F485681
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 918 | 576 | 713 | 418 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2885312484|2885315494 |
| Length | 417 |
| Sequence | RTLIGGAAASVAAAVLAAPQVRAQAQPRVVVVGGGFAGASCARALKQLDRGLAVTLIEPETAYLACPFSNAVLAGLRGIEAQTFGYGRFGDIGLIRRRAAAVDAERRRVRLEDGTEIGYTRLVLAPGVDLRFDALPGYDQAAAEIMPHAWKAGPQTLLLRDQLAAMPDGGVVILAAPANPFRCPPGPYERASLIAHYLKTSKPRSKLIILDAKDAFSKQRLFEAAWRELYPGLIEWVPLSSGGRVTEVDPATTTLVTEFGSHKADVANVIPPQRAGRIAQAAGVADQTGWCPIDPVTFESRLQPAIHVVGDAAIGGAMPKSAFSANAQAKACAAAVAALVRGRQPAPPKLINTCYSLVAPGYGISIAGVYQPRDGLLAEVEGAGGTSPLEAPPSVRELEAAYAQDWFRTITSEVFGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 20 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 21 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 22 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 23 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 24 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 25 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 26 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 27 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 28 | 2791355199 | |||
| 29 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 30 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 31 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 32 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 33 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 34 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 35 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 36 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 37 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 38 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 39 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 40 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 41 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 42 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 43 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 44 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 45 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 46 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 47 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 48 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 49 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 50 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 51 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 52 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 53 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 54 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 55 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 56 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 57 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 58 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 59 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 60 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 61 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 62 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 63 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 64 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 65 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 66 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 67 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 68 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 69 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 70 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 71 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 72 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 73 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 74 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 75 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 76 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 77 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 78 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 79 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 80 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 81 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 82 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 83 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 84 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 85 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 86 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 87 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 88 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 89 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 90 | 2906610324 | |||
| 91 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 92 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 93 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 94 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 95 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 96 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 97 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 98 | 2922425934 | |||
| 99 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 100 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 101 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 102 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 103 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 104 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 105 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 106 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 107 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 108 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 109 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 110 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 111 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 112 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 113 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 114 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 115 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 116 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 117 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 118 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 119 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 120 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 121 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 122 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 123 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 124 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 125 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 126 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 127 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 128 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 129 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 130 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 131 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 132 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 133 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 134 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 135 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 136 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 137 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 138 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 139 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 140 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 141 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 142 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 143 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 144 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 145 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 146 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 147 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 148 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 149 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 150 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 151 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 152 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 153 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 154 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 155 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 156 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 157 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 158 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 159 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 160 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 161 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 162 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 163 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 164 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 165 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 166 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 167 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 168 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 169 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 170 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 171 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 172 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 173 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 174 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 175 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 176 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 177 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 178 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 179 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 180 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 181 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 182 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 184 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 185 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 186 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 188 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 191 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 192 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 198 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 199 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 200 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 201 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 202 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 203 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 206 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 208 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 209 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 211 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 212 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 213 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 214 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 215 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 216 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 217 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 218 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 219 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 220 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 221 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 223 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 224 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 225 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 226 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 227 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 228 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 229 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 230 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 232 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 233 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 234 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 235 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 236 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 237 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 238 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 239 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 241 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 242 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 243 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 256 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 268 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 269 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 270 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 271 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 272 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 273 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 330 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 331 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 332 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 333 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 335 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 339 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 340 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 341 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 342 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 343 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 344 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 345 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 346 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 347 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 348 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 349 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 350 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 351 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 352 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 353 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 354 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 355 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 356 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 357 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 358 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 359 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 360 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 361 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 362 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 363 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 364 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 365 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 366 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 367 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 368 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 369 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 370 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 371 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 372 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 373 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 374 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 375 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 376 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 377 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 378 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 379 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 380 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 381 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 382 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 383 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 384 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 385 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 386 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 387 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 388 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 389 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 390 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 391 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 392 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 393 