0056336 3300046616 Bacteria 2169
604 Ga0495668_0060496 3300046616 Bacteria 2089
605 Ga0495668_0063701 3300046616 Bacteria 2030
606 Ga0495668_0070764 3300046616 Bacteria 1918
607 Ga0495668_0407178 3300046616 Bacteria 747
608 Ga0495634_0015257 3300046642 Bacteria 5524
609 Ga0495611_0000503 3300046648 Bacteria 23232
610 Ga0495611_0000909 3300046648 Bacteria 16011
611 Ga0495611_0024824 3300046648 Bacteria 2608
612 Ga0495611_0028021 3300046648 Bacteria 2466
613 Ga0495611_0044133 3300046648 Bacteria 1993
614 Ga0495611_0061386 3300046648 Bacteria 1708
615 Ga0495611_0072854 3300046648 Bacteria 1572
616 Ga0495611_0095972 3300046648 Bacteria 1372
617 Ga0495611_0147461 3300046648 Bacteria 1098
618 Ga0495625_0001111 3300046660 Bacteria 34888
619 Ga0495625_0005276 3300046660 Bacteria 11861
620 Ga0495625_0007701 3300046660 Bacteria 9322
621 Ga0495625_0009390 3300046660 Bacteria 8188
622 Ga0495625_0015253 3300046660 Bacteria 6094
623 Ga0495625_0025935 3300046660 Bacteria 4435
624 Ga0495625_0039518 3300046660 Bacteria 3444
625 Ga0495625_0057433 3300046660 Bacteria 2767
626 Ga0495625_0071775 3300046660 Bacteria 2429
627 Ga0495625_0348237 3300046660 Bacteria 937
628 Ga0495635_0004579 3300046663 Bacteria 9592
629 Ga0495635_0059679 3300046663 Bacteria 2623
630 Ga0495659_0000049 3300046664 Bacteria 52682
631 Ga0495659_0003870 3300046664 Bacteria 4753
632 Ga0495659_0330252 3300046664 Bacteria 649
633 Ga0495661_0000091 3300046665 Bacteria 110008
634 Ga0495661_0000798 3300046665 Bacteria 29791
635 Ga0495661_0001154 3300046665 Bacteria 23052
636 Ga0495661_0001188 3300046665 Bacteria 22605
637 Ga0495661_0002171 3300046665 Bacteria 15317
638 Ga0495661_0009106 3300046665 Bacteria 6826
639 Ga0495661_0010564 3300046665 Bacteria 6295
640 Ga0495661_0027413 3300046665 Bacteria 3657
641 Ga0495661_0039244 3300046665 Bacteria 2943
642 Ga0495661_0049487 3300046665 Bacteria 2548
643 Ga0495661_0051007 3300046665 Bacteria 2500
644 Ga0495661_0052095 3300046665 Bacteria 2467
645 Ga0495661_0062056 3300046665 Bacteria 2215
646 Ga0495661_0093967 3300046665 Bacteria 1700
647 Ga0495661_0094514 3300046665 Bacteria 1694
648 Ga0495661_0172683 3300046665 Bacteria 1151
649 Ga0495588_0000083 3300046674 Bacteria 197018
650 Ga0495588_0067699 3300046674 Bacteria 1853
651 Ga0495588_0072611 3300046674 Bacteria 1790
652 Ga0495588_0076325 3300046674 Bacteria 1746
653 Ga0495588_0107813 3300046674 Bacteria 1466
654 Ga0495599_0007003 3300046678 Bacteria 6820
655 Ga0495623_0047900 3300046679 Bacteria 2712
656 Ga0495623_0127018 3300046679 Bacteria 1530
657 Ga0495646_0031412 3300046680 Bacteria 3309
658 Ga0495646_0045634 3300046680 Bacteria 2676
659 Ga0495669_0000085 3300046684 Bacteria 62167
660 Ga0495669_0005609 3300046684 Bacteria 5237
661 Ga0495669_0005856 3300046684 Bacteria 5125
662 Ga0495669_0033307 3300046684 Bacteria 2267
663 Ga0495669_0325855 3300046684 Bacteria 741
664 Ga0495613_0021032 3300046689 Bacteria 4864
665 Ga0495613_0056539 3300046689 Bacteria 2881
666 Ga0495624_0081358 3300046690 Bacteria 2006
667 Ga0495624_0279646 3300046690 Bacteria 1008
668 Ga0495670_0001905 3300046691 Bacteria 10284
669 Ga0495670_0002678 3300046691 Bacteria 8787
670 Ga0495670_0022660 3300046691 Bacteria 3101
671 Ga0495670_0030121 3300046691 Bacteria 2695
672 Ga0495670_0199846 3300046691 Bacteria 1058
673 Ga0495670_0229699 3300046691 Bacteria 986
674 Ga0495671_0000005 3300046692 Bacteria 509397
675 Ga0495671_0004998 3300046692 Bacteria 7814
676 Ga0495671_0006502 3300046692 Bacteria 6747
677 Ga0495671_0113779 3300046692 Bacteria 1321
678 Ga0495671_0147805 3300046692 Bacteria 1144
679 Ga0495649_0005036 3300046694 Bacteria 8496
680 Ga0495649_0044619 3300046694 Bacteria 2420
681 Ga0495589_0000012 3300046794 Bacteria 248641
682 Ga0495589_0000022 3300046794 Bacteria 196021
683 Ga0495589_0000420 3300046794 Bacteria 31618
684 Ga0495589_0007242 3300046794 Bacteria 5811
685 Ga0495589_0014059 3300046794 Bacteria 4126
686 Ga0495589_0024520 3300046794 Bacteria 3066
687 Ga0495589_0025436 3300046794 Bacteria 3004
688 Ga0495589_0036258 3300046794 Bacteria 2472
689 Ga0495589_0041314 3300046794 Bacteria 2301
690 Ga0495589_0047066 3300046794 Bacteria 2138
691 Ga0495589_0072549 3300046794 Bacteria 1681
692 Ga0495600_0014283 3300046809 Bacteria 5002
693 Ga0495600_0072949 3300046809 Bacteria 2241
694 Ga0495600_0146470 3300046809 Bacteria 1530
695 Ga0495660_0000192 3300046810 Bacteria 64339
696 Ga0495660_0000203 3300046810 Bacteria 62255
697 Ga0495660_0000514 3300046810 Bacteria 31796
698 Ga0495660_0002004 3300046810 Bacteria 13240
699 Ga0495660_0004348 3300046810 Bacteria 8578
700 Ga0495660_0004732 3300046810 Bacteria 8217
701 Ga0495660_0065327 3300046810 Bacteria 1942
702 Ga0495660_0264645 3300046810 Bacteria 792
703 Ga0495581_0006379 3300047315 Bacteria 6844
704 Ga0495581_0007089 3300047315 Bacteria 6490
705 Ga0495581_0010263 3300047315 Bacteria 5416
706 Ga0495581_0030890 3300047315 Bacteria 3103
707 Ga0495604_0007352 3300047317 Bacteria 8725
708 Ga0495604_0063363 3300047317 Bacteria 2820
709 Ga0495604_0090489 3300047317 Bacteria 2272
710 Ga0495636_0000698 3300047318 Bacteria 12302
711 Ga0495636_0011290 3300047318 Bacteria 3534
712 Ga0495674_0010761 3300047319 Bacteria 8652
713 Ga0495674_0511242 3300047319 Bacteria 960
714 Ga0495672_0000026 3300047320 Bacteria 340319
715 Ga0495672_0000081 3300047320 Bacteria 159863
716 Ga0495672_0000523 3300047320 Bacteria 43871
717 Ga0495672_0000861 3300047320 Bacteria 31983
718 Ga0495672_0003857 3300047320 Bacteria 12610
719 Ga0495672_0021590 3300047320 Bacteria 4197
720 Ga0495672_0120382 3300047320 Bacteria 1396
721 Ga0495676_0000214 3300047321 Bacteria 46256
722 Ga0495676_0018769 3300047321 Bacteria 6096
723 Ga0495676_0061566 3300047321 Bacteria 2935
724 Ga0495683_0000035 3300047323 Bacteria 146394
725 Ga0495683_0001320 3300047323 Bacteria 16652
726 Ga0495683_0003892 3300047323 Bacteria 8588
727 Ga0495683_0008357 3300047323 Bacteria 5545
728 Ga0495683_0009395 3300047323 Bacteria 5210
729 Ga0495683_0016977 3300047323 Bacteria 3775
730 Ga0495683_0048269 3300047323 Bacteria 2134
731 Ga0495683_0055938 3300047323 Bacteria 1963
732 Ga0495683_0099472 3300047323 Bacteria 1400
733 Ga0495687_000063 3300047443 Bacteria 169101
734 Ga0495687_000151 3300047443 Bacteria 105607
735 Ga0495687_000214 3300047443 Bacteria 83035
736 Ga0495687_000284 3300047443 Bacteria 66578
737 Ga0495687_000671 3300047443 Bacteria 38945
738 Ga0495687_001571 3300047443 Bacteria 20729
739 Ga0495687_008516 3300047443 Bacteria 5865
740 Ga0495687_013290 3300047443 Bacteria 4308
741 Ga0495675_0004016 3300047444 Bacteria 8915
742 Ga0495675_0298116 3300047444 Bacteria 958
743 Ga0495677_0000046 3300047445 Bacteria 73466
744 Ga0495677_0007225 3300047445 Bacteria 4155
745 Ga0495677_0012550 3300047445 Bacteria 3089
746 Ga0495677_0018812 3300047445 Bacteria 2504
747 Ga0495677_0026974 3300047445 Bacteria 2083
748 Ga0495677_0032228 3300047445 Bacteria 1908
749 Ga0495677_0117014 3300047445 Bacteria 1015
750 Ga0495679_004467 3300047446 Bacteria 6437
751 Ga0495679_024697 3300047446 Bacteria 2021
752 Ga0495685_000084 3300047447 Bacteria 34726
753 Ga0495685_024820 3300047447 Bacteria 2063
754 Ga0495685_061356 3300047447 Bacteria 1266
755 Ga0495673_0000008 3300047469 Bacteria 752462
756 Ga0495673_0000009 3300047469 Bacteria 731993
757 Ga0495673_0000012 3300047469 Bacteria 656908
758 Ga0495681_0000334 3300047470 Bacteria 37186
759 Ga0495681_0006521 3300047470 Bacteria 7654
760 Ga0495681_0017619 3300047470 Bacteria 3958
761 Ga0495681_0040387 3300047470 Bacteria 2272
762 Ga0495681_0051071 3300047470 Bacteria 1946
763 Ga0495681_0103795 3300047470 Bacteria 1239
764 Ga0495681_0106784 3300047470 Bacteria 1217
765 Ga0495681_0183436 3300047470 Bacteria 858
766 Ga0495686_0000328 3300047472 Bacteria 78155
767 Ga0495686_0000348 3300047472 Bacteria 75868
768 Ga0495686_0005295 3300047472 Bacteria 10226
769 Ga0495686_0010068 3300047472 Bacteria 6753
770 Ga0495686_0014249 3300047472 Bacteria 5479
771 Ga0495686_0064102 3300047472 Bacteria 2275
772 Ga0495593_0006069 3300047673 Bacteria 7106
773 Ga0495593_0009789 3300047673 Bacteria 5560
774 Ga0495593_0192943 3300047673 Bacteria 1024
775 Ga0495602_0013467 3300048088 Bacteria 8359
776 Ga0495602_0176287 3300048088 Bacteria 1653
777 Ga0495614_0005972 3300048089 Bacteria 5485
778 Ga0495614_0016163 3300048089 Bacteria 3249
779 Ga0495614_0344157 3300048089 Bacteria 694
780 Ga0495615_0028374 3300048090 Bacteria 1321
781 Ga0495615_0031127 3300048090 Bacteria 1278
782 Ga0495626_0000021 3300048091 Bacteria 217213
783 Ga0495626_0000122 3300048091 Bacteria 101672
784 Ga0495626_0000793 3300048091 Bacteria 28672
785 Ga0495626_0004338 3300048091 Bacteria 8746
786 Ga0495626_0004682 3300048091 Bacteria 8300
787 Ga0495626_0006948 3300048091 Bacteria 6372
788 Ga0495626_0008530 3300048091 Bacteria 5608
789 Ga0495626_0018719 3300048091 Bacteria 3470
790 Ga0495626_0029526 3300048091 Bacteria 2653
791 Ga0495626_0031152 3300048091 Bacteria 2568
792 Ga0495626_0067550 3300048091 Bacteria 1614
793 Ga0495626_0160534 3300048091 Bacteria 942
794 Ga0496100_0062388 3300048903 Bacteria 2459
795 Ga0496101_0068401 3300048904 Bacteria 2596
796 Ga0496102_0067868 3300048905 Bacteria 3271
797 Ga0496102_0167241 3300048905 Bacteria 2069
798 Ga0496103_0002721 3300048906 Bacteria 11025
799 Ga0496103_0619770 3300048906 Bacteria 688
800 Ga0496105_0024042 3300048908 Bacteria 4949
801 Ga0496106_0017162 3300048909 Bacteria 5360
802 Ga0496110_0000085 3300048913 Bacteria 49001
803 Ga0496114_0086866 3300048917 Bacteria 2651
804 Ga0496115_0376539 3300048918 Bacteria 1155
805 Ga0496116_0045416 3300048919 Bacteria 2974
806 Ga0496118_0184939 3300048921 Bacteria 1254
807 Ga0496121_0083984 3300048924 Bacteria 2512
808 Ga0496121_0147384 3300048924 Bacteria 1737
809 Ga0496122_0000432 3300048925 Bacteria 87744
810 Ga0496122_0015889 3300048925 Bacteria 7167
811 Ga0496122_0038127 3300048925 Bacteria 3856
812 Ga0496122_0052986 3300048925 Bacteria 3063
813 Ga0496123_0000916 3300048926 Bacteria 46316
814 Ga0496123_0028342 3300048926 Bacteria 4148
815 Ga0496124_0006076 3300048927 Bacteria 13280
816 Ga0496124_0022498 3300048927 Bacteria 5776
817 Ga0496124_0069882 3300048927 Bacteria 2914
818 Ga0496124_0096751 3300048927 Bacteria 2398
819 Ga0496124_0432291 3300048927 Bacteria 903
820 Ga0496125_0004178 3300048928 Bacteria 16832
821 Ga0496125_0176876 3300048928 Bacteria 1426
822 Ga0496126_0010059 3300048929 Bacteria 9979
823 Ga0496126_0794417 3300048929 Bacteria 727
824 Ga0501309_045099 3300049129 Bacteria 682
825 Ga0501341_04867 3300049131 Bacteria 792
826 Ga0495678_000027 3300049459 Bacteria 222075
827 Ga0495678_000074 3300049459 Bacteria 125964
828 Ga0495678_000123 3300049459 Bacteria 90881
829 Ga0495678_000629 3300049459 Bacteria 32776
830 Ga0495678_000758 3300049459 Bacteria 29313
831 Ga0495678_001070 3300049459 Bacteria 23187
832 Ga0495678_035865 3300049459 Bacteria 2029
833 Ga0495682_0005477 3300049460 Bacteria 5265
834 Ga0495682_0005610 3300049460 Bacteria 5192
835 Ga0495682_0010310 3300049460 Bacteria 3622
836 Ga0495682_0016584 3300049460 Bacteria 2787
837 Ga0501311_013327 3300049527 Bacteria 1036
838 Ga0501312_052893 3300049528 Bacteria 688
839 Ga0501323_038762 3300049539 Bacteria 692
840 Ga0501324_007101 3300049540 Bacteria 959
841 Ga0501334_11282 3300049550 Bacteria 653
842 Ga0501031_0007119 3300049568 Bacteria 7300
843 Ga0501033_0002135 3300049570 Bacteria 17104
844 Ga0501033_0008896 3300049570 Bacteria 7756
845 Ga0501034_0024529 3300049571 Bacteria 6135
846 Ga0501034_0067425 3300049571 Bacteria 3591
847 Ga0501036_0001322 3300049572 Bacteria 19039
848 Ga0501037_0009574 3300049573 Bacteria 7111
849 Ga0501037_0024614 3300049573 Bacteria 4451
850 Ga0501039_0207665 3300049575 Unclassified 1540
851 Ga0501043_0032180 3300049579 Bacteria 4122
852 Ga0501046_0051025 3300049580 Bacteria 3266
853 Ga0501046_0633988 3300049580 Bacteria 756
854 Ga0501047_0400985 3300049581 Bacteria 1204
855 Ga0501211_004776 3300049658 Bacteria 1371
856 Ga0501222_002410 3300049662 Bacteria 2595
857 Ga0501227_001086 3300049665 Bacteria 6052
858 Ga0501238_009063 3300049671 Bacteria 1315
859 Ga0501249_014752 3300049679 Bacteria 1667
860 Ga0501252_003309 3300049682 Bacteria 1653
861 Ga0501269_000005 3300049766 Bacteria 77832
862 Ga0501279_006482 3300049775 Bacteria 1547
863 Ga0501035_0023268 3300049822 Bacteria 5682
864 Ga0501035_0030003 3300049822 Bacteria 4959
865 Ga0501044_0002016 3300049823 Bacteria 23415
866 Ga0501044_0123595 3300049823 Bacteria 2586
867 nmdc:mga03683_134594_c1 3300050489 Bacteria 1108
868 nmdc:mga03n38_66912_c1 3300050490 Bacteria 1652
869 nmdc:mga00v17_281508_c1 3300050491 Bacteria 1080
870 nmdc:mga0yw44_287106_c1 3300050492 Bacteria 1101
871 nmdc:mga07m45_97008_c1 3300050496 Bacteria 1692
872 nmdc:mga05p37_188254_c1 3300050507 Bacteria 2508
873 nmdc:mga09592_124568_c1 3300050508 Bacteria 2215
874 nmdc:mga0qj67_193520_c1 3300050509 Bacteria 1652
875 nmdc:mga06r32_56772_c1 3300050510 Bacteria 3759
876 nmdc:mga06r32_84819_c1 3300050510 Bacteria 3088
877 nmdc:mga0n895_201011_c1 3300050512 Unclassified 2024
878 nmdc:mga08x19_28573_c1 3300050514 Bacteria 3493
879 nmdc:mga0a205_494475_c1 3300050515 Unclassified 1080
880 nmdc:mga0a205_81512_c1 3300050515 Bacteria 3126
881 Ga0500557_076903 3300053105 Bacteria 1099
882 Ga0500594_0003538 3300053118 Bacteria 3437
883 Ga0500618_000170 3300053125 Bacteria 54570
884 Ga0500618_004583 3300053125 Bacteria 4365
885 Ga0500618_016008 3300053125 Bacteria 1884
886 Ga0500574_020631 3300053141 Bacteria 1657
887 Ga0500586_000124 3300053145 Bacteria 13969
888 Ga0500645_008848 3300053730 Bacteria 3410
889 Ga0587084_023889 3300059477 Bacteria 937
890 Ga0587093_011893 3300059478 Bacteria 1048
891 Ga0587066_104437 3300059490 Bacteria 649
892 Ga0587070_010639 3300059491 Bacteria 1360
893 Ga0587077_020918 3300059493 Bacteria 1155
894 Ga0587082_021985 3300059504 Bacteria 1046
895 Ga0587085_007423 3300059506 Bacteria 1368
896 Ga0587086_012158 3300059507 Bacteria 1066
897 Ga0587088_010905 3300059508 Bacteria 1342
898 Ga0587089_011846 3300059509 Bacteria 1106
899 Ga0587090_013564 3300059510 Bacteria 1180
900 Ga0587091_011376 3300059511 Bacteria 1387
901 Ga0587092_030021 3300059512 Bacteria 894
902 Ga0587094_033948 3300059513 Bacteria 804
903 Ga0587074_02287 3300059602 Bacteria 639
904 Ga0587106_027761 3300059605 Bacteria 888
905 Ga0587125_006728 3300059607 Bacteria 1097
906 Ga0587067_048078 3300059640 Bacteria 854
907 Ga0587068_005455 3300059641 Bacteria 1736
908 Ga0587069_003311 3300059642 Bacteria 1728
909 Ga0587076_058884 3300059645 Bacteria 769
910 Ga0587078_028399 3300059646 Bacteria 743
911 Ga0587104_004414 3300059650 Bacteria 900
912 Ga0587107_026556 3300059652 Bacteria 851
913 Ga0587071_106542 3300060344 Bacteria 655
914 Ga0587111_0053327 3300060346 Bacteria 899
915 Ga0466962_0025287 3300061719 Bacteria 2851
916 Ga0466962_0103455 3300061719 Bacteria 1368

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2690315857 2691332389 184
2 iso_pu_bacteria 2919534386 2919538269 184
3 iso_pu_bacteria 2919688452 2919692303 184
4 3300044706 Ga0466964_0000242 Ga0466964_0000242_8773_9330 185
5 3300039093 Ga0400489_25670 Ga0400489_25670_44176_44736 186
6 3300042876 Ga0451577_0019726 Ga0451577_0019726_4059_4625 186
7 3300044712 Ga0453684_0685564 Ga0453684_0685564_377_943 186
8 3300045051 Ga0451576_0217332 Ga0451576_0217332_634_1200 186
9 3300002704 JGI25155J39150_1000750 JGI25155J39150_10007502 187
10 3300002705 JGI25156J39149_1000185 JGI25156J39149_100018526 187
11 3300002737 JGI25162J39368_1000038 JGI25162J39368_100003849 187
12 3300002737 JGI25162J39368_1004094 JGI25162J39368_10040943 187
13 3300002738 JGI25154J39366_1001907 JGI25154J39366_10019072 187
14 3300002738 JGI25154J39366_1004938 JGI25154J39366_10049383 187
15 3300002741 JGI25157J39369_1000284 JGI25157J39369_100028413 187
16 3300002741 JGI25157J39369_1000431 JGI25157J39369_100043123 187
17 3300002772 JGI25164J39214_1001783 JGI25164J39214_10017832 187
18 3300002774 JGI25150J39212_1001795 JGI25150J39212_10017954 187
19 3300002774 JGI25150J39212_1009348 JGI25150J39212_10093482 187
20 3300002870 Ga0006763J43179_101775 Ga0006763J43179_1017751 187
21 3300002872 Ga0006762J43184_105387 Ga0006762J43184_1053871 187
22 3300002987 JGI25159J45721_1004023 JGI25159J45721_10040232 187
23 3300003158 Ga0006760J45825_103373 Ga0006760J45825_1033731 187
24 3300003160 Ga0006779J45831_107007 Ga0006779J45831_1070071 187
25 3300003161 Ga0006765J45826_104465 Ga0006765J45826_1044651 187
26 3300003162 Ga0006778J45830_1018011 Ga0006778J45830_10180111 187
27 3300003162 Ga0006778J45830_1046945 Ga0006778J45830_10469451 187
28 3300003163 Ga0006759J45824_1004153 Ga0006759J45824_10041531 187
29 3300003163 Ga0006759J45824_1006275 Ga0006759J45824_10062751 187
30 3300003214 JGI25165J46597_1000045 JGI25165J46597_100004549 187
31 3300003215 JGI25153J46596_10021708 JGI25153J46596_100217082 187
32 3300003288 Ga0007428J48920_101749 Ga0007428J48920_1017491 187
33 3300003300 Ga0006758J48902_1014592 Ga0006758J48902_10145921 187
34 3300003305 Ga0006770J48903_1023283 Ga0006770J48903_10232831 187
35 3300003305 Ga0006770J48903_1026315 Ga0006770J48903_10263151 187
36 3300003308 Ga0006777J48905_1017375 Ga0006777J48905_10173751 187
37 3300003308 Ga0006777J48905_1020868 Ga0006777J48905_10208681 187
38 3300003354 JGI25160J50197_1008040 JGI25160J50197_10080404 187
39 3300003374 JGI25161J50226_1018534 JGI25161J50226_10185341 187
40 3300003544 Ga0007417J51691_1010995 Ga0007417J51691_10109951 187
41 3300003568 Ga0006781J51513_1014323 Ga0006781J51513_10143231 187
42 3300003574 Ga0007410J51695_1033499 Ga0007410J51695_10334991 187
43 3300003577 Ga0007416J51690_1088669 Ga0007416J51690_10886691 187
44 3300003693 Ga0032354_1015485 Ga0032354_10154851 187
45 3300003735 Ga0006780_1008912 Ga0006780_10089121 187
46 3300003751 Ga0055538_1000022 Ga0055538_100002249 187
47 3300003751 Ga0055538_1000085 Ga0055538_100008551 187
48 3300003752 Ga0055539_1000028 Ga0055539_100002849 187
49 3300003752 Ga0055539_1000126 Ga0055539_100012651 187
50 3300003756 Ga0055533_1000036 Ga0055533_100003649 187
51 3300003756 Ga0055533_1000133 Ga0055533_100013351 187
52 3300003758 Ga0055532_1000044 Ga0055532_1000044173 187
53 3300003759 Ga0055525_1000071 Ga0055525_1000071115 187
54 3300003759 Ga0055525_1000174 Ga0055525_100017451 187
55 3300003761 Ga0055535_1006579 Ga0055535_10065792 187
56 3300003763 Ga0055529_1000015 Ga0055529_100001555 187
57 3300003771 Ga0055526_1000007 Ga0055526_100000757 187
58 3300003771 Ga0055526_1000037 Ga0055526_100003763 187
59 3300003771 Ga0055526_1002076 Ga0055526_100207615 187
60 3300003771 Ga0055526_1003417 Ga0055526_10034174 187
61 3300003773 Ga0055537_1000236 Ga0055537_10002364 187
62 3300003773 Ga0055537_1020993 Ga0055537_10209931 187
63 3300003775 Ga0055524_1022725 Ga0055524_10227252 187
64 3300003784 Ga0055534_1000544 Ga0055534_10005446 187
65 3300003784 Ga0055534_1003580 Ga0055534_10035804 187
66 3300003790 Ga0055528_1000136 Ga0055528_100013652 187
67 3300003790 Ga0055528_1005295 Ga0055528_10052956 187
68 3300003791 Ga0055530_10004518 Ga0055530_100045182 187
69 3300003791 Ga0055530_10013523 Ga0055530_100135232 187
70 3300003794 Ga0055531_10079968 Ga0055531_100799681 187
71 3300003841 Ga0055541_1000037 Ga0055541_1000037115 187
72 3300003841 Ga0055541_1000085 Ga0055541_100008526 187
73 3300005262 Ga0065165_1001295 Ga0065165_10012959 187
74 3300005334 Ga0068869_100665581 Ga0068869_1006655812 187
75 3300005336 Ga0070680_100256296 Ga0070680_1002562962 187
76 3300005336 Ga0070680_100305247 Ga0070680_1003052472 187
77 3300005338 Ga0068868_101190880 Ga0068868_1011908801 187
78 3300005344 Ga0070661_100033803 Ga0070661_1000338034 187
79 3300005344 Ga0070661_100867724 Ga0070661_1008677241 187
80 3300005347 Ga0070668_100390125 Ga0070668_1003901252 187
81 3300005364 Ga0070673_101084580 Ga0070673_1010845801 187
82 3300005367 Ga0070667_100022285 Ga0070667_1000222856 187
83 3300005455 Ga0070663_100267735 Ga0070663_1002677352 187
84 3300005457 Ga0070662_100288682 Ga0070662_1002886821 187
85 3300005458 Ga0070681_10091379 Ga0070681_100913792 187
86 3300005459 Ga0068867_100136338 Ga0068867_1001363381 187
87 3300005535 Ga0070684_100482892 Ga0070684_1004828921 187
88 3300005536 Ga0070697_100056747 Ga0070697_1000567476 187
89 3300005539 Ga0068853_100278514 Ga0068853_1002785141 187
90 3300005543 Ga0070672_100451704 Ga0070672_1004517042 187
91 3300005546 Ga0070696_100033584 Ga0070696_1000335843 187
92 3300005548 Ga0070665_100137461 Ga0070665_1001374612 187
93 3300005563 Ga0068855_100005477 Ga0068855_10000547716 187
94 3300005564 Ga0070664_100024751 Ga0070664_1000247515 187
95 3300005564 Ga0070664_100218481 Ga0070664_1002184812 187
96 3300005577 Ga0068857_100145949 Ga0068857_1001459492 187
97 3300005578 Ga0068854_100008400 Ga0068854_1000084002 187
98 3300005616 Ga0068852_100000490 Ga0068852_10000049012 187
99 3300005616 Ga0068852_100435513 Ga0068852_1004355132 187
100 3300005834 Ga0068851_10042392 Ga0068851_100423922 187
101 3300005834 Ga0068851_10093296 Ga0068851_100932962 187
102 3300005843 Ga0068860_100299709 Ga0068860_1002997091 187
103 3300006028 Ga0070717_10118214 Ga0070717_101182141 187
104 3300006051 Ga0075364_10230283 Ga0075364_102302832 187
105 3300006177 Ga0075362_10001657 Ga0075362_100016575 187
106 3300006177 Ga0075362_10017122 Ga0075362_100171223 187
107 3300006177 Ga0075362_10083266 Ga0075362_100832662 187
108 3300006178 Ga0075367_10012290 Ga0075367_100122902 187
109 3300006186 Ga0075369_10146400 Ga0075369_101464001 187
110 3300006195 Ga0075366_10019177 Ga0075366_100191773 187
111 3300006237 Ga0097621_100176540 Ga0097621_1001765402 187
112 3300006353 Ga0075370_10053243 Ga0075370_100532431 187
113 3300006353 Ga0075370_10302848 Ga0075370_103028481 187
114 3300006358 Ga0068871_100076765 Ga0068871_1000767652 187
115 3300006844 Ga0075428_100172309 Ga0075428_1001723091 187
116 3300006846 Ga0075430_100127705 Ga0075430_1001277052 187
117 3300006847 Ga0075431_100300244 Ga0075431_1003002443 187
118 3300006847 Ga0075431_100450548 Ga0075431_1004505481 187
119 3300006871 Ga0075434_100055035 Ga0075434_1000550356 187
120 3300006880 Ga0075429_100219007 Ga0075429_1002190073 187
121 3300006881 Ga0068865_100233324 Ga0068865_1002333242 187
122 3300006914 Ga0075436_100173885 Ga0075436_1001738852 187
123 3300006946 Ga0079104_1017411 Ga0079104_10174112 187
124 3300007076 Ga0075435_100058404 Ga0075435_1000584045 187
125 3300009036 Ga0105244_10000395 Ga0105244_100003958 187
126 3300009036 Ga0105244_10001280 Ga0105244_1000128018 187
127 3300009036 Ga0105244_10038887 Ga0105244_100388872 187
128 3300009036 Ga0105244_10145558 Ga0105244_101455581 187
129 3300009036 Ga0105244_10147050 Ga0105244_101470502 187
130 3300009093 Ga0105240_10000523 Ga0105240_100005232 187
131 3300009093 Ga0105240_10212001 Ga0105240_102120013 187
132 3300009093 Ga0105240_10429712 Ga0105240_104297122 187
133 3300009093 Ga0105240_10449723 Ga0105240_104497232 187
134 3300009094 Ga0111539_10137917 Ga0111539_101379172 187
135 3300009147 Ga0114129_11106162 Ga0114129_111061621 187
136 3300009148 Ga0105243_10246701 Ga0105243_102467012 187
137 3300009174 Ga0105241_10011217 Ga0105241_100112175 187
138 3300009174 Ga0105241_10865216 Ga0105241_108652161 187
139 3300009176 Ga0105242_10093084 Ga0105242_100930842 187
140 3300009176 Ga0105242_10209812 Ga0105242_102098122 187
141 3300009545 Ga0105237_10041411 Ga0105237_100414111 187
142 3300009545 Ga0105237_10244489 Ga0105237_102444892 187
143 3300009551 Ga0105238_10000038 Ga0105238_1000003852 187
144 3300009551 Ga0105238_10097218 Ga0105238_100972181 187
145 3300009551 Ga0105238_10527717 Ga0105238_105277172 187
146 3300009553 Ga0105249_11364383 Ga0105249_113643831 187
147 3300010375 Ga0105239_10003685 Ga0105239_1000368510 187
148 3300011119 Ga0105246_10265641 Ga0105246_102656411 187
149 3300013100 Ga0157373_10131749 Ga0157373_101317493 187
150 3300013102 Ga0157371_10000001 Ga0157371_10000001316 187
151 3300013105 Ga0157369_10314670 Ga0157369_103146702 187
152 3300013296 Ga0157374_10122216 Ga0157374_101222162 187
153 3300013297 Ga0157378_10031139 Ga0157378_100311392 187
154 3300013306 Ga0163162_10128902 Ga0163162_101289022 187
155 3300013307 Ga0157372_10336753 Ga0157372_103367532 187
156 3300013307 Ga0157372_10856653 Ga0157372_108566531 187
157 3300013307 Ga0157372_11445283 Ga0157372_114452831 187
158 3300013308 Ga0157375_10033594 Ga0157375_100335944 187
159 3300014326 Ga0157380_10926951 Ga0157380_109269512 187
160 3300014497 Ga0182008_10010891 Ga0182008_100108914 187
161 3300014968 Ga0157379_10107876 Ga0157379_101078762 187