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 394 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 395 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 453 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 454 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 455 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 456 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 457 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 458 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 459 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 460 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 461 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 462 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 463 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 464 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 465 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 466 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 467 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 468 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 469 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 470 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 471 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 472 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 473 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 474 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 475 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 476 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 494 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 495 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 496 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 497 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 498 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 499 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 508 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 512 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 513 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 515 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 516 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 517 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 518 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 519 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 520 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 521 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 522 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 523 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 524 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 525 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 526 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 527 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 528 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 529 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 530 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 531 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 532 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 533 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 534 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 535 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 536 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 537 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 538 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 539 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 540 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 541 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 543 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 544 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 545 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 546 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 547 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 548 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 549 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 550 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 551 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 552 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 553 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 554 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 555 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 556 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 557 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 558 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 559 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 560 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 561 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 562 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 563 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 564 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 565 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 566 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 567 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 568 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 569 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 570 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 571 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 572 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 573 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 574 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 575 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 576 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.92 |
| Metatranscriptomes | 0 |
| Isolates | 22.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.24 |
| Nodule | 18.63 |
| Rhizoplane | 6.32 |
| Rhizosphere | 54.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000138 | 3300003203 | Bacteria | 31765 |
| 2 | JGI25153J46596_10000317 | 3300003215 | Bacteria | 35509 |
| 3 | JGI25153J46596_10005866 | 3300003215 | Bacteria | 6357 |
| 4 | rootL2_10158942 | 3300003322 | Bacteria | 2631 |
| 5 | JGI25404J52841_10006155 | 3300003659 | Bacteria | 2500 |
| 6 | Ga0055526_1025395 | 3300003771 | Bacteria | 1902 |
| 7 | Ga0055531_10008821 | 3300003794 | Bacteria | 5250 |
| 8 | Ga0055543_1009959 | 3300004625 | Bacteria | 2016 |
| 9 | Ga0065165_1000747 | 3300005262 | Bacteria | 44635 |
| 10 | Ga0065165_1004585 | 3300005262 | Bacteria | 8426 |
| 11 | Ga0065165_1012243 | 3300005262 | Bacteria | 3507 |
| 12 | Ga0070658_10123665 | 3300005327 | Bacteria | 2151 |
| 13 | Ga0070683_100035975 | 3300005329 | Bacteria | 4529 |
| 14 | Ga0070683_100244080 | 3300005329 | Bacteria | 1708 |
| 15 | Ga0070680_100000841 | 3300005336 | Bacteria | 21741 |
| 16 | Ga0070680_100053807 | 3300005336 | Bacteria | 3285 |
| 17 | Ga0070680_100093332 | 3300005336 | Bacteria | 2494 |
| 18 | Ga0070689_100056909 | 3300005340 | Bacteria | 3034 |
| 19 | Ga0070661_100069576 | 3300005344 | Bacteria | 2588 |
| 20 | Ga0070661_100148532 | 3300005344 | Bacteria | 1771 |
| 21 | Ga0070688_100026113 | 3300005365 | Bacteria | 3467 |
| 22 | Ga0070667_100111159 | 3300005367 | Bacteria | 2376 |
| 23 | Ga0070667_100151855 | 3300005367 | Bacteria | 2035 |
| 24 | Ga0070709_10002197 | 3300005434 | Bacteria | 10578 |
| 25 | Ga0070709_10010839 | 3300005434 | Bacteria | 5059 |
| 26 | Ga0070709_10026207 | 3300005434 | Bacteria | 3452 |
| 27 | Ga0070713_100001462 | 3300005436 | Bacteria | 15088 |
| 28 | Ga0070713_100014026 | 3300005436 | Bacteria | 5934 |
| 29 | Ga0070713_100026138 | 3300005436 | Bacteria | 4578 |
| 30 | Ga0070713_100052936 | 3300005436 | Bacteria | 3362 |
| 31 | Ga0070713_100115088 | 3300005436 | Bacteria | 2350 |
| 32 | Ga0070713_100166983 | 3300005436 | Bacteria | 1969 |
| 33 | Ga0070710_10000678 | 3300005437 | Bacteria | 16149 |
| 34 | Ga0070710_10003896 | 3300005437 | Bacteria | 7065 |
| 35 | Ga0070710_10007682 | 3300005437 | Bacteria | 5229 |
| 36 | Ga0070711_100000465 | 3300005439 | Bacteria | 21200 |
| 37 | Ga0070711_100003772 | 3300005439 | Bacteria | 8886 |
| 38 | Ga0070711_100087288 | 3300005439 | Bacteria | 2239 |
| 39 | Ga0070708_100029298 | 3300005445 | Bacteria | 4746 |
| 40 | Ga0070663_100034033 | 3300005455 | Bacteria | 3525 |
| 41 | Ga0070678_100064623 | 3300005456 | Bacteria | 2713 |
| 42 | Ga0070678_100162002 | 3300005456 | Bacteria | 1813 |
| 43 | Ga0070662_100256264 | 3300005457 | Bacteria | 1408 |
| 44 | Ga0070681_10009737 | 3300005458 | Bacteria | 9457 |
| 45 | Ga0070681_10103984 | 3300005458 | Bacteria | 2783 |
| 46 | Ga0070681_10147603 | 3300005458 | Bacteria | 2280 |
| 47 | Ga0068867_100059990 | 3300005459 | Bacteria | 2821 |
| 48 | Ga0070707_100022473 | 3300005468 | Bacteria | 5963 |
| 49 | Ga0070698_100013803 | 3300005471 | Bacteria | 8546 |
| 50 | Ga0070698_100080213 | 3300005471 | Bacteria | 3259 |
| 51 | Ga0070698_100240368 | 3300005471 | Bacteria | 1744 |
| 52 | Ga0070679_100003118 | 3300005530 | Bacteria | 15155 |
| 53 | Ga0070679_100004998 | 3300005530 | Bacteria | 12236 |
| 54 | Ga0070679_100100769 | 3300005530 | Bacteria | 2874 |
| 55 | Ga0070679_100139466 | 3300005530 | Bacteria | 2405 |
| 56 | Ga0070679_100228455 | 3300005530 | Bacteria | 1821 |
| 57 | Ga0070684_100007961 | 3300005535 | Bacteria | 8272 |
| 58 | Ga0070684_100009391 | 3300005535 | Bacteria | 7700 |
| 59 | Ga0070697_100061449 | 3300005536 | Bacteria | 3064 |
| 60 | Ga0070665_100023384 | 3300005548 | Bacteria | 6222 |
| 61 | Ga0070665_100053413 | 3300005548 | Bacteria | 4052 |
| 62 | Ga0070665_100073338 | 3300005548 | Bacteria | 3429 |
| 63 | Ga0068855_100058768 | 3300005563 | Bacteria | 4501 |
| 64 | Ga0068855_100112512 | 3300005563 | Bacteria | 3124 |
| 65 | Ga0068855_100210946 | 3300005563 | Bacteria | 2182 |
| 66 | Ga0068855_100306921 | 3300005563 | Bacteria | 1756 |
| 67 | Ga0070664_100165643 | 3300005564 | Bacteria | 1958 |
| 68 | Ga0068857_100037748 | 3300005577 | Bacteria | 4280 |
| 69 | Ga0068857_100059974 | 3300005577 | Bacteria | 3380 |
| 70 | Ga0068856_100079699 | 3300005614 | Bacteria | 3247 |
| 71 | Ga0068856_100172420 | 3300005614 | Bacteria | 2176 |
| 72 | Ga0068856_100268782 | 3300005614 | Bacteria | 1721 |
| 73 | Ga0070702_100034040 | 3300005615 | Bacteria | 2806 |
| 74 | Ga0068852_100038198 | 3300005616 | Bacteria | 4033 |
| 75 | Ga0068859_100383909 | 3300005617 | Bacteria | 1500 |
| 76 | Ga0068864_100049929 | 3300005618 | Bacteria | 3600 |
| 77 | Ga0068866_10087823 | 3300005718 | Bacteria | 1686 |
| 78 | Ga0068851_10009836 | 3300005834 | Bacteria | 4454 |
| 79 | Ga0068863_100074750 | 3300005841 | Bacteria | 3206 |
| 80 | Ga0068858_100031960 | 3300005842 | Bacteria | 4889 |
| 81 | Ga0068858_100202761 | 3300005842 | Bacteria | 1876 |
| 82 | Ga0068860_100000360 | 3300005843 | Bacteria | 60297 |
| 83 | Ga0081455_10003176 | 3300005937 | Bacteria | 19071 |
| 84 | Ga0081455_10005955 | 3300005937 | Bacteria | 13226 |
| 85 | Ga0081540_1000102 | 3300005983 | Bacteria | 91311 |
| 86 | Ga0081540_1000841 | 3300005983 | Bacteria | 28015 |
| 87 | Ga0081540_1003418 | 3300005983 | Bacteria | 12554 |
| 88 | Ga0081540_1008125 | 3300005983 | Bacteria | 7364 |
| 89 | Ga0081540_1008941 | 3300005983 | Bacteria | 6939 |
| 90 | Ga0081540_1009558 | 3300005983 | Bacteria | 6672 |
| 91 | Ga0081540_1021006 | 3300005983 | Bacteria | 3906 |
| 92 | Ga0081540_1021049 | 3300005983 | Bacteria | 3901 |
| 93 | Ga0081540_1035588 | 3300005983 | Bacteria | 2668 |
| 94 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 95 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 96 | Ga0081539_10055131 | 3300005985 | Bacteria | 2214 |
| 97 | Ga0070717_10006207 | 3300006028 | Bacteria | 8777 |
| 98 | Ga0070717_10007544 | 3300006028 | Bacteria | 8083 |
| 99 | Ga0070717_10021364 | 3300006028 | Bacteria | 5099 |
| 100 | Ga0070717_10134682 | 3300006028 | Bacteria | 2127 |
| 101 | Ga0075365_10033778 | 3300006038 | Bacteria | 3299 |
| 102 | Ga0075365_10038742 | 3300006038 | Bacteria | 3101 |
| 103 | Ga0075365_10096957 | 3300006038 | Bacteria | 2015 |
| 104 | Ga0075363_100009226 | 3300006048 | Bacteria | 4634 |
| 105 | Ga0075364_10023541 | 3300006051 | Bacteria | 3900 |
| 106 | Ga0075364_10074428 | 3300006051 | Bacteria | 2240 |
| 107 | Ga0070715_10035264 | 3300006163 | Bacteria | 2056 |
| 108 | Ga0070712_100022680 | 3300006175 | Bacteria | 4138 |
| 109 | Ga0070712_100038780 | 3300006175 | Bacteria | 3257 |
| 110 | Ga0070712_100091514 | 3300006175 | Bacteria | 2229 |
| 111 | Ga0070712_100173947 | 3300006175 | Bacteria | 1673 |
| 112 | Ga0075362_10019648 | 3300006177 | Bacteria | 2812 |
| 113 | Ga0075369_10005844 | 3300006186 | Bacteria | 4625 |
| 114 | Ga0075369_10032411 | 3300006186 | Bacteria | 2211 |
| 115 | Ga0075366_10038702 | 3300006195 | Bacteria | 2817 |
| 116 | Ga0097621_100040392 | 3300006237 | Bacteria | 3751 |
| 117 | Ga0097621_100094887 | 3300006237 | Bacteria | 2501 |
| 118 | Ga0097621_100112416 | 3300006237 | Bacteria | 2303 |
| 119 | Ga0075370_10038846 | 3300006353 | Bacteria | 2679 |
| 120 | Ga0068871_100001491 | 3300006358 | Bacteria | 15694 |
| 121 | Ga0075428_100003814 | 3300006844 | Bacteria | 16541 |
| 122 | Ga0075428_100269582 | 3300006844 | Bacteria | 1832 |
| 123 | Ga0075430_100002189 | 3300006846 | Bacteria | 16184 |
| 124 | Ga0075430_100004241 | 3300006846 | Bacteria | 12110 |
| 125 | Ga0075430_100012744 | 3300006846 | Bacteria | 7164 |
| 126 | Ga0075430_100044526 | 3300006846 | Bacteria | 3751 |
| 127 | Ga0075431_100013553 | 3300006847 | Bacteria | 8239 |
| 128 | Ga0075431_100021216 | 3300006847 | Bacteria | 6638 |
| 129 | Ga0075431_100119215 | 3300006847 | Bacteria | 2723 |
| 130 | Ga0075433_10036313 | 3300006852 | Bacteria | 4244 |
| 131 | Ga0075434_100001946 | 3300006871 | Bacteria | 17909 |
| 132 | Ga0075434_100083230 | 3300006871 | Bacteria | 3197 |
| 133 | Ga0075434_100260056 | 3300006871 | Bacteria | 1755 |
| 134 | Ga0075429_100000055 | 3300006880 | Bacteria | 55152 |
| 135 | Ga0075429_100003786 | 3300006880 | Bacteria | 12905 |
| 136 | Ga0075429_100012545 | 3300006880 | Bacteria | 7352 |
| 137 | Ga0097620_100383932 | 3300006931 | Bacteria | 1500 |
| 138 | Ga0099824_1011502 | 3300006942 | Bacteria | 9987 |
| 139 | Ga0099824_1018474 | 3300006942 | Bacteria | 5716 |
| 140 | Ga0075435_100011949 | 3300007076 | Bacteria | 6415 |
| 141 | Ga0075435_100119473 | 3300007076 | Bacteria | 2198 |
| 142 | Ga0099795_10037437 | 3300007788 | Bacteria | 1707 |
| 143 | Ga0105240_10013046 | 3300009093 | Bacteria | 11437 |
| 144 | Ga0105240_10021941 | 3300009093 | Bacteria | 8480 |
| 145 | Ga0105240_10024721 | 3300009093 | Bacteria | 7912 |
| 146 | Ga0105240_10192740 | 3300009093 | Bacteria | 2395 |
| 147 | Ga0111539_10000852 | 3300009094 | Bacteria | 39772 |
| 148 | Ga0105245_10048961 | 3300009098 | Bacteria | 3782 |
| 149 | Ga0105245_10078010 | 3300009098 | Bacteria | 3021 |
| 150 | Ga0105245_10081675 | 3300009098 | Bacteria | 2955 |
| 151 | Ga0105247_10021886 | 3300009101 | Bacteria | 3847 |
| 152 | Ga0105247_10081130 | 3300009101 | Bacteria | 2044 |
| 153 | Ga0114129_10001487 | 3300009147 | Bacteria | 31741 |
| 154 | Ga0114129_10007257 | 3300009147 | Bacteria | 15778 |
| 155 | Ga0114129_10012532 | 3300009147 | Bacteria | 12074 |
| 156 | Ga0114129_10021318 | 3300009147 | Bacteria | 9199 |
| 157 | Ga0114129_10060555 | 3300009147 | Bacteria | 5293 |
| 158 | Ga0105243_10178387 | 3300009148 | Bacteria | 1845 |
| 159 | Ga0105241_10029756 | 3300009174 | Bacteria | 4077 |
| 160 | Ga0105241_10118948 | 3300009174 | Bacteria | 2125 |
| 161 | Ga0105242_10212373 | 3300009176 | Bacteria | 1725 |
| 162 | Ga0105248_10027462 | 3300009177 | Bacteria | 6337 |
| 163 | Ga0105237_10009950 | 3300009545 | Bacteria | 10145 |
| 164 | Ga0105237_10021234 | 3300009545 | Bacteria | 6678 |
| 165 | Ga0105237_10031207 | 3300009545 | Bacteria | 5405 |
| 166 | Ga0105237_10228750 | 3300009545 | Bacteria | 1860 |
| 167 | Ga0105237_10380401 | 3300009545 | Bacteria | 1416 |
| 168 | Ga0105238_10014750 | 3300009551 | Bacteria | 7903 |
| 169 | Ga0105238_10027647 | 3300009551 | Bacteria | 5781 |
| 170 | Ga0105249_10295488 | 3300009553 | Bacteria | 1623 |
| 171 | Ga0099796_10046613 | 3300010159 | Bacteria | 1488 |
| 172 | Ga0105239_10084742 | 3300010375 | Bacteria | 3492 |
| 173 | Ga0105239_10150755 | 3300010375 | Bacteria | 2595 |
| 174 | Ga0105246_10013775 | 3300011119 | Bacteria | 5074 |
| 175 | Ga0157370_10053036 | 3300013104 | Bacteria | 3869 |
| 176 | Ga0157369_10012423 | 3300013105 | Bacteria | 9667 |
| 177 | Ga0157374_10019281 | 3300013296 | Bacteria | 6035 |