162 3300015261 Ga0182006_1000023 Ga0182006_100002337 187
163 3300015261 Ga0182006_1002148 Ga0182006_100214812 187
164 3300015261 Ga0182006_1042983 Ga0182006_10429832 187
165 3300015261 Ga0182006_1070123 Ga0182006_10701233 187
166 3300015261 Ga0182006_1084355 Ga0182006_10843551 187
167 3300015262 Ga0182007_10007368 Ga0182007_100073682 187
168 3300015262 Ga0182007_10016147 Ga0182007_100161472 187
169 3300015262 Ga0182007_10068862 Ga0182007_100688622 187
170 3300015262 Ga0182007_10215338 Ga0182007_102153381 187
171 3300015265 Ga0182005_1000154 Ga0182005_10001547 187
172 3300015265 Ga0182005_1001032 Ga0182005_10010325 187
173 3300017792 Ga0163161_10005395 Ga0163161_100053955 187
174 3300020069 Ga0197907_10354872 Ga0197907_103548721 187
175 3300020070 Ga0206356_10412366 Ga0206356_104123661 187
176 3300020070 Ga0206356_10770575 Ga0206356_107705751 187
177 3300020077 Ga0206351_10185510 Ga0206351_101855101 187
178 3300021361 Ga0213872_10000024 Ga0213872_100000247 187
179 3300025206 Ga0209435_100004 Ga0209435_100004582 187
180 3300025208 Ga0209436_101397 Ga0209436_1013971 187
181 3300025208 Ga0209436_109773 Ga0209436_1097732 187
182 3300025224 Ga0209784_100021 Ga0209784_10002156 187
183 3300025224 Ga0209784_100036 Ga0209784_100036185 187
184 3300025225 Ga0209566_100039 Ga0209566_10003957 187
185 3300025225 Ga0209566_100044 Ga0209566_100044185 187
186 3300025226 Ga0209674_100036 Ga0209674_10003656 187
187 3300025226 Ga0209674_100065 Ga0209674_100065185 187
188 3300025229 Ga0209147_100011 Ga0209147_100011651 187
189 3300025230 Ga0209563_100007 Ga0209563_1000071099 187
190 3300025230 Ga0209563_100040 Ga0209563_10004056 187
191 3300025230 Ga0209563_100063 Ga0209563_100063185 187
192 3300025231 Ga0207427_101732 Ga0207427_1017326 187
193 3300025233 Ga0209437_100082 Ga0209437_100082185 187
194 3300025233 Ga0209437_100282 Ga0209437_10028267 187
195 3300025242 Ga0209258_100421 Ga0209258_10042126 187
196 3300025245 Ga0207425_1000009 Ga0207425_100000940 187
197 3300025245 Ga0207425_1005726 Ga0207425_10057262 187
198 3300025246 Ga0209646_1000125 Ga0209646_100012513 187
199 3300025246 Ga0209646_1000149 Ga0209646_100014924 187
200 3300025250 Ga0209026_1000409 Ga0209026_100040926 187
201 3300025253 Ga0209677_100023 Ga0209677_10002356 187
202 3300025253 Ga0209677_100038 Ga0209677_100038185 187
203 3300025253 Ga0209677_102916 Ga0209677_1029165 187
204 3300025254 Ga0209148_1000760 Ga0209148_100076011 187
205 3300025256 Ga0209759_1000182 Ga0209759_100018272 187
206 3300025258 Ga0209129_1000198 Ga0209129_100019839 187
207 3300025261 Ga0209233_1000109 Ga0209233_1000109185 187
208 3300025263 Ga0209565_1000082 Ga0209565_100008275 187
209 3300025263 Ga0209565_1000493 Ga0209565_10004934 187
210 3300025263 Ga0209565_1004404 Ga0209565_10044043 187
211 3300025272 Ga0209455_1000031 Ga0209455_100003156 187
212 3300025272 Ga0209455_1002933 Ga0209455_10029333 187
213 3300025273 Ga0209673_1000381 Ga0209673_100038161 187
214 3300025273 Ga0209673_1007566 Ga0209673_10075662 187
215 3300025284 Ga0209130_1000016 Ga0209130_1000016215 187
216 3300025284 Ga0209130_1005385 Ga0209130_10053854 187
217 3300025291 Ga0209675_1000166 Ga0209675_100016613 187
218 3300025291 Ga0209675_1008144 Ga0209675_10081442 187
219 3300025295 Ga0209564_1000010 Ga0209564_1000010620 187
220 3300025295 Ga0209564_1000042 Ga0209564_1000042196 187
221 3300025295 Ga0209564_1000959 Ga0209564_100095924 187
222 3300025295 Ga0209564_1001111 Ga0209564_100111113 187
223 3300025295 Ga0209564_1001315 Ga0209564_10013155 187
224 3300025295 Ga0209564_1021895 Ga0209564_10218951 187
225 3300025297 Ga0209758_1000054 Ga0209758_100005440 187
226 3300025297 Ga0209758_1001194 Ga0209758_10011946 187
227 3300025298 Ga0209050_1000086 Ga0209050_1000086111 187
228 3300025298 Ga0209050_1018392 Ga0209050_10183924 187
229 3300025299 Ga0209256_1000380 Ga0209256_100038061 187
230 3300025299 Ga0209256_1016020 Ga0209256_10160202 187
231 3300025302 Ga0207426_1001363 Ga0207426_100136319 187
232 3300025303 Ga0209051_1036875 Ga0209051_10368752 187
233 3300025304 Ga0209257_1000087 Ga0209257_1000087156 187
234 3300025321 Ga0207656_10122449 Ga0207656_101224491 187
235 3300025728 Ga0207655_1005987 Ga0207655_10059875 187
236 3300025728 Ga0207655_1009515 Ga0207655_10095155 187
237 3300025728 Ga0207655_1114016 Ga0207655_11140162 187
238 3300025899 Ga0207642_10164971 Ga0207642_101649712 187
239 3300025904 Ga0207647_10462323 Ga0207647_104623231 187
240 3300025909 Ga0207705_10030888 Ga0207705_100308882 187
241 3300025911 Ga0207654_10003822 Ga0207654_100038225 187
242 3300025913 Ga0207695_10001573 Ga0207695_1000157316 187
243 3300025913 Ga0207695_10004969 Ga0207695_1000496916 187
244 3300025913 Ga0207695_10129096 Ga0207695_101290962 187
245 3300025913 Ga0207695_10437674 Ga0207695_104376742 187
246 3300025914 Ga0207671_10006537 Ga0207671_100065373 187
247 3300025914 Ga0207671_10394232 Ga0207671_103942322 187
248 3300025914 Ga0207671_10708886 Ga0207671_107088861 187
249 3300025917 Ga0207660_10121190 Ga0207660_101211901 187
250 3300025917 Ga0207660_10268426 Ga0207660_102684262 187
251 3300025924 Ga0207694_10000069 Ga0207694_1000006955 187
252 3300025933 Ga0207706_10368648 Ga0207706_103686481 187
253 3300025934 Ga0207686_10135781 Ga0207686_101357811 187
254 3300025938 Ga0207704_10308452 Ga0207704_103084522 187
255 3300025940 Ga0207691_10413066 Ga0207691_104130662 187
256 3300025941 Ga0207711_10517522 Ga0207711_105175221 187
257 3300025942 Ga0207689_10290865 Ga0207689_102908652 187
258 3300025945 Ga0207679_10019920 Ga0207679_100199204 187
259 3300025945 Ga0207679_10228086 Ga0207679_102280862 187
260 3300025945 Ga0207679_10230672 Ga0207679_102306721 187
261 3300025949 Ga0207667_10000043 Ga0207667_10000043248 187
262 3300025949 Ga0207667_10096117 Ga0207667_100961172 187
263 3300025981 Ga0207640_10587851 Ga0207640_105878512 187
264 3300025986 Ga0207658_10015319 Ga0207658_100153191 187
265 3300026023 Ga0207677_10250407 Ga0207677_102504072 187
266 3300026078 Ga0207702_10171311 Ga0207702_101713112 187
267 3300026078 Ga0207702_10590972 Ga0207702_105909721 187
268 3300026121 Ga0207683_10189622 Ga0207683_101896222 187
269 3300026142 Ga0207698_10004855 Ga0207698_100048552 187
270 3300027111 Ga0209281_1005985 Ga0209281_10059855 187
271 3300027111 Ga0209281_1023398 Ga0209281_10233982 187
272 3300028379 Ga0268266_10102650 Ga0268266_101026502 187
273 3300028381 Ga0268264_10147278 Ga0268264_101472782 187
274 3300028794 Ga0307515_10073112 Ga0307515_100731123 187
275 3300030744 Ga0316181_1164203 Ga0316181_11642032 187
276 3300031238 Ga0265332_10036377 Ga0265332_100363773 187
277 3300031507 Ga0307509_10007371 Ga0307509_1000737114 187
278 3300031730 Ga0307516_10467000 Ga0307516_104670002 187
279 3300031838 Ga0307518_10006545 Ga0307518_100065453 187
280 3300031901 Ga0307406_10453065 Ga0307406_104530651 187
281 3300032002 Ga0307416_100000420 Ga0307416_10000042013 187
282 3300032002 Ga0307416_100941845 Ga0307416_1009418451 187
283 3300032004 Ga0307414_10048175 Ga0307414_100481754 187
284 3300033541 Ga0316596_1166449 Ga0316596_11664491 187
285 3300035083 Ga0373926_0082278 Ga0373926_0082278_63_689 187
286 3300035112 Ga0373932_0063100 Ga0373932_0063100_464_1027 187
287 3300035113 Ga0373936_0338617 Ga0373936_0338617_99_662 187
288 3300035398 Ga0316574_0235938 Ga0316574_0235938_371_934 187
289 3300037312 Ga0395899_0000028 Ga0395899_0000028_85293_85856 187
290 3300037418 Ga0395900_0000349 Ga0395900_0000349_10364_10927 187
291 3300037418 Ga0395900_0051074 Ga0395900_0051074_783_1346 187
292 3300037466 Ga0395898_0351504 Ga0395898_0351504_826_1389 187
293 3300037466 Ga0395898_0390193 Ga0395898_0390193_709_1272 187
294 3300037466 Ga0395898_0933006 Ga0395898_0933006_21_584 187
295 3300037471 Ga0395905_0346467 Ga0395905_0346467_315_878 187
296 3300038443 Ga0395901_0000123 Ga0395901_0000123_42747_43310 187
297 3300039093 Ga0400489_02039 Ga0400489_02039_646_1233 187
298 3300039447 Ga0436361_0224368 Ga0436361_0224368_94311_94874 187
299 3300041441 Ga0451787_231606 Ga0451787_231606_153_716 187
300 3300042005 Ga0439448_0095177 Ga0439448_0095177_391_954 187
301 3300042005 Ga0439448_0203634 Ga0439448_0203634_83_646 187
302 3300042007 Ga0439449_0021318 Ga0439449_0021318_1746_2309 187
303 3300042008 Ga0439450_003650 Ga0439450_003650_10_573 187
304 3300042012 Ga0439455_0002195 Ga0439455_0002195_368_931 187
305 3300042121 Ga0450919_005688 Ga0450919_005688_675_1238 187
306 3300042129 Ga0450891_013123 Ga0450891_013123_133_696 187
307 3300042139 Ga0450904_000892 Ga0450904_000892_2459_3022 187
308 3300042531 Ga0450918_000815 Ga0450918_000815_545_1108 187
309 3300042876 Ga0451577_0000552 Ga0451577_0000552_43088_43651 187
310 3300042876 Ga0451577_0004172 Ga0451577_0004172_4245_4808 187
311 3300042876 Ga0451577_0068112 Ga0451577_0068112_1468_2127 187
312 3300042876 Ga0451577_0649713 Ga0451577_0649713_225_788 187
313 3300044658 Ga0466972_0015994 Ga0466972_0015994_505_1068 187
314 3300044673 Ga0453683_0000281 Ga0453683_0000281_3446_4009 187
315 3300044673 Ga0453683_0010844 Ga0453683_0010844_4877_5440 187
316 3300044673 Ga0453683_0289311 Ga0453683_0289311_172_735 187
317 3300044683 Ga0466965_0029343 Ga0466965_0029343_1609_2172 187
318 3300044683 Ga0466965_0198819 Ga0466965_0198819_463_1026 187
319 3300044683 Ga0466965_0413048 Ga0466965_0413048_147_710 187
320 3300044684 Ga0466966_0082484 Ga0466966_0082484_178_741 187
321 3300044693 Ga0466961_0031725 Ga0466961_0031725_1397_1960 187
322 3300044694 Ga0466963_0024119 Ga0466963_0024119_396_965 187
323 3300044706 Ga0466964_0001121 Ga0466964_0001121_6161_6724 187
324 3300044712 Ga0453684_0000008 Ga0453684_0000008_1043444_1044007 187
325 3300044712 Ga0453684_0000009 Ga0453684_0000009_977301_977864 187