| 178 | Ga0157374_10024785 | 3300013296 | Bacteria | 5379 |
| 179 | Ga0157374_10063878 | 3300013296 | Bacteria | 3453 |
| 180 | Ga0157374_10129211 | 3300013296 | Bacteria | 2444 |
| 181 | Ga0157378_10004961 | 3300013297 | Bacteria | 11667 |
| 182 | Ga0157378_10038833 | 3300013297 | Bacteria | 4221 |
| 183 | Ga0163162_10060239 | 3300013306 | Bacteria | 3831 |
| 184 | Ga0163162_10225195 | 3300013306 | Bacteria | 2005 |
| 185 | Ga0163162_10281427 | 3300013306 | Bacteria | 1795 |
| 186 | Ga0157375_10128467 | 3300013308 | Bacteria | 2652 |
| 187 | Ga0157375_10371170 | 3300013308 | Bacteria | 1597 |
| 188 | Ga0163163_10060452 | 3300014325 | Bacteria | 3752 |
| 189 | Ga0163163_10135612 | 3300014325 | Bacteria | 2503 |
| 190 | Ga0163163_10200834 | 3300014325 | Bacteria | 2042 |
| 191 | Ga0163163_10334734 | 3300014325 | Bacteria | 1569 |
| 192 | Ga0157379_10136897 | 3300014968 | Bacteria | 2207 |
| 193 | Ga0157376_10050368 | 3300014969 | Bacteria | 3455 |
| 194 | Ga0157376_10292110 | 3300014969 | Bacteria | 1539 |
| 195 | Ga0214542_1001925 | 3300021321 | Bacteria | 42950 |
| 196 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 197 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 198 | Ga0213872_10040411 | 3300021361 | Bacteria | 2130 |
| 199 | Ga0213876_10003579 | 3300021384 | Bacteria | 8838 |
| 200 | Ga0213875_10062030 | 3300021388 | Bacteria | 1749 |
| 201 | Ga0209563_100325 | 3300025230 | Bacteria | 18742 |
| 202 | Ga0209677_102245 | 3300025253 | Bacteria | 7486 |
| 203 | Ga0209148_1000812 | 3300025254 | Bacteria | 22632 |
| 204 | Ga0209233_1003610 | 3300025261 | Bacteria | 5425 |
| 205 | Ga0209233_1008563 | 3300025261 | Bacteria | 3154 |
| 206 | Ga0209455_1002923 | 3300025272 | Bacteria | 6300 |
| 207 | Ga0209455_1005249 | 3300025272 | Bacteria | 4048 |
| 208 | Ga0209455_1005452 | 3300025272 | Bacteria | 3927 |
| 209 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 210 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 211 | Ga0209758_1001848 | 3300025297 | Bacteria | 23245 |
| 212 | Ga0209758_1002848 | 3300025297 | Bacteria | 16788 |
| 213 | Ga0209758_1007270 | 3300025297 | Bacteria | 7608 |
| 214 | Ga0209758_1018387 | 3300025297 | Bacteria | 3426 |
| 215 | Ga0209758_1032806 | 3300025297 | Bacteria | 2100 |
| 216 | Ga0207426_1000328 | 3300025302 | Bacteria | 90659 |
| 217 | Ga0207426_1000458 | 3300025302 | Bacteria | 64019 |
| 218 | Ga0207426_1019068 | 3300025302 | Bacteria | 2405 |
| 219 | Ga0209257_1001101 | 3300025304 | Bacteria | 35153 |
| 220 | Ga0207692_10000797 | 3300025898 | Bacteria | 11223 |
| 221 | Ga0207692_10006627 | 3300025898 | Bacteria | 4706 |
| 222 | Ga0207692_10017877 | 3300025898 | Bacteria | 3171 |
| 223 | Ga0207710_10008721 | 3300025900 | Bacteria | 4274 |
| 224 | Ga0207688_10059711 | 3300025901 | Bacteria | 2148 |
| 225 | Ga0207647_10008820 | 3300025904 | Bacteria | 7199 |
| 226 | Ga0207685_10002427 | 3300025905 | Bacteria | 4270 |
| 227 | Ga0207685_10028315 | 3300025905 | Bacteria | 1972 |
| 228 | Ga0207699_10001610 | 3300025906 | Bacteria | 10719 |
| 229 | Ga0207699_10004027 | 3300025906 | Bacteria | 7033 |
| 230 | Ga0207699_10014207 | 3300025906 | Bacteria | 4097 |
| 231 | Ga0207645_10066067 | 3300025907 | Bacteria | 2312 |
| 232 | Ga0207645_10081474 | 3300025907 | Bacteria | 2075 |
| 233 | Ga0207643_10058265 | 3300025908 | Bacteria | 2201 |
| 234 | Ga0207705_10003219 | 3300025909 | Bacteria | 12434 |
| 235 | Ga0207684_10003339 | 3300025910 | Bacteria | 15735 |
| 236 | Ga0207684_10019497 | 3300025910 | Bacteria | 5800 |
| 237 | Ga0207654_10120122 | 3300025911 | Bacteria | 1649 |
| 238 | Ga0207707_10000886 | 3300025912 | Bacteria | 29266 |
| 239 | Ga0207707_10003317 | 3300025912 | Bacteria | 14301 |
| 240 | Ga0207707_10023656 | 3300025912 | Bacteria | 5372 |
| 241 | Ga0207707_10027833 | 3300025912 | Bacteria | 4942 |
| 242 | Ga0207707_10031075 | 3300025912 | Bacteria | 4672 |
| 243 | Ga0207707_10117125 | 3300025912 | Bacteria | 2328 |
| 244 | Ga0207707_10141869 | 3300025912 | Bacteria | 2100 |
| 245 | Ga0207707_10235770 | 3300025912 | Bacteria | 1592 |
| 246 | Ga0207695_10000163 | 3300025913 | Bacteria | 197030 |
| 247 | Ga0207671_10056823 | 3300025914 | Bacteria | 2900 |
| 248 | Ga0207693_10000506 | 3300025915 | Bacteria | 35208 |
| 249 | Ga0207693_10002637 | 3300025915 | Bacteria | 15580 |
| 250 | Ga0207693_10007874 | 3300025915 | Bacteria | 8752 |
| 251 | Ga0207693_10014584 | 3300025915 | Bacteria | 6315 |
| 252 | Ga0207693_10034047 | 3300025915 | Bacteria | 4019 |
| 253 | Ga0207693_10062713 | 3300025915 | Bacteria | 2912 |
| 254 | Ga0207693_10095504 | 3300025915 | Bacteria | 2330 |
| 255 | Ga0207663_10004038 | 3300025916 | Bacteria | 7275 |
| 256 | Ga0207663_10006243 | 3300025916 | Bacteria | 6080 |
| 257 | Ga0207663_10021217 | 3300025916 | Bacteria | 3695 |
| 258 | Ga0207663_10062817 | 3300025916 | Bacteria | 2362 |
| 259 | Ga0207663_10065540 | 3300025916 | Bacteria | 2322 |
| 260 | Ga0207660_10010388 | 3300025917 | Bacteria | 6040 |
| 261 | Ga0207660_10022287 | 3300025917 | Bacteria | 4267 |
| 262 | Ga0207657_10008437 | 3300025919 | Bacteria | 10455 |
| 263 | Ga0207649_10040161 | 3300025920 | Bacteria | 2842 |
| 264 | Ga0207649_10109100 | 3300025920 | Bacteria | 1846 |
| 265 | Ga0207652_10016478 | 3300025921 | Bacteria | 6035 |
| 266 | Ga0207652_10019601 | 3300025921 | Bacteria | 5566 |
| 267 | Ga0207652_10115718 | 3300025921 | Bacteria | 2382 |
| 268 | Ga0207652_10148500 | 3300025921 | Bacteria | 2098 |
| 269 | Ga0207652_10178835 | 3300025921 | Bacteria | 1906 |
| 270 | Ga0207646_10002996 | 3300025922 | Bacteria | 19501 |
| 271 | Ga0207646_10003246 | 3300025922 | Bacteria | 18533 |
| 272 | Ga0207694_10071234 | 3300025924 | Bacteria | 2716 |
| 273 | Ga0207650_10205616 | 3300025925 | Bacteria | 1579 |
| 274 | Ga0207687_10021155 | 3300025927 | Bacteria | 4319 |
| 275 | Ga0207687_10053608 | 3300025927 | Bacteria | 2818 |
| 276 | Ga0207687_10117944 | 3300025927 | Bacteria | 1980 |
| 277 | Ga0207700_10000668 | 3300025928 | Bacteria | 20081 |
| 278 | Ga0207700_10007466 | 3300025928 | Bacteria | 6681 |
| 279 | Ga0207700_10041345 | 3300025928 | Bacteria | 3372 |
| 280 | Ga0207700_10083120 | 3300025928 | Bacteria | 2506 |
| 281 | Ga0207700_10158000 | 3300025928 | Bacteria | 1880 |
| 282 | Ga0207664_10102478 | 3300025929 | Bacteria | 2367 |
| 283 | Ga0207690_10172879 | 3300025932 | Bacteria | 1620 |
| 284 | Ga0207706_10015391 | 3300025933 | Bacteria | 6910 |
| 285 | Ga0207706_10107404 | 3300025933 | Bacteria | 2456 |
| 286 | Ga0207686_10040459 | 3300025934 | Bacteria | 2834 |
| 287 | Ga0207709_10212003 | 3300025935 | Bacteria | 1391 |
| 288 | Ga0207669_10086754 | 3300025937 | Bacteria | 2025 |
| 289 | Ga0207669_10107067 | 3300025937 | Bacteria | 1864 |
| 290 | Ga0207665_10000528 | 3300025939 | Bacteria | 25777 |
| 291 | Ga0207665_10001385 | 3300025939 | Bacteria | 16335 |
| 292 | Ga0207691_10186072 | 3300025940 | Bacteria | 1813 |
| 293 | Ga0207711_10009654 | 3300025941 | Bacteria | 8041 |
| 294 | Ga0207711_10018144 | 3300025941 | Bacteria | 5851 |
| 295 | Ga0207689_10036827 | 3300025942 | Bacteria | 4060 |
| 296 | Ga0207661_10008452 | 3300025944 | Bacteria | 7359 |
| 297 | Ga0207661_10018951 | 3300025944 | Bacteria | 5120 |
| 298 | Ga0207661_10083044 | 3300025944 | Bacteria | 2650 |
| 299 | Ga0207661_10291186 | 3300025944 | Bacteria | 1461 |
| 300 | Ga0207667_10019974 | 3300025949 | Bacteria | 7463 |
| 301 | Ga0207667_10027626 | 3300025949 | Bacteria | 6173 |
| 302 | Ga0207651_10065505 | 3300025960 | Bacteria | 2548 |
| 303 | Ga0207668_10143392 | 3300025972 | Bacteria | 1840 |
| 304 | Ga0207668_10186534 | 3300025972 | Bacteria | 1640 |
| 305 | Ga0207703_10045836 | 3300026035 | Bacteria | 3518 |
| 306 | Ga0207639_10034032 | 3300026041 | Bacteria | 3763 |
| 307 | Ga0207678_10022393 | 3300026067 | Bacteria | 5534 |
| 308 | Ga0207678_10023935 | 3300026067 | Bacteria | 5340 |
| 309 | Ga0207678_10033211 | 3300026067 | Bacteria | 4496 |
| 310 | Ga0207678_10034200 | 3300026067 | Bacteria | 4427 |
| 311 | Ga0207678_10035164 | 3300026067 | Bacteria | 4362 |
| 312 | Ga0207641_10198815 | 3300026088 | Bacteria | 1847 |
| 313 | Ga0207648_10184860 | 3300026089 | Bacteria | 1846 |
| 314 | Ga0207676_10097698 | 3300026095 | Bacteria | 2426 |
| 315 | Ga0207674_10007720 | 3300026116 | Bacteria | 12520 |
| 316 | Ga0207674_10078663 | 3300026116 | Bacteria | 3303 |
| 317 | Ga0207674_10128182 | 3300026116 | Bacteria | 2502 |
| 318 | Ga0207683_10003797 | 3300026121 | Bacteria | 13083 |
| 319 | Ga0207683_10009714 | 3300026121 | Bacteria | 8206 |
| 320 | Ga0207683_10091282 | 3300026121 | Bacteria | 2713 |
| 321 | Ga0207683_10262268 | 3300026121 | Bacteria | 1578 |
| 322 | Ga0207698_10060190 | 3300026142 | Bacteria | 2952 |
| 323 | Ga0209389_1000043 | 3300027296 | Bacteria | 123224 |
| 324 | Ga0209389_1000077 | 3300027296 | Bacteria | 91273 |
| 325 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 326 | Ga0209589_1000047 | 3300027357 | Bacteria | 118659 |
| 327 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 328 | Ga0209489_100075 | 3300027361 | Bacteria | 136991 |
| 329 | Ga0209489_100251 | 3300027361 | Bacteria | 91273 |
| 330 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 331 | Ga0209700_100271 | 3300027363 | Bacteria | 91215 |
| 332 | Ga0209179_1001680 | 3300027512 | Bacteria | 2799 |
| 333 | Ga0207428_10005470 | 3300027907 | Bacteria | 11844 |
| 334 | Ga0268266_10007625 | 3300028379 | Bacteria | 9734 |
| 335 | Ga0268266_10234117 | 3300028379 | Bacteria | 1692 |
| 336 | Ga0268265_10118725 | 3300028380 | Bacteria | 2175 |
| 337 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 338 | Ga0268264_10163025 | 3300028381 | Bacteria | 2010 |
| 339 | Ga0265337_1006171 | 3300028556 | Bacteria | 4658 |
| 340 | Ga0265319_1011253 | 3300028563 | Bacteria | 3676 |
| 341 | Ga0265318_10024101 | 3300028577 | Bacteria | 2418 |
| 342 | Ga0265323_10000434 | 3300028653 | Bacteria | 23913 |
| 343 | Ga0265336_10000649 | 3300028666 | Bacteria | 18964 |
| 344 | Ga0307517_10000279 | 3300028786 | Bacteria | 88025 |
| 345 | Ga0307515_10152056 | 3300028794 | Bacteria | 2413 |
| 346 | Ga0265338_10000280 | 3300028800 | Bacteria | 91942 |
| 347 | Ga0265324_10010387 | 3300029957 | Bacteria | 3591 |
| 348 | Ga0265330_10006697 | 3300031235 | Bacteria | 5683 |
| 349 | Ga0265325_10000599 | 3300031241 | Bacteria | 26290 |
| 350 | Ga0265329_10042580 | 3300031242 | Bacteria | 1454 |
| 351 | Ga0265340_10010905 | 3300031247 | Bacteria | 4848 |
| 352 | Ga0265340_10014569 | 3300031247 | Bacteria | 4103 |
| 353 | Ga0265340_10025159 | 3300031247 | Bacteria | 3018 |
| 354 | Ga0265339_10020885 | 3300031249 | Bacteria | 3820 |
| 355 | Ga0265339_10035899 | 3300031249 | Bacteria | 2777 |
| 356 | Ga0265339_10107760 | 3300031249 | Bacteria | 1445 |
| 357 | Ga0307509_10204543 | 3300031507 | Bacteria | 1806 |
| 358 | Ga0307508_10003532 | 3300031616 | Bacteria | 15752 |
| 359 | Ga0307508_10140808 | 3300031616 | Bacteria | 2016 |
| 360 | Ga0265314_10014967 | 3300031711 | Bacteria | 6177 |
| 361 | Ga0265342_10009847 | 3300031712 | Bacteria | 6686 |
| 362 | Ga0307516_10097075 | 3300031730 | Bacteria | 2767 |
| 363 | Ga0307507_10043063 | 3300033179 | Bacteria | 4486 |
| 364 | Ga0307510_10037733 | 3300033180 | Bacteria | 5357 |
| 365 | Ga0307510_10073832 | 3300033180 | Bacteria | 3376 |
| 366 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 367 | Ga0373928_0004389 | 3300035084 | Bacteria | 2691 |
| 368 | Ga0373936_0003178 | 3300035113 | Bacteria | 6151 |
| 369 | Ga0373941_0005728 | 3300035115 | Bacteria | 2948 |
| 370 | Ga0373953_0003406 | 3300035117 | Bacteria | 4946 |
| 371 | Ga0373954_0068936 | 3300035118 | Bacteria | 1679 |
| 372 | Ga0373956_0007041 | 3300035119 | Bacteria | 4524 |
| 373 | Ga0373957_0020281 | 3300035120 | Bacteria | 2347 |
| 374 | Ga0373960_0014063 | 3300035121 | Bacteria | 2020 |
| 375 | Ga0373943_0000795 | 3300035170 | Bacteria | 13844 |
| 376 | Ga0373943_0025222 | 3300035170 | Bacteria | 2778 |
| 377 | Ga0373943_0037571 | 3300035170 | Bacteria | 2325 |
| 378 | Ga0373946_0064791 | 3300035171 | Bacteria | 1563 |
| 379 | Ga0373955_0064066 | 3300035172 | Bacteria | 2036 |
| 380 | Ga0373942_0003177 | 3300035207 | Bacteria | 3887 |
| 381 | Ga0373931_0006081 | 3300035691 | Bacteria | 5624 |
| 382 | Ga0373935_0000536 | 3300035692 | Bacteria | 19758 |
| 383 | Ga0373935_0017022 | 3300035692 | Bacteria | 4403 |
| 384 | Ga0373927_0000898 | 3300035695 | Bacteria | 22620 |
| 385 | Ga0373927_0045712 | 3300035695 | Bacteria | 2832 |
| 386 | Ga0373933_0001821 | 3300035724 | Bacteria | 12354 |
| 387 | Ga0373933_0056140 | 3300035724 | Bacteria | 2363 |
| 388 | Ga0373947_0010479 | 3300035725 | Bacteria | 5318 |
| 389 | Ga0373937_0054540 | 3300036401 | Bacteria | 3668 |
| 390 | Ga0373937_0139955 | 3300036401 | Bacteria | 2264 |
| 391 | Ga0373937_0216891 | 3300036401 | Bacteria | 1801 |
| 392 | Ga0373925_0001796 | 3300037068 | Bacteria | 17888 |
| 393 | Ga0373925_0027047 | 3300037068 | Bacteria | 4200 |
| 394 | Ga0373925_0038098 | 3300037068 | Bacteria | 3552 |
| 395 | Ga0373925_0138906 | 3300037068 | Bacteria | 1901 |
| 396 | Ga0373925_0166865 | 3300037068 | Bacteria | 1736 |
| 397 | Ga0373925_0227748 | 3300037068 | Bacteria | 1489 |
| 398 | Ga0395899_0060103 | 3300037312 | Bacteria | 2800 |
| 399 | Ga0395900_0003092 | 3300037418 | Bacteria | 18074 |
| 400 | Ga0395905_0084980 | 3300037471 | Bacteria | 2965 |
| 401 | Ga0436364_0356418 | 3300037853 | Bacteria | 2149 |
| 402 | Ga0395901_0001902 | 3300038443 | Bacteria | 21558 |
| 403 | Ga0395901_0209340 | 3300038443 | Bacteria | 2042 |
| 404 | Ga0436365_1236739 | 3300039437 | Bacteria | 30341 |
| 405 | Ga0436365_1571642 | 3300039437 | Bacteria | 1625 |
| 406 | Ga0436361_0535015 | 3300039447 | Bacteria | 2198 |
| 407 | Ga0436361_0632240 | 3300039447 | Bacteria | 3925 |
| 408 | Ga0436363_0621011 | 3300039450 | Bacteria | 2545 |
| 409 | Ga0436363_0698487 | 3300039450 | Bacteria | 1356 |
| 410 | Ga0436362_0652931 | 3300039453 | Bacteria | 7115 |
| 411 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 412 | Ga0466965_0068555 | 3300044683 | Bacteria | 1781 |
| 413 | Ga0466963_0007491 | 3300044694 | Bacteria | 6512 |
| 414 | Ga0466968_0010560 | 3300044735 | Bacteria | 3583 |
| 415 | Ga0466960_0006472 | 3300044901 | Bacteria | 4699 |
| 416 | Ga0466959_0033466 | 3300045049 | Bacteria | 3801 |
| 417 | Ga0466959_0052521 | 3300045049 | Bacteria | 2984 |
| 418 | Ga0466959_0154985 | 3300045049 | Bacteria | 1613 |
| 419 | Ga0466967_0249181 | 3300045976 | Bacteria | 1696 |
| 420 | Ga0466967_0295043 | 3300045976 | Bacteria | 1558 |
| 421 | Ga0495592_0008855 | 3300046454 | Bacteria | 7559 |
| 422 | Ga0495592_0011606 | 3300046454 | Bacteria | 6672 |
| 423 | Ga0495592_0029907 | 3300046454 | Bacteria | 4121 |
| 424 | Ga0495603_0000046 | 3300046455 | Bacteria | 53187 |
| 425 | Ga0495603_0086322 | 3300046455 | Bacteria | 1837 |
| 426 | Ga0495629_0000071 | 3300046459 | Bacteria | 88879 |
| 427 | Ga0495629_0009871 | 3300046459 | Bacteria | 6968 |
| 428 | Ga0495629_0163739 | 3300046459 | Bacteria | 1545 |
| 429 | Ga0495638_0020090 | 3300046460 | Bacteria | 4414 |
| 430 | Ga0495641_0009896 | 3300046461 | Bacteria | 5611 |
| 431 | Ga0495641_0011415 | 3300046461 | Bacteria | 5064 |
| 432 | Ga0495653_0032304 | 3300046463 | Bacteria | 4157 |
| 433 | Ga0495580_0000057 | 3300046472 | Bacteria | 64650 |
| 434 | Ga0495580_0043983 | 3300046472 | Bacteria | 3177 |
| 435 | Ga0495582_0000111 | 3300046473 | Bacteria | 42751 |
| 436 | Ga0495605_0056668 | 3300046474 | Bacteria | 1889 |
| 437 | Ga0495639_0000108 | 3300046475 | Bacteria | 41656 |
| 438 | Ga0495639_0015341 | 3300046475 | Bacteria | 3322 |
| 439 | Ga0495662_0000992 | 3300046476 | Bacteria | 13882 |
| 440 | Ga0495662_0020305 | 3300046476 | Bacteria | 3213 |
| 441 | Ga0495664_0002718 | 3300046477 | Bacteria | 9505 |
| 442 | Ga0495664_0007884 | 3300046477 | Bacteria | 5926 |
| 443 | Ga0495664_0030650 | 3300046477 | Bacteria | 3151 |
| 444 | Ga0495664_0063064 | 3300046477 | Bacteria | 2208 |
| 445 | Ga0495594_0000133 | 3300046499 | Bacteria | 34897 |
| 446 | Ga0495583_0055522 | 3300046506 | Bacteria | 1790 |
| 447 | Ga0495606_0003362 | 3300046507 | Bacteria | 17052 |
| 448 | Ga0495606_0006998 | 3300046507 | Bacteria | 10238 |
| 449 | Ga0495606_0080559 | 3300046507 | Bacteria | 2026 |
| 450 | Ga0495606_0138832 | 3300046507 | Bacteria | 1437 |
| 451 | Ga0495628_0012530 | 3300046516 | Bacteria | 7144 |
| 452 | Ga0495628_0042625 | 3300046516 | Bacteria | 3619 |