326 3300044712 Ga0453684_0000135 Ga0453684_0000135_162127_162690 187
327 3300044712 Ga0453684_0000423 Ga0453684_0000423_38253_38819 187
328 3300044712 Ga0453684_0001387 Ga0453684_0001387_1278_1844 187
329 3300044712 Ga0453684_0004817 Ga0453684_0004817_11386_11949 187
330 3300044712 Ga0453684_0028098 Ga0453684_0028098_6801_7367 187
331 3300044712 Ga0453684_0187659 Ga0453684_0187659_191_757 187
332 3300044719 Ga0466971_0033767 Ga0466971_0033767_265_828 187
333 3300044719 Ga0466971_0037630 Ga0466971_0037630_1488_2051 187
334 3300044735 Ga0466968_0003991 Ga0466968_0003991_2769_3332 187
335 3300044735 Ga0466968_0125330 Ga0466968_0125330_341_904 187
336 3300044735 Ga0466968_0221906 Ga0466968_0221906_106_669 187
337 3300044765 Ga0466970_0243609 Ga0466970_0243609_122_685 187
338 3300044842 Ga0466957_0034706 Ga0466957_0034706_1075_1638 187
339 3300045049 Ga0466959_0229032 Ga0466959_0229032_458_1027 187
340 3300045051 Ga0451576_0000062 Ga0451576_0000062_142041_142700 187
341 3300045051 Ga0451576_0000154 Ga0451576_0000154_130446_131009 187
342 3300045051 Ga0451576_0066973 Ga0451576_0066973_1069_1632 187
343 3300045051 Ga0451576_0312378 Ga0451576_0312378_656_1219 187
344 3300045051 Ga0451576_0664722 Ga0451576_0664722_473_1039 187
345 3300045836 Ga0466958_0102810 Ga0466958_0102810_167_736 187
346 3300045836 Ga0466958_0224251 Ga0466958_0224251_380_943 187
347 3300045976 Ga0466967_0178373 Ga0466967_0178373_1407_1970 187
348 3300046452 Ga0495617_000008 Ga0495617_000008_275849_276412 187
349 3300046452 Ga0495617_000020 Ga0495617_000020_31557_32120 187
350 3300046452 Ga0495617_000153 Ga0495617_000153_13758_14381 187
351 3300046452 Ga0495617_000232 Ga0495617_000232_29196_29759 187
352 3300046452 Ga0495617_008876 Ga0495617_008876_2007_2696 187
353 3300046453 Ga0495627_000004 Ga0495627_000004_120880_121443 187
354 3300046453 Ga0495627_000490 Ga0495627_000490_12440_13003 187
355 3300046453 Ga0495627_018393 Ga0495627_018393_1633_2196 187
356 3300046455 Ga0495603_0002723 Ga0495603_0002723_5528_6091 187
357 3300046455 Ga0495603_0081925 Ga0495603_0081925_922_1485 187
358 3300046455 Ga0495603_0515566 Ga0495603_0515566_101_664 187
359 3300046457 Ga0495590_0000039 Ga0495590_0000039_30171_30734 187
360 3300046457 Ga0495590_0000047 Ga0495590_0000047_48302_48865 187
361 3300046457 Ga0495590_0006258 Ga0495590_0006258_327_890 187
362 3300046457 Ga0495590_0026792 Ga0495590_0026792_1432_1995 187
363 3300046458 Ga0495591_000091 Ga0495591_000091_18506_19069 187
364 3300046459 Ga0495629_0012836 Ga0495629_0012836_1925_2488 187
365 3300046459 Ga0495629_0035893 Ga0495629_0035893_1488_2051 187
366 3300046459 Ga0495629_0041206 Ga0495629_0041206_494_1057 187
367 3300046460 Ga0495638_0000407 Ga0495638_0000407_1104_1667 187
368 3300046460 Ga0495638_0004498 Ga0495638_0004498_4325_4888 187
369 3300046460 Ga0495638_0030712 Ga0495638_0030712_1719_2408 187
370 3300046460 Ga0495638_0081596 Ga0495638_0081596_870_1433 187
371 3300046462 Ga0495651_0048412 Ga0495651_0048412_2677_3240 187
372 3300046462 Ga0495651_0052558 Ga0495651_0052558_676_1239 187
373 3300046463 Ga0495653_0000035 Ga0495653_0000035_21095_21688 187
374 3300046463 Ga0495653_0023979 Ga0495653_0023979_1748_2311 187
375 3300046463 Ga0495653_0024510 Ga0495653_0024510_1148_1711 187
376 3300046463 Ga0495653_0034641 Ga0495653_0034641_2703_3266 187
377 3300046471 Ga0495650_0000128 Ga0495650_0000128_21044_21607 187
378 3300046471 Ga0495650_0000157 Ga0495650_0000157_107385_107948 187
379 3300046471 Ga0495650_0000261 Ga0495650_0000261_45486_46049 187
380 3300046471 Ga0495650_0000576 Ga0495650_0000576_25173_25736 187
381 3300046471 Ga0495650_0000650 Ga0495650_0000650_2476_3039 187
382 3300046471 Ga0495650_0000970 Ga0495650_0000970_4534_5097 187
383 3300046471 Ga0495650_0007876 Ga0495650_0007876_3369_3932 187
384 3300046471 Ga0495650_0026596 Ga0495650_0026596_2007_2570 187
385 3300046472 Ga0495580_0153631 Ga0495580_0153631_417_980 187
386 3300046473 Ga0495582_0003440 Ga0495582_0003440_794_1357 187
387 3300046473 Ga0495582_0007750 Ga0495582_0007750_5351_5914 187
388 3300046473 Ga0495582_0196839 Ga0495582_0196839_233_796 187
389 3300046474 Ga0495605_0000096 Ga0495605_0000096_63958_64521 187
390 3300046474 Ga0495605_0000239 Ga0495605_0000239_30280_30843 187
391 3300046474 Ga0495605_0005839 Ga0495605_0005839_396_959 187
392 3300046474 Ga0495605_0037164 Ga0495605_0037164_486_1049 187
393 3300046474 Ga0495605_0042662 Ga0495605_0042662_1267_1830 187
394 3300046474 Ga0495605_0046257 Ga0495605_0046257_809_1372 187
395 3300046474 Ga0495605_0049462 Ga0495605_0049462_705_1394 187
396 3300046474 Ga0495605_0050603 Ga0495605_0050603_1235_1798 187
397 3300046474 Ga0495605_0066793 Ga0495605_0066793_481_1044 187
398 3300046474 Ga0495605_0146157 Ga0495605_0146157_231_794 187
399 3300046474 Ga0495605_0157745 Ga0495605_0157745_205_768 187
400 3300046474 Ga0495605_0223725 Ga0495605_0223725_56_619 187
401 3300046491 Ga0495584_0000008 Ga0495584_0000008_112765_113328 187
402 3300046491 Ga0495584_0000085 Ga0495584_0000085_49917_50480 187
403 3300046491 Ga0495584_0000661 Ga0495584_0000661_15954_16643 187
404 3300046491 Ga0495584_0000702 Ga0495584_0000702_19096_19659 187
405 3300046491 Ga0495584_0007961 Ga0495584_0007961_1412_1975 187
406 3300046491 Ga0495584_0018702 Ga0495584_0018702_1893_2456 187
407 3300046491 Ga0495584_0021242 Ga0495584_0021242_1989_2552 187
408 3300046491 Ga0495584_0028932 Ga0495584_0028932_1818_2381 187
409 3300046491 Ga0495584_0074750 Ga0495584_0074750_1046_1609 187
410 3300046492 Ga0495585_0000175 Ga0495585_0000175_32714_33277 187
411 3300046492 Ga0495585_0000410 Ga0495585_0000410_26368_26931 187
412 3300046492 Ga0495585_0000558 Ga0495585_0000558_18221_18784 187
413 3300046492 Ga0495585_0000739 Ga0495585_0000739_12794_13357 187
414 3300046492 Ga0495585_0001146 Ga0495585_0001146_3819_4382 187
415 3300046492 Ga0495585_0002326 Ga0495585_0002326_7895_8458 187
416 3300046492 Ga0495585_0004740 Ga0495585_0004740_5998_6561 187
417 3300046492 Ga0495585_0006142 Ga0495585_0006142_1842_2405 187
418 3300046492 Ga0495585_0006680 Ga0495585_0006680_6475_7038 187
419 3300046492 Ga0495585_0012864 Ga0495585_0012864_3252_3815 187
420 3300046492 Ga0495585_0021010 Ga0495585_0021010_1997_2560 187
421 3300046492 Ga0495585_0021598 Ga0495585_0021598_1340_1903 187
422 3300046492 Ga0495585_0025762 Ga0495585_0025762_2736_3299 187
423 3300046492 Ga0495585_0029234 Ga0495585_0029234_213_776 187
424 3300046492 Ga0495585_0044924 Ga0495585_0044924_56_619 187
425 3300046492 Ga0495585_0053045 Ga0495585_0053045_454_1017 187
426 3300046492 Ga0495585_0086112 Ga0495585_0086112_724_1287 187
427 3300046492 Ga0495585_0086515 Ga0495585_0086515_530_1093 187
428 3300046492 Ga0495585_0132041 Ga0495585_0132041_642_1205 187
429 3300046492 Ga0495585_0176218 Ga0495585_0176218_164_727 187
430 3300046499 Ga0495594_0006303 Ga0495594_0006303_2103_2666 187
431 3300046499 Ga0495594_0013500 Ga0495594_0013500_3545_4108 187
432 3300046499 Ga0495594_0034800 Ga0495594_0034800_1423_1986 187
433 3300046499 Ga0495594_0068173 Ga0495594_0068173_248_811 187
434 3300046499 Ga0495594_0141171 Ga0495594_0141171_576_1139 187
435 3300046500 Ga0495596_0000646 Ga0495596_0000646_10063_10626 187
436 3300046500 Ga0495596_0001510 Ga0495596_0001510_391_954 187
437 3300046500 Ga0495596_0002243 Ga0495596_0002243_1050_1613 187
438 3300046500 Ga0495596_0012883 Ga0495596_0012883_1641_2204 187
439 3300046500 Ga0495596_0020544 Ga0495596_0020544_1323_1886 187
440 3300046500 Ga0495596_0035281 Ga0495596_0035281_1312_1875 187
441 3300046500 Ga0495596_0079897 Ga0495596_0079897_437_1000 187
442 3300046501 Ga0495607_0000554 Ga0495607_0000554_16461_17024 187
443 3300046501 Ga0495607_0000669 Ga0495607_0000669_24921_25484 187
444 3300046501 Ga0495607_0005056 Ga0495607_0005056_4037_4600 187
445 3300046501 Ga0495607_0005864 Ga0495607_0005864_4923_5486 187
446 3300046501 Ga0495607_0008086 Ga0495607_0008086_5428_5991 187
447 3300046501 Ga0495607_0012656 Ga0495607_0012656_1189_1752 187
448 3300046501 Ga0495607_0012665 Ga0495607_0012665_2633_3196 187
449 3300046501 Ga0495607_0016637 Ga0495607_0016637_3469_4032 187
450 3300046501 Ga0495607_0055955 Ga0495607_0055955_1088_1651 187
451 3300046501 Ga0495607_0159208 Ga0495607_0159208_26_589 187
452 3300046501 Ga0495607_0263473 Ga0495607_0263473_218_781 187
453 3300046506 Ga0495583_0000115 Ga0495583_0000115_112178_112867 187
454 3300046506 Ga0495583_0000141 Ga0495583_0000141_37387_37950 187
455 3300046506 Ga0495583_0000981 Ga0495583_0000981_13425_13988 187
456 3300046506 Ga0495583_0001163 Ga0495583_0001163_1259_1822 187
457 3300046506 Ga0495583_0001485 Ga0495583_0001485_6157_6720 187
458 3300046506 Ga0495583_0030694 Ga0495583_0030694_1989_2552 187
459 3300046506 Ga0495583_0037677 Ga0495583_0037677_776_1339 187
460 3300046506 Ga0495583_0068455 Ga0495583_0068455_740_1303 187
461 3300046507 Ga0495606_0000180 Ga0495606_0000180_36046_36609 187
462 3300046507 Ga0495606_0000228 Ga0495606_0000228_44036_44659 187
463 3300046507 Ga0495606_0000512 Ga0495606_0000512_51372_51965 187
464 3300046507 Ga0495606_0000828 Ga0495606_0000828_46338_46901 187
465 3300046507 Ga0495606_0000829 Ga0495606_0000829_43423_43986 187
466 3300046507 Ga0495606_0000850 Ga0495606_0000850_36059_36682 187
467 3300046507 Ga0495606_0001374 Ga0495606_0001374_10710_11273 187
468 3300046507 Ga0495606_0002886 Ga0495606_0002886_5882_6445 187
469 3300046507 Ga0495606_0003647 Ga0495606_0003647_9255_9818 187
470 3300046507 Ga0495606_0006698 Ga0495606_0006698_9585_10148 187
471 3300046507 Ga0495606_0030597 Ga0495606_0030597_585_1148 187
472 3300046507 Ga0495606_0042288 Ga0495606_0042288_253_816 187
473 3300046507 Ga0495606_0050086 Ga0495606_0050086_1478_2041 187