| 453 | Ga0495630_0000959 | 3300046517 | Bacteria | 20201 |
| 454 | Ga0495637_0048728 | 3300046520 | Bacteria | 1783 |
| 455 | Ga0495643_0005954 | 3300046522 | Bacteria | 8136 |
| 456 | Ga0495648_0046019 | 3300046524 | Bacteria | 2708 |
| 457 | Ga0495666_0005822 | 3300046526 | Bacteria | 6215 |
| 458 | Ga0495666_0032607 | 3300046526 | Bacteria | 2548 |
| 459 | Ga0495652_0042099 | 3300046529 | Bacteria | 3939 |
| 460 | Ga0495652_0097969 | 3300046529 | Bacteria | 2384 |
| 461 | Ga0495652_0168431 | 3300046529 | Bacteria | 1693 |
| 462 | Ga0495665_0000001 | 3300046531 | Bacteria | 156121 |
| 463 | Ga0495665_0057438 | 3300046531 | Bacteria | 2054 |
| 464 | Ga0495640_0012179 | 3300046533 | Bacteria | 6583 |
| 465 | Ga0495640_0023983 | 3300046533 | Bacteria | 4438 |
| 466 | Ga0495640_0028223 | 3300046533 | Bacteria | 4042 |
| 467 | Ga0495640_0143197 | 3300046533 | Bacteria | 1540 |
| 468 | Ga0495586_0056589 | 3300046535 | Bacteria | 2127 |
| 469 | Ga0495587_0044824 | 3300046536 | Bacteria | 2630 |
| 470 | Ga0495597_0031638 | 3300046542 | Bacteria | 2406 |
| 471 | Ga0495645_0007155 | 3300046543 | Bacteria | 7768 |
| 472 | Ga0495645_0009374 | 3300046543 | Bacteria | 6845 |
| 473 | Ga0495622_0001363 | 3300046557 | Bacteria | 12492 |
| 474 | Ga0495633_0041177 | 3300046558 | Bacteria | 2197 |
| 475 | Ga0495667_0006892 | 3300046559 | Bacteria | 7715 |
| 476 | Ga0495667_0016295 | 3300046559 | Bacteria | 5021 |
| 477 | Ga0495667_0032071 | 3300046559 | Bacteria | 3523 |
| 478 | Ga0495668_0066567 | 3300046616 | Bacteria | 1982 |
| 479 | Ga0495634_0000046 | 3300046642 | Bacteria | 97947 |
| 480 | Ga0495634_0076372 | 3300046642 | Bacteria | 2199 |
| 481 | Ga0495625_0164898 | 3300046660 | Bacteria | 1482 |
| 482 | Ga0495635_0000338 | 3300046663 | Bacteria | 29955 |
| 483 | Ga0495635_0019273 | 3300046663 | Bacteria | 4758 |
| 484 | Ga0495635_0051638 | 3300046663 | Bacteria | 2832 |
| 485 | Ga0495588_0001464 | 3300046674 | Bacteria | 10138 |
| 486 | Ga0495657_0054792 | 3300046675 | Bacteria | 2662 |
| 487 | Ga0495599_0007149 | 3300046678 | Bacteria | 6759 |
| 488 | Ga0495599_0124670 | 3300046678 | Bacteria | 1601 |
| 489 | Ga0495623_0045020 | 3300046679 | Bacteria | 2803 |
| 490 | Ga0495646_0007433 | 3300046680 | Bacteria | 6965 |
| 491 | Ga0495646_0008580 | 3300046680 | Bacteria | 6490 |
| 492 | Ga0495647_0000754 | 3300046681 | Bacteria | 9612 |
| 493 | Ga0495658_0000994 | 3300046683 | Bacteria | 14995 |
| 494 | Ga0495658_0005502 | 3300046683 | Bacteria | 6226 |
| 495 | Ga0495613_0005517 | 3300046689 | Bacteria | 9500 |
| 496 | Ga0495613_0025092 | 3300046689 | Bacteria | 4442 |
| 497 | Ga0495624_0003652 | 3300046690 | Bacteria | 11380 |
| 498 | Ga0495624_0050265 | 3300046690 | Bacteria | 2641 |
| 499 | Ga0495670_0004308 | 3300046691 | Bacteria | 6972 |
| 500 | Ga0495649_0038307 | 3300046694 | Bacteria | 2631 |
| 501 | Ga0495649_0059545 | 3300046694 | Bacteria | 2056 |
| 502 | Ga0495600_0005381 | 3300046809 | Bacteria | 7717 |
| 503 | Ga0495581_0000012 | 3300047315 | Bacteria | 62886 |
| 504 | Ga0495581_0018927 | 3300047315 | Bacteria | 3996 |
| 505 | Ga0495581_0019391 | 3300047315 | Bacteria | 3948 |
| 506 | Ga0495604_0004988 | 3300047317 | Bacteria | 10511 |
| 507 | Ga0495604_0009096 | 3300047317 | Bacteria | 7860 |
| 508 | Ga0495604_0082749 | 3300047317 | Bacteria | 2399 |
| 509 | Ga0495674_0000031 | 3300047319 | Bacteria | 115867 |
| 510 | Ga0495674_0042923 | 3300047319 | Bacteria | 4029 |
| 511 | Ga0495674_0167781 | 3300047319 | Bacteria | 1833 |
| 512 | Ga0495680_0024280 | 3300047322 | Bacteria | 5030 |
| 513 | Ga0495687_014302 | 3300047443 | Bacteria | 4091 |
| 514 | Ga0495673_0036405 | 3300047469 | Bacteria | 2258 |
| 515 | Ga0495684_0010711 | 3300047471 | Bacteria | 7091 |
| 516 | Ga0495684_0028321 | 3300047471 | Bacteria | 4301 |
| 517 | Ga0495684_0087681 | 3300047471 | Bacteria | 2358 |
| 518 | Ga0495684_0106060 | 3300047471 | Bacteria | 2123 |
| 519 | Ga0495686_0057595 | 3300047472 | Bacteria | 2425 |
| 520 | Ga0495593_0000008 | 3300047673 | Bacteria | 87310 |
| 521 | Ga0495593_0089256 | 3300047673 | Bacteria | 1588 |
| 522 | Ga0495602_0011752 | 3300048088 | Bacteria | 9041 |
| 523 | Ga0496100_0024358 | 3300048903 | Bacteria | 3691 |
| 524 | Ga0496100_0048201 | 3300048903 | Bacteria | 2749 |
| 525 | Ga0496100_0057600 | 3300048903 | Bacteria | 2546 |
| 526 | Ga0496101_0006365 | 3300048904 | Bacteria | 7599 |
| 527 | Ga0496101_0143379 | 3300048904 | Bacteria | 1822 |
| 528 | Ga0496101_0175899 | 3300048904 | Bacteria | 1646 |
| 529 | Ga0496102_0003595 | 3300048905 | Bacteria | 13132 |
| 530 | Ga0496102_0047832 | 3300048905 | Bacteria | 3888 |
| 531 | Ga0496102_0135445 | 3300048905 | Bacteria | 2308 |
| 532 | Ga0496102_0155765 | 3300048905 | Bacteria | 2147 |
| 533 | Ga0496102_0405944 | 3300048905 | Bacteria | 1280 |
| 534 | Ga0496103_0013766 | 3300048906 | Bacteria | 4802 |
| 535 | Ga0496103_0056345 | 3300048906 | Bacteria | 2439 |
| 536 | Ga0496104_0047727 | 3300048907 | Bacteria | 4036 |
| 537 | Ga0496104_0091600 | 3300048907 | Bacteria | 2906 |
| 538 | Ga0496104_0105275 | 3300048907 | Bacteria | 2703 |
| 539 | Ga0496104_0156936 | 3300048907 | Bacteria | 2183 |
| 540 | Ga0496104_0191109 | 3300048907 | Bacteria | 1959 |
| 541 | Ga0496104_0209150 | 3300048907 | Bacteria | 1863 |
| 542 | Ga0496105_0019331 | 3300048908 | Bacteria | 5493 |
| 543 | Ga0496105_0047299 | 3300048908 | Bacteria | 3550 |
| 544 | Ga0496105_0051555 | 3300048908 | Bacteria | 3399 |
| 545 | Ga0496106_0048244 | 3300048909 | Bacteria | 3207 |
| 546 | Ga0496106_0223856 | 3300048909 | Bacteria | 1501 |
| 547 | Ga0496107_0000947 | 3300048910 | Bacteria | 17177 |
| 548 | Ga0496107_0059812 | 3300048910 | Bacteria | 2757 |
| 549 | Ga0496107_0116062 | 3300048910 | Bacteria | 1970 |
| 550 | Ga0496108_0009810 | 3300048911 | Bacteria | 7756 |
| 551 | Ga0496108_0013705 | 3300048911 | Bacteria | 6616 |
| 552 | Ga0496109_0008951 | 3300048912 | Bacteria | 8527 |
| 553 | Ga0496109_0009381 | 3300048912 | Bacteria | 8337 |
| 554 | Ga0496109_0031864 | 3300048912 | Bacteria | 4735 |
| 555 | Ga0496109_0048452 | 3300048912 | Bacteria | 3866 |
| 556 | Ga0496110_0013781 | 3300048913 | Bacteria | 6698 |
| 557 | Ga0496110_0033318 | 3300048913 | Bacteria | 4455 |
| 558 | Ga0496110_0126144 | 3300048913 | Bacteria | 2309 |
| 559 | Ga0496111_0029039 | 3300048914 | Bacteria | 3923 |
| 560 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 561 | Ga0496112_0029131 | 3300048915 | Bacteria | 5337 |
| 562 | Ga0496112_0030083 | 3300048915 | Bacteria | 5255 |
| 563 | Ga0496112_0034956 | 3300048915 | Bacteria | 4890 |
| 564 | Ga0496112_0065820 | 3300048915 | Bacteria | 3576 |
| 565 | Ga0496112_0165206 | 3300048915 | Bacteria | 2179 |
| 566 | Ga0496113_0001327 | 3300048916 | Bacteria | 13676 |
| 567 | Ga0496113_0038477 | 3300048916 | Bacteria | 3517 |
| 568 | Ga0496113_0067913 | 3300048916 | Bacteria | 2704 |
| 569 | Ga0496113_0139736 | 3300048916 | Bacteria | 1905 |
| 570 | Ga0496113_0152713 | 3300048916 | Bacteria | 1822 |
| 571 | Ga0496114_0009690 | 3300048917 | Bacteria | 7651 |
| 572 | Ga0496114_0024353 | 3300048917 | Bacteria | 4940 |
| 573 | Ga0496115_0000604 | 3300048918 | Bacteria | 27391 |
| 574 | Ga0496115_0011581 | 3300048918 | Bacteria | 6613 |
| 575 | Ga0496115_0071313 | 3300048918 | Bacteria | 2818 |
| 576 | Ga0496115_0119789 | 3300048918 | Bacteria | 2165 |
| 577 | Ga0496115_0176244 | 3300048918 | Bacteria | 1768 |
| 578 | Ga0496115_0242729 | 3300048918 | Bacteria | 1485 |
| 579 | Ga0496115_0247343 | 3300048918 | Bacteria | 1469 |
| 580 | Ga0496117_0010071 | 3300048920 | Bacteria | 8683 |
| 581 | Ga0496117_0064449 | 3300048920 | Bacteria | 2498 |
| 582 | Ga0496118_0008611 | 3300048921 | Bacteria | 10500 |
| 583 | Ga0496118_0009891 | 3300048921 | Bacteria | 9537 |
| 584 | Ga0496118_0116503 | 3300048921 | Bacteria | 1755 |
| 585 | Ga0496119_0006875 | 3300048922 | Bacteria | 10389 |
| 586 | Ga0496119_0072328 | 3300048922 | Bacteria | 2015 |
| 587 | Ga0496120_0005140 | 3300048923 | Bacteria | 10571 |
| 588 | Ga0496121_0002635 | 3300048924 | Bacteria | 27038 |
| 589 | Ga0496121_0014245 | 3300048924 | Bacteria | 8457 |
| 590 | Ga0496121_0020183 | 3300048924 | Bacteria | 6613 |
| 591 | Ga0496121_0048593 | 3300048924 | Bacteria | 3608 |
| 592 | Ga0496121_0152966 | 3300048924 | Bacteria | 1695 |
| 593 | Ga0496124_0011581 | 3300048927 | Bacteria | 8801 |
| 594 | Ga0496124_0190514 | 3300048927 | Bacteria | 1570 |
| 595 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 596 | Ga0496125_0000746 | 3300048928 | Bacteria | 53671 |
| 597 | Ga0496125_0071057 | 3300048928 | Bacteria | 2721 |
| 598 | Ga0496126_0008677 | 3300048929 | Bacteria | 10918 |
| 599 | Ga0496126_0009242 | 3300048929 | Bacteria | 10508 |
| 600 | Ga0496126_0022113 | 3300048929 | Bacteria | 6194 |
| 601 | Ga0496126_0045158 | 3300048929 | Bacteria | 4052 |
| 602 | Ga0496126_0065897 | 3300048929 | Bacteria | 3239 |
| 603 | Ga0496126_0073717 | 3300048929 | Bacteria | 3034 |
| 604 | Ga0496126_0127252 | 3300048929 | Bacteria | 2204 |
| 605 | Ga0496126_0239357 | 3300048929 | Bacteria | 1517 |
| 606 | Ga0496126_0247949 | 3300048929 | Bacteria | 1485 |
| 607 | Ga0495682_0018342 | 3300049460 | Bacteria | 2636 |
| 608 | Ga0501032_0022551 | 3300049569 | Bacteria | 4363 |
| 609 | Ga0501034_0165443 | 3300049571 | Bacteria | 2180 |
| 610 | Ga0501036_0005911 | 3300049572 | Bacteria | 9917 |
| 611 | Ga0501037_0065576 | 3300049573 | Bacteria | 2645 |
| 612 | Ga0501038_0020172 | 3300049574 | Bacteria | 5996 |
| 613 | Ga0501039_0009067 | 3300049575 | Bacteria | 7583 |
| 614 | Ga0501046_0008999 | 3300049580 | Bacteria | 8663 |
| 615 | Ga0501048_0013379 | 3300049582 | Bacteria | 6089 |
| 616 | Ga0501069_0001752 | 3300049585 | Bacteria | 10825 |
| 617 | Ga0501070_0051123 | 3300049586 | Bacteria | 3430 |
| 618 | Ga0501070_0119773 | 3300049586 | Bacteria | 2175 |
| 619 | Ga0501071_0046675 | 3300049587 | Bacteria | 3111 |
| 620 | Ga0501074_0002882 | 3300049590 | Bacteria | 12058 |
| 621 | Ga0501076_0010510 | 3300049592 | Bacteria | 6869 |
| 622 | Ga0501076_0051612 | 3300049592 | Bacteria | 3256 |
| 623 | Ga0501076_0090535 | 3300049592 | Bacteria | 2461 |
| 624 | Ga0501079_0080288 | 3300049741 | Bacteria | 2522 |
| 625 | Ga0501083_0003764 | 3300049744 | Bacteria | 10648 |
| 626 | Ga0501044_0001655 | 3300049823 | Bacteria | 26167 |
| 627 | Ga0501044_0049412 | 3300049823 | Bacteria | 4343 |
| 628 | Ga0501044_0061643 | 3300049823 | Bacteria | 3836 |
| 629 | nmdc:mga03683_32601_c1 | 3300050489 | Bacteria | 2097 |
| 630 | nmdc:mga0yw44_134932_c1 | 3300050492 | Bacteria | 1601 |
| 631 | nmdc:mga0k408_22090_c2 | 3300050493 | Bacteria | 2760 |
| 632 | nmdc:mga0k408_25121_c1 | 3300050493 | Bacteria | 3372 |
| 633 | nmdc:mga06z11_108051_c1 | 3300050494 | Bacteria | 1537 |
| 634 | nmdc:mga04h51_25898_c1 | 3300050495 | Bacteria | 1810 |
| 635 | nmdc:mga07m45_63476_c1 | 3300050496 | Bacteria | 2095 |
| 636 | nmdc:mga05p37_213_c1 | 3300050507 | Bacteria | 58791 |
| 637 | nmdc:mga05p37_24611_c1 | 3300050507 | Bacteria | 7319 |
| 638 | nmdc:mga05p37_49620_c1 | 3300050507 | Bacteria | 5163 |
| 639 | nmdc:mga05p37_54085_c1 | 3300050507 | Bacteria | 4939 |
| 640 | nmdc:mga09592_1171_c1 | 3300050508 | Bacteria | 12926 |
| 641 | nmdc:mga09592_1606_c1 | 3300050508 | Bacteria | 18226 |
| 642 | nmdc:mga0qj67_129_c1 | 3300050509 | Bacteria | 50064 |
| 643 | nmdc:mga0qj67_31281_c1 | 3300050509 | Bacteria | 4145 |
| 644 | nmdc:mga0qj67_885_c1 | 3300050509 | Bacteria | 20530 |
| 645 | nmdc:mga06r32_1219_c1 | 3300050510 | Bacteria | 23164 |
| 646 | nmdc:mga06r32_253962_c1 | 3300050510 | Bacteria | 1746 |
| 647 | nmdc:mga06r32_6151_c1 | 3300050510 | Bacteria | 10773 |
| 648 | nmdc:mga08y16_275_c1 | 3300050511 | Bacteria | 46750 |
| 649 | nmdc:mga0n895_179945_c1 | 3300050512 | Bacteria | 2146 |
| 650 | nmdc:mga0n895_72723_c1 | 3300050512 | Bacteria | 3412 |
| 651 | nmdc:mga0rr50_12121_c1 | 3300050513 | Bacteria | 5556 |
| 652 | nmdc:mga0rr50_169464_c1 | 3300050513 | Bacteria | 1778 |
| 653 | nmdc:mga0a205_5452_c1 | 3300050515 | Bacteria | 11461 |
| 654 | nmdc:mga0sz30_34204_c1 | 3300050516 | Bacteria | 2114 |
| 655 | nmdc:mga0sz30_50717_c1 | 3300050516 | Bacteria | 1760 |
| 656 | Ga0495601_0067367 | 3300053077 | Bacteria | 2280 |
| 657 | Ga0495595_0027742 | 3300053084 | Bacteria | 2524 |
| 658 | Ga0495595_0033994 | 3300053084 | Bacteria | 2304 |
| 659 | Ga0495619_0011258 | 3300053085 | Bacteria | 5625 |
| 660 | Ga0495619_0017972 | 3300053085 | Bacteria | 4484 |
| 661 | Ga0495619_0058742 | 3300053085 | Bacteria | 2554 |
| 662 | Ga0495619_0062539 | 3300053085 | Bacteria | 2478 |
| 663 | Ga0500578_0051297 | 3300053086 | Bacteria | 2643 |
| 664 | Ga0500578_0110590 | 3300053086 | Bacteria | 1732 |
| 665 | Ga0500643_002271 | 3300053087 | Bacteria | 10082 |
| 666 | Ga0500644_0000771 | 3300053088 | Bacteria | 10930 |
| 667 | Ga0500583_0052684 | 3300053092 | Bacteria | 1894 |
| 668 | Ga0500651_0031020 | 3300053093 | Bacteria | 3365 |
| 669 | Ga0500651_0090684 | 3300053093 | Bacteria | 1882 |
| 670 | Ga0500566_0000011 | 3300053094 | Bacteria | 118644 |
| 671 | Ga0500566_0000293 | 3300053094 | Bacteria | 26861 |
| 672 | Ga0500566_0000412 | 3300053094 | Bacteria | 23818 |
| 673 | Ga0500566_0135551 | 3300053094 | Bacteria | 1312 |
| 674 | Ga0500640_001527 | 3300053095 | Bacteria | 7094 |
| 675 | Ga0500554_020862 | 3300053102 | Bacteria | 1808 |
| 676 | Ga0500555_001186 | 3300053103 | Bacteria | 8535 |
| 677 | Ga0500557_000062 | 3300053105 | Bacteria | 43893 |
| 678 | Ga0500572_000065 | 3300053111 | Bacteria | 32713 |
| 679 | Ga0500572_001006 | 3300053111 | Bacteria | 8512 |
| 680 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 681 | Ga0500595_000395 | 3300053119 | Bacteria | 28044 |
| 682 | Ga0500595_003500 | 3300053119 | Bacteria | 7305 |
| 683 | Ga0500607_022647 | 3300053121 | Bacteria | 3529 |
| 684 | Ga0500614_017278 | 3300053123 | Bacteria | 1628 |
| 685 | Ga0500642_0000127 | 3300053130 | Bacteria | 34341 |
| 686 | Ga0500652_005161 | 3300053131 | Bacteria | 4091 |
| 687 | Ga0500559_0001342 | 3300053136 | Bacteria | 14123 |
| 688 | Ga0500559_0001798 | 3300053136 | Bacteria | 11758 |
| 689 | Ga0500603_000269 | 3300053150 | Bacteria | 13789 |
| 690 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 691 | Ga0500616_0002075 | 3300053153 | Bacteria | 17550 |
| 692 | Ga0500616_0029688 | 3300053153 | Bacteria | 3008 |
| 693 | Ga0500630_000832 | 3300053159 | Bacteria | 14267 |
| 694 | Ga0500638_000370 | 3300053162 | Bacteria | 10477 |
| 695 | Ga0500639_000079 | 3300053163 | Bacteria | 45631 |
| 696 | Ga0500639_004522 | 3300053163 | Bacteria | 7069 |
| 697 | Ga0500636_0000041 | 3300053177 | Bacteria | 69687 |
| 698 | Ga0500636_0037290 | 3300053177 | Bacteria | 2876 |
| 699 | Ga0500637_0000026 | 3300053178 | Bacteria | 59050 |
| 700 | Ga0500637_0053059 | 3300053178 | Bacteria | 2314 |
| 701 | Ga0500637_0085364 | 3300053178 | Bacteria | 1825 |
| 702 | Ga0500625_015998 | 3300053729 | Bacteria | 3488 |
| 703 | Ga0500645_000226 | 3300053730 | Bacteria | 42982 |
| 704 | Ga0500609_002277 | 3300053731 | Bacteria | 2738 |
| 705 | Ga0500596_000987 | 3300053735 | Bacteria | 5689 |
| 706 | Ga0500596_004947 | 3300053735 | Bacteria | 2393 |
| 707 | Ga0500599_002636 | 3300053736 | Bacteria | 2163 |
| 708 | Ga0500601_005302 | 3300053737 | Bacteria | 1411 |
| 709 | Ga0501084_0032968 | 3300054114 | Bacteria | 4333 |
| 710 | Ga0500661_001127 | 3300055283 | Bacteria | 5003 |
| 711 | Ga0501082_0002831 | 3300060353 | Bacteria | 15119 |
| 712 | Ga0530510_0090886 | 3300061734 | Bacteria | 2227 |
| 713 | Ga0530510_0161046 | 3300061734 | Bacteria | 1660 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0165443 | Ga0501034_0165443_57_1229 | 377 |
| 2 | 3300031249 | Ga0265339_10107760 | Ga0265339_101077601 | 378 |
| 3 | iso_pu_bacteria | 8055617313 | 8055621701 | 378 |
| 4 | 3300003322 | rootL2_10158942 | rootL2_101589423 | 380 |
| 5 | 3300049569 | Ga0501032_0022551 | Ga0501032_0022551_2472_3752 | 380 |
| 6 | 3300049572 | Ga0501036_0005911 | Ga0501036_0005911_6100_7380 | 380 |
| 7 | 3300049573 | Ga0501037_0065576 | Ga0501037_0065576_96_1376 | 380 |
| 8 | 3300049574 | Ga0501038_0020172 | Ga0501038_0020172_3303_4583 | 380 |
| 9 | 3300049575 | Ga0501039_0009067 | Ga0501039_0009067_1336_2616 | 380 |
| 10 | 3300049580 | Ga0501046_0008999 | Ga0501046_0008999_2455_3735 | 380 |
| 11 | 3300049582 | Ga0501048_0013379 | Ga0501048_0013379_1577_2857 | 380 |