474 3300046507 Ga0495606_0084295 Ga0495606_0084295_295_858 187
475 3300046507 Ga0495606_0180206 Ga0495606_0180206_64_627 187
476 3300046511 Ga0495608_0033832 Ga0495608_0033832_2167_2730 187
477 3300046512 Ga0495610_0003299 Ga0495610_0003299_1385_1948 187
478 3300046512 Ga0495610_0003645 Ga0495610_0003645_3727_4290 187
479 3300046512 Ga0495610_0009819 Ga0495610_0009819_4246_4809 187
480 3300046512 Ga0495610_0017488 Ga0495610_0017488_1907_2530 187
481 3300046512 Ga0495610_0085695 Ga0495610_0085695_639_1202 187
482 3300046513 Ga0495616_0000120 Ga0495616_0000120_17715_18278 187
483 3300046513 Ga0495616_0000990 Ga0495616_0000990_19416_19979 187
484 3300046513 Ga0495616_0001050 Ga0495616_0001050_4180_4743 187
485 3300046513 Ga0495616_0004042 Ga0495616_0004042_4901_5464 187
486 3300046513 Ga0495616_0004864 Ga0495616_0004864_577_1140 187
487 3300046513 Ga0495616_0008919 Ga0495616_0008919_1104_1667 187
488 3300046513 Ga0495616_0017909 Ga0495616_0017909_2347_2910 187
489 3300046513 Ga0495616_0029802 Ga0495616_0029802_114_677 187
490 3300046513 Ga0495616_0044553 Ga0495616_0044553_1246_1809 187
491 3300046513 Ga0495616_0049234 Ga0495616_0049234_1237_1800 187
492 3300046513 Ga0495616_0053260 Ga0495616_0053260_50_613 187
493 3300046515 Ga0495620_0011899 Ga0495620_0011899_1062_1625 187
494 3300046518 Ga0495631_0000300 Ga0495631_0000300_14492_15055 187
495 3300046518 Ga0495631_0003792 Ga0495631_0003792_6403_6966 187
496 3300046518 Ga0495631_0005692 Ga0495631_0005692_1310_1873 187
497 3300046518 Ga0495631_0008274 Ga0495631_0008274_2615_3178 187
498 3300046518 Ga0495631_0024426 Ga0495631_0024426_1726_2289 187
499 3300046518 Ga0495631_0039073 Ga0495631_0039073_283_846 187
500 3300046518 Ga0495631_0063056 Ga0495631_0063056_268_831 187
501 3300046518 Ga0495631_0070367 Ga0495631_0070367_77_640 187
502 3300046519 Ga0495632_0000094 Ga0495632_0000094_45776_46339 187
503 3300046519 Ga0495632_0000141 Ga0495632_0000141_44118_44681 187
504 3300046519 Ga0495632_0000456 Ga0495632_0000456_23169_23732 187
505 3300046519 Ga0495632_0000458 Ga0495632_0000458_16705_17268 187
506 3300046519 Ga0495632_0002459 Ga0495632_0002459_8810_9373 187
507 3300046519 Ga0495632_0030953 Ga0495632_0030953_980_1543 187
508 3300046520 Ga0495637_0000004 Ga0495637_0000004_72591_73154 187
509 3300046520 Ga0495637_0000142 Ga0495637_0000142_1749_2372 187
510 3300046520 Ga0495637_0001262 Ga0495637_0001262_3915_4538 187
511 3300046520 Ga0495637_0012374 Ga0495637_0012374_2006_2569 187
512 3300046520 Ga0495637_0054858 Ga0495637_0054858_1036_1599 187
513 3300046522 Ga0495643_0000082 Ga0495643_0000082_89266_89829 187
514 3300046522 Ga0495643_0000160 Ga0495643_0000160_62349_62912 187
515 3300046522 Ga0495643_0000822 Ga0495643_0000822_21307_21870 187
516 3300046522 Ga0495643_0005425 Ga0495643_0005425_4840_5403 187
517 3300046522 Ga0495643_0044587 Ga0495643_0044587_1318_1881 187
518 3300046522 Ga0495643_0093163 Ga0495643_0093163_928_1491 187
519 3300046523 Ga0495644_0002967 Ga0495644_0002967_5193_5756 187
520 3300046523 Ga0495644_0007916 Ga0495644_0007916_3076_3639 187
521 3300046523 Ga0495644_0009102 Ga0495644_0009102_1067_1630 187
522 3300046523 Ga0495644_0015551 Ga0495644_0015551_1087_1650 187
523 3300046523 Ga0495644_0027834 Ga0495644_0027834_1428_2117 187
524 3300046523 Ga0495644_0041211 Ga0495644_0041211_321_884 187
525 3300046523 Ga0495644_0042956 Ga0495644_0042956_733_1296 187
526 3300046523 Ga0495644_0083888 Ga0495644_0083888_94_657 187
527 3300046523 Ga0495644_0101265 Ga0495644_0101265_469_1032 187
528 3300046524 Ga0495648_0000019 Ga0495648_0000019_50756_51319 187
529 3300046524 Ga0495648_0000030 Ga0495648_0000030_87642_88205 187
530 3300046524 Ga0495648_0001166 Ga0495648_0001166_3020_3709 187
531 3300046524 Ga0495648_0007615 Ga0495648_0007615_1352_1915 187
532 3300046524 Ga0495648_0007994 Ga0495648_0007994_2597_3160 187
533 3300046524 Ga0495648_0016105 Ga0495648_0016105_2755_3318 187
534 3300046524 Ga0495648_0162972 Ga0495648_0162972_438_1001 187
535 3300046525 Ga0495663_0015304 Ga0495663_0015304_1435_1998 187
536 3300046525 Ga0495663_0022922 Ga0495663_0022922_1193_1756 187
537 3300046525 Ga0495663_0033891 Ga0495663_0033891_309_872 187
538 3300046526 Ga0495666_0002786 Ga0495666_0002786_6144_6707 187
539 3300046526 Ga0495666_0008506 Ga0495666_0008506_3323_3886 187
540 3300046526 Ga0495666_0056067 Ga0495666_0056067_802_1365 187
541 3300046528 Ga0495642_0000271 Ga0495642_0000271_11793_12356 187
542 3300046528 Ga0495642_0000806 Ga0495642_0000806_7871_8434 187
543 3300046528 Ga0495642_0010238 Ga0495642_0010238_1428_1991 187
544 3300046528 Ga0495642_0020073 Ga0495642_0020073_1407_1970 187
545 3300046528 Ga0495642_0031119 Ga0495642_0031119_481_1044 187
546 3300046528 Ga0495642_0033364 Ga0495642_0033364_587_1150 187
547 3300046528 Ga0495642_0034743 Ga0495642_0034743_1446_2009 187
548 3300046528 Ga0495642_0040216 Ga0495642_0040216_680_1243 187
549 3300046529 Ga0495652_0132760 Ga0495652_0132760_895_1458 187
550 3300046529 Ga0495652_0177819 Ga0495652_0177819_120_683 187
551 3300046530 Ga0495654_0000014 Ga0495654_0000014_170306_170929 187
552 3300046530 Ga0495654_0011998 Ga0495654_0011998_843_1406 187
553 3300046530 Ga0495654_0035958 Ga0495654_0035958_1862_2425 187
554 3300046530 Ga0495654_0052510 Ga0495654_0052510_23_586 187
555 3300046531 Ga0495665_0048107 Ga0495665_0048107_1345_1908 187
556 3300046533 Ga0495640_0258966 Ga0495640_0258966_316_879 187
557 3300046535 Ga0495586_0011018 Ga0495586_0011018_3640_4203 187
558 3300046535 Ga0495586_0151531 Ga0495586_0151531_205_768 187
559 3300046536 Ga0495587_0007968 Ga0495587_0007968_4035_4598 187
560 3300046536 Ga0495587_0123277 Ga0495587_0123277_228_791 187
561 3300046538 Ga0495609_0000021 Ga0495609_0000021_201449_202012 187
562 3300046538 Ga0495609_0000813 Ga0495609_0000813_1344_1907 187
563 3300046538 Ga0495609_0002273 Ga0495609_0002273_8008_8571 187
564 3300046538 Ga0495609_0006554 Ga0495609_0006554_4866_5429 187
565 3300046538 Ga0495609_0006887 Ga0495609_0006887_83_646 187
566 3300046538 Ga0495609_0040246 Ga0495609_0040246_667_1230 187
567 3300046538 Ga0495609_0055718 Ga0495609_0055718_87_650 187
568 3300046538 Ga0495609_0165475 Ga0495609_0165475_327_890 187
569 3300046542 Ga0495597_0000364 Ga0495597_0000364_7183_7746 187
570 3300046542 Ga0495597_0000544 Ga0495597_0000544_9327_9890 187
571 3300046542 Ga0495597_0001183 Ga0495597_0001183_9188_9751 187
572 3300046542 Ga0495597_0002172 Ga0495597_0002172_5727_6290 187
573 3300046542 Ga0495597_0005834 Ga0495597_0005834_1358_1921 187
574 3300046542 Ga0495597_0029465 Ga0495597_0029465_449_1012 187
575 3300046542 Ga0495597_0042859 Ga0495597_0042859_169_732 187
576 3300046542 Ga0495597_0049952 Ga0495597_0049952_751_1314 187
577 3300046543 Ga0495645_0258422 Ga0495645_0258422_342_905 187
578 3300046557 Ga0495622_0000034 Ga0495622_0000034_61799_62362 187
579 3300046557 Ga0495622_0000071 Ga0495622_0000071_52752_53315 187
580 3300046557 Ga0495622_0003694 Ga0495622_0003694_3730_4293 187
581 3300046557 Ga0495622_0104216 Ga0495622_0104216_546_1109 187
582 3300046557 Ga0495622_0111315 Ga0495622_0111315_180_743 187
583 3300046557 Ga0495622_0132976 Ga0495622_0132976_399_962 187
584 3300046558 Ga0495633_0000077 Ga0495633_0000077_47688_48251 187
585 3300046558 Ga0495633_0000100 Ga0495633_0000100_72913_73536 187
586 3300046558 Ga0495633_0000764 Ga0495633_0000764_17803_18366 187
587 3300046558 Ga0495633_0003422 Ga0495633_0003422_9555_10118 187
588 3300046558 Ga0495633_0004475 Ga0495633_0004475_8213_8776 187
589 3300046558 Ga0495633_0006936 Ga0495633_0006936_2863_3426 187
590 3300046558 Ga0495633_0007251 Ga0495633_0007251_4017_4580 187
591 3300046558 Ga0495633_0038051 Ga0495633_0038051_733_1296 187
592 3300046558 Ga0495633_0064906 Ga0495633_0064906_218_907 187
593 3300046558 Ga0495633_0096202 Ga0495633_0096202_530_1093 187
594 3300046558 Ga0495633_0136701 Ga0495633_0136701_214_777 187
595 3300046558 Ga0495633_0240248 Ga0495633_0240248_44_607 187
596 3300046615 Ga0495656_0000543 Ga0495656_0000543_1269_1832 187
597 3300046615 Ga0495656_0105001 Ga0495656_0105001_473_1162 187
598 3300046616 Ga0495668_0000220 Ga0495668_0000220_38483_39046 187
599 3300046616 Ga0495668_0000231 Ga0495668_0000231_25231_25794 187
600 3300046616 Ga0495668_0000308 Ga0495668_0000308_11350_11913 187
601 3300046616 Ga0495668_0000351 Ga0495668_0000351_31384_31947 187
602 3300046616 Ga0495668_0000481 Ga0495668_0000481_17141_17704 187
603 3300046616 Ga0495668_0000602 Ga0495668_0000602_8059_8622 187
604 3300046616 Ga0495668_0011582 Ga0495668_0011582_3858_4481 187
605 3300046616 Ga0495668_0029703 Ga0495668_0029703_89_652 187
606 3300046616 Ga0495668_0056336 Ga0495668_0056336_924_1487 187
607 3300046616 Ga0495668_0060496 Ga0495668_0060496_1229_1792 187
608 3300046616 Ga0495668_0063701 Ga0495668_0063701_221_784 187
609 3300046616 Ga0495668_0070764 Ga0495668_0070764_1332_1895 187
610 3300046616 Ga0495668_0407178 Ga0495668_0407178_157_720 187
611 3300046642 Ga0495634_0015257 Ga0495634_0015257_71_634 187
612 3300046648 Ga0495611_0000503 Ga0495611_0000503_20619_21182 187
613 3300046648 Ga0495611_0000909 Ga0495611_0000909_11483_12046 187
614 3300046648 Ga0495611_0024824 Ga0495611_0024824_2006_2569 187
615 3300046648 Ga0495611_0028021 Ga0495611_0028021_1270_1833 187
616 3300046648 Ga0495611_0044133 Ga0495611_0044133_357_920 187
617 3300046648 Ga0495611_0061386 Ga0495611_0061386_12_575 187
618 3300046648 Ga0495611_0072854 Ga0495611_0072854_434_997 187
619 3300046648 Ga0495611_0095972 Ga0495611_0095972_404_967 187
620 3300046648 Ga0495611_0147461 Ga0495611_0147461_308_871 187
621 3300046660 Ga0495625_0001111 Ga0495625_0001111_21641_22204 187
622 3300046660 Ga0495625_0005276 Ga0495625_0005276_136_759 187
623 3300046660 Ga0495625_0007701 Ga0495625_0007701_1285_1848 187
624 3300046660 Ga0495625_0009390 Ga0495625_0009390_4503_5096 187
625 3300046660 Ga0495625_0015253 Ga0495625_0015253_5337_5900 187
626 3300046660 Ga0495625_0025935 Ga0495625_0025935_1734_2423 187
627 3300046660 Ga0495625_0039518 Ga0495625_0039518_825_1388 187
628 3300046660 Ga0495625_0057433 Ga0495625_0057433_1943_2506 187
629 3300046660 Ga0495625_0071775 Ga0495625_0071775_1853_2416 187
630 3300046660 Ga0495625_0348237 Ga0495625_0348237_69_632 187
631 3300046663 Ga0495635_0004579 Ga0495635_0004579_1372_1935 187
632 3300046663 Ga0495635_0059679 Ga0495635_0059679_26_589 187
633 3300046664 Ga0495659_0000049 Ga0495659_0000049_46537_47160 187
634 3300046664 Ga0495659_0003870 Ga0495659_0003870_1930_2619 187
635 3300046664 Ga0495659_0330252 Ga0495659_0330252_16_636 187
636 3300046665 Ga0495661_0000091 Ga0495661_0000091_85947_86510 187
637 3300046665 Ga0495661_0000798 Ga0495661_0000798_21073_21636 187
638 3300046665 Ga0495661_0001154 Ga0495661_0001154_18671_19234 187
639 3300046665 Ga0495661_0001188 Ga0495661_0001188_833_1396 187
640 3300046665 Ga0495661_0002171 Ga0495661_0002171_1423_1986 187
641 3300046665 Ga0495661_0009106 Ga0495661_0009106_4949_5512 187
642 3300046665 Ga0495661_0010564 Ga0495661_0010564_3896_4459 187
643 3300046665 Ga0495661_0027413 Ga0495661_0027413_886_1449 187
644 3300046665 Ga0495661_0039244 Ga0495661_0039244_1903_2466 187
645 3300046665 Ga0495661_0049487 Ga0495661_0049487_1482_2045 187
646 3300046665 Ga0495661_0051007 Ga0495661_0051007_61_624 187
647 3300046665 Ga0495661_0052095 Ga0495661_0052095_831_1394 187
648 3300046665 Ga0495661_0062056 Ga0495661_0062056_12_575 187
649 3300046665 Ga0495661_0093967 Ga0495661_0093967_840_1403 187
650 3300046665 Ga0495661_0094514 Ga0495661_0094514_1099_1662 187
651 3300046665 Ga0495661_0172683 Ga0495661_0172683_69_632 187
652 3300046674 Ga0495588_0000083 Ga0495588_0000083_101054_101617 187
653 3300046674 Ga0495588_0067699 Ga0495588_0067699_285_848 187
654 3300046674 Ga0495588_0072611 Ga0495588_0072611_513_1076 187
655 3300046674 Ga0495588_0076325 Ga0495588_0076325_406_969 187
656 3300046674 Ga0495588_0107813 Ga0495588_0107813_656_1219 187
657 3300046678 Ga0495599_0007003 Ga0495599_0007003_4505_5068 187
658 3300046679 Ga0495623_0047900 Ga0495623_0047900_2107_2670 187
659 3300046679 Ga0495623_0127018 Ga0495623_0127018_410_973 187
660 3300046680 Ga0495646_0031412 Ga0495646_0031412_983_1546 187
661 3300046680 Ga0495646_0045634 Ga0495646_0045634_2005_2568 187
662 3300046684 Ga0495669_0000085 Ga0495669_0000085_40431_40994 187
663 3300046684 Ga0495669_0005609 Ga0495669_0005609_1942_2505 187
664 3300046684 Ga0495669_0005856 Ga0495669_0005856_4310_4873 187
665 3300046684 Ga0495669_0033307 Ga0495669_0033307_56_619 187
666 3300046684 Ga0495669_0325855 Ga0495669_0325855_161_724 187
667 3300046689 Ga0495613_0021032 Ga0495613_0021032_704_1267 187
668 3300046689 Ga0495613_0056539 Ga0495613_0056539_661_1224 187
669 3300046690 Ga0495624_0081358 Ga0495624_0081358_1015_1578 187
670 3300046690 Ga0495624_0279646 Ga0495624_0279646_55_618 187
671 3300046691 Ga0495670_0001905 Ga0495670_0001905_8893_9456 187
672 3300046691 Ga0495670_0002678 Ga0495670_0002678_43_606 187
673 3300046691 Ga0495670_0022660 Ga0495670_0022660_1861_2424 187
674 3300046691 Ga0495670_0030121 Ga0495670_0030121_406_969 187
675 3300046691 Ga0495670_0199846 Ga0495670_0199846_362_925 187
676 3300046691 Ga0495670_0229699 Ga0495670_0229699_40_603 187
677 3300046692 Ga0495671_0000005 Ga0495671_0000005_222575_223168 187
678 3300046692 Ga0495671_0004998 Ga0495671_0004998_2738_3301 187
679 3300046692 Ga0495671_0006502 Ga0495671_0006502_554_1117 187
680 3300046692 Ga0495671_0113779 Ga0495671_0113779_107_670 187
681 3300046692 Ga0495671_0147805 Ga0495671_0147805_94_657 187
682 3300046694 Ga0495649_0005036 Ga0495649_0005036_1019_1582 187
683 3300046694 Ga0495649_0044619 Ga0495649_0044619_1076_1639 187
684 3300046794 Ga0495589_0000012 Ga0495589_0000012_201288_201851 187
685 3300046794 Ga0495589_0000022 Ga0495589_0000022_28564_29127 187
686 3300046794 Ga0495589_0000420 Ga0495589_0000420_11977_12540 187
687 3300046794 Ga0495589_0007242 Ga0495589_0007242_5133_5696 187
688 3300046794 Ga0495589_0014059 Ga0495589_0014059_3161_3724 187
689 3300046794 Ga0495589_0024520 Ga0495589_0024520_1100_1663 187
690 3300046794 Ga0495589_0025436 Ga0495589_0025436_1888_2451 187
691 3300046794 Ga0495589_0036258 Ga0495589_0036258_770_1333 187
692 3300046794 Ga0495589_0041314 Ga0495589_0041314_962_1525 187
693 3300046794 Ga0495589_0047066 Ga0495589_0047066_1447_2010 187
694 3300046794 Ga0495589_0072549 Ga0495589_0072549_511_1074 187
695 3300046809 Ga0495600_0014283 Ga0495600_0014283_2697_3260 187
696 3300046809 Ga0495600_0072949 Ga0495600_0072949_1141_1704 187
697 3300046809 Ga0495600_0146470 Ga0495600_0146470_454_1017 187
698 3300046810 Ga0495660_0000192 Ga0495660_0000192_2626_3189 187
699 3300046810 Ga0495660_0000203 Ga0495660_0000203_53905_54468 187
700 3300046810 Ga0495660_0000514 Ga0495660_0000514_4281_4904 187
701 3300046810 Ga0495660_0002004 Ga0495660_0002004_11380_11943 187
702 3300046810 Ga0495660_0004348 Ga0495660_0004348_5250_5813 187
703 3300046810 Ga0495660_0004732 Ga0495660_0004732_2294_2857 187
704 3300046810 Ga0495660_0065327 Ga0495660_0065327_649_1212 187
705 3300046810 Ga0495660_0264645 Ga0495660_0264645_122_685 187
706 3300047315 Ga0495581_0006379 Ga0495581_0006379_1426_1989 187
707 3300047315 Ga0495581_0007089 Ga0495581_0007089_355_918 187
708 3300047315 Ga0495581_0010263 Ga0495581_0010263_4207_4770 187
709 3300047315 Ga0495581_0030890 Ga0495581_0030890_1295_1858 187
710 3300047317 Ga0495604_0007352 Ga0495604_0007352_4473_5036 187
711 3300047317 Ga0495604_0063363 Ga0495604_0063363_788_1351 187
712 3300047317 Ga0495604_0090489 Ga0495604_0090489_475_1038 187
713 3300047318 Ga0495636_0000698 Ga0495636_0000698_4525_5214 187
714 3300047318 Ga0495636_0011290 Ga0495636_0011290_405_968 187
715 3300047319 Ga0495674_0010761 Ga0495674_0010761_4667_5230 187
716 3300047319 Ga0495674_0511242 Ga0495674_0511242_159_722 187
717 3300047320 Ga0495672_0000026 Ga0495672_0000026_10140_10763 187
718 3300047320 Ga0495672_0000081 Ga0495672_0000081_69445_70008 187
719 3300047320 Ga0495672_0000523 Ga0495672_0000523_40827_41390 187
720 3300047320 Ga0495672_0000861 Ga0495672_0000861_8227_8790 187
721 3300047320 Ga0495672_0003857 Ga0495672_0003857_9852_10415 187
722 3300047320 Ga0495672_0021590 Ga0495672_0021590_3118_3807 187
723 3300047320 Ga0495672_0120382 Ga0495672_0120382_107_670 187
724 3300047321 Ga0495676_0000214 Ga0495676_0000214_19727_20290 187
725 3300047321 Ga0495676_0018769 Ga0495676_0018769_3321_3884 187
726 3300047321 Ga0495676_0061566 Ga0495676_0061566_11_574 187
727 3300047323 Ga0495683_0000035 Ga0495683_0000035_21085_21648 187
728 3300047323 Ga0495683_0001320 Ga0495683_0001320_8723_9286 187
729 3300047323 Ga0495683_0003892 Ga0495683_0003892_4433_4996 187
730 3300047323 Ga0495683_0008357 Ga0495683_0008357_4534_5097 187
731 3300047323 Ga0495683_0009395 Ga0495683_0009395_2498_3061 187
732 3300047323 Ga0495683_0016977 Ga0495683_0016977_732_1295 187
733 3300047323 Ga0495683_0048269 Ga0495683_0048269_773_1462 187
734 3300047323 Ga0495683_0055938 Ga0495683_0055938_843_1406 187
735 3300047323 Ga0495683_0099472 Ga0495683_0099472_645_1208 187
736 3300047443 Ga0495687_000063 Ga0495687_000063_39487_40050 187
737 3300047443 Ga0495687_000151 Ga0495687_000151_23507_24070 187
738 3300047443 Ga0495687_000214 Ga0495687_000214_45822_46385 187
739 3300047443 Ga0495687_000284 Ga0495687_000284_23234_23797 187
740 3300047443 Ga0495687_000671 Ga0495687_000671_12675_13238 187
741 3300047443 Ga0495687_001571 Ga0495687_001571_7089_7778 187
742 3300047443 Ga0495687_008516 Ga0495687_008516_459_1022 187
743 3300047443 Ga0495687_013290 Ga0495687_013290_447_1010 187
744 3300047444 Ga0495675_0004016 Ga0495675_0004016_7080_7643 187
745 3300047444 Ga0495675_0298116 Ga0495675_0298116_330_893 187
746 3300047445 Ga0495677_0000046 Ga0495677_0000046_26584_27147 187
747 3300047445 Ga0495677_0007225 Ga0495677_0007225_1813_2376 187
748 3300047445 Ga0495677_0012550 Ga0495677_0012550_1911_2600 187
749 3300047445 Ga0495677_0018812 Ga0495677_0018812_1535_2098 187
750 3300047445 Ga0495677_0026974 Ga0495677_0026974_1237_1800 187
751 3300047445 Ga0495677_0032228 Ga0495677_0032228_1028_1591 187
752 3300047445 Ga0495677_0117014 Ga0495677_0117014_404_967 187
753 3300047446 Ga0495679_004467 Ga0495679_004467_4071_4634 187
754 3300047446 Ga0495679_024697 Ga0495679_024697_980_1543 187
755 3300047447 Ga0495685_000084 Ga0495685_000084_17675_18364 187
756 3300047447 Ga0495685_024820 Ga0495685_024820_355_918 187
757 3300047447 Ga0495685_061356 Ga0495685_061356_11_574 187
758 3300047469 Ga0495673_0000008 Ga0495673_0000008_636205_636828 187
759 3300047469 Ga0495673_0000009 Ga0495673_0000009_566211_566774 187
760 3300047469 Ga0495673_0000012 Ga0495673_0000012_451053_451616 187
761 3300047470 Ga0495681_0000334 Ga0495681_0000334_16978_17541 187
762 3300047470 Ga0495681_0006521 Ga0495681_0006521_1102_1665 187
763 3300047470 Ga0495681_0017619 Ga0495681_0017619_3245_3808 187
764 3300047470 Ga0495681_0040387 Ga0495681_0040387_1429_1992 187
765 3300047470 Ga0495681_0051071 Ga0495681_0051071_1227_1790 187
766 3300047470 Ga0495681_0103795 Ga0495681_0103795_306_869 187
767 3300047470 Ga0495681_0106784 Ga0495681_0106784_31_594 187
768 3300047470 Ga0495681_0183436 Ga0495681_0183436_180_743 187
769 3300047472 Ga0495686_0000328 Ga0495686_0000328_6851_7414 187
770 3300047472 Ga0495686_0000348 Ga0495686_0000348_39198_39761 187