| 12 | 3300049585 | Ga0501069_0001752 | Ga0501069_0001752_7088_8368 | 380 |
| 13 | 3300049586 | Ga0501070_0051123 | Ga0501070_0051123_1228_2508 | 380 |
| 14 | 3300049587 | Ga0501071_0046675 | Ga0501071_0046675_1412_2692 | 380 |
| 15 | 3300049590 | Ga0501074_0002882 | Ga0501074_0002882_755_2035 | 380 |
| 16 | 3300049592 | Ga0501076_0090535 | Ga0501076_0090535_485_1765 | 380 |
| 17 | 3300049741 | Ga0501079_0080288 | Ga0501079_0080288_823_2103 | 380 |
| 18 | 3300049744 | Ga0501083_0003764 | Ga0501083_0003764_2641_3921 | 380 |
| 19 | 3300049823 | Ga0501044_0061643 | Ga0501044_0061643_1314_2594 | 380 |
| 20 | 3300054114 | Ga0501084_0032968 | Ga0501084_0032968_1473_2753 | 380 |
| 21 | 3300060353 | Ga0501082_0002831 | Ga0501082_0002831_6880_8160 | 380 |
| 22 | iso_pu_bacteria | 2824600985 | 2824605660 | 380 |
| 23 | 3300005327 | Ga0070658_10123665 | Ga0070658_101236653 | 381 |
| 24 | 3300005336 | Ga0070680_100000841 | Ga0070680_10000084121 | 381 |
| 25 | 3300005458 | Ga0070681_10009737 | Ga0070681_100097379 | 381 |
| 26 | 3300005530 | Ga0070679_100003118 | Ga0070679_10000311815 | 381 |
| 27 | 3300005563 | Ga0068855_100058768 | Ga0068855_1000587684 | 381 |
| 28 | 3300025909 | Ga0207705_10003219 | Ga0207705_1000321914 | 381 |
| 29 | 3300025912 | Ga0207707_10003317 | Ga0207707_1000331715 | 381 |
| 30 | 3300025921 | Ga0207652_10016478 | Ga0207652_100164787 | 381 |
| 31 | 3300025949 | Ga0207667_10027626 | Ga0207667_100276268 | 381 |
| 32 | 3300037068 | Ga0373925_0138906 | Ga0373925_0138906_81_1241 | 381 |
| 33 | 3300048918 | Ga0496115_0247343 | Ga0496115_0247343_296_1456 | 381 |
| 34 | 3300025937 | Ga0207669_10086754 | Ga0207669_100867542 | 382 |
| 35 | 3300048904 | Ga0496101_0175899 | Ga0496101_0175899_12_1178 | 382 |
| 36 | 3300053153 | Ga0500616_0029688 | Ga0500616_0029688_265_1431 | 382 |
| 37 | 3300005336 | Ga0070680_100053807 | Ga0070680_1000538072 | 383 |
| 38 | 3300005530 | Ga0070679_100004998 | Ga0070679_1000049985 | 383 |
| 39 | 3300009093 | Ga0105240_10013046 | Ga0105240_100130464 | 383 |
| 40 | 3300025921 | Ga0207652_10148500 | Ga0207652_101485002 | 383 |
| 41 | 3300028556 | Ga0265337_1006171 | Ga0265337_10061712 | 383 |
| 42 | 3300028563 | Ga0265319_1011253 | Ga0265319_10112532 | 383 |
| 43 | 3300028577 | Ga0265318_10024101 | Ga0265318_100241012 | 383 |
| 44 | 3300028653 | Ga0265323_10000434 | Ga0265323_1000043425 | 383 |
| 45 | 3300028666 | Ga0265336_10000649 | Ga0265336_1000064918 | 383 |
| 46 | 3300028800 | Ga0265338_10000280 | Ga0265338_1000028051 | 383 |
| 47 | 3300029957 | Ga0265324_10010387 | Ga0265324_100103872 | 383 |
| 48 | 3300049823 | Ga0501044_0001655 | Ga0501044_0001655_7757_9037 | 383 |
| 49 | iso_pu_bacteria | 2824732956 | 2824735657 | 383 |
| 50 | 3300009176 | Ga0105242_10212373 | Ga0105242_102123732 | 384 |
| 51 | 3300045049 | Ga0466959_0052521 | Ga0466959_0052521_1754_2932 | 384 |
| 52 | 3300046660 | Ga0495625_0164898 | Ga0495625_0164898_277_1470 | 384 |
| 53 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_112187_113356 | 384 |
| 54 | 3300048929 | Ga0496126_0065897 | Ga0496126_0065897_28_1200 | 384 |
| 55 | iso_pu_bacteria | 8019586578 | 8019592309 | 386 |
| 56 | iso_pu_bacteria | 2844533157 | 2844534782 | 387 |
| 57 | 3300053094 | Ga0500566_0135551 | Ga0500566_0135551_52_1236 | 389 |
| 58 | 3300061734 | Ga0530510_0161046 | Ga0530510_0161046_48_1340 | 389 |
| 59 | 3300006847 | Ga0075431_100119215 | Ga0075431_1001192153 | 390 |
| 60 | 3300006871 | Ga0075434_100001946 | Ga0075434_10000194613 | 390 |
| 61 | 3300007076 | Ga0075435_100011949 | Ga0075435_1000119493 | 390 |
| 62 | 3300025297 | Ga0209758_1007270 | Ga0209758_10072705 | 390 |
| 63 | 3300048918 | Ga0496115_0119789 | Ga0496115_0119789_923_2110 | 390 |
| 64 | 3300050507 | nmdc:mga05p37_49620_c1 | nmdc:mga05p37_49620_c1_3815_5086 | 390 |
| 65 | 3300050510 | nmdc:mga06r32_253962_c1 | nmdc:mga06r32_253962_c1_455_1726 | 390 |
| 66 | 3300050513 | nmdc:mga0rr50_12121_c1 | nmdc:mga0rr50_12121_c1_1256_2527 | 390 |
| 67 | 3300005983 | Ga0081540_1000102 | Ga0081540_100010213 | 391 |
| 68 | 3300006844 | Ga0075428_100003814 | Ga0075428_1000038149 | 391 |
| 69 | 3300006846 | Ga0075430_100012744 | Ga0075430_1000127443 | 391 |
| 70 | 3300006847 | Ga0075431_100013553 | Ga0075431_1000135537 | 391 |
| 71 | 3300006880 | Ga0075429_100003786 | Ga0075429_1000037868 | 391 |
| 72 | 3300009094 | Ga0111539_10000852 | Ga0111539_100008529 | 391 |
| 73 | 3300009147 | Ga0114129_10001487 | Ga0114129_1000148723 | 391 |
| 74 | 3300027907 | Ga0207428_10005470 | Ga0207428_100054706 | 391 |
| 75 | 3300048929 | Ga0496126_0009242 | Ga0496126_0009242_5354_6625 | 391 |
| 76 | 3300050507 | nmdc:mga05p37_213_c1 | nmdc:mga05p37_213_c1_21315_22610 | 391 |
| 77 | 3300050508 | nmdc:mga09592_1171_c1 | nmdc:mga09592_1171_c1_4263_5558 | 391 |
| 78 | 3300050509 | nmdc:mga0qj67_31281_c1 | nmdc:mga0qj67_31281_c1_1962_3257 | 391 |
| 79 | 3300050510 | nmdc:mga06r32_1219_c1 | nmdc:mga06r32_1219_c1_10021_11316 | 391 |
| 80 | 3300050511 | nmdc:mga08y16_275_c1 | nmdc:mga08y16_275_c1_36182_37477 | 391 |
| 81 | 3300005367 | Ga0070667_100151855 | Ga0070667_1001518552 | 392 |
| 82 | 3300025901 | Ga0207688_10059711 | Ga0207688_100597112 | 392 |
| 83 | 3300025940 | Ga0207691_10186072 | Ga0207691_101860722 | 392 |
| 84 | 3300033180 | Ga0307510_10073832 | Ga0307510_100738322 | 392 |
| 85 | 3300006846 | Ga0075430_100004241 | Ga0075430_1000042414 | 393 |
| 86 | 3300039450 | Ga0436363_0698487 | Ga0436363_0698487_14_1249 | 393 |
| 87 | 3300050509 | nmdc:mga0qj67_129_c1 | nmdc:mga0qj67_129_c1_3021_4322 | 393 |
| 88 | 3300049592 | Ga0501076_0051612 | Ga0501076_0051612_1308_2582 | 394 |
| 89 | 3300061734 | Ga0530510_0090886 | Ga0530510_0090886_681_1955 | 394 |
| 90 | 3300050493 | nmdc:mga0k408_22090_c2 | nmdc:mga0k408_22090_c2_566_1777 | 397 |
| 91 | 3300005937 | Ga0081455_10003176 | Ga0081455_1000317613 | 398 |
| 92 | 3300005983 | Ga0081540_1000841 | Ga0081540_100084111 | 399 |
| 93 | 3300046459 | Ga0495629_0163739 | Ga0495629_0163739_319_1533 | 399 |
| 94 | 3300046472 | Ga0495580_0043983 | Ga0495580_0043983_39_1253 | 399 |
| 95 | 3300046529 | Ga0495652_0168431 | Ga0495652_0168431_428_1642 | 399 |
| 96 | 3300053088 | Ga0500644_0000771 | Ga0500644_0000771_1259_2530 | 399 |
| 97 | 3300053093 | Ga0500651_0031020 | Ga0500651_0031020_473_1744 | 399 |
| 98 | iso_pu_bacteria | 8016530956 | 8016533660 | 399 |
| 99 | 3300006871 | Ga0075434_100083230 | Ga0075434_1000832301 | 400 |
| 100 | 3300007076 | Ga0075435_100119473 | Ga0075435_1001194733 | 400 |
| 101 | 3300031247 | Ga0265340_10014569 | Ga0265340_100145692 | 400 |
| 102 | 3300031249 | Ga0265339_10035899 | Ga0265339_100358992 | 400 |
| 103 | 3300050512 | nmdc:mga0n895_179945_c1 | nmdc:mga0n895_179945_c1_813_2087 | 400 |
| 104 | 3300050513 | nmdc:mga0rr50_169464_c1 | nmdc:mga0rr50_169464_c1_192_1466 | 400 |
| 105 | iso_pu_bacteria | 2937836603 | 2937837668 | 400 |
| 106 | 3300031242 | Ga0265329_10042580 | Ga0265329_100425801 | 401 |
| 107 | 3300050510 | nmdc:mga06r32_6151_c1 | nmdc:mga06r32_6151_c1_4679_5941 | 401 |
| 108 | 3300005471 | Ga0070698_100240368 | Ga0070698_1002403682 | 402 |
| 109 | 3300006942 | Ga0099824_1018474 | Ga0099824_10184744 | 402 |
| 110 | 3300027357 | Ga0209589_1000011 | Ga0209589_100001141 | 402 |
| 111 | 3300027361 | Ga0209489_100012 | Ga0209489_10001241 | 402 |
| 112 | 3300027363 | Ga0209700_100019 | Ga0209700_10001941 | 402 |
| 113 | 3300028786 | Ga0307517_10000279 | Ga0307517_1000027916 | 402 |
| 114 | 3300046543 | Ga0495645_0007155 | Ga0495645_0007155_3931_5193 | 402 |
| 115 | 3300053087 | Ga0500643_002271 | Ga0500643_002271_7470_8741 | 402 |
| 116 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_415015_416286 | 402 |
| 117 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1601655_1602926 | 402 |
| 118 | 3300005365 | Ga0070688_100026113 | Ga0070688_1000261132 | 403 |
| 119 | 3300005436 | Ga0070713_100001462 | Ga0070713_10000146217 | 403 |
| 120 | 3300005456 | Ga0070678_100162002 | Ga0070678_1001620022 | 403 |
| 121 | 3300005459 | Ga0068867_100059990 | Ga0068867_1000599903 | 403 |
| 122 | 3300005548 | Ga0070665_100073338 | Ga0070665_1000733385 | 403 |
| 123 | 3300005615 | Ga0070702_100034040 | Ga0070702_1000340401 | 403 |
| 124 | 3300005618 | Ga0068864_100049929 | Ga0068864_1000499292 | 403 |
| 125 | 3300005841 | Ga0068863_100074750 | Ga0068863_1000747503 | 403 |
| 126 | 3300005842 | Ga0068858_100031960 | Ga0068858_1000319602 | 403 |
| 127 | 3300006028 | Ga0070717_10006207 | Ga0070717_1000620711 | 403 |
| 128 | 3300006038 | Ga0075365_10033778 | Ga0075365_100337784 | 403 |
| 129 | 3300006163 | Ga0070715_10035264 | Ga0070715_100352641 | 403 |
| 130 | 3300006237 | Ga0097621_100040392 | Ga0097621_1000403926 | 403 |
| 131 | 3300006358 | Ga0068871_100001491 | Ga0068871_1000014912 | 403 |
| 132 | 3300009098 | Ga0105245_10078010 | Ga0105245_100780102 | 403 |
| 133 | 3300009101 | Ga0105247_10021886 | Ga0105247_100218862 | 403 |
| 134 | 3300009148 | Ga0105243_10178387 | Ga0105243_101783871 | 403 |
| 135 | 3300009174 | Ga0105241_10118948 | Ga0105241_101189483 | 403 |
| 136 | 3300009177 | Ga0105248_10027462 | Ga0105248_100274629 | 403 |
| 137 | 3300013296 | Ga0157374_10019281 | Ga0157374_100192819 | 403 |
| 138 | 3300013306 | Ga0163162_10281427 | Ga0163162_102814272 | 403 |
| 139 | 3300013308 | Ga0157375_10371170 | Ga0157375_103711702 | 403 |
| 140 | 3300014969 | Ga0157376_10292110 | Ga0157376_102921102 | 403 |
| 141 | 3300025900 | Ga0207710_10008721 | Ga0207710_100087212 | 403 |
| 142 | 3300025906 | Ga0207699_10004027 | Ga0207699_100040277 | 403 |
| 143 | 3300025907 | Ga0207645_10066067 | Ga0207645_100660672 | 403 |
| 144 | 3300025915 | Ga0207693_10000506 | Ga0207693_1000050633 | 403 |
| 145 | 3300025916 | Ga0207663_10004038 | Ga0207663_100040382 | 403 |
| 146 | 3300025925 | Ga0207650_10205616 | Ga0207650_102056162 | 403 |
| 147 | 3300025927 | Ga0207687_10021155 | Ga0207687_100211552 | 403 |
| 148 | 3300025928 | Ga0207700_10000668 | Ga0207700_1000066815 | 403 |
| 149 | 3300025933 | Ga0207706_10107404 | Ga0207706_101074042 | 403 |
| 150 | 3300025934 | Ga0207686_10040459 | Ga0207686_100404592 | 403 |
| 151 | 3300025935 | Ga0207709_10212003 | Ga0207709_102120031 | 403 |
| 152 | 3300025937 | Ga0207669_10107067 | Ga0207669_101070672 | 403 |
| 153 | 3300025939 | Ga0207665_10000528 | Ga0207665_1000052812 | 403 |
| 154 | 3300025941 | Ga0207711_10009654 | Ga0207711_1000965412 | 403 |
| 155 | 3300025960 | Ga0207651_10065505 | Ga0207651_100655052 | 403 |
| 156 | 3300026089 | Ga0207648_10184860 | Ga0207648_101848602 | 403 |
| 157 | 3300026095 | Ga0207676_10097698 | Ga0207676_100976982 | 403 |
| 158 | 3300026121 | Ga0207683_10009714 | Ga0207683_100097149 | 403 |
| 159 | 3300035170 | Ga0373943_0025222 | Ga0373943_0025222_79_1311 | 403 |
| 160 | 3300035171 | Ga0373946_0064791 | Ga0373946_0064791_167_1399 | 403 |
| 161 | 3300035172 | Ga0373955_0064066 | Ga0373955_0064066_496_1728 | 403 |
| 162 | 3300035724 | Ga0373933_0001821 | Ga0373933_0001821_8797_10074 | 403 |
| 163 | 3300046461 | Ga0495641_0011415 | Ga0495641_0011415_1296_2528 | 403 |
| 164 | 3300046463 | Ga0495653_0032304 | Ga0495653_0032304_1122_2354 | 403 |
| 165 | 3300046475 | Ga0495639_0015341 | Ga0495639_0015341_2036_3268 | 403 |
| 166 | 3300046520 | Ga0495637_0048728 | Ga0495637_0048728_511_1743 | 403 |
| 167 | 3300046531 | Ga0495665_0057438 | Ga0495665_0057438_232_1464 | 403 |
| 168 | 3300046559 | Ga0495667_0016295 | Ga0495667_0016295_421_1653 | 403 |
| 169 | 3300046663 | Ga0495635_0019273 | Ga0495635_0019273_865_2097 | 403 |
| 170 | 3300046683 | Ga0495658_0005502 | Ga0495658_0005502_4277_5509 | 403 |
| 171 | 3300046689 | Ga0495613_0025092 | Ga0495613_0025092_2493_3725 | 403 |
| 172 | 3300046809 | Ga0495600_0005381 | Ga0495600_0005381_2874_4106 | 403 |
| 173 | 3300047315 | Ga0495581_0018927 | Ga0495581_0018927_1314_2546 | 403 |
| 174 | 3300047319 | Ga0495674_0167781 | Ga0495674_0167781_232_1464 | 403 |
| 175 | 3300047322 | Ga0495680_0024280 | Ga0495680_0024280_165_1397 | 403 |
| 176 | 3300047471 | Ga0495684_0028321 | Ga0495684_0028321_2612_3844 | 403 |
| 177 | 3300047472 | Ga0495686_0057595 | Ga0495686_0057595_1033_2316 | 403 |
| 178 | 3300048903 | Ga0496100_0024358 | Ga0496100_0024358_2305_3537 | 403 |
| 179 | 3300048904 | Ga0496101_0143379 | Ga0496101_0143379_22_1254 | 403 |
| 180 | 3300048905 | Ga0496102_0405944 | Ga0496102_0405944_22_1254 | 403 |
| 181 | 3300048907 | Ga0496104_0047727 | Ga0496104_0047727_219_1451 | 403 |
| 182 | 3300048907 | Ga0496104_0156936 | Ga0496104_0156936_930_2162 | 403 |
| 183 | 3300048908 | Ga0496105_0047299 | Ga0496105_0047299_2091_3323 | 403 |
| 184 | 3300048910 | Ga0496107_0059812 | Ga0496107_0059812_733_1965 | 403 |
| 185 | 3300048911 | Ga0496108_0009810 | Ga0496108_0009810_1165_2397 | 403 |
| 186 | 3300048912 | Ga0496109_0009381 | Ga0496109_0009381_5164_6396 | 403 |
| 187 | 3300048912 | Ga0496109_0031864 | Ga0496109_0031864_918_2150 | 403 |
| 188 | 3300048913 | Ga0496110_0013781 | Ga0496110_0013781_3183_4415 | 403 |
| 189 | 3300048913 | Ga0496110_0033318 | Ga0496110_0033318_2514_3746 | 403 |
| 190 | 3300048914 | Ga0496111_0029039 | Ga0496111_0029039_2670_3902 | 403 |
| 191 | 3300048915 | Ga0496112_0034956 | Ga0496112_0034956_2305_3537 | 403 |
| 192 | 3300048915 | Ga0496112_0065820 | Ga0496112_0065820_245_1477 | 403 |
| 193 | 3300048916 | Ga0496113_0067913 | Ga0496113_0067913_808_2040 | 403 |
| 194 | 3300048916 | Ga0496113_0152713 | Ga0496113_0152713_22_1254 | 403 |
| 195 | 3300048917 | Ga0496114_0009690 | Ga0496114_0009690_793_2025 | 403 |
| 196 | 3300048918 | Ga0496115_0011581 | Ga0496115_0011581_22_1254 | 403 |
| 197 | 3300048929 | Ga0496126_0247949 | Ga0496126_0247949_163_1395 | 403 |
| 198 | 3300050512 | nmdc:mga0n895_72723_c1 | nmdc:mga0n895_72723_c1_439_1671 | 403 |
| 199 | 3300053085 | Ga0495619_0011258 | Ga0495619_0011258_2111_3343 | 403 |
| 200 | 3300053131 | Ga0500652_005161 | Ga0500652_005161_1953_3224 | 403 |
| 201 | 3300053730 | Ga0500645_000226 | Ga0500645_000226_9523_10794 | 403 |
| 202 | iso_pu_bacteria | 2924754689 | 2924760248 | 403 |
| 203 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003447 | 404 |
| 204 | 3300046474 | Ga0495605_0056668 | Ga0495605_0056668_436_1719 | 404 |
| 205 | 3300048905 | Ga0496102_0155765 | Ga0496102_0155765_650_1939 | 404 |
| 206 | 3300048908 | Ga0496105_0051555 | Ga0496105_0051555_1265_2548 | 404 |
| 207 | 3300048910 | Ga0496107_0116062 | Ga0496107_0116062_652_1935 | 404 |
| 208 | 3300048916 | Ga0496113_0139736 | Ga0496113_0139736_395_1678 | 404 |
| 209 | 3300048918 | Ga0496115_0176244 | Ga0496115_0176244_279_1562 | 404 |
| 210 | 3300048922 | Ga0496119_0006875 | Ga0496119_0006875_1886_3154 | 404 |
| 211 | 3300048929 | Ga0496126_0045158 | Ga0496126_0045158_78_1361 | 404 |
| 212 | 3300005439 | Ga0070711_100003772 | Ga0070711_1000037722 | 405 |
| 213 | 3300006175 | Ga0070712_100091514 | Ga0070712_1000915141 | 405 |
| 214 | 3300025898 | Ga0207692_10017877 | Ga0207692_100178772 | 405 |
| 215 | 3300025915 | Ga0207693_10062713 | Ga0207693_100627132 | 405 |
| 216 | 3300048909 | Ga0496106_0048244 | Ga0496106_0048244_1136_2425 | 405 |
| 217 | 3300048916 | Ga0496113_0038477 | Ga0496113_0038477_305_1594 | 405 |
| 218 | iso_pu_bacteria | 3003665799 | 3003670217 | 405 |
| 219 | 3300005455 | Ga0070663_100034033 | Ga0070663_1000340332 | 406 |
| 220 | 3300005617 | Ga0068859_100383909 | Ga0068859_1003839091 | 406 |
| 221 | 3300006931 | Ga0097620_100383932 | Ga0097620_1003839322 | 406 |
| 222 | 3300026067 | Ga0207678_10034200 | Ga0207678_100342002 | 406 |
| 223 | 3300044658 | Ga0466972_0000079 | Ga0466972_0000079_69315_70601 | 406 |
| 224 | 3300046506 | Ga0495583_0055522 | Ga0495583_0055522_65_1348 | 406 |
| 225 | 3300048929 | Ga0496126_0127252 | Ga0496126_0127252_474_1760 | 406 |
| 226 | 3300053094 | Ga0500566_0000011 | Ga0500566_0000011_69105_70385 | 406 |
| 227 | 3300053095 | Ga0500640_001527 | Ga0500640_001527_2630_3910 | 406 |
| 228 | 3300053111 | Ga0500572_000065 | Ga0500572_000065_33_1313 | 406 |
| 229 | 3300053136 | Ga0500559_0001798 | Ga0500559_0001798_5465_6745 | 406 |
| 230 | 3300053150 | Ga0500603_000269 | Ga0500603_000269_9031_10311 | 406 |
| 231 | 3300053159 | Ga0500630_000832 | Ga0500630_000832_6014_7294 | 406 |
| 232 | 3300053163 | Ga0500639_000079 | Ga0500639_000079_11319_12599 | 406 |
| 233 | 3300053178 | Ga0500637_0085364 | Ga0500637_0085364_156_1436 | 406 |
| 234 | 3300053731 | Ga0500609_002277 | Ga0500609_002277_806_2080 | 406 |
| 235 | 3300053735 | Ga0500596_000987 | Ga0500596_000987_159_1439 | 406 |