771 3300047472 Ga0495686_0005295 Ga0495686_0005295_2146_2709 187
772 3300047472 Ga0495686_0010068 Ga0495686_0010068_4970_5533 187
773 3300047472 Ga0495686_0014249 Ga0495686_0014249_4855_5418 187
774 3300047472 Ga0495686_0064102 Ga0495686_0064102_204_767 187
775 3300047673 Ga0495593_0006069 Ga0495593_0006069_6222_6785 187
776 3300047673 Ga0495593_0009789 Ga0495593_0009789_4006_4569 187
777 3300047673 Ga0495593_0192943 Ga0495593_0192943_267_830 187
778 3300048088 Ga0495602_0013467 Ga0495602_0013467_3232_3795 187
779 3300048088 Ga0495602_0176287 Ga0495602_0176287_871_1434 187
780 3300048089 Ga0495614_0005972 Ga0495614_0005972_4497_5060 187
781 3300048089 Ga0495614_0016163 Ga0495614_0016163_1742_2305 187
782 3300048089 Ga0495614_0344157 Ga0495614_0344157_121_684 187
783 3300048090 Ga0495615_0028374 Ga0495615_0028374_643_1206 187
784 3300048090 Ga0495615_0031127 Ga0495615_0031127_76_639 187
785 3300048091 Ga0495626_0000021 Ga0495626_0000021_184529_185092 187
786 3300048091 Ga0495626_0000122 Ga0495626_0000122_38999_39562 187
787 3300048091 Ga0495626_0000793 Ga0495626_0000793_2103_2666 187
788 3300048091 Ga0495626_0004338 Ga0495626_0004338_6462_7025 187
789 3300048091 Ga0495626_0004682 Ga0495626_0004682_6225_6788 187
790 3300048091 Ga0495626_0006948 Ga0495626_0006948_158_721 187
791 3300048091 Ga0495626_0008530 Ga0495626_0008530_987_1550 187
792 3300048091 Ga0495626_0018719 Ga0495626_0018719_745_1308 187
793 3300048091 Ga0495626_0029526 Ga0495626_0029526_250_813 187
794 3300048091 Ga0495626_0031152 Ga0495626_0031152_696_1259 187
795 3300048091 Ga0495626_0067550 Ga0495626_0067550_133_696 187
796 3300048091 Ga0495626_0160534 Ga0495626_0160534_41_604 187
797 3300048903 Ga0496100_0062388 Ga0496100_0062388_818_1381 187
798 3300048904 Ga0496101_0068401 Ga0496101_0068401_1898_2461 187
799 3300048905 Ga0496102_0067868 Ga0496102_0067868_1035_1598 187
800 3300048905 Ga0496102_0167241 Ga0496102_0167241_642_1205 187
801 3300048906 Ga0496103_0002721 Ga0496103_0002721_1128_1721 187
802 3300048906 Ga0496103_0619770 Ga0496103_0619770_37_600 187
803 3300048908 Ga0496105_0024042 Ga0496105_0024042_494_1057 187
804 3300048909 Ga0496106_0017162 Ga0496106_0017162_3222_3785 187
805 3300048913 Ga0496110_0000085 Ga0496110_0000085_31380_31943 187
806 3300048917 Ga0496114_0086866 Ga0496114_0086866_1984_2577 187
807 3300048918 Ga0496115_0376539 Ga0496115_0376539_214_777 187
808 3300048919 Ga0496116_0045416 Ga0496116_0045416_504_1067 187
809 3300048921 Ga0496118_0184939 Ga0496118_0184939_549_1112 187
810 3300048924 Ga0496121_0083984 Ga0496121_0083984_554_1117 187
811 3300048924 Ga0496121_0147384 Ga0496121_0147384_144_707 187
812 3300048925 Ga0496122_0000432 Ga0496122_0000432_42452_43015 187
813 3300048925 Ga0496122_0015889 Ga0496122_0015889_6196_6759 187
814 3300048925 Ga0496122_0038127 Ga0496122_0038127_64_627 187
815 3300048925 Ga0496122_0052986 Ga0496122_0052986_766_1329 187
816 3300048926 Ga0496123_0000916 Ga0496123_0000916_43795_44358 187
817 3300048926 Ga0496123_0028342 Ga0496123_0028342_3362_3925 187
818 3300048927 Ga0496124_0006076 Ga0496124_0006076_2686_3249 187
819 3300048927 Ga0496124_0022498 Ga0496124_0022498_2777_3340 187
820 3300048927 Ga0496124_0069882 Ga0496124_0069882_710_1273 187
821 3300048927 Ga0496124_0096751 Ga0496124_0096751_999_1562 187
822 3300048927 Ga0496124_0432291 Ga0496124_0432291_48_611 187
823 3300048928 Ga0496125_0004178 Ga0496125_0004178_746_1309 187
824 3300048928 Ga0496125_0176876 Ga0496125_0176876_250_813 187
825 3300048929 Ga0496126_0010059 Ga0496126_0010059_6101_6664 187
826 3300048929 Ga0496126_0794417 Ga0496126_0794417_16_579 187
827 3300049129 Ga0501309_045099 Ga0501309_045099_100_663 187
828 3300049131 Ga0501341_04867 Ga0501341_04867_154_747 187
829 3300049459 Ga0495678_000027 Ga0495678_000027_125454_126017 187
830 3300049459 Ga0495678_000074 Ga0495678_000074_35501_36064 187
831 3300049459 Ga0495678_000123 Ga0495678_000123_48058_48621 187
832 3300049459 Ga0495678_000629 Ga0495678_000629_24230_24793 187
833 3300049459 Ga0495678_000758 Ga0495678_000758_26598_27161 187
834 3300049459 Ga0495678_001070 Ga0495678_001070_21130_21693 187
835 3300049459 Ga0495678_035865 Ga0495678_035865_434_1123 187
836 3300049460 Ga0495682_0005477 Ga0495682_0005477_2571_3260 187
837 3300049460 Ga0495682_0005610 Ga0495682_0005610_2007_2696 187
838 3300049460 Ga0495682_0010310 Ga0495682_0010310_458_1021 187
839 3300049460 Ga0495682_0016584 Ga0495682_0016584_1959_2522 187
840 3300049527 Ga0501311_013327 Ga0501311_013327_361_924 187
841 3300049528 Ga0501312_052893 Ga0501312_052893_106_669 187
842 3300049539 Ga0501323_038762 Ga0501323_038762_82_645 187
843 3300049540 Ga0501324_007101 Ga0501324_007101_229_792 187
844 3300049550 Ga0501334_11282 Ga0501334_11282_79_642 187
845 3300049568 Ga0501031_0007119 Ga0501031_0007119_5399_5962 187
846 3300049570 Ga0501033_0002135 Ga0501033_0002135_14950_15513 187
847 3300049570 Ga0501033_0008896 Ga0501033_0008896_3036_3698 187
848 3300049571 Ga0501034_0024529 Ga0501034_0024529_1328_1891 187
849 3300049571 Ga0501034_0067425 Ga0501034_0067425_1136_1699 187
850 3300049572 Ga0501036_0001322 Ga0501036_0001322_3623_4186 187
851 3300049573 Ga0501037_0009574 Ga0501037_0009574_5264_5827 187
852 3300049573 Ga0501037_0024614 Ga0501037_0024614_2061_2624 187
853 3300049575 Ga0501039_0207665 Ga0501039_0207665_243_806 187
854 3300049579 Ga0501043_0032180 Ga0501043_0032180_92_655 187
855 3300049580 Ga0501046_0051025 Ga0501046_0051025_1890_2453 187
856 3300049580 Ga0501046_0633988 Ga0501046_0633988_92_655 187
857 3300049581 Ga0501047_0400985 Ga0501047_0400985_440_1003 187
858 3300049658 Ga0501211_004776 Ga0501211_004776_796_1359 187
859 3300049662 Ga0501222_002410 Ga0501222_002410_499_1062 187
860 3300049665 Ga0501227_001086 Ga0501227_001086_3056_3619 187
861 3300049671 Ga0501238_009063 Ga0501238_009063_387_950 187
862 3300049679 Ga0501249_014752 Ga0501249_014752_1067_1630 187
863 3300049682 Ga0501252_003309 Ga0501252_003309_458_1021 187
864 3300049766 Ga0501269_000005 Ga0501269_000005_10960_11523 187
865 3300049775 Ga0501279_006482 Ga0501279_006482_45_809 187
866 3300049822 Ga0501035_0023268 Ga0501035_0023268_3248_3811 187
867 3300049822 Ga0501035_0030003 Ga0501035_0030003_3291_3854 187
868 3300049823 Ga0501044_0002016 Ga0501044_0002016_3734_4297 187
869 3300049823 Ga0501044_0123595 Ga0501044_0123595_1753_2316 187
870 3300050489 nmdc:mga03683_134594_c1 nmdc:mga03683_134594_c1_338_931 187
871 3300050490 nmdc:mga03n38_66912_c1 nmdc:mga03n38_66912_c1_229_792 187
872 3300050491 nmdc:mga00v17_281508_c1 nmdc:mga00v17_281508_c1_437_1000 187
873 3300050492 nmdc:mga0yw44_287106_c1 nmdc:mga0yw44_287106_c1_102_665 187
874 3300050496 nmdc:mga07m45_97008_c1 nmdc:mga07m45_97008_c1_370_933 187
875 3300050507 nmdc:mga05p37_188254_c1 nmdc:mga05p37_188254_c1_52_615 187
876 3300050508 nmdc:mga09592_124568_c1 nmdc:mga09592_124568_c1_1437_2000 187
877 3300050509 nmdc:mga0qj67_193520_c1 nmdc:mga0qj67_193520_c1_514_1140 187
878 3300050510 nmdc:mga06r32_56772_c1 nmdc:mga06r32_56772_c1_746_1309 187
879 3300050510 nmdc:mga06r32_84819_c1 nmdc:mga06r32_84819_c1_2226_2852 187
880 3300050512 nmdc:mga0n895_201011_c1 nmdc:mga0n895_201011_c1_991_1554 187
881 3300050514 nmdc:mga08x19_28573_c1 nmdc:mga08x19_28573_c1_2858_3481 187
882 3300050515 nmdc:mga0a205_494475_c1 nmdc:mga0a205_494475_c1_235_846 187
883 3300050515 nmdc:mga0a205_81512_c1 nmdc:mga0a205_81512_c1_699_1262 187
884 3300053105 Ga0500557_076903 Ga0500557_076903_354_977 187
885 3300053118 Ga0500594_0003538 Ga0500594_0003538_527_1090 187
886 3300053125 Ga0500618_000170 Ga0500618_000170_1858_2481 187
887 3300053125 Ga0500618_004583 Ga0500618_004583_2564_3127 187
888 3300053125 Ga0500618_016008 Ga0500618_016008_588_1151 187
889 3300053141 Ga0500574_020631 Ga0500574_020631_767_1330 187
890 3300053145 Ga0500586_000124 Ga0500586_000124_9500_10063 187
891 3300053730 Ga0500645_008848 Ga0500645_008848_1774_2337 187
892 3300059477 Ga0587084_023889 Ga0587084_023889_253_816 187
893 3300059478 Ga0587093_011893 Ga0587093_011893_475_1038 187
894 3300059490 Ga0587066_104437 Ga0587066_104437_29_592 187
895 3300059491 Ga0587070_010639 Ga0587070_010639_558_1121 187
896 3300059493 Ga0587077_020918 Ga0587077_020918_428_991 187
897 3300059504 Ga0587082_021985 Ga0587082_021985_335_898 187
898 3300059506 Ga0587085_007423 Ga0587085_007423_671_1234 187
899 3300059507 Ga0587086_012158 Ga0587086_012158_382_945 187
900 3300059508 Ga0587088_010905 Ga0587088_010905_110_673 187
901 3300059509 Ga0587089_011846 Ga0587089_011846_102_665 187
902 3300059510 Ga0587090_013564 Ga0587090_013564_451_1014 187
903 3300059511 Ga0587091_011376 Ga0587091_011376_161_724 187
904 3300059512 Ga0587092_030021 Ga0587092_030021_141_704 187
905 3300059513 Ga0587094_033948 Ga0587094_033948_117_680 187
906 3300059602 Ga0587074_02287 Ga0587074_02287_19_582 187
907 3300059605 Ga0587106_027761 Ga0587106_027761_246_809 187
908 3300059607 Ga0587125_006728 Ga0587125_006728_389_952 187
909 3300059640 Ga0587067_048078 Ga0587067_048078_137_700 187
910 3300059641 Ga0587068_005455 Ga0587068_005455_381_944 187
911 3300059642 Ga0587069_003311 Ga0587069_003311_463_1026 187
912 3300059645 Ga0587076_058884 Ga0587076_058884_127_690 187
913 3300059646 Ga0587078_028399 Ga0587078_028399_82_645 187
914 3300059650 Ga0587104_004414 Ga0587104_004414_215_778 187
915 3300059652 Ga0587107_026556 Ga0587107_026556_198_761 187
916 3300060344 Ga0587071_106542 Ga0587071_106542_82_645 187
917 3300060346 Ga0587111_0053327 Ga0587111_0053327_188_751 187
918 3300061719 Ga0466962_0025287 Ga0466962_0025287_2059_2622 187
919 3300061719 Ga0466962_0103455 Ga0466962_0103455_199_768 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