| 236 | 3300003215 | JGI25153J46596_10000317 | JGI25153J46596_1000031712 | 407 |
| 237 | 3300025261 | Ga0209233_1003610 | Ga0209233_10036105 | 407 |
| 238 | 3300025272 | Ga0209455_1005249 | Ga0209455_10052492 | 407 |
| 239 | 3300025297 | Ga0209758_1000120 | Ga0209758_100012034 | 407 |
| 240 | 3300025297 | Ga0209758_1018387 | Ga0209758_10183872 | 407 |
| 241 | 3300047469 | Ga0495673_0036405 | Ga0495673_0036405_889_2166 | 407 |
| 242 | 3300048920 | Ga0496117_0064449 | Ga0496117_0064449_349_1632 | 407 |
| 243 | 3300048921 | Ga0496118_0116503 | Ga0496118_0116503_206_1489 | 407 |
| 244 | 3300053086 | Ga0500578_0051297 | Ga0500578_0051297_114_1397 | 407 |
| 245 | 3300053092 | Ga0500583_0052684 | Ga0500583_0052684_603_1874 | 407 |
| 246 | 3300053093 | Ga0500651_0090684 | Ga0500651_0090684_585_1868 | 407 |
| 247 | 3300053103 | Ga0500555_001186 | Ga0500555_001186_5219_6490 | 407 |
| 248 | 3300005344 | Ga0070661_100148532 | Ga0070661_1001485322 | 408 |
| 249 | 3300005367 | Ga0070667_100111159 | Ga0070667_1001111591 | 408 |
| 250 | 3300005548 | Ga0070665_100053413 | Ga0070665_1000534136 | 408 |
| 251 | 3300005577 | Ga0068857_100059974 | Ga0068857_1000599742 | 408 |
| 252 | 3300005614 | Ga0068856_100079699 | Ga0068856_1000796994 | 408 |
| 253 | 3300006051 | Ga0075364_10074428 | Ga0075364_100744283 | 408 |
| 254 | 3300009545 | Ga0105237_10021234 | Ga0105237_100212343 | 408 |
| 255 | 3300009551 | Ga0105238_10027647 | Ga0105238_100276477 | 408 |
| 256 | 3300013296 | Ga0157374_10063878 | Ga0157374_100638783 | 408 |
| 257 | 3300014325 | Ga0163163_10200834 | Ga0163163_102008342 | 408 |
| 258 | 3300025904 | Ga0207647_10008820 | Ga0207647_100088202 | 408 |
| 259 | 3300025914 | Ga0207671_10056823 | Ga0207671_100568231 | 408 |
| 260 | 3300025920 | Ga0207649_10109100 | Ga0207649_101091002 | 408 |
| 261 | 3300025932 | Ga0207690_10172879 | Ga0207690_101728792 | 408 |
| 262 | 3300025972 | Ga0207668_10143392 | Ga0207668_101433922 | 408 |
| 263 | 3300026067 | Ga0207678_10022393 | Ga0207678_100223932 | 408 |
| 264 | 3300026067 | Ga0207678_10023935 | Ga0207678_100239352 | 408 |
| 265 | 3300026116 | Ga0207674_10078663 | Ga0207674_100786635 | 408 |
| 266 | 3300026116 | Ga0207674_10128182 | Ga0207674_101281822 | 408 |
| 267 | 3300028380 | Ga0268265_10118725 | Ga0268265_101187253 | 408 |
| 268 | 3300031247 | Ga0265340_10010905 | Ga0265340_100109053 | 408 |
| 269 | 3300037068 | Ga0373925_0038098 | Ga0373925_0038098_1702_2976 | 408 |
| 270 | 3300046522 | Ga0495643_0005954 | Ga0495643_0005954_5911_7185 | 408 |
| 271 | 3300046542 | Ga0495597_0031638 | Ga0495597_0031638_815_2089 | 408 |
| 272 | 3300046616 | Ga0495668_0066567 | Ga0495668_0066567_473_1747 | 408 |
| 273 | 3300046694 | Ga0495649_0059545 | Ga0495649_0059545_132_1406 | 408 |
| 274 | 3300047443 | Ga0495687_014302 | Ga0495687_014302_1797_3071 | 408 |
| 275 | 3300048905 | Ga0496102_0047832 | Ga0496102_0047832_2172_3446 | 408 |
| 276 | 3300048906 | Ga0496103_0056345 | Ga0496103_0056345_820_2094 | 408 |
| 277 | 3300048927 | Ga0496124_0190514 | Ga0496124_0190514_77_1351 | 408 |
| 278 | 3300050492 | nmdc:mga0yw44_134932_c1 | nmdc:mga0yw44_134932_c1_91_1365 | 408 |
| 279 | 3300050494 | nmdc:mga06z11_108051_c1 | nmdc:mga06z11_108051_c1_237_1511 | 408 |
| 280 | 3300050495 | nmdc:mga04h51_25898_c1 | nmdc:mga04h51_25898_c1_250_1524 | 408 |
| 281 | 3300050496 | nmdc:mga07m45_63476_c1 | nmdc:mga07m45_63476_c1_89_1363 | 408 |
| 282 | 3300003771 | Ga0055526_1025395 | Ga0055526_10253951 | 409 |
| 283 | 3300005434 | Ga0070709_10026207 | Ga0070709_100262071 | 409 |
| 284 | 3300005437 | Ga0070710_10007682 | Ga0070710_100076823 | 409 |
| 285 | 3300005983 | Ga0081540_1008125 | Ga0081540_10081252 | 409 |
| 286 | 3300011119 | Ga0105246_10013775 | Ga0105246_100137752 | 409 |
| 287 | 3300025297 | Ga0209758_1032806 | Ga0209758_10328063 | 409 |
| 288 | 3300025905 | Ga0207685_10028315 | Ga0207685_100283152 | 409 |
| 289 | 3300025915 | Ga0207693_10007874 | Ga0207693_100078747 | 409 |
| 290 | 3300025929 | Ga0207664_10102478 | Ga0207664_101024783 | 409 |
| 291 | 3300025939 | Ga0207665_10001385 | Ga0207665_100013858 | 409 |
| 292 | 3300035170 | Ga0373943_0037571 | Ga0373943_0037571_615_1895 | 409 |
| 293 | 3300037068 | Ga0373925_0027047 | Ga0373925_0027047_12_1292 | 409 |
| 294 | 3300044694 | Ga0466963_0007491 | Ga0466963_0007491_3744_5018 | 409 |
| 295 | 3300046459 | Ga0495629_0009871 | Ga0495629_0009871_5592_6875 | 409 |
| 296 | 3300046460 | Ga0495638_0020090 | Ga0495638_0020090_155_1438 | 409 |
| 297 | 3300046529 | Ga0495652_0097969 | Ga0495652_0097969_504_1787 | 409 |
| 298 | 3300048923 | Ga0496120_0005140 | Ga0496120_0005140_8875_10158 | 409 |
| 299 | 3300053085 | Ga0495619_0058742 | Ga0495619_0058742_159_1439 | 409 |
| 300 | 3300053153 | Ga0500616_0002075 | Ga0500616_0002075_8423_9700 | 409 |
| 301 | 3300053736 | Ga0500599_002636 | Ga0500599_002636_791_2074 | 409 |
| 302 | 3300053737 | Ga0500601_005302 | Ga0500601_005302_99_1394 | 409 |
| 303 | iso_pu_bacteria | 2508501127 | 2509140462 | 409 |
| 304 | iso_pu_bacteria | 2524023205 | 2524436080 | 409 |
| 305 | iso_pu_bacteria | 2597489875 | 2597813935 | 409 |
| 306 | iso_pu_bacteria | 2744054633 | 2745080024 | 409 |
| 307 | iso_pu_bacteria | 2841734538 | 2841740203 | 409 |
| 308 | iso_pu_bacteria | 2856342000 | 2856344111 | 409 |
| 309 | iso_pu_bacteria | 2871474448 | 2871480009 | 409 |
| 310 | iso_pu_bacteria | 2885312484 | 2885315494 | 409 |
| 311 | iso_pu_bacteria | 2888343758 | 2888347628 | 409 |
| 312 | iso_pu_bacteria | 2958071322 | 2958077696 | 409 |
| 313 | iso_pu_bacteria | 2970524798 | 2970530301 | 409 |
| 314 | iso_pu_bacteria | 2970540015 | 2970542806 | 409 |
| 315 | iso_pu_bacteria | 8004395343 | 8004401455 | 409 |
| 316 | iso_pu_bacteria | 8004633249 | 8004637161 | 409 |
| 317 | 3300014325 | Ga0163163_10334734 | Ga0163163_103347341 | 410 |
| 318 | 3300021321 | Ga0214542_1001925 | Ga0214542_100192535 | 410 |
| 319 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003214 | 410 |
| 320 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002552 | 410 |
| 321 | 3300025907 | Ga0207645_10081474 | Ga0207645_100814741 | 410 |
| 322 | 3300033180 | Ga0307510_10037733 | Ga0307510_100377334 | 410 |
| 323 | 3300037312 | Ga0395899_0060103 | Ga0395899_0060103_774_2045 | 410 |
| 324 | 3300037418 | Ga0395900_0003092 | Ga0395900_0003092_5509_6780 | 410 |
| 325 | 3300038443 | Ga0395901_0001902 | Ga0395901_0001902_16849_18120 | 410 |
| 326 | 3300038443 | Ga0395901_0209340 | Ga0395901_0209340_755_2026 | 410 |
| 327 | 3300046507 | Ga0495606_0006998 | Ga0495606_0006998_4677_5960 | 410 |
| 328 | 3300046694 | Ga0495649_0038307 | Ga0495649_0038307_231_1514 | 410 |
| 329 | 3300049460 | Ga0495682_0018342 | Ga0495682_0018342_25_1308 | 410 |
| 330 | 3300053121 | Ga0500607_022647 | Ga0500607_022647_955_2238 | 410 |
| 331 | 3300053123 | Ga0500614_017278 | Ga0500614_017278_35_1318 | 410 |
| 332 | 3300053177 | Ga0500636_0000041 | Ga0500636_0000041_15716_16999 | 410 |
| 333 | iso_pu_bacteria | 2849076700 | 2849078190 | 410 |
| 334 | 3300005471 | Ga0070698_100080213 | Ga0070698_1000802133 | 411 |
| 335 | 3300006028 | Ga0070717_10007544 | Ga0070717_100075446 | 411 |
| 336 | 3300006175 | Ga0070712_100173947 | Ga0070712_1001739472 | 411 |
| 337 | 3300013306 | Ga0163162_10225195 | Ga0163162_102251952 | 411 |
| 338 | 3300025254 | Ga0209148_1000812 | Ga0209148_100081219 | 411 |
| 339 | 3300025272 | Ga0209455_1005452 | Ga0209455_10054523 | 411 |
| 340 | 3300025297 | Ga0209758_1002848 | Ga0209758_10028488 | 411 |
| 341 | 3300025915 | Ga0207693_10095504 | Ga0207693_100955042 | 411 |
| 342 | 3300035207 | Ga0373942_0003177 | Ga0373942_0003177_1441_2700 | 411 |
| 343 | 3300035695 | Ga0373927_0045712 | Ga0373927_0045712_1269_2549 | 411 |
| 344 | 3300046507 | Ga0495606_0003362 | Ga0495606_0003362_223_1500 | 411 |
| 345 | 3300048929 | Ga0496126_0239357 | Ga0496126_0239357_212_1495 | 411 |
| 346 | 3300009101 | Ga0105247_10081130 | Ga0105247_100811303 | 412 |
| 347 | 3300046516 | Ga0495628_0042625 | Ga0495628_0042625_2156_3517 | 412 |
| 348 | 3300046535 | Ga0495586_0056589 | Ga0495586_0056589_420_1781 | 412 |
| 349 | 3300046536 | Ga0495587_0044824 | Ga0495587_0044824_205_1566 | 412 |
| 350 | 3300005457 | Ga0070662_100256264 | Ga0070662_1002562641 | 413 |
| 351 | 3300006048 | Ga0075363_100009226 | Ga0075363_1000092264 | 413 |
| 352 | 3300006051 | Ga0075364_10023541 | Ga0075364_100235413 | 413 |
| 353 | 3300006177 | Ga0075362_10019648 | Ga0075362_100196482 | 413 |
| 354 | 3300006186 | Ga0075369_10032411 | Ga0075369_100324112 | 413 |
| 355 | 3300006195 | Ga0075366_10038702 | Ga0075366_100387023 | 413 |
| 356 | 3300025933 | Ga0207706_10015391 | Ga0207706_100153913 | 413 |
| 357 | 3300050489 | nmdc:mga03683_32601_c1 | nmdc:mga03683_32601_c1_718_1977 | 413 |
| 358 | 3300050493 | nmdc:mga0k408_25121_c1 | nmdc:mga0k408_25121_c1_1670_2929 | 413 |
| 359 | 3300050516 | nmdc:mga0sz30_34204_c1 | nmdc:mga0sz30_34204_c1_203_1462 | 413 |
| 360 | iso_pu_bacteria | 2513237104 | 2513721517 | 413 |
| 361 | iso_pu_bacteria | 2922393267 | 2922396860 | 413 |
| 362 | 3300005329 | Ga0070683_100035975 | Ga0070683_1000359753 | 414 |
| 363 | 3300005458 | Ga0070681_10147603 | Ga0070681_101476032 | 414 |
| 364 | 3300005530 | Ga0070679_100139466 | Ga0070679_1001394662 | 414 |
| 365 | 3300005535 | Ga0070684_100009391 | Ga0070684_1000093917 | 414 |
| 366 | 3300009553 | Ga0105249_10295488 | Ga0105249_102954881 | 414 |
| 367 | 3300010159 | Ga0099796_10046613 | Ga0099796_100466131 | 414 |
| 368 | 3300025912 | Ga0207707_10031075 | Ga0207707_100310756 | 414 |
| 369 | 3300025916 | Ga0207663_10006243 | Ga0207663_100062435 | 414 |
| 370 | 3300025921 | Ga0207652_10115718 | Ga0207652_101157182 | 414 |
| 371 | 3300025944 | Ga0207661_10008452 | Ga0207661_100084525 | 414 |
| 372 | 3300025944 | Ga0207661_10291186 | Ga0207661_102911861 | 414 |
| 373 | 3300053094 | Ga0500566_0000412 | Ga0500566_0000412_11390_12649 | 414 |
| 374 | 3300053105 | Ga0500557_000062 | Ga0500557_000062_37347_38606 | 414 |
| 375 | 3300053130 | Ga0500642_0000127 | Ga0500642_0000127_18935_20194 | 414 |
| 376 | iso_pu_bacteria | 2507262055 | 2507507463 | 414 |
| 377 | iso_pu_bacteria | 2508501009 | 2508541577 | 414 |
| 378 | iso_pu_bacteria | 2508501042 | 2508692880 | 414 |
| 379 | iso_pu_bacteria | 2511231028 | 2511398979 | 414 |
| 380 | iso_pu_bacteria | 2513237092 | 2513621669 | 414 |
| 381 | iso_pu_bacteria | 2513237096 | 2513657139 | 414 |
| 382 | iso_pu_bacteria | 2513237137 | 2513857027 | 414 |
| 383 | iso_pu_bacteria | 2513237139 | 2513878358 | 414 |
| 384 | iso_pu_bacteria | 2513237145 | 2513919147 | 414 |
| 385 | iso_pu_bacteria | 2513237161 | 2514011715 | 414 |
| 386 | iso_pu_bacteria | 2515154112 | 2515626270 | 414 |
| 387 | iso_pu_bacteria | 2517572143 | 2517891159 | 414 |
| 388 | iso_pu_bacteria | 2617270735 | 2617352718 | 414 |
| 389 | iso_pu_bacteria | 2728368998 | 2728755524 | 414 |
| 390 | iso_pu_bacteria | 2791355196 | 2793061081 | 414 |
| 391 | iso_pu_bacteria | 2791355197 | 2793066502 | 414 |
| 392 | iso_pu_bacteria | 2802429603 | 2805920581 | 414 |
| 393 | iso_pu_bacteria | 2816332527 | 2818236767 | 414 |
| 394 | iso_pu_bacteria | 2824609381 | 2824611778 | 414 |
| 395 | iso_pu_bacteria | 2824653114 | 2824655014 | 414 |
| 396 | iso_pu_bacteria | 2824671348 | 2824675199 | 414 |
| 397 | iso_pu_bacteria | 2824679649 | 2824681575 | 414 |
| 398 | iso_pu_bacteria | 2824687955 | 2824690053 | 414 |
| 399 | iso_pu_bacteria | 2824696289 | 2824701150 | 414 |
| 400 | iso_pu_bacteria | 2824773399 | 2824776677 | 414 |
| 401 | iso_pu_bacteria | 2838122688 | 2838127373 | 414 |
| 402 | iso_pu_bacteria | 2841941048 | 2841946392 | 414 |
| 403 | iso_pu_bacteria | 2841949485 | 2841957111 | 414 |
| 404 | iso_pu_bacteria | 2841966195 | 2841972902 | 414 |
| 405 | iso_pu_bacteria | 2841974524 | 2841978426 | 414 |
| 406 | iso_pu_bacteria | 2841983080 | 2841987472 | 414 |
| 407 | iso_pu_bacteria | 2842038055 | 2842040855 | 414 |
| 408 | iso_pu_bacteria | 2842045827 | 2842046200 | 414 |
| 409 | iso_pu_bacteria | 2847930680 | 2847937534 | 414 |
| 410 | iso_pu_bacteria | 2847939898 | 2847947962 | 414 |
| 411 | iso_pu_bacteria | 2857509624 | 2857511351 | 414 |
| 412 | iso_pu_bacteria | 2874590934 | 2874598579 | 414 |
| 413 | iso_pu_bacteria | 2874612657 | 2874616764 | 414 |
| 414 | iso_pu_bacteria | 2874620515 | 2874628286 | 414 |
| 415 | iso_pu_bacteria | 2874645413 | 2874652032 | 414 |
| 416 | iso_pu_bacteria | 2876761206 | 2876768291 | 414 |
| 417 | iso_pu_bacteria | 2876771140 | 2876778617 | 414 |
| 418 | iso_pu_bacteria | 2876818435 | 2876823422 | 414 |
| 419 | iso_pu_bacteria | 2879074833 | 2879082410 | 414 |
| 420 | iso_pu_bacteria | 2879083081 | 2879084947 | 414 |
| 421 | iso_pu_bacteria | 2879127579 | 2879131809 | 414 |
| 422 | iso_pu_bacteria | 2879142872 | 2879150145 | 414 |
| 423 | iso_pu_bacteria | 2881364244 | 2881370114 | 414 |
| 424 | iso_pu_bacteria | 2881665667 | 2881670114 | 414 |
| 425 | iso_pu_bacteria | 2885366525 | 2885370179 | 414 |
| 426 | iso_pu_bacteria | 2885409591 | 2885414370 | 414 |
| 427 | iso_pu_bacteria | 2888378607 | 2888385690 | 414 |
| 428 | iso_pu_bacteria | 2888388044 | 2888392577 | 414 |
| 429 | iso_pu_bacteria | 2888419890 | 2888425813 | 414 |
| 430 | iso_pu_bacteria | 2903748898 | 2903752222 | 414 |
| 431 | iso_pu_bacteria | 2904666416 | 2904674095 | 414 |
| 432 | iso_pu_bacteria | 2906610324 | 2906616339 | 414 |
| 433 | iso_pu_bacteria | 2906643746 | 2906651217 | 414 |
| 434 | iso_pu_bacteria | 2906660503 | 2906662878 | 414 |
| 435 | iso_pu_bacteria | 2908775508 | 2908781388 | 414 |
| 436 | iso_pu_bacteria | 2922361189 | 2922361758 | 414 |
| 437 | iso_pu_bacteria | 2922386360 | 2922386997 | 414 |
| 438 | iso_pu_bacteria | 2922425934 | 2922431663 | 414 |
| 439 | iso_pu_bacteria | 2935608549 | 2935610033 | 414 |
| 440 | iso_pu_bacteria | 2935630451 | 2935635787 | 414 |
| 441 | iso_pu_bacteria | 2935648319 | 2935656357 | 414 |
| 442 | iso_pu_bacteria | 2935656913 | 2935660087 | 414 |
| 443 | iso_pu_bacteria | 2935769743 | 2935776444 | 414 |
| 444 | iso_pu_bacteria | 2935777560 | 2935780837 | 414 |
| 445 | iso_pu_bacteria | 2935785616 | 2935792331 | 414 |
| 446 | iso_pu_bacteria | 2935793552 | 2935800494 | 414 |
| 447 | iso_pu_bacteria | 2935819856 | 2935823193 | 414 |
| 448 | iso_pu_bacteria | 2935847175 | 2935848775 | 414 |
| 449 | iso_pu_bacteria | 2935908558 | 2935909423 | 414 |
| 450 | iso_pu_bacteria | 2935916978 | 2935917145 | 414 |
| 451 | iso_pu_bacteria | 2935926038 | 2935926904 | 414 |
| 452 | iso_pu_bacteria | 2935934488 | 2935937252 | 414 |
| 453 | iso_pu_bacteria | 2935942939 | 2935944445 | 414 |
| 454 | iso_pu_bacteria | 2935951376 | 2935952882 | 414 |
| 455 | iso_pu_bacteria | 2935967501 | 2935969722 | 414 |
| 456 | iso_pu_bacteria | 2935975950 | 2935976333 | 414 |
| 457 | iso_pu_bacteria | 2935984226 | 2935991826 | 414 |
| 458 | iso_pu_bacteria | 2936011229 | 2936014503 | 414 |
| 459 | iso_pu_bacteria | 2936019824 | 2936027830 | 414 |
| 460 | iso_pu_bacteria | 2936028420 | 2936031300 | 414 |
| 461 | iso_pu_bacteria | 2936046547 | 2936049609 | 414 |
| 462 | iso_pu_bacteria | 2936055302 | 2936061175 | 414 |
| 463 | iso_pu_bacteria | 2941507105 | 2941512376 | 414 |
| 464 | iso_pu_bacteria | 2941515067 | 2941520119 | 414 |
| 465 | iso_pu_bacteria | 2941523033 | 2941528268 | 414 |
| 466 | iso_pu_bacteria | 3005474847 | 3005481462 | 414 |
| 467 | iso_pu_bacteria | 3005483717 | 3005488442 | 414 |
| 468 | iso_pu_bacteria | 3005506211 | 3005508231 | 414 |
| 469 | iso_pu_bacteria | 3005587118 | 3005588267 | 414 |
| 470 | iso_pu_bacteria | 8016522445 | 8016528501 | 414 |
| 471 | iso_pu_bacteria | 8016539877 | 8016546882 | 414 |
| 472 | iso_pu_bacteria | 8016548790 | 8016555237 | 414 |
| 473 | iso_pu_bacteria | 8016575299 | 8016576195 | 414 |
| 474 | iso_pu_bacteria | 8016595262 | 8016601334 | 414 |
| 475 | iso_pu_bacteria | 8016603502 | 8016609096 | 414 |
| 476 | iso_pu_bacteria | 8016613128 | 8016615808 | 414 |
| 477 | iso_pu_bacteria | 8019530166 | 8019533440 | 414 |
| 478 | iso_pu_bacteria | 8019547302 | 8019552473 | 414 |
| 479 | iso_pu_bacteria | 8019555841 | 8019565116 | 414 |
| 480 | iso_pu_bacteria | 8019565922 | 8019575218 | 414 |
| 481 | iso_pu_bacteria | 8019619141 | 8019620022 | 414 |
| 482 | iso_pu_bacteria | 8019629233 | 8019633082 | 414 |
| 483 | iso_pu_bacteria | 8019659431 | 8019660964 | 414 |
| 484 | iso_pu_bacteria | 8019668869 | 8019670524 | 414 |
| 485 | iso_pu_bacteria | 8019678201 | 8019685708 | 414 |