46

176

0.92

PF08534

Redoxin

Redoxin

46

193

0.89

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

196

228

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xrd-assembly1.cif.gz_C-2 salmonella typhimurium ahpc w169f mutant 0.9866 2 172
5uka-assembly1.cif.gz_B salmonella typhimurium ahpc e49q mutant 0.9837 2 165
3emp-assembly1.cif.gz_D-2 crystal structure of the s-acetanilide modified form of c165s ahpc 0.9824 2 163
4xrd-assembly1.cif.gz_C-2 salmonella typhimurium ahpc w169f mutant 0.981 2 172
4xts-assembly2.cif.gz_T salmonella typhimurium ahpc t43a mutant 0.9803 2 161
ID Description Score Start End Superfamily
af_A0A0R4J2P7_61_260_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9568 1 183 3.40.30.10
5b8aJ00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9505 1 170 3.40.30.10
5b8aJ00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.945 1 170 3.40.30.10
af_Q7JX87_151_219_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.942 144 178 3.30.1020.10
5dvbA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9413 4 182 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6I1J208-F1-model_v4 deleted 0.9948 15 163
AF-A0A7H4LXI5-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) 0.9922 48 171 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A7S1HFU1-F1-model_v4 Thioredoxin domain-containing protein 0.9903 1 132 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A1H6CQD9-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) (Thioredoxin peroxidase) 0.9894 4 163 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
GO:0102039
AF-B1B6S9-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) (Thioredoxin peroxidase) 0.9893 8 179 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
GO:0102039

Feature Viewer

pLDDT pTM Quality
92.74 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map