| 486 | iso_pu_bacteria | 8019687851 | 8019691285 | 414 |
| 487 | iso_pu_bacteria | 8056689827 | 8056690619 | 414 |
| 488 | 3300005445 | Ga0070708_100029298 | Ga0070708_1000292983 | 415 |
| 489 | 3300005468 | Ga0070707_100022473 | Ga0070707_1000224735 | 415 |
| 490 | 3300005530 | Ga0070679_100228455 | Ga0070679_1002284552 | 415 |
| 491 | 3300005536 | Ga0070697_100061449 | Ga0070697_1000614493 | 415 |
| 492 | 3300006028 | Ga0070717_10021364 | Ga0070717_100213644 | 415 |
| 493 | 3300006852 | Ga0075433_10036313 | Ga0075433_100363132 | 415 |
| 494 | 3300006880 | Ga0075429_100012545 | Ga0075429_1000125453 | 415 |
| 495 | 3300009147 | Ga0114129_10007257 | Ga0114129_100072575 | 415 |
| 496 | 3300009147 | Ga0114129_10021318 | Ga0114129_100213183 | 415 |
| 497 | 3300013297 | Ga0157378_10004961 | Ga0157378_100049617 | 415 |
| 498 | 3300025910 | Ga0207684_10003339 | Ga0207684_100033395 | 415 |
| 499 | 3300025912 | Ga0207707_10027833 | Ga0207707_100278332 | 415 |
| 500 | 3300025922 | Ga0207646_10002996 | Ga0207646_1000299615 | 415 |
| 501 | 3300026121 | Ga0207683_10262268 | Ga0207683_102622682 | 415 |
| 502 | 3300046455 | Ga0495603_0086322 | Ga0495603_0086322_277_1539 | 415 |
| 503 | 3300048924 | Ga0496121_0014245 | Ga0496121_0014245_825_2108 | 415 |
| 504 | 3300050515 | nmdc:mga0a205_5452_c1 | nmdc:mga0a205_5452_c1_7161_8432 | 415 |
| 505 | iso_pu_bacteria | 2513237094 | 2513636902 | 415 |
| 506 | iso_pu_bacteria | 2528768022 | 2528852873 | 415 |
| 507 | iso_pu_bacteria | 2667528175 | 2671123239 | 415 |
| 508 | iso_pu_bacteria | 2824661429 | 2824664031 | 415 |
| 509 | iso_pu_bacteria | 2824704595 | 2824711111 | 415 |
| 510 | iso_pu_bacteria | 2824753945 | 2824760454 | 415 |
| 511 | iso_pu_bacteria | 2824763712 | 2824766557 | 415 |
| 512 | iso_pu_bacteria | 2841957949 | 2841965633 | 415 |
| 513 | iso_pu_bacteria | 2844315083 | 2844320212 | 415 |
| 514 | iso_pu_bacteria | 2874628541 | 2874630117 | 415 |
| 515 | iso_pu_bacteria | 2879099564 | 2879107930 | 415 |
| 516 | iso_pu_bacteria | 2903727486 | 2903731198 | 415 |
| 517 | iso_pu_bacteria | 2904690495 | 2904698941 | 415 |
| 518 | iso_pu_bacteria | 2904711408 | 2904711745 | 415 |
| 519 | iso_pu_bacteria | 2906602504 | 2906610035 | 415 |
| 520 | iso_pu_bacteria | 2906626472 | 2906629224 | 415 |
| 521 | iso_pu_bacteria | 2929615660 | 2929621250 | 415 |
| 522 | iso_pu_bacteria | 2929624759 | 2929625919 | 415 |
| 523 | iso_pu_bacteria | 2932784394 | 2932785196 | 415 |
| 524 | iso_pu_bacteria | 2932809354 | 2932810230 | 415 |
| 525 | iso_pu_bacteria | 2932818245 | 2932821802 | 415 |
| 526 | iso_pu_bacteria | 2932828146 | 2932829032 | 415 |
| 527 | iso_pu_bacteria | 2933577622 | 2933582881 | 415 |
| 528 | iso_pu_bacteria | 2935616580 | 2935619548 | 415 |
| 529 | iso_pu_bacteria | 2935638405 | 2935638528 | 415 |
| 530 | iso_pu_bacteria | 2935665750 | 2935666620 | 415 |
| 531 | iso_pu_bacteria | 2935675223 | 2935682190 | 415 |
| 532 | iso_pu_bacteria | 2935684952 | 2935691154 | 415 |
| 533 | iso_pu_bacteria | 2935694250 | 2935694421 | 415 |
| 534 | iso_pu_bacteria | 2935703347 | 2935703534 | 415 |
| 535 | iso_pu_bacteria | 2935713505 | 2935718535 | 415 |
| 536 | iso_pu_bacteria | 2935722832 | 2935727485 | 415 |
| 537 | iso_pu_bacteria | 2935732158 | 2935736188 | 415 |
| 538 | iso_pu_bacteria | 2935741537 | 2935745568 | 415 |
| 539 | iso_pu_bacteria | 2935750917 | 2935755949 | 415 |
| 540 | iso_pu_bacteria | 2935760218 | 2935760789 | 415 |
| 541 | iso_pu_bacteria | 2935801545 | 2935801671 | 415 |
| 542 | iso_pu_bacteria | 2935810662 | 2935814919 | 415 |
| 543 | iso_pu_bacteria | 2935827899 | 2935828022 | 415 |
| 544 | iso_pu_bacteria | 2935837841 | 2935842228 | 415 |
| 545 | iso_pu_bacteria | 2935855204 | 2935858136 | 415 |
| 546 | iso_pu_bacteria | 2935864058 | 2935868041 | 415 |
| 547 | iso_pu_bacteria | 2935873716 | 2935873936 | 415 |
| 548 | iso_pu_bacteria | 2935992306 | 2935993140 | 415 |
| 549 | iso_pu_bacteria | 2936002035 | 2936003077 | 415 |
| 550 | iso_pu_bacteria | 2936037263 | 2936040438 | 415 |
| 551 | iso_pu_bacteria | 2940556831 | 2940562076 | 415 |
| 552 | iso_pu_bacteria | 2941531003 | 2941531402 | 415 |
| 553 | iso_pu_bacteria | 2941538514 | 2941542276 | 415 |
| 554 | iso_pu_bacteria | 3005594810 | 3005600525 | 415 |
| 555 | iso_pu_bacteria | 3005710791 | 3005715999 | 415 |
| 556 | iso_pu_bacteria | 8006973647 | 8006978913 | 415 |
| 557 | iso_pu_bacteria | 8016511872 | 8016520429 | 415 |
| 558 | iso_pu_bacteria | 8016583857 | 8016594597 | 415 |
| 559 | iso_pu_bacteria | 8017057580 | 8017065146 | 415 |
| 560 | iso_pu_bacteria | 8019576017 | 8019584536 | 415 |
| 561 | iso_pu_bacteria | 8019597564 | 8019598978 | 415 |
| 562 | iso_pu_bacteria | 8019608314 | 8019609399 | 415 |
| 563 | iso_pu_bacteria | 8019648815 | 8019649593 | 415 |
| 564 | iso_pu_bacteria | 8055742211 | 8055744889 | 415 |
| 565 | 3300005436 | Ga0070713_100052936 | Ga0070713_1000529362 | 416 |
| 566 | 3300005471 | Ga0070698_100013803 | Ga0070698_1000138032 | 416 |
| 567 | 3300006846 | Ga0075430_100002189 | Ga0075430_1000021893 | 416 |
| 568 | 3300006846 | Ga0075430_100044526 | Ga0075430_1000445265 | 416 |
| 569 | 3300006847 | Ga0075431_100021216 | Ga0075431_1000212163 | 416 |
| 570 | 3300006880 | Ga0075429_100000055 | Ga0075429_10000005533 | 416 |
| 571 | 3300009147 | Ga0114129_10012532 | Ga0114129_100125325 | 416 |
| 572 | 3300009147 | Ga0114129_10060555 | Ga0114129_100605557 | 416 |
| 573 | 3300025910 | Ga0207684_10019497 | Ga0207684_100194977 | 416 |
| 574 | 3300025922 | Ga0207646_10003246 | Ga0207646_1000324615 | 416 |
| 575 | 3300025928 | Ga0207700_10083120 | Ga0207700_100831202 | 416 |
| 576 | 3300026088 | Ga0207641_10198815 | Ga0207641_101988152 | 416 |
| 577 | 3300028381 | Ga0268264_10163025 | Ga0268264_101630252 | 416 |
| 578 | 3300031241 | Ga0265325_10000599 | Ga0265325_1000059911 | 416 |
| 579 | 3300036401 | Ga0373937_0139955 | Ga0373937_0139955_462_1733 | 416 |
| 580 | 3300048918 | Ga0496115_0242729 | Ga0496115_0242729_154_1425 | 416 |
| 581 | 3300049592 | Ga0501076_0010510 | Ga0501076_0010510_1923_3197 | 416 |
| 582 | 3300050507 | nmdc:mga05p37_24611_c1 | nmdc:mga05p37_24611_c1_2549_3820 | 416 |
| 583 | 3300050507 | nmdc:mga05p37_54085_c1 | nmdc:mga05p37_54085_c1_660_1931 | 416 |
| 584 | 3300050508 | nmdc:mga09592_1606_c1 | nmdc:mga09592_1606_c1_1146_2417 | 416 |
| 585 | 3300050509 | nmdc:mga0qj67_885_c1 | nmdc:mga0qj67_885_c1_1949_3220 | 416 |
| 586 | iso_pu_bacteria | 2508501128 | 2509152283 | 416 |
| 587 | iso_pu_bacteria | 2513237141 | 2513892563 | 416 |
| 588 | iso_pu_bacteria | 2721755755 | 2723843502 | 416 |
| 589 | iso_pu_bacteria | 2791355199 | 2793083970 | 416 |
| 590 | 3300003215 | JGI25153J46596_10005866 | JGI25153J46596_100058668 | 417 |
| 591 | 3300005983 | Ga0081540_1008941 | Ga0081540_10089415 | 417 |
| 592 | 3300006038 | Ga0075365_10096957 | Ga0075365_100969572 | 417 |
| 593 | 3300006175 | Ga0070712_100038780 | Ga0070712_1000387802 | 417 |
| 594 | 3300014325 | Ga0163163_10135612 | Ga0163163_101356123 | 417 |
| 595 | 3300025906 | Ga0207699_10014207 | Ga0207699_100142075 | 417 |
| 596 | 3300025915 | Ga0207693_10002637 | Ga0207693_100026374 | 417 |
| 597 | 3300025916 | Ga0207663_10062817 | Ga0207663_100628173 | 417 |
| 598 | 3300026067 | Ga0207678_10035164 | Ga0207678_100351645 | 417 |
| 599 | 3300028379 | Ga0268266_10007625 | Ga0268266_100076257 | 417 |
| 600 | 3300039437 | Ga0436365_1571642 | Ga0436365_1571642_14_1285 | 417 |
| 601 | 3300039450 | Ga0436363_0621011 | Ga0436363_0621011_848_2119 | 417 |
| 602 | 3300048907 | Ga0496104_0209150 | Ga0496104_0209150_472_1746 | 417 |
| 603 | 3300048929 | Ga0496126_0073717 | Ga0496126_0073717_1124_2398 | 417 |
| 604 | 3300005262 | Ga0065165_1004585 | Ga0065165_10045856 | 418 |
| 605 | 3300005329 | Ga0070683_100244080 | Ga0070683_1002440802 | 418 |
| 606 | 3300005340 | Ga0070689_100056909 | Ga0070689_1000569091 | 418 |
| 607 | 3300005434 | Ga0070709_10002197 | Ga0070709_100021977 | 418 |
| 608 | 3300005434 | Ga0070709_10010839 | Ga0070709_100108394 | 418 |
| 609 | 3300005436 | Ga0070713_100115088 | Ga0070713_1001150882 | 418 |
| 610 | 3300005436 | Ga0070713_100166983 | Ga0070713_1001669833 | 418 |
| 611 | 3300005437 | Ga0070710_10000678 | Ga0070710_100006784 | 418 |
| 612 | 3300005437 | Ga0070710_10003896 | Ga0070710_100038965 | 418 |
| 613 | 3300005439 | Ga0070711_100000465 | Ga0070711_1000004653 | 418 |
| 614 | 3300005439 | Ga0070711_100087288 | Ga0070711_1000872882 | 418 |
| 615 | 3300005563 | Ga0068855_100306921 | Ga0068855_1003069212 | 418 |
| 616 | 3300005616 | Ga0068852_100038198 | Ga0068852_1000381986 | 418 |
| 617 | 3300005718 | Ga0068866_10087823 | Ga0068866_100878232 | 418 |
| 618 | 3300005985 | Ga0081539_10055131 | Ga0081539_100551312 | 418 |
| 619 | 3300006028 | Ga0070717_10134682 | Ga0070717_101346822 | 418 |
| 620 | 3300006038 | Ga0075365_10038742 | Ga0075365_100387423 | 418 |
| 621 | 3300006175 | Ga0070712_100022680 | Ga0070712_1000226806 | 418 |
| 622 | 3300006237 | Ga0097621_100094887 | Ga0097621_1000948872 | 418 |
| 623 | 3300006844 | Ga0075428_100269582 | Ga0075428_1002695822 | 418 |
| 624 | 3300006871 | Ga0075434_100260056 | Ga0075434_1002600562 | 418 |
| 625 | 3300006942 | Ga0099824_1011502 | Ga0099824_10115025 | 418 |
| 626 | 3300009098 | Ga0105245_10048961 | Ga0105245_100489612 | 418 |
| 627 | 3300009174 | Ga0105241_10029756 | Ga0105241_100297565 | 418 |
| 628 | 3300009545 | Ga0105237_10228750 | Ga0105237_102287501 | 418 |
| 629 | 3300009545 | Ga0105237_10380401 | Ga0105237_103804011 | 418 |
| 630 | 3300013296 | Ga0157374_10129211 | Ga0157374_101292112 | 418 |
| 631 | 3300013297 | Ga0157378_10038833 | Ga0157378_100388332 | 418 |
| 632 | 3300014968 | Ga0157379_10136897 | Ga0157379_101368972 | 418 |
| 633 | 3300025230 | Ga0209563_100325 | Ga0209563_1003252 | 418 |
| 634 | 3300025302 | Ga0207426_1000328 | Ga0207426_10003285 | 418 |
| 635 | 3300025898 | Ga0207692_10000797 | Ga0207692_100007976 | 418 |
| 636 | 3300025898 | Ga0207692_10006627 | Ga0207692_100066275 | 418 |
| 637 | 3300025905 | Ga0207685_10002427 | Ga0207685_100024272 | 418 |
| 638 | 3300025906 | Ga0207699_10001610 | Ga0207699_100016107 | 418 |
| 639 | 3300025908 | Ga0207643_10058265 | Ga0207643_100582652 | 418 |
| 640 | 3300025911 | Ga0207654_10120122 | Ga0207654_101201222 | 418 |
| 641 | 3300025912 | Ga0207707_10141869 | Ga0207707_101418692 | 418 |
| 642 | 3300025915 | Ga0207693_10034047 | Ga0207693_100340476 | 418 |
| 643 | 3300025916 | Ga0207663_10021217 | Ga0207663_100212172 | 418 |
| 644 | 3300025916 | Ga0207663_10065540 | Ga0207663_100655402 | 418 |
| 645 | 3300025921 | Ga0207652_10178835 | Ga0207652_101788352 | 418 |
| 646 | 3300025927 | Ga0207687_10053608 | Ga0207687_100536084 | 418 |
| 647 | 3300025928 | Ga0207700_10041345 | Ga0207700_100413452 | 418 |
| 648 | 3300025942 | Ga0207689_10036827 | Ga0207689_100368276 | 418 |
| 649 | 3300025944 | Ga0207661_10018951 | Ga0207661_100189515 | 418 |
| 650 | 3300025944 | Ga0207661_10083044 | Ga0207661_100830442 | 418 |
| 651 | 3300025972 | Ga0207668_10186534 | Ga0207668_101865342 | 418 |
| 652 | 3300026035 | Ga0207703_10045836 | Ga0207703_100458362 | 418 |
| 653 | 3300026041 | Ga0207639_10034032 | Ga0207639_100340325 | 418 |
| 654 | 3300026067 | Ga0207678_10033211 | Ga0207678_100332117 | 418 |
| 655 | 3300026121 | Ga0207683_10091282 | Ga0207683_100912822 | 418 |
| 656 | 3300027296 | Ga0209389_1000043 | Ga0209389_100004316 | 418 |
| 657 | 3300027296 | Ga0209389_1000077 | Ga0209389_100007782 | 418 |
| 658 | 3300027357 | Ga0209589_1000047 | Ga0209589_100004795 | 418 |
| 659 | 3300027361 | Ga0209489_100075 | Ga0209489_100075127 | 418 |
| 660 | 3300027361 | Ga0209489_100251 | Ga0209489_10025182 | 418 |
| 661 | 3300027363 | Ga0209700_100271 | Ga0209700_10027182 | 418 |
| 662 | 3300028379 | Ga0268266_10234117 | Ga0268266_102341172 | 418 |
| 663 | 3300035115 | Ga0373941_0005728 | Ga0373941_0005728_1503_2777 | 418 |
| 664 | 3300035121 | Ga0373960_0014063 | Ga0373960_0014063_343_1617 | 418 |
| 665 | 3300036401 | Ga0373937_0216891 | Ga0373937_0216891_358_1635 | 418 |
| 666 | 3300037471 | Ga0395905_0084980 | Ga0395905_0084980_667_1938 | 418 |
| 667 | 3300044683 | Ga0466965_0068555 | Ga0466965_0068555_467_1738 | 418 |
| 668 | 3300044901 | Ga0466960_0006472 | Ga0466960_0006472_2539_3810 | 418 |
| 669 | 3300046477 | Ga0495664_0063064 | Ga0495664_0063064_647_1933 | 418 |
| 670 | 3300046533 | Ga0495640_0143197 | Ga0495640_0143197_221_1498 | 418 |
| 671 | 3300046679 | Ga0495623_0045020 | Ga0495623_0045020_645_1931 | 418 |
| 672 | 3300047317 | Ga0495604_0082749 | Ga0495604_0082749_86_1372 | 418 |
| 673 | 3300048905 | Ga0496102_0135445 | Ga0496102_0135445_217_1488 | 418 |
| 674 | 3300048907 | Ga0496104_0191109 | Ga0496104_0191109_352_1623 | 418 |
| 675 | 3300048909 | Ga0496106_0223856 | Ga0496106_0223856_107_1378 | 418 |
| 676 | 3300048915 | Ga0496112_0029131 | Ga0496112_0029131_3268_4638 | 418 |
| 677 | 3300048924 | Ga0496121_0152966 | Ga0496121_0152966_165_1436 | 418 |
| 678 | 3300048928 | Ga0496125_0071057 | Ga0496125_0071057_275_1552 | 418 |
| 679 | 3300049586 | Ga0501070_0119773 | Ga0501070_0119773_856_2127 | 418 |
| 680 | 3300049823 | Ga0501044_0049412 | Ga0501044_0049412_169_1440 | 418 |
| 681 | 3300053084 | Ga0495595_0033994 | Ga0495595_0033994_211_1488 | 418 |
| 682 | 3300053086 | Ga0500578_0110590 | Ga0500578_0110590_13_1284 | 418 |
| 683 | 3300003659 | JGI25404J52841_10006155 | JGI25404J52841_100061551 | 419 |
| 684 | 3300004625 | Ga0055543_1009959 | Ga0055543_10099592 | 419 |
| 685 | 3300005262 | Ga0065165_1000747 | Ga0065165_100074720 | 419 |
| 686 | 3300005336 | Ga0070680_100093332 | Ga0070680_1000933322 | 419 |
| 687 | 3300005344 | Ga0070661_100069576 | Ga0070661_1000695763 | 419 |
| 688 | 3300005456 | Ga0070678_100064623 | Ga0070678_1000646233 | 419 |
| 689 | 3300005458 | Ga0070681_10103984 | Ga0070681_101039842 | 419 |
| 690 | 3300005548 | Ga0070665_100023384 | Ga0070665_1000233848 | 419 |
| 691 | 3300005563 | Ga0068855_100210946 | Ga0068855_1002109462 | 419 |
| 692 | 3300005564 | Ga0070664_100165643 | Ga0070664_1001656432 | 419 |
| 693 | 3300005614 | Ga0068856_100172420 | Ga0068856_1001724203 | 419 |
| 694 | 3300005614 | Ga0068856_100268782 | Ga0068856_1002687822 | 419 |
| 695 | 3300005937 | Ga0081455_10005955 | Ga0081455_1000595510 | 419 |
| 696 | 3300005983 | Ga0081540_1003418 | Ga0081540_10034186 | 419 |
| 697 | 3300005983 | Ga0081540_1009558 | Ga0081540_10095582 | 419 |
| 698 | 3300005983 | Ga0081540_1021006 | Ga0081540_10210066 | 419 |
| 699 | 3300005983 | Ga0081540_1021049 | Ga0081540_10210492 | 419 |
| 700 | 3300005983 | Ga0081540_1035588 | Ga0081540_10355882 | 419 |
| 701 | 3300005985 | Ga0081539_10000220 | Ga0081539_1000022060 | 419 |
| 702 | 3300006237 | Ga0097621_100112416 | Ga0097621_1001124162 | 419 |
| 703 | 3300009093 | Ga0105240_10021941 | Ga0105240_100219414 | 419 |
| 704 | 3300009093 | Ga0105240_10024721 | Ga0105240_100247216 | 419 |
| 705 | 3300009545 | Ga0105237_10031207 | Ga0105237_100312074 | 419 |
| 706 | 3300010375 | Ga0105239_10150755 | Ga0105239_101507553 | 419 |
| 707 | 3300013104 | Ga0157370_10053036 | Ga0157370_100530362 | 419 |
| 708 | 3300013296 | Ga0157374_10024785 | Ga0157374_100247852 | 419 |
| 709 | 3300013306 | Ga0163162_10060239 | Ga0163162_100602395 | 419 |
| 710 | 3300013308 | Ga0157375_10128467 | Ga0157375_101284672 | 419 |
| 711 | 3300014325 | Ga0163163_10060452 | Ga0163163_100604526 | 419 |
| 712 | 3300014969 | Ga0157376_10050368 | Ga0157376_100503682 | 419 |
| 713 | 3300025261 | Ga0209233_1008563 | Ga0209233_10085634 | 419 |
| 714 | 3300025912 | Ga0207707_10117125 | Ga0207707_101171252 | 419 |
| 715 | 3300025913 | Ga0207695_10000163 | Ga0207695_100001636 | 419 |
| 716 | 3300025915 | Ga0207693_10014584 | Ga0207693_100145842 | 419 |
| 717 | 3300025917 | Ga0207660_10022287 | Ga0207660_100222872 | 419 |
| 718 | 3300025920 | Ga0207649_10040161 | Ga0207649_100401612 | 419 |
| 719 | 3300025927 | Ga0207687_10117944 | Ga0207687_101179442 | 419 |
| 720 | 3300025941 | Ga0207711_10018144 | Ga0207711_100181447 | 419 |
| 721 | 3300025949 | Ga0207667_10019974 | Ga0207667_100199744 | 419 |
| 722 | 3300026121 | Ga0207683_10003797 | Ga0207683_100037973 | 419 |
| 723 | 3300026142 | Ga0207698_10060190 | Ga0207698_100601902 | 419 |
| 724 | 3300028794 | Ga0307515_10152056 | Ga0307515_101520562 | 419 |
| 725 | 3300035084 | Ga0373928_0004389 | Ga0373928_0004389_551_1840 | 419 |
| 726 | 3300035113 | Ga0373936_0003178 | Ga0373936_0003178_4183_5457 | 419 |
| 727 | 3300035117 | Ga0373953_0003406 | Ga0373953_0003406_612_1886 | 419 |
| 728 | 3300035118 | Ga0373954_0068936 | Ga0373954_0068936_70_1344 | 419 |
| 729 | 3300035119 | Ga0373956_0007041 | Ga0373956_0007041_1335_2696 | 419 |
| 730 | 3300035120 | Ga0373957_0020281 | Ga0373957_0020281_34_1308 | 419 |
| 731 | 3300035170 | Ga0373943_0000795 | Ga0373943_0000795_12132_13406 | 419 |
| 732 | 3300035691 | Ga0373931_0006081 | Ga0373931_0006081_671_1951 | 419 |
| 733 | 3300035692 | Ga0373935_0000536 | Ga0373935_0000536_6482_7756 | 419 |
| 734 | 3300035692 | Ga0373935_0017022 | Ga0373935_0017022_1547_2908 | 419 |
| 735 | 3300035695 | Ga0373927_0000898 | Ga0373927_0000898_8184_9458 | 419 |
| 736 | 3300035724 | Ga0373933_0056140 | Ga0373933_0056140_379_1653 | 419 |
| 737 | 3300035725 | Ga0373947_0010479 | Ga0373947_0010479_3664_4938 | 419 |
| 738 | 3300036401 | Ga0373937_0054540 | Ga0373937_0054540_2105_3379 | 419 |
| 739 | 3300037068 | Ga0373925_0001796 | Ga0373925_0001796_2337_3611 | 419 |
| 740 | 3300037068 | Ga0373925_0227748 | Ga0373925_0227748_195_1469 | 419 |
| 741 | 3300045976 | Ga0466967_0249181 | Ga0466967_0249181_93_1373 | 419 |
| 742 | 3300046454 | Ga0495592_0008855 | Ga0495592_0008855_4877_6238 | 419 |
| 743 | 3300046454 | Ga0495592_0029907 | Ga0495592_0029907_1452_2726 | 419 |
| 744 | 3300046455 | Ga0495603_0000046 | Ga0495603_0000046_44122_45396 | 419 |
| 745 | 3300046459 | Ga0495629_0000071 | Ga0495629_0000071_25293_26567 | 419 |
| 746 | 3300046461 | Ga0495641_0009896 | Ga0495641_0009896_563_1837 | 419 |
| 747 | 3300046472 | Ga0495580_0000057 | Ga0495580_0000057_36335_37609 | 419 |
| 748 | 3300046473 | Ga0495582_0000111 | Ga0495582_0000111_14594_15868 | 419 |
| 749 | 3300046475 | Ga0495639_0000108 | Ga0495639_0000108_16806_18080 | 419 |
| 750 | 3300046476 | Ga0495662_0000992 | Ga0495662_0000992_2353_3627 | 419 |
| 751 | 3300046477 | Ga0495664_0002718 | Ga0495664_0002718_2616_3890 | 419 |
| 752 | 3300046477 | Ga0495664_0007884 | Ga0495664_0007884_2640_4001 | 419 |
| 753 | 3300046477 | Ga0495664_0030650 | Ga0495664_0030650_785_2059 | 419 |
| 754 | 3300046499 | Ga0495594_0000133 | Ga0495594_0000133_11825_13099 | 419 |
| 755 | 3300046507 | Ga0495606_0080559 | Ga0495606_0080559_161_1441 | 419 |
| 756 | 3300046507 | Ga0495606_0138832 | Ga0495606_0138832_45_1319 | 419 |
| 757 | 3300046517 | Ga0495630_0000959 | Ga0495630_0000959_7044_8318 | 419 |
| 758 | 3300046526 | Ga0495666_0005822 | Ga0495666_0005822_1240_2601 | 419 |
| 759 | 3300046526 | Ga0495666_0032607 | Ga0495666_0032607_456_1730 | 419 |
| 760 | 3300046529 | Ga0495652_0042099 | Ga0495652_0042099_2455_3729 | 419 |
| 761 | 3300046531 | Ga0495665_0000001 | Ga0495665_0000001_53713_54987 | 419 |
| 762 | 3300046533 | Ga0495640_0012179 | Ga0495640_0012179_1000_2274 | 419 |
| 763 | 3300046557 | Ga0495622_0001363 | Ga0495622_0001363_10246_11520 | 419 |
| 764 | 3300046558 | Ga0495633_0041177 | Ga0495633_0041177_489_1850 | 419 |
| 765 | 3300046559 | Ga0495667_0032071 | Ga0495667_0032071_2145_3419 | 419 |
| 766 | 3300046642 | Ga0495634_0000046 | Ga0495634_0000046_26835_28109 | 419 |
| 767 | 3300046663 | Ga0495635_0000338 | Ga0495635_0000338_23709_24983 | 419 |
| 768 | 3300046674 | Ga0495588_0001464 | Ga0495588_0001464_6178_7452 | 419 |
| 769 | 3300046678 | Ga0495599_0007149 | Ga0495599_0007149_1222_2583 | 419 |
| 770 | 3300046678 | Ga0495599_0124670 | Ga0495599_0124670_311_1585 | 419 |
| 771 | 3300046680 | Ga0495646_0007433 | Ga0495646_0007433_3272_4633 | 419 |
| 772 | 3300046680 | Ga0495646_0008580 | Ga0495646_0008580_4170_5444 | 419 |
| 773 | 3300046681 | Ga0495647_0000754 | Ga0495647_0000754_3602_4876 | 419 |
| 774 | 3300046683 | Ga0495658_0000994 | Ga0495658_0000994_4469_5743 | 419 |
| 775 | 3300046689 | Ga0495613_0005517 | Ga0495613_0005517_1128_2402 | 419 |
| 776 | 3300046690 | Ga0495624_0003652 | Ga0495624_0003652_6345_7619 | 419 |
| 777 | 3300046690 | Ga0495624_0050265 | Ga0495624_0050265_860_2221 | 419 |
| 778 | 3300046691 | Ga0495670_0004308 | Ga0495670_0004308_1508_2869 | 419 |
| 779 | 3300047315 | Ga0495581_0000012 | Ga0495581_0000012_18380_19654 | 419 |
| 780 | 3300047315 | Ga0495581_0019391 | Ga0495581_0019391_1859_3133 | 419 |
| 781 | 3300047317 | Ga0495604_0009096 | Ga0495604_0009096_1760_3121 | 419 |
| 782 | 3300047319 | Ga0495674_0000031 | Ga0495674_0000031_21320_22594 | 419 |
| 783 | 3300047471 | Ga0495684_0087681 | Ga0495684_0087681_432_1706 | 419 |
| 784 | 3300047673 | Ga0495593_0000008 | Ga0495593_0000008_33310_34584 | 419 |
| 785 | 3300047673 | Ga0495593_0089256 | Ga0495593_0089256_216_1577 | 419 |
| 786 | 3300048903 | Ga0496100_0048201 | Ga0496100_0048201_923_2203 | 419 |
| 787 | 3300048903 | Ga0496100_0057600 | Ga0496100_0057600_680_1969 | 419 |
| 788 | 3300048904 | Ga0496101_0006365 | Ga0496101_0006365_4338_5618 | 419 |
| 789 | 3300048905 | Ga0496102_0003595 | Ga0496102_0003595_6427_7707 | 419 |
| 790 | 3300048906 | Ga0496103_0013766 | Ga0496103_0013766_1594_2874 | 419 |
| 791 | 3300048907 | Ga0496104_0091600 | Ga0496104_0091600_1243_2523 | 419 |
| 792 | 3300048907 | Ga0496104_0105275 | Ga0496104_0105275_1386_2666 | 419 |
| 793 | 3300048908 | Ga0496105_0019331 | Ga0496105_0019331_3338_4618 | 419 |
| 794 | 3300048910 | Ga0496107_0000947 | Ga0496107_0000947_6920_8200 | 419 |
| 795 | 3300048911 | Ga0496108_0013705 | Ga0496108_0013705_3943_5223 | 419 |
| 796 | 3300048912 | Ga0496109_0008951 | Ga0496109_0008951_4217_5497 | 419 |
| 797 | 3300048912 | Ga0496109_0048452 | Ga0496109_0048452_1330_2619 | 419 |
| 798 | 3300048913 | Ga0496110_0126144 | Ga0496110_0126144_636_1916 | 419 |
| 799 | 3300048915 | Ga0496112_0165206 | Ga0496112_0165206_153_1433 | 419 |
| 800 | 3300048916 | Ga0496113_0001327 | Ga0496113_0001327_5070_6350 | 419 |
| 801 | 3300048917 | Ga0496114_0024353 | Ga0496114_0024353_1489_2769 | 419 |
| 802 | 3300048918 | Ga0496115_0000604 | Ga0496115_0000604_6960_8240 | 419 |
| 803 | 3300048918 | Ga0496115_0071313 | Ga0496115_0071313_386_1660 | 419 |
| 804 | 3300048924 | Ga0496121_0020183 | Ga0496121_0020183_3535_4809 | 419 |
| 805 | 3300048928 | Ga0496125_0000048 | Ga0496125_0000048_155865_157142 | 419 |
| 806 | 3300048928 | Ga0496125_0000746 | Ga0496125_0000746_35837_37114 | 419 |
| 807 | 3300048929 | Ga0496126_0008677 | Ga0496126_0008677_2495_3769 | 419 |
| 808 | 3300050516 | nmdc:mga0sz30_50717_c1 | nmdc:mga0sz30_50717_c1_434_1708 | 419 |
| 809 | 3300053077 | Ga0495601_0067367 | Ga0495601_0067367_591_1952 | 419 |
| 810 | 3300053084 | Ga0495595_0027742 | Ga0495595_0027742_1035_2396 | 419 |
| 811 | 3300053085 | Ga0495619_0017972 | Ga0495619_0017972_1826_3100 | 419 |
| 812 | 3300053085 | Ga0495619_0062539 | Ga0495619_0062539_1054_2343 | 419 |
| 813 | 3300053094 | Ga0500566_0000293 | Ga0500566_0000293_15237_16511 | 419 |
| 814 | 3300053102 | Ga0500554_020862 | Ga0500554_020862_504_1778 | 419 |
| 815 | 3300053119 | Ga0500595_000395 | Ga0500595_000395_26689_27963 | 419 |
| 816 | 3300053119 | Ga0500595_003500 | Ga0500595_003500_706_1980 | 419 |
| 817 | 3300053162 | Ga0500638_000370 | Ga0500638_000370_8653_9927 | 419 |
| 818 | 3300053178 | Ga0500637_0000026 | Ga0500637_0000026_37491_38765 | 419 |
| 819 | 3300053178 | Ga0500637_0053059 | Ga0500637_0053059_430_1704 | 419 |
| 820 | 3300053729 | Ga0500625_015998 | Ga0500625_015998_1683_2957 | 419 |
| 821 | 3300055283 | Ga0500661_001127 | Ga0500661_001127_1457_2731 | 419 |
| 822 | 3300003203 | JGI25406J46586_10000138 | JGI25406J46586_100001382 | 420 |
| 823 | 3300003794 | Ga0055531_10008821 | Ga0055531_100088212 | 420 |
| 824 | 3300005262 | Ga0065165_1012243 | Ga0065165_10122432 | 420 |
| 825 | 3300005436 | Ga0070713_100014026 | Ga0070713_1000140263 | 420 |
| 826 | 3300005436 | Ga0070713_100026138 | Ga0070713_1000261382 | 420 |
| 827 | 3300005530 | Ga0070679_100100769 | Ga0070679_1001007694 | 420 |
| 828 | 3300005535 | Ga0070684_100007961 | Ga0070684_1000079616 | 420 |
| 829 | 3300005563 | Ga0068855_100112512 | Ga0068855_1001125122 | 420 |
| 830 | 3300005577 | Ga0068857_100037748 | Ga0068857_1000377485 | 420 |
| 831 | 3300005834 | Ga0068851_10009836 | Ga0068851_100098363 | 420 |
| 832 | 3300005842 | Ga0068858_100202761 | Ga0068858_1002027612 | 420 |
| 833 | 3300005843 | Ga0068860_100000360 | Ga0068860_10000036041 | 420 |
| 834 | 3300005985 | Ga0081539_10000008 | Ga0081539_1000000870 | 420 |
| 835 | 3300006186 | Ga0075369_10005844 | Ga0075369_100058443 | 420 |
| 836 | 3300006353 | Ga0075370_10038846 | Ga0075370_100388462 | 420 |
| 837 | 3300007788 | Ga0099795_10037437 | Ga0099795_100374372 | 420 |
| 838 | 3300009093 | Ga0105240_10192740 | Ga0105240_101927402 | 420 |
| 839 | 3300009098 | Ga0105245_10081675 | Ga0105245_100816753 | 420 |
| 840 | 3300009545 | Ga0105237_10009950 | Ga0105237_100099506 | 420 |
| 841 | 3300009551 | Ga0105238_10014750 | Ga0105238_100147502 | 420 |
| 842 | 3300010375 | Ga0105239_10084742 | Ga0105239_100847422 | 420 |
| 843 | 3300013105 | Ga0157369_10012423 | Ga0157369_100124237 | 420 |
| 844 | 3300021361 | Ga0213872_10040411 | Ga0213872_100404113 | 420 |
| 845 | 3300021384 | Ga0213876_10003579 | Ga0213876_100035792 | 420 |
| 846 | 3300021388 | Ga0213875_10062030 | Ga0213875_100620301 | 420 |
| 847 | 3300025253 | Ga0209677_102245 | Ga0209677_1022455 | 420 |
| 848 | 3300025272 | Ga0209455_1002923 | Ga0209455_10029234 | 420 |
| 849 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011535 | 420 |
| 850 | 3300025297 | Ga0209758_1001848 | Ga0209758_100184812 | 420 |
| 851 | 3300025302 | Ga0207426_1000458 | Ga0207426_100045817 | 420 |
| 852 | 3300025302 | Ga0207426_1019068 | Ga0207426_10190682 | 420 |
| 853 | 3300025304 | Ga0209257_1001101 | Ga0209257_100110111 | 420 |
| 854 | 3300025912 | Ga0207707_10000886 | Ga0207707_1000088619 | 420 |
| 855 | 3300025912 | Ga0207707_10023656 | Ga0207707_100236564 | 420 |
| 856 | 3300025912 | Ga0207707_10235770 | Ga0207707_102357702 | 420 |
| 857 | 3300025917 | Ga0207660_10010388 | Ga0207660_100103884 | 420 |
| 858 | 3300025919 | Ga0207657_10008437 | Ga0207657_100084379 | 420 |
| 859 | 3300025921 | Ga0207652_10019601 | Ga0207652_100196014 | 420 |
| 860 | 3300025924 | Ga0207694_10071234 | Ga0207694_100712344 | 420 |
| 861 | 3300025928 | Ga0207700_10007466 | Ga0207700_100074665 | 420 |
| 862 | 3300025928 | Ga0207700_10158000 | Ga0207700_101580001 | 420 |
| 863 | 3300026116 | Ga0207674_10007720 | Ga0207674_100077208 | 420 |
| 864 | 3300027512 | Ga0209179_1001680 | Ga0209179_10016803 | 420 |
| 865 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030242 | 420 |
| 866 | 3300031235 | Ga0265330_10006697 | Ga0265330_100066978 | 420 |
| 867 | 3300031247 | Ga0265340_10025159 | Ga0265340_100251592 | 420 |
| 868 | 3300031249 | Ga0265339_10020885 | Ga0265339_100208854 | 420 |
| 869 | 3300031507 | Ga0307509_10204543 | Ga0307509_102045432 | 420 |
| 870 | 3300031616 | Ga0307508_10003532 | Ga0307508_100035329 | 420 |
| 871 | 3300031616 | Ga0307508_10140808 | Ga0307508_101408082 | 420 |
| 872 | 3300031711 | Ga0265314_10014967 | Ga0265314_100149675 | 420 |
| 873 | 3300031712 | Ga0265342_10009847 | Ga0265342_100098474 | 420 |
| 874 | 3300031730 | Ga0307516_10097075 | Ga0307516_100970754 | 420 |
| 875 | 3300033179 | Ga0307507_10043063 | Ga0307507_100430632 | 420 |
| 876 | 3300037068 | Ga0373925_0166865 | Ga0373925_0166865_336_1613 | 420 |
| 877 | 3300037853 | Ga0436364_0356418 | Ga0436364_0356418_194_1477 | 420 |
| 878 | 3300039437 | Ga0436365_1236739 | Ga0436365_1236739_20472_21749 | 420 |
| 879 | 3300039447 | Ga0436361_0535015 | Ga0436361_0535015_527_1813 | 420 |
| 880 | 3300039447 | Ga0436361_0632240 | Ga0436361_0632240_2100_3383 | 420 |
| 881 | 3300039453 | Ga0436362_0652931 | Ga0436362_0652931_2106_3383 | 420 |
| 882 | 3300044735 | Ga0466968_0010560 | Ga0466968_0010560_220_1503 | 420 |
| 883 | 3300045049 | Ga0466959_0033466 | Ga0466959_0033466_2212_3498 | 420 |
| 884 | 3300045049 | Ga0466959_0154985 | Ga0466959_0154985_260_1543 | 420 |
| 885 | 3300045976 | Ga0466967_0295043 | Ga0466967_0295043_158_1465 | 420 |
| 886 | 3300046454 | Ga0495592_0011606 | Ga0495592_0011606_911_2194 | 420 |
| 887 | 3300046476 | Ga0495662_0020305 | Ga0495662_0020305_778_2097 | 420 |
| 888 | 3300046516 | Ga0495628_0012530 | Ga0495628_0012530_5622_6905 | 420 |
| 889 | 3300046524 | Ga0495648_0046019 | Ga0495648_0046019_1239_2522 | 420 |
| 890 | 3300046533 | Ga0495640_0023983 | Ga0495640_0023983_1766_3052 | 420 |
| 891 | 3300046533 | Ga0495640_0028223 | Ga0495640_0028223_1424_2707 | 420 |
| 892 | 3300046543 | Ga0495645_0009374 | Ga0495645_0009374_5441_6724 | 420 |
| 893 | 3300046559 | Ga0495667_0006892 | Ga0495667_0006892_5036_6319 | 420 |
| 894 | 3300046642 | Ga0495634_0076372 | Ga0495634_0076372_84_1367 | 420 |
| 895 | 3300046663 | Ga0495635_0051638 | Ga0495635_0051638_361_1644 | 420 |
| 896 | 3300046675 | Ga0495657_0054792 | Ga0495657_0054792_30_1316 | 420 |
| 897 | 3300047317 | Ga0495604_0004988 | Ga0495604_0004988_8075_9358 | 420 |
| 898 | 3300047319 | Ga0495674_0042923 | Ga0495674_0042923_1289_2572 | 420 |
| 899 | 3300047471 | Ga0495684_0010711 | Ga0495684_0010711_390_1676 | 420 |
| 900 | 3300047471 | Ga0495684_0106060 | Ga0495684_0106060_260_1543 | 420 |
| 901 | 3300048088 | Ga0495602_0011752 | Ga0495602_0011752_1154_2437 | 420 |
| 902 | 3300048915 | Ga0496112_0030083 | Ga0496112_0030083_3701_4984 | 420 |
| 903 | 3300048920 | Ga0496117_0010071 | Ga0496117_0010071_1422_2747 | 420 |
| 904 | 3300048921 | Ga0496118_0008611 | Ga0496118_0008611_819_2144 | 420 |
| 905 | 3300048921 | Ga0496118_0009891 | Ga0496118_0009891_5734_7017 | 420 |
| 906 | 3300048922 | Ga0496119_0072328 | Ga0496119_0072328_67_1350 | 420 |
| 907 | 3300048924 | Ga0496121_0002635 | Ga0496121_0002635_19353_20678 | 420 |
| 908 | 3300048924 | Ga0496121_0048593 | Ga0496121_0048593_174_1457 | 420 |
| 909 | 3300048927 | Ga0496124_0011581 | Ga0496124_0011581_2261_3586 | 420 |
| 910 | 3300048929 | Ga0496126_0022113 | Ga0496126_0022113_3046_4329 | 420 |
| 911 | 3300053111 | Ga0500572_001006 | Ga0500572_001006_419_1702 | 420 |
| 912 | 3300053136 | Ga0500559_0001342 | Ga0500559_0001342_12816_14099 | 420 |
| 913 | 3300053163 | Ga0500639_004522 | Ga0500639_004522_5343_6626 | 420 |
| 914 | 3300053177 | Ga0500636_0037290 | Ga0500636_0037290_328_1611 | 420 |
| 915 | 3300053735 | Ga0500596_004947 | Ga0500596_004947_386_1669 | 420 |
| 916 | iso_pu_bacteria | 2932801729 | 2932808765 | 420 |
| 917 | iso_pu_bacteria | 2935883170 | 2935885695 | 420 |
| 918 | iso_pu_bacteria | 2935959822 | 2935962905 | 420 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF21706
FCSD_central
Sulfide dehydrogenase [flavocytochrome c] flavoprotein chain, central
156
271
0.97
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5n1t-assembly1.cif.gz_A | crystal structure of complex between flavocytochrome c and copper chaperone copc from t. paradoxus | 0.9615 | 34 | 420 |
| 1fcd-assembly2.cif.gz_B | the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution | 0.9552 | 33 | 420 |
| 3vrd-assembly1.cif.gz_B | crystal structure of flavocytochrome c from thermochromatium tepidum | 0.9534 | 35 | 420 |
| 5n1t-assembly1.cif.gz_A | crystal structure of complex between flavocytochrome c and copper chaperone copc from t. paradoxus | 0.9472 | 34 | 420 |
| 3vrd-assembly1.cif.gz_B | crystal structure of flavocytochrome c from thermochromatium tepidum | 0.9231 | 35 | 420 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q10062_1_488_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9615 | 36 | 67 | 3.50.50.60 |
| af_P40012_11_539_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9598 | 35 | 68 | 3.50.50.60 |
| 5n1tA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9517 | 149 | 282 | 3.50.50.60 |
| 5n1tA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9448 | 149 | 282 | 3.50.50.60 |
| 5n1tA03 | Alpha Beta;Alpha-Beta Complex;Flavocytochrome C Sulfide Dehydrogenase; Chain A Domain 3;Flavocytochrome c sulphide dehydrogenase, flavin-binding domain | 0.9408 | 350 | 420 | 3.90.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C1WBB1-F1-model_v4 | NAD(P)/FAD-dependent oxidoreductase | 0.9632 | 36 | 375 |
GO:0016491
GO:0050660 |
| AF-A0A3M0YCT5-F1-model_v4 | Cytochrome C | 0.9623 | 33 | 420 |
GO:0016491
GO:0050660 |
| AF-A0A5C7T8X0-F1-model_v4 | Cytochrome C | 0.9611 | 85 | 420 |
GO:0016491
GO:0050660 |
| AF-A0A537TJZ6-F1-model_v4 | NAD(P)/FAD-dependent oxidoreductase | 0.96 | 26 | 231 |
GO:0016491
|
| AF-A0A661C3F5-F1-model_v4 | Cytochrome C | 0.9578 | 40 | 420 |
GO:0016491
GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar