F485681

General Info

Members Datasets Scaffolds Average Seq Length
918 576 713 418

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2885312484|2885315494
Length 417
Sequence RTLIGGAAASVAAAVLAAPQVRAQAQPRVVVVGGGFAGASCARALKQLDRGLAVTLIEPETAYLACPFSNAVLAGLRGIEAQTFGYGRFGDIGLIRRRAAAVDAERRRVRLEDGTEIGYTRLVLAPGVDLRFDALPGYDQAAAEIMPHAWKAGPQTLLLRDQLAAMPDGGVVILAAPANPFRCPPGPYERASLIAHYLKTSKPRSKLIILDAKDAFSKQRLFEAAWRELYPGLIEWVPLSSGGRVTEVDPATTTLVTEFGSHKADVANVIPPQRAGRIAQAAGVADQTGWCPIDPVTFESRLQPAIHVVGDAAIGGAMPKSAFSANAQAKACAAAVAALVRGRQPAPPKLINTCYSLVAPGYGISIAGVYQPRDGLLAEVEGAGGTSPLEAPPSVRELEAAYAQDWFRTITSEVFGV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
21 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
22 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
23 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
24 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
25 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
26 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
27 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
28 2791355199
29 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
30 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
31 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
34 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
35 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
36 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
37 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
38 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
39 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
40 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
41 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
42 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
43 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
44 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
45 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
46 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
47 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
48 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
49 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
50 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
51 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
52 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
53 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
54 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
55 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
56 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
57 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
58 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
59 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
60 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
61 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
62 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
63 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
64 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
65 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
66 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
67 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
68 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
69 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
70 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
71 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
72 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
73 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
74 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
75 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
76 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
77 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
78 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
79 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
80 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
81 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
82 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
83 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
84 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
85 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
86 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
87 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
88 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
89 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
90 2906610324
91 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
92 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
93 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
94 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
95 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
96 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
97 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
98 2922425934
99 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
100 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
101 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
102 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
103 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
104 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
105 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
106 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
107 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
108 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
109 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
110 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
111 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
112 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
113 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
114 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
115 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
116 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
117 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
118 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
119 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
120 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
121 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
122 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
123 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
124 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
125 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
126 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
127 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
128 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
129 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
130 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
131 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
132 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
133 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
134 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
135 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
136 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
137 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
138 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
139 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
140 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
141 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
142 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
143 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
144 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
145 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
146 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
147 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
148 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
149 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
150 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
151 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
152 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
153 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
154 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
155 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
156 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
157 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
158 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
159 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
160 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
161 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
162 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
163 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
164 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
165 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
166 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
167 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
168 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
169 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
170 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
171 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
172 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
173 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
174 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
175 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
176 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
177 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
178 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
179 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
180 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
181 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
182 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
183 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
184 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
185 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
186 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
187 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
188 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
189 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
190 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
191 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
192 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
193 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
194 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
195 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
196 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
197 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
198 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
199 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
200 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
201 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
202 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
203 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
204 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
205 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
206 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
207 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
208 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
209 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
210 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
211 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
212 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
213 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
214 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
215 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
216 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
217 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
218 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
219 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
220 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
221 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
222 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
223 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
224 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
225 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
226 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
227 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
228 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
229 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
230 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
231 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
232 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
233 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
234 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
235 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
236 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
237 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
238 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
239 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
240 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
241 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
242 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
243 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
244 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
245 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
246 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
247 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
248 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
249 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
250 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
251 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
252 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
253 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
254 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
255 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
256 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
257 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
258 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
259 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
260 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
261 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
262 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
263 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
264 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
265 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
266 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
267 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
268 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
269 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
270 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
271 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
272 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
273 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
277 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
279 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
280 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
330 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
331 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
332 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
333 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
335 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
339 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
340 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
341 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
342 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
343 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
344 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
345 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
346 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
347 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
348 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
349 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
350 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
351 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
352 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
353 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
354 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
355 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
356 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
357 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
358 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
359 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
360 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
361 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
362 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
363 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
364 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
365 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
366 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
367 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
368 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
369 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
370 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
371 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
372 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
373 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
374 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
375 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
376 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
377 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
378 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
379 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
380 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
381 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
382 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
383 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
384 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
385 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
386 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
387 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
388 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
389 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
390 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
391 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
392 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
393 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
394 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
395 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
396 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
397 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
398 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
399 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
400 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
401 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
402 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
403 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
404 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
405 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
406 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
407 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
408 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
409 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
410 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
411 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
412 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
413 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
414 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
415 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
416 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
417 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
418 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
419 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
420 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
421 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
422 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
423 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
424 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
425 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
426 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
427 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
428 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
429 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
430 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
431 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
432 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
433 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
434 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
435 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
436 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
437 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
438 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
439 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
440 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
441 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
442 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
443 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
444 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
445 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
446 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
447 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
448 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
449 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
450 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
451 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
452 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
453 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
454 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
455 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
456 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
457 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
458 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
459 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
460 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
461 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
462 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
463 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
464 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
465 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
466 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
467 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
468 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
469 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
470 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
471 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
472 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
473 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
474 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
475 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
476 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
477 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
479 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
480 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
483 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
486 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
487 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
488 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
489 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
490 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
491 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
492 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
493 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
494 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
495 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
496 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
497 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
498 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
499 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
500 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
501 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
502 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
503 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
504 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
505 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
506 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
507 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
508 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
509 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
510 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
511 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
512 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
513 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
514 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
515 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
516 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
517 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
518 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
519 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
520 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
521 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
522 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
523 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
524 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
525 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
526 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
527 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
528 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
529 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
530 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
531 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
532 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
533 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
534 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
535 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
536 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
537 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
538 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
539 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
540 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
541 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
542 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
543 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
544 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
545 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
546 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
547 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
548 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
549 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
550 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
551 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
552 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
553 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
554 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
555 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
556 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
557 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
558 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
559 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
560 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
561 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
562 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
563 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
564 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
565 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
566 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
567 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
568 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
569 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
570 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
571 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
572 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
573 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
574 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
575 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
576 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.92
Metatranscriptomes 0
Isolates 22.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.24
Nodule 18.63
Rhizoplane 6.32
Rhizosphere 54.9
Stem 0
Stem Tuber 0
Unclassified 9.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000138 3300003203 Bacteria 31765
2 JGI25153J46596_10000317 3300003215 Bacteria 35509
3 JGI25153J46596_10005866 3300003215 Bacteria 6357
4 rootL2_10158942 3300003322 Bacteria 2631
5 JGI25404J52841_10006155 3300003659 Bacteria 2500
6 Ga0055526_1025395 3300003771 Bacteria 1902
7 Ga0055531_10008821 3300003794 Bacteria 5250
8 Ga0055543_1009959 3300004625 Bacteria 2016
9 Ga0065165_1000747 3300005262 Bacteria 44635
10 Ga0065165_1004585 3300005262 Bacteria 8426
11 Ga0065165_1012243 3300005262 Bacteria 3507
12 Ga0070658_10123665 3300005327 Bacteria 2151
13 Ga0070683_100035975 3300005329 Bacteria 4529
14 Ga0070683_100244080 3300005329 Bacteria 1708
15 Ga0070680_100000841 3300005336 Bacteria 21741
16 Ga0070680_100053807 3300005336 Bacteria 3285
17 Ga0070680_100093332 3300005336 Bacteria 2494
18 Ga0070689_100056909 3300005340 Bacteria 3034
19 Ga0070661_100069576 3300005344 Bacteria 2588
20 Ga0070661_100148532 3300005344 Bacteria 1771
21 Ga0070688_100026113 3300005365 Bacteria 3467
22 Ga0070667_100111159 3300005367 Bacteria 2376
23 Ga0070667_100151855 3300005367 Bacteria 2035
24 Ga0070709_10002197 3300005434 Bacteria 10578
25 Ga0070709_10010839 3300005434 Bacteria 5059
26 Ga0070709_10026207 3300005434 Bacteria 3452
27 Ga0070713_100001462 3300005436 Bacteria 15088
28 Ga0070713_100014026 3300005436 Bacteria 5934
29 Ga0070713_100026138 3300005436 Bacteria 4578
30 Ga0070713_100052936 3300005436 Bacteria 3362
31 Ga0070713_100115088 3300005436 Bacteria 2350
32 Ga0070713_100166983 3300005436 Bacteria 1969
33 Ga0070710_10000678 3300005437 Bacteria 16149
34 Ga0070710_10003896 3300005437 Bacteria 7065
35 Ga0070710_10007682 3300005437 Bacteria 5229
36 Ga0070711_100000465 3300005439 Bacteria 21200
37 Ga0070711_100003772 3300005439 Bacteria 8886
38 Ga0070711_100087288 3300005439 Bacteria 2239
39 Ga0070708_100029298 3300005445 Bacteria 4746
40 Ga0070663_100034033 3300005455 Bacteria 3525
41 Ga0070678_100064623 3300005456 Bacteria 2713
42 Ga0070678_100162002 3300005456 Bacteria 1813
43 Ga0070662_100256264 3300005457 Bacteria 1408
44 Ga0070681_10009737 3300005458 Bacteria 9457
45 Ga0070681_10103984 3300005458 Bacteria 2783
46 Ga0070681_10147603 3300005458 Bacteria 2280
47 Ga0068867_100059990 3300005459 Bacteria 2821
48 Ga0070707_100022473 3300005468 Bacteria 5963
49 Ga0070698_100013803 3300005471 Bacteria 8546
50 Ga0070698_100080213 3300005471 Bacteria 3259
51 Ga0070698_100240368 3300005471 Bacteria 1744
52 Ga0070679_100003118 3300005530 Bacteria 15155
53 Ga0070679_100004998 3300005530 Bacteria 12236
54 Ga0070679_100100769 3300005530 Bacteria 2874
55 Ga0070679_100139466 3300005530 Bacteria 2405
56 Ga0070679_100228455 3300005530 Bacteria 1821
57 Ga0070684_100007961 3300005535 Bacteria 8272
58 Ga0070684_100009391 3300005535 Bacteria 7700
59 Ga0070697_100061449 3300005536 Bacteria 3064
60 Ga0070665_100023384 3300005548 Bacteria 6222
61 Ga0070665_100053413 3300005548 Bacteria 4052
62 Ga0070665_100073338 3300005548 Bacteria 3429
63 Ga0068855_100058768 3300005563 Bacteria 4501
64 Ga0068855_100112512 3300005563 Bacteria 3124
65 Ga0068855_100210946 3300005563 Bacteria 2182
66 Ga0068855_100306921 3300005563 Bacteria 1756
67 Ga0070664_100165643 3300005564 Bacteria 1958
68 Ga0068857_100037748 3300005577 Bacteria 4280
69 Ga0068857_100059974 3300005577 Bacteria 3380
70 Ga0068856_100079699 3300005614 Bacteria 3247
71 Ga0068856_100172420 3300005614 Bacteria 2176
72 Ga0068856_100268782 3300005614 Bacteria 1721
73 Ga0070702_100034040 3300005615 Bacteria 2806
74 Ga0068852_100038198 3300005616 Bacteria 4033
75 Ga0068859_100383909 3300005617 Bacteria 1500
76 Ga0068864_100049929 3300005618 Bacteria 3600
77 Ga0068866_10087823 3300005718 Bacteria 1686
78 Ga0068851_10009836 3300005834 Bacteria 4454
79 Ga0068863_100074750 3300005841 Bacteria 3206
80 Ga0068858_100031960 3300005842 Bacteria 4889
81 Ga0068858_100202761 3300005842 Bacteria 1876
82 Ga0068860_100000360 3300005843 Bacteria 60297
83 Ga0081455_10003176 3300005937 Bacteria 19071
84 Ga0081455_10005955 3300005937 Bacteria 13226
85 Ga0081540_1000102 3300005983 Bacteria 91311
86 Ga0081540_1000841 3300005983 Bacteria 28015
87 Ga0081540_1003418 3300005983 Bacteria 12554
88 Ga0081540_1008125 3300005983 Bacteria 7364
89 Ga0081540_1008941 3300005983 Bacteria 6939
90 Ga0081540_1009558 3300005983 Bacteria 6672
91 Ga0081540_1021006 3300005983 Bacteria 3906
92 Ga0081540_1021049 3300005983 Bacteria 3901
93 Ga0081540_1035588 3300005983 Bacteria 2668
94 Ga0081539_10000008 3300005985 Bacteria 525071
95 Ga0081539_10000220 3300005985 Bacteria 133834
96 Ga0081539_10055131 3300005985 Bacteria 2214
97 Ga0070717_10006207 3300006028 Bacteria 8777
98 Ga0070717_10007544 3300006028 Bacteria 8083
99 Ga0070717_10021364 3300006028 Bacteria 5099
100 Ga0070717_10134682 3300006028 Bacteria 2127
101 Ga0075365_10033778 3300006038 Bacteria 3299
102 Ga0075365_10038742 3300006038 Bacteria 3101
103 Ga0075365_10096957 3300006038 Bacteria 2015
104 Ga0075363_100009226 3300006048 Bacteria 4634
105 Ga0075364_10023541 3300006051 Bacteria 3900
106 Ga0075364_10074428 3300006051 Bacteria 2240
107 Ga0070715_10035264 3300006163 Bacteria 2056
108 Ga0070712_100022680 3300006175 Bacteria 4138
109 Ga0070712_100038780 3300006175 Bacteria 3257
110 Ga0070712_100091514 3300006175 Bacteria 2229
111 Ga0070712_100173947 3300006175 Bacteria 1673
112 Ga0075362_10019648 3300006177 Bacteria 2812
113 Ga0075369_10005844 3300006186 Bacteria 4625
114 Ga0075369_10032411 3300006186 Bacteria 2211
115 Ga0075366_10038702 3300006195 Bacteria 2817
116 Ga0097621_100040392 3300006237 Bacteria 3751
117 Ga0097621_100094887 3300006237 Bacteria 2501
118 Ga0097621_100112416 3300006237 Bacteria 2303
119 Ga0075370_10038846 3300006353 Bacteria 2679
120 Ga0068871_100001491 3300006358 Bacteria 15694
121 Ga0075428_100003814 3300006844 Bacteria 16541
122 Ga0075428_100269582 3300006844 Bacteria 1832
123 Ga0075430_100002189 3300006846 Bacteria 16184
124 Ga0075430_100004241 3300006846 Bacteria 12110
125 Ga0075430_100012744 3300006846 Bacteria 7164
126 Ga0075430_100044526 3300006846 Bacteria 3751
127 Ga0075431_100013553 3300006847 Bacteria 8239
128 Ga0075431_100021216 3300006847 Bacteria 6638
129 Ga0075431_100119215 3300006847 Bacteria 2723
130 Ga0075433_10036313 3300006852 Bacteria 4244
131 Ga0075434_100001946 3300006871 Bacteria 17909
132 Ga0075434_100083230 3300006871 Bacteria 3197
133 Ga0075434_100260056 3300006871 Bacteria 1755
134 Ga0075429_100000055 3300006880 Bacteria 55152
135 Ga0075429_100003786 3300006880 Bacteria 12905
136 Ga0075429_100012545 3300006880 Bacteria 7352
137 Ga0097620_100383932 3300006931 Bacteria 1500
138 Ga0099824_1011502 3300006942 Bacteria 9987
139 Ga0099824_1018474 3300006942 Bacteria 5716
140 Ga0075435_100011949 3300007076 Bacteria 6415
141 Ga0075435_100119473 3300007076 Bacteria 2198
142 Ga0099795_10037437 3300007788 Bacteria 1707
143 Ga0105240_10013046 3300009093 Bacteria 11437
144 Ga0105240_10021941 3300009093 Bacteria 8480
145 Ga0105240_10024721 3300009093 Bacteria 7912
146 Ga0105240_10192740 3300009093 Bacteria 2395
147 Ga0111539_10000852 3300009094 Bacteria 39772
148 Ga0105245_10048961 3300009098 Bacteria 3782
149 Ga0105245_10078010 3300009098 Bacteria 3021
150 Ga0105245_10081675 3300009098 Bacteria 2955
151 Ga0105247_10021886 3300009101 Bacteria 3847
152 Ga0105247_10081130 3300009101 Bacteria 2044
153 Ga0114129_10001487 3300009147 Bacteria 31741
154 Ga0114129_10007257 3300009147 Bacteria 15778
155 Ga0114129_10012532 3300009147 Bacteria 12074
156 Ga0114129_10021318 3300009147 Bacteria 9199
157 Ga0114129_10060555 3300009147 Bacteria 5293
158 Ga0105243_10178387 3300009148 Bacteria 1845
159 Ga0105241_10029756 3300009174 Bacteria 4077
160 Ga0105241_10118948 3300009174 Bacteria 2125
161 Ga0105242_10212373 3300009176 Bacteria 1725
162 Ga0105248_10027462 3300009177 Bacteria 6337
163 Ga0105237_10009950 3300009545 Bacteria 10145
164 Ga0105237_10021234 3300009545 Bacteria 6678
165 Ga0105237_10031207 3300009545 Bacteria 5405
166 Ga0105237_10228750 3300009545 Bacteria 1860
167 Ga0105237_10380401 3300009545 Bacteria 1416
168 Ga0105238_10014750 3300009551 Bacteria 7903
169 Ga0105238_10027647 3300009551 Bacteria 5781
170 Ga0105249_10295488 3300009553 Bacteria 1623
171 Ga0099796_10046613 3300010159 Bacteria 1488
172 Ga0105239_10084742 3300010375 Bacteria 3492
173 Ga0105239_10150755 3300010375 Bacteria 2595
174 Ga0105246_10013775 3300011119 Bacteria 5074
175 Ga0157370_10053036 3300013104 Bacteria 3869
176 Ga0157369_10012423 3300013105 Bacteria 9667
177 Ga0157374_10019281 3300013296 Bacteria 6035
178 Ga0157374_10024785 3300013296 Bacteria 5379
179 Ga0157374_10063878 3300013296 Bacteria 3453
180 Ga0157374_10129211 3300013296 Bacteria 2444
181 Ga0157378_10004961 3300013297 Bacteria 11667
182 Ga0157378_10038833 3300013297 Bacteria 4221
183 Ga0163162_10060239 3300013306 Bacteria 3831
184 Ga0163162_10225195 3300013306 Bacteria 2005
185 Ga0163162_10281427 3300013306 Bacteria 1795
186 Ga0157375_10128467 3300013308 Bacteria 2652
187 Ga0157375_10371170 3300013308 Bacteria 1597
188 Ga0163163_10060452 3300014325 Bacteria 3752
189 Ga0163163_10135612 3300014325 Bacteria 2503
190 Ga0163163_10200834 3300014325 Bacteria 2042
191 Ga0163163_10334734 3300014325 Bacteria 1569
192 Ga0157379_10136897 3300014968 Bacteria 2207
193 Ga0157376_10050368 3300014969 Bacteria 3455
194 Ga0157376_10292110 3300014969 Bacteria 1539
195 Ga0214542_1001925 3300021321 Bacteria 42950
196 Ga0214545_1000003 3300021324 Bacteria 720274
197 Ga0214543_1000002 3300021327 Bacteria 712733
198 Ga0213872_10040411 3300021361 Bacteria 2130
199 Ga0213876_10003579 3300021384 Bacteria 8838
200 Ga0213875_10062030 3300021388 Bacteria 1749
201 Ga0209563_100325 3300025230 Bacteria 18742
202 Ga0209677_102245 3300025253 Bacteria 7486
203 Ga0209148_1000812 3300025254 Bacteria 22632
204 Ga0209233_1003610 3300025261 Bacteria 5425
205 Ga0209233_1008563 3300025261 Bacteria 3154
206 Ga0209455_1002923 3300025272 Bacteria 6300
207 Ga0209455_1005249 3300025272 Bacteria 4048
208 Ga0209455_1005452 3300025272 Bacteria 3927
209 Ga0209758_1000011 3300025297 Bacteria 1049685
210 Ga0209758_1000120 3300025297 Bacteria 192212
211 Ga0209758_1001848 3300025297 Bacteria 23245
212 Ga0209758_1002848 3300025297 Bacteria 16788
213 Ga0209758_1007270 3300025297 Bacteria 7608
214 Ga0209758_1018387 3300025297 Bacteria 3426
215 Ga0209758_1032806 3300025297 Bacteria 2100
216 Ga0207426_1000328 3300025302 Bacteria 90659
217 Ga0207426_1000458 3300025302 Bacteria 64019
218 Ga0207426_1019068 3300025302 Bacteria 2405
219 Ga0209257_1001101 3300025304 Bacteria 35153
220 Ga0207692_10000797 3300025898 Bacteria 11223
221 Ga0207692_10006627 3300025898 Bacteria 4706
222 Ga0207692_10017877 3300025898 Bacteria 3171
223 Ga0207710_10008721 3300025900 Bacteria 4274
224 Ga0207688_10059711 3300025901 Bacteria 2148
225 Ga0207647_10008820 3300025904 Bacteria 7199
226 Ga0207685_10002427 3300025905 Bacteria 4270
227 Ga0207685_10028315 3300025905 Bacteria 1972
228 Ga0207699_10001610 3300025906 Bacteria 10719
229 Ga0207699_10004027 3300025906 Bacteria 7033
230 Ga0207699_10014207 3300025906 Bacteria 4097
231 Ga0207645_10066067 3300025907 Bacteria 2312
232 Ga0207645_10081474 3300025907 Bacteria 2075
233 Ga0207643_10058265 3300025908 Bacteria 2201
234 Ga0207705_10003219 3300025909 Bacteria 12434
235 Ga0207684_10003339 3300025910 Bacteria 15735
236 Ga0207684_10019497 3300025910 Bacteria 5800
237 Ga0207654_10120122 3300025911 Bacteria 1649
238 Ga0207707_10000886 3300025912 Bacteria 29266
239 Ga0207707_10003317 3300025912 Bacteria 14301
240 Ga0207707_10023656 3300025912 Bacteria 5372
241 Ga0207707_10027833 3300025912 Bacteria 4942
242 Ga0207707_10031075 3300025912 Bacteria 4672
243 Ga0207707_10117125 3300025912 Bacteria 2328
244 Ga0207707_10141869 3300025912 Bacteria 2100
245 Ga0207707_10235770 3300025912 Bacteria 1592
246 Ga0207695_10000163 3300025913 Bacteria 197030
247 Ga0207671_10056823 3300025914 Bacteria 2900
248 Ga0207693_10000506 3300025915 Bacteria 35208
249 Ga0207693_10002637 3300025915 Bacteria 15580
250 Ga0207693_10007874 3300025915 Bacteria 8752
251 Ga0207693_10014584 3300025915 Bacteria 6315
252 Ga0207693_10034047 3300025915 Bacteria 4019
253 Ga0207693_10062713 3300025915 Bacteria 2912
254 Ga0207693_10095504 3300025915 Bacteria 2330
255 Ga0207663_10004038 3300025916 Bacteria 7275
256 Ga0207663_10006243 3300025916 Bacteria 6080
257 Ga0207663_10021217 3300025916 Bacteria 3695
258 Ga0207663_10062817 3300025916 Bacteria 2362
259 Ga0207663_10065540 3300025916 Bacteria 2322
260 Ga0207660_10010388 3300025917 Bacteria 6040
261 Ga0207660_10022287 3300025917 Bacteria 4267
262 Ga0207657_10008437 3300025919 Bacteria 10455
263 Ga0207649_10040161 3300025920 Bacteria 2842
264 Ga0207649_10109100 3300025920 Bacteria 1846
265 Ga0207652_10016478 3300025921 Bacteria 6035
266 Ga0207652_10019601 3300025921 Bacteria 5566
267 Ga0207652_10115718 3300025921 Bacteria 2382
268 Ga0207652_10148500 3300025921 Bacteria 2098
269 Ga0207652_10178835 3300025921 Bacteria 1906
270 Ga0207646_10002996 3300025922 Bacteria 19501
271 Ga0207646_10003246 3300025922 Bacteria 18533
272 Ga0207694_10071234 3300025924 Bacteria 2716
273 Ga0207650_10205616 3300025925 Bacteria 1579
274 Ga0207687_10021155 3300025927 Bacteria 4319
275 Ga0207687_10053608 3300025927 Bacteria 2818
276 Ga0207687_10117944 3300025927 Bacteria 1980
277 Ga0207700_10000668 3300025928 Bacteria 20081
278 Ga0207700_10007466 3300025928 Bacteria 6681
279 Ga0207700_10041345 3300025928 Bacteria 3372
280 Ga0207700_10083120 3300025928 Bacteria 2506
281 Ga0207700_10158000 3300025928 Bacteria 1880
282 Ga0207664_10102478 3300025929 Bacteria 2367
283 Ga0207690_10172879 3300025932 Bacteria 1620
284 Ga0207706_10015391 3300025933 Bacteria 6910
285 Ga0207706_10107404 3300025933 Bacteria 2456
286 Ga0207686_10040459 3300025934 Bacteria 2834
287 Ga0207709_10212003 3300025935 Bacteria 1391
288 Ga0207669_10086754 3300025937 Bacteria 2025
289 Ga0207669_10107067 3300025937 Bacteria 1864
290 Ga0207665_10000528 3300025939 Bacteria 25777
291 Ga0207665_10001385 3300025939 Bacteria 16335
292 Ga0207691_10186072 3300025940 Bacteria 1813
293 Ga0207711_10009654 3300025941 Bacteria 8041
294 Ga0207711_10018144 3300025941 Bacteria 5851
295 Ga0207689_10036827 3300025942 Bacteria 4060
296 Ga0207661_10008452 3300025944 Bacteria 7359
297 Ga0207661_10018951 3300025944 Bacteria 5120
298 Ga0207661_10083044 3300025944 Bacteria 2650
299 Ga0207661_10291186 3300025944 Bacteria 1461
300 Ga0207667_10019974 3300025949 Bacteria 7463
301 Ga0207667_10027626 3300025949 Bacteria 6173
302 Ga0207651_10065505 3300025960 Bacteria 2548
303 Ga0207668_10143392 3300025972 Bacteria 1840
304 Ga0207668_10186534 3300025972 Bacteria 1640
305 Ga0207703_10045836 3300026035 Bacteria 3518
306 Ga0207639_10034032 3300026041 Bacteria 3763
307 Ga0207678_10022393 3300026067 Bacteria 5534
308 Ga0207678_10023935 3300026067 Bacteria 5340
309 Ga0207678_10033211 3300026067 Bacteria 4496
310 Ga0207678_10034200 3300026067 Bacteria 4427
311 Ga0207678_10035164 3300026067 Bacteria 4362
312 Ga0207641_10198815 3300026088 Bacteria 1847
313 Ga0207648_10184860 3300026089 Bacteria 1846
314 Ga0207676_10097698 3300026095 Bacteria 2426
315 Ga0207674_10007720 3300026116 Bacteria 12520
316 Ga0207674_10078663 3300026116 Bacteria 3303
317 Ga0207674_10128182 3300026116 Bacteria 2502
318 Ga0207683_10003797 3300026121 Bacteria 13083
319 Ga0207683_10009714 3300026121 Bacteria 8206
320 Ga0207683_10091282 3300026121 Bacteria 2713
321 Ga0207683_10262268 3300026121 Bacteria 1578
322 Ga0207698_10060190 3300026142 Bacteria 2952
323 Ga0209389_1000043 3300027296 Bacteria 123224
324 Ga0209389_1000077 3300027296 Bacteria 91273
325 Ga0209589_1000011 3300027357 Bacteria 236981
326 Ga0209589_1000047 3300027357 Bacteria 118659
327 Ga0209489_100012 3300027361 Bacteria 236981
328 Ga0209489_100075 3300027361 Bacteria 136991
329 Ga0209489_100251 3300027361 Bacteria 91273
330 Ga0209700_100019 3300027363 Bacteria 236981
331 Ga0209700_100271 3300027363 Bacteria 91215
332 Ga0209179_1001680 3300027512 Bacteria 2799
333 Ga0207428_10005470 3300027907 Bacteria 11844
334 Ga0268266_10007625 3300028379 Bacteria 9734
335 Ga0268266_10234117 3300028379 Bacteria 1692
336 Ga0268265_10118725 3300028380 Bacteria 2175
337 Ga0268264_10000030 3300028381 Bacteria 418542
338 Ga0268264_10163025 3300028381 Bacteria 2010
339 Ga0265337_1006171 3300028556 Bacteria 4658
340 Ga0265319_1011253 3300028563 Bacteria 3676
341 Ga0265318_10024101 3300028577 Bacteria 2418
342 Ga0265323_10000434 3300028653 Bacteria 23913
343 Ga0265336_10000649 3300028666 Bacteria 18964
344 Ga0307517_10000279 3300028786 Bacteria 88025
345 Ga0307515_10152056 3300028794 Bacteria 2413
346 Ga0265338_10000280 3300028800 Bacteria 91942
347 Ga0265324_10010387 3300029957 Bacteria 3591
348 Ga0265330_10006697 3300031235 Bacteria 5683
349 Ga0265325_10000599 3300031241 Bacteria 26290
350 Ga0265329_10042580 3300031242 Bacteria 1454
351 Ga0265340_10010905 3300031247 Bacteria 4848
352 Ga0265340_10014569 3300031247 Bacteria 4103
353 Ga0265340_10025159 3300031247 Bacteria 3018
354 Ga0265339_10020885 3300031249 Bacteria 3820
355 Ga0265339_10035899 3300031249 Bacteria 2777
356 Ga0265339_10107760 3300031249 Bacteria 1445
357 Ga0307509_10204543 3300031507 Bacteria 1806
358 Ga0307508_10003532 3300031616 Bacteria 15752
359 Ga0307508_10140808 3300031616 Bacteria 2016
360 Ga0265314_10014967 3300031711 Bacteria 6177
361 Ga0265342_10009847 3300031712 Bacteria 6686
362 Ga0307516_10097075 3300031730 Bacteria 2767
363 Ga0307507_10043063 3300033179 Bacteria 4486
364 Ga0307510_10037733 3300033180 Bacteria 5357
365 Ga0307510_10073832 3300033180 Bacteria 3376
366 Ga0315911_1000003 3300033442 Bacteria 502217
367 Ga0373928_0004389 3300035084 Bacteria 2691
368 Ga0373936_0003178 3300035113 Bacteria 6151
369 Ga0373941_0005728 3300035115 Bacteria 2948
370 Ga0373953_0003406 3300035117 Bacteria 4946
371 Ga0373954_0068936 3300035118 Bacteria 1679
372 Ga0373956_0007041 3300035119 Bacteria 4524
373 Ga0373957_0020281 3300035120 Bacteria 2347
374 Ga0373960_0014063 3300035121 Bacteria 2020
375 Ga0373943_0000795 3300035170 Bacteria 13844
376 Ga0373943_0025222 3300035170 Bacteria 2778
377 Ga0373943_0037571 3300035170 Bacteria 2325
378 Ga0373946_0064791 3300035171 Bacteria 1563
379 Ga0373955_0064066 3300035172 Bacteria 2036
380 Ga0373942_0003177 3300035207 Bacteria 3887
381 Ga0373931_0006081 3300035691 Bacteria 5624
382 Ga0373935_0000536 3300035692 Bacteria 19758
383 Ga0373935_0017022 3300035692 Bacteria 4403
384 Ga0373927_0000898 3300035695 Bacteria 22620
385 Ga0373927_0045712 3300035695 Bacteria 2832
386 Ga0373933_0001821 3300035724 Bacteria 12354
387 Ga0373933_0056140 3300035724 Bacteria 2363
388 Ga0373947_0010479 3300035725 Bacteria 5318
389 Ga0373937_0054540 3300036401 Bacteria 3668
390 Ga0373937_0139955 3300036401 Bacteria 2264
391 Ga0373937_0216891 3300036401 Bacteria 1801
392 Ga0373925_0001796 3300037068 Bacteria 17888
393 Ga0373925_0027047 3300037068 Bacteria 4200
394 Ga0373925_0038098 3300037068 Bacteria 3552
395 Ga0373925_0138906 3300037068 Bacteria 1901
396 Ga0373925_0166865 3300037068 Bacteria 1736
397 Ga0373925_0227748 3300037068 Bacteria 1489
398 Ga0395899_0060103 3300037312 Bacteria 2800
399 Ga0395900_0003092 3300037418 Bacteria 18074
400 Ga0395905_0084980 3300037471 Bacteria 2965
401 Ga0436364_0356418 3300037853 Bacteria 2149
402 Ga0395901_0001902 3300038443 Bacteria 21558
403 Ga0395901_0209340 3300038443 Bacteria 2042
404 Ga0436365_1236739 3300039437 Bacteria 30341
405 Ga0436365_1571642 3300039437 Bacteria 1625
406 Ga0436361_0535015 3300039447 Bacteria 2198
407 Ga0436361_0632240 3300039447 Bacteria 3925
408 Ga0436363_0621011 3300039450 Bacteria 2545
409 Ga0436363_0698487 3300039450 Bacteria 1356
410 Ga0436362_0652931 3300039453 Bacteria 7115
411 Ga0466972_0000079 3300044658 Bacteria 90348
412 Ga0466965_0068555 3300044683 Bacteria 1781
413 Ga0466963_0007491 3300044694 Bacteria 6512
414 Ga0466968_0010560 3300044735 Bacteria 3583
415 Ga0466960_0006472 3300044901 Bacteria 4699
416 Ga0466959_0033466 3300045049 Bacteria 3801
417 Ga0466959_0052521 3300045049 Bacteria 2984
418 Ga0466959_0154985 3300045049 Bacteria 1613
419 Ga0466967_0249181 3300045976 Bacteria 1696
420 Ga0466967_0295043 3300045976 Bacteria 1558
421 Ga0495592_0008855 3300046454 Bacteria 7559
422 Ga0495592_0011606 3300046454 Bacteria 6672
423 Ga0495592_0029907 3300046454 Bacteria 4121
424 Ga0495603_0000046 3300046455 Bacteria 53187
425 Ga0495603_0086322 3300046455 Bacteria 1837
426 Ga0495629_0000071 3300046459 Bacteria 88879
427 Ga0495629_0009871 3300046459 Bacteria 6968
428 Ga0495629_0163739 3300046459 Bacteria 1545
429 Ga0495638_0020090 3300046460 Bacteria 4414
430 Ga0495641_0009896 3300046461 Bacteria 5611
431 Ga0495641_0011415 3300046461 Bacteria 5064
432 Ga0495653_0032304 3300046463 Bacteria 4157
433 Ga0495580_0000057 3300046472 Bacteria 64650
434 Ga0495580_0043983 3300046472 Bacteria 3177
435 Ga0495582_0000111 3300046473 Bacteria 42751
436 Ga0495605_0056668 3300046474 Bacteria 1889
437 Ga0495639_0000108 3300046475 Bacteria 41656
438 Ga0495639_0015341 3300046475 Bacteria 3322
439 Ga0495662_0000992 3300046476 Bacteria 13882
440 Ga0495662_0020305 3300046476 Bacteria 3213
441 Ga0495664_0002718 3300046477 Bacteria 9505
442 Ga0495664_0007884 3300046477 Bacteria 5926
443 Ga0495664_0030650 3300046477 Bacteria 3151
444 Ga0495664_0063064 3300046477 Bacteria 2208
445 Ga0495594_0000133 3300046499 Bacteria 34897
446 Ga0495583_0055522 3300046506 Bacteria 1790
447 Ga0495606_0003362 3300046507 Bacteria 17052
448 Ga0495606_0006998 3300046507 Bacteria 10238
449 Ga0495606_0080559 3300046507 Bacteria 2026
450 Ga0495606_0138832 3300046507 Bacteria 1437
451 Ga0495628_0012530 3300046516 Bacteria 7144
452 Ga0495628_0042625 3300046516 Bacteria 3619
453 Ga0495630_0000959 3300046517 Bacteria 20201
454 Ga0495637_0048728 3300046520 Bacteria 1783
455 Ga0495643_0005954 3300046522 Bacteria 8136
456 Ga0495648_0046019 3300046524 Bacteria 2708
457 Ga0495666_0005822 3300046526 Bacteria 6215
458 Ga0495666_0032607 3300046526 Bacteria 2548
459 Ga0495652_0042099 3300046529 Bacteria 3939
460 Ga0495652_0097969 3300046529 Bacteria 2384
461 Ga0495652_0168431 3300046529 Bacteria 1693
462 Ga0495665_0000001 3300046531 Bacteria 156121
463 Ga0495665_0057438 3300046531 Bacteria 2054
464 Ga0495640_0012179 3300046533 Bacteria 6583
465 Ga0495640_0023983 3300046533 Bacteria 4438
466 Ga0495640_0028223 3300046533 Bacteria 4042
467 Ga0495640_0143197 3300046533 Bacteria 1540
468 Ga0495586_0056589 3300046535 Bacteria 2127
469 Ga0495587_0044824 3300046536 Bacteria 2630
470 Ga0495597_0031638 3300046542 Bacteria 2406
471 Ga0495645_0007155 3300046543 Bacteria 7768
472 Ga0495645_0009374 3300046543 Bacteria 6845
473 Ga0495622_0001363 3300046557 Bacteria 12492
474 Ga0495633_0041177 3300046558 Bacteria 2197
475 Ga0495667_0006892 3300046559 Bacteria 7715
476 Ga0495667_0016295 3300046559 Bacteria 5021
477 Ga0495667_0032071 3300046559 Bacteria 3523
478 Ga0495668_0066567 3300046616 Bacteria 1982
479 Ga0495634_0000046 3300046642 Bacteria 97947
480 Ga0495634_0076372 3300046642 Bacteria 2199
481 Ga0495625_0164898 3300046660 Bacteria 1482
482 Ga0495635_0000338 3300046663 Bacteria 29955
483 Ga0495635_0019273 3300046663 Bacteria 4758
484 Ga0495635_0051638 3300046663 Bacteria 2832
485 Ga0495588_0001464 3300046674 Bacteria 10138
486 Ga0495657_0054792 3300046675 Bacteria 2662
487 Ga0495599_0007149 3300046678 Bacteria 6759
488 Ga0495599_0124670 3300046678 Bacteria 1601
489 Ga0495623_0045020 3300046679 Bacteria 2803
490 Ga0495646_0007433 3300046680 Bacteria 6965
491 Ga0495646_0008580 3300046680 Bacteria 6490
492 Ga0495647_0000754 3300046681 Bacteria 9612
493 Ga0495658_0000994 3300046683 Bacteria 14995
494 Ga0495658_0005502 3300046683 Bacteria 6226
495 Ga0495613_0005517 3300046689 Bacteria 9500
496 Ga0495613_0025092 3300046689 Bacteria 4442
497 Ga0495624_0003652 3300046690 Bacteria 11380
498 Ga0495624_0050265 3300046690 Bacteria 2641
499 Ga0495670_0004308 3300046691 Bacteria 6972
500 Ga0495649_0038307 3300046694 Bacteria 2631
501 Ga0495649_0059545 3300046694 Bacteria 2056
502 Ga0495600_0005381 3300046809 Bacteria 7717
503 Ga0495581_0000012 3300047315 Bacteria 62886
504 Ga0495581_0018927 3300047315 Bacteria 3996
505 Ga0495581_0019391 3300047315 Bacteria 3948
506 Ga0495604_0004988 3300047317 Bacteria 10511
507 Ga0495604_0009096 3300047317 Bacteria 7860
508 Ga0495604_0082749 3300047317 Bacteria 2399
509 Ga0495674_0000031 3300047319 Bacteria 115867
510 Ga0495674_0042923 3300047319 Bacteria 4029
511 Ga0495674_0167781 3300047319 Bacteria 1833
512 Ga0495680_0024280 3300047322 Bacteria 5030
513 Ga0495687_014302 3300047443 Bacteria 4091
514 Ga0495673_0036405 3300047469 Bacteria 2258
515 Ga0495684_0010711 3300047471 Bacteria 7091
516 Ga0495684_0028321 3300047471 Bacteria 4301
517 Ga0495684_0087681 3300047471 Bacteria 2358
518 Ga0495684_0106060 3300047471 Bacteria 2123
519 Ga0495686_0057595 3300047472 Bacteria 2425
520 Ga0495593_0000008 3300047673 Bacteria 87310
521 Ga0495593_0089256 3300047673 Bacteria 1588
522 Ga0495602_0011752 3300048088 Bacteria 9041
523 Ga0496100_0024358 3300048903 Bacteria 3691
524 Ga0496100_0048201 3300048903 Bacteria 2749
525 Ga0496100_0057600 3300048903 Bacteria 2546
526 Ga0496101_0006365 3300048904 Bacteria 7599
527 Ga0496101_0143379 3300048904 Bacteria 1822
528 Ga0496101_0175899 3300048904 Bacteria 1646
529 Ga0496102_0003595 3300048905 Bacteria 13132
530 Ga0496102_0047832 3300048905 Bacteria 3888
531 Ga0496102_0135445 3300048905 Bacteria 2308
532 Ga0496102_0155765 3300048905 Bacteria 2147
533 Ga0496102_0405944 3300048905 Bacteria 1280
534 Ga0496103_0013766 3300048906 Bacteria 4802
535 Ga0496103_0056345 3300048906 Bacteria 2439
536 Ga0496104_0047727 3300048907 Bacteria 4036
537 Ga0496104_0091600 3300048907 Bacteria 2906
538 Ga0496104_0105275 3300048907 Bacteria 2703
539 Ga0496104_0156936 3300048907 Bacteria 2183
540 Ga0496104_0191109 3300048907 Bacteria 1959
541 Ga0496104_0209150 3300048907 Bacteria 1863
542 Ga0496105_0019331 3300048908 Bacteria 5493
543 Ga0496105_0047299 3300048908 Bacteria 3550
544 Ga0496105_0051555 3300048908 Bacteria 3399
545 Ga0496106_0048244 3300048909 Bacteria 3207
546 Ga0496106_0223856 3300048909 Bacteria 1501
547 Ga0496107_0000947 3300048910 Bacteria 17177
548 Ga0496107_0059812 3300048910 Bacteria 2757
549 Ga0496107_0116062 3300048910 Bacteria 1970
550 Ga0496108_0009810 3300048911 Bacteria 7756
551 Ga0496108_0013705 3300048911 Bacteria 6616
552 Ga0496109_0008951 3300048912 Bacteria 8527
553 Ga0496109_0009381 3300048912 Bacteria 8337
554 Ga0496109_0031864 3300048912 Bacteria 4735
555 Ga0496109_0048452 3300048912 Bacteria 3866
556 Ga0496110_0013781 3300048913 Bacteria 6698
557 Ga0496110_0033318 3300048913 Bacteria 4455
558 Ga0496110_0126144 3300048913 Bacteria 2309
559 Ga0496111_0029039 3300048914 Bacteria 3923
560 Ga0496112_0000008 3300048915 Bacteria 310323
561 Ga0496112_0029131 3300048915 Bacteria 5337
562 Ga0496112_0030083 3300048915 Bacteria 5255
563 Ga0496112_0034956 3300048915 Bacteria 4890
564 Ga0496112_0065820 3300048915 Bacteria 3576
565 Ga0496112_0165206 3300048915 Bacteria 2179
566 Ga0496113_0001327 3300048916 Bacteria 13676
567 Ga0496113_0038477 3300048916 Bacteria 3517
568 Ga0496113_0067913 3300048916 Bacteria 2704
569 Ga0496113_0139736 3300048916 Bacteria 1905
570 Ga0496113_0152713 3300048916 Bacteria 1822
571 Ga0496114_0009690 3300048917 Bacteria 7651
572 Ga0496114_0024353 3300048917 Bacteria 4940
573 Ga0496115_0000604 3300048918 Bacteria 27391
574 Ga0496115_0011581 3300048918 Bacteria 6613
575 Ga0496115_0071313 3300048918 Bacteria 2818
576 Ga0496115_0119789 3300048918 Bacteria 2165
577 Ga0496115_0176244 3300048918 Bacteria 1768
578 Ga0496115_0242729 3300048918 Bacteria 1485
579 Ga0496115_0247343 3300048918 Bacteria 1469
580 Ga0496117_0010071 3300048920 Bacteria 8683
581 Ga0496117_0064449 3300048920 Bacteria 2498
582 Ga0496118_0008611 3300048921 Bacteria 10500
583 Ga0496118_0009891 3300048921 Bacteria 9537
584 Ga0496118_0116503 3300048921 Bacteria 1755
585 Ga0496119_0006875 3300048922 Bacteria 10389
586 Ga0496119_0072328 3300048922 Bacteria 2015
587 Ga0496120_0005140 3300048923 Bacteria 10571
588 Ga0496121_0002635 3300048924 Bacteria 27038
589 Ga0496121_0014245 3300048924 Bacteria 8457
590 Ga0496121_0020183 3300048924 Bacteria 6613
591 Ga0496121_0048593 3300048924 Bacteria 3608
592 Ga0496121_0152966 3300048924 Bacteria 1695
593 Ga0496124_0011581 3300048927 Bacteria 8801
594 Ga0496124_0190514 3300048927 Bacteria 1570
595 Ga0496125_0000048 3300048928 Bacteria 290651
596 Ga0496125_0000746 3300048928 Bacteria 53671
597 Ga0496125_0071057 3300048928 Bacteria 2721
598 Ga0496126_0008677 3300048929 Bacteria 10918
599 Ga0496126_0009242 3300048929 Bacteria 10508
600 Ga0496126_0022113 3300048929 Bacteria 6194
601 Ga0496126_0045158 3300048929 Bacteria 4052
602 Ga0496126_0065897 3300048929 Bacteria 3239
603 Ga0496126_0073717 3300048929 Bacteria 3034
604 Ga0496126_0127252 3300048929 Bacteria 2204
605 Ga0496126_0239357 3300048929 Bacteria 1517
606 Ga0496126_0247949 3300048929 Bacteria 1485
607 Ga0495682_0018342 3300049460 Bacteria 2636
608 Ga0501032_0022551 3300049569 Bacteria 4363
609 Ga0501034_0165443 3300049571 Bacteria 2180
610 Ga0501036_0005911 3300049572 Bacteria 9917
611 Ga0501037_0065576 3300049573 Bacteria 2645
612 Ga0501038_0020172 3300049574 Bacteria 5996
613 Ga0501039_0009067 3300049575 Bacteria 7583
614 Ga0501046_0008999 3300049580 Bacteria 8663
615 Ga0501048_0013379 3300049582 Bacteria 6089
616 Ga0501069_0001752 3300049585 Bacteria 10825
617 Ga0501070_0051123 3300049586 Bacteria 3430
618 Ga0501070_0119773 3300049586 Bacteria 2175
619 Ga0501071_0046675 3300049587 Bacteria 3111
620 Ga0501074_0002882 3300049590 Bacteria 12058
621 Ga0501076_0010510 3300049592 Bacteria 6869
622 Ga0501076_0051612 3300049592 Bacteria 3256
623 Ga0501076_0090535 3300049592 Bacteria 2461
624 Ga0501079_0080288 3300049741 Bacteria 2522
625 Ga0501083_0003764 3300049744 Bacteria 10648
626 Ga0501044_0001655 3300049823 Bacteria 26167
627 Ga0501044_0049412 3300049823 Bacteria 4343
628 Ga0501044_0061643 3300049823 Bacteria 3836
629 nmdc:mga03683_32601_c1 3300050489 Bacteria 2097
630 nmdc:mga0yw44_134932_c1 3300050492 Bacteria 1601
631 nmdc:mga0k408_22090_c2 3300050493 Bacteria 2760
632 nmdc:mga0k408_25121_c1 3300050493 Bacteria 3372
633 nmdc:mga06z11_108051_c1 3300050494 Bacteria 1537
634 nmdc:mga04h51_25898_c1 3300050495 Bacteria 1810
635 nmdc:mga07m45_63476_c1 3300050496 Bacteria 2095
636 nmdc:mga05p37_213_c1 3300050507 Bacteria 58791
637 nmdc:mga05p37_24611_c1 3300050507 Bacteria 7319
638 nmdc:mga05p37_49620_c1 3300050507 Bacteria 5163
639 nmdc:mga05p37_54085_c1 3300050507 Bacteria 4939
640 nmdc:mga09592_1171_c1 3300050508 Bacteria 12926
641 nmdc:mga09592_1606_c1 3300050508 Bacteria 18226
642 nmdc:mga0qj67_129_c1 3300050509 Bacteria 50064
643 nmdc:mga0qj67_31281_c1 3300050509 Bacteria 4145
644 nmdc:mga0qj67_885_c1 3300050509 Bacteria 20530
645 nmdc:mga06r32_1219_c1 3300050510 Bacteria 23164
646 nmdc:mga06r32_253962_c1 3300050510 Bacteria 1746
647 nmdc:mga06r32_6151_c1 3300050510 Bacteria 10773
648 nmdc:mga08y16_275_c1 3300050511 Bacteria 46750
649 nmdc:mga0n895_179945_c1 3300050512 Bacteria 2146
650 nmdc:mga0n895_72723_c1 3300050512 Bacteria 3412
651 nmdc:mga0rr50_12121_c1 3300050513 Bacteria 5556
652 nmdc:mga0rr50_169464_c1 3300050513 Bacteria 1778
653 nmdc:mga0a205_5452_c1 3300050515 Bacteria 11461
654 nmdc:mga0sz30_34204_c1 3300050516 Bacteria 2114
655 nmdc:mga0sz30_50717_c1 3300050516 Bacteria 1760
656 Ga0495601_0067367 3300053077 Bacteria 2280
657 Ga0495595_0027742 3300053084 Bacteria 2524
658 Ga0495595_0033994 3300053084 Bacteria 2304
659 Ga0495619_0011258 3300053085 Bacteria 5625
660 Ga0495619_0017972 3300053085 Bacteria 4484
661 Ga0495619_0058742 3300053085 Bacteria 2554
662 Ga0495619_0062539 3300053085 Bacteria 2478
663 Ga0500578_0051297 3300053086 Bacteria 2643
664 Ga0500578_0110590 3300053086 Bacteria 1732
665 Ga0500643_002271 3300053087 Bacteria 10082
666 Ga0500644_0000771 3300053088 Bacteria 10930
667 Ga0500583_0052684 3300053092 Bacteria 1894
668 Ga0500651_0031020 3300053093 Bacteria 3365
669 Ga0500651_0090684 3300053093 Bacteria 1882
670 Ga0500566_0000011 3300053094 Bacteria 118644
671 Ga0500566_0000293 3300053094 Bacteria 26861
672 Ga0500566_0000412 3300053094 Bacteria 23818
673 Ga0500566_0135551 3300053094 Bacteria 1312
674 Ga0500640_001527 3300053095 Bacteria 7094
675 Ga0500554_020862 3300053102 Bacteria 1808
676 Ga0500555_001186 3300053103 Bacteria 8535
677 Ga0500557_000062 3300053105 Bacteria 43893
678 Ga0500572_000065 3300053111 Bacteria 32713
679 Ga0500572_001006 3300053111 Bacteria 8512
680 Ga0500595_000003 3300053119 Bacteria 419332
681 Ga0500595_000395 3300053119 Bacteria 28044
682 Ga0500595_003500 3300053119 Bacteria 7305
683 Ga0500607_022647 3300053121 Bacteria 3529
684 Ga0500614_017278 3300053123 Bacteria 1628
685 Ga0500642_0000127 3300053130 Bacteria 34341
686 Ga0500652_005161 3300053131 Bacteria 4091
687 Ga0500559_0001342 3300053136 Bacteria 14123
688 Ga0500559_0001798 3300053136 Bacteria 11758
689 Ga0500603_000269 3300053150 Bacteria 13789
690 Ga0500616_0000002 3300053153 Bacteria 1611257
691 Ga0500616_0002075 3300053153 Bacteria 17550
692 Ga0500616_0029688 3300053153 Bacteria 3008
693 Ga0500630_000832 3300053159 Bacteria 14267
694 Ga0500638_000370 3300053162 Bacteria 10477
695 Ga0500639_000079 3300053163 Bacteria 45631
696 Ga0500639_004522 3300053163 Bacteria 7069
697 Ga0500636_0000041 3300053177 Bacteria 69687
698 Ga0500636_0037290 3300053177 Bacteria 2876
699 Ga0500637_0000026 3300053178 Bacteria 59050
700 Ga0500637_0053059 3300053178 Bacteria 2314
701 Ga0500637_0085364 3300053178 Bacteria 1825
702 Ga0500625_015998 3300053729 Bacteria 3488
703 Ga0500645_000226 3300053730 Bacteria 42982
704 Ga0500609_002277 3300053731 Bacteria 2738
705 Ga0500596_000987 3300053735 Bacteria 5689
706 Ga0500596_004947 3300053735 Bacteria 2393
707 Ga0500599_002636 3300053736 Bacteria 2163
708 Ga0500601_005302 3300053737 Bacteria 1411
709 Ga0501084_0032968 3300054114 Bacteria 4333
710 Ga0500661_001127 3300055283 Bacteria 5003
711 Ga0501082_0002831 3300060353 Bacteria 15119
712 Ga0530510_0090886 3300061734 Bacteria 2227
713 Ga0530510_0161046 3300061734 Bacteria 1660

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0165443 Ga0501034_0165443_57_1229 377
2 3300031249 Ga0265339_10107760 Ga0265339_101077601 378
3 iso_pu_bacteria 8055617313 8055621701 378
4 3300003322 rootL2_10158942 rootL2_101589423 380
5 3300049569 Ga0501032_0022551 Ga0501032_0022551_2472_3752 380
6 3300049572 Ga0501036_0005911 Ga0501036_0005911_6100_7380 380
7 3300049573 Ga0501037_0065576 Ga0501037_0065576_96_1376 380
8 3300049574 Ga0501038_0020172 Ga0501038_0020172_3303_4583 380
9 3300049575 Ga0501039_0009067 Ga0501039_0009067_1336_2616 380
10 3300049580 Ga0501046_0008999 Ga0501046_0008999_2455_3735 380
11 3300049582 Ga0501048_0013379 Ga0501048_0013379_1577_2857 380
12 3300049585 Ga0501069_0001752 Ga0501069_0001752_7088_8368 380
13 3300049586 Ga0501070_0051123 Ga0501070_0051123_1228_2508 380
14 3300049587 Ga0501071_0046675 Ga0501071_0046675_1412_2692 380
15 3300049590 Ga0501074_0002882 Ga0501074_0002882_755_2035 380
16 3300049592 Ga0501076_0090535 Ga0501076_0090535_485_1765 380
17 3300049741 Ga0501079_0080288 Ga0501079_0080288_823_2103 380
18 3300049744 Ga0501083_0003764 Ga0501083_0003764_2641_3921 380
19 3300049823 Ga0501044_0061643 Ga0501044_0061643_1314_2594 380
20 3300054114 Ga0501084_0032968 Ga0501084_0032968_1473_2753 380
21 3300060353 Ga0501082_0002831 Ga0501082_0002831_6880_8160 380
22 iso_pu_bacteria 2824600985 2824605660 380
23 3300005327 Ga0070658_10123665 Ga0070658_101236653 381
24 3300005336 Ga0070680_100000841 Ga0070680_10000084121 381
25 3300005458 Ga0070681_10009737 Ga0070681_100097379 381
26 3300005530 Ga0070679_100003118 Ga0070679_10000311815 381
27 3300005563 Ga0068855_100058768 Ga0068855_1000587684 381
28 3300025909 Ga0207705_10003219 Ga0207705_1000321914 381
29 3300025912 Ga0207707_10003317 Ga0207707_1000331715 381
30 3300025921 Ga0207652_10016478 Ga0207652_100164787 381
31 3300025949 Ga0207667_10027626 Ga0207667_100276268 381
32 3300037068 Ga0373925_0138906 Ga0373925_0138906_81_1241 381
33 3300048918 Ga0496115_0247343 Ga0496115_0247343_296_1456 381
34 3300025937 Ga0207669_10086754 Ga0207669_100867542 382
35 3300048904 Ga0496101_0175899 Ga0496101_0175899_12_1178 382
36 3300053153 Ga0500616_0029688 Ga0500616_0029688_265_1431 382
37 3300005336 Ga0070680_100053807 Ga0070680_1000538072 383
38 3300005530 Ga0070679_100004998 Ga0070679_1000049985 383
39 3300009093 Ga0105240_10013046 Ga0105240_100130464 383
40 3300025921 Ga0207652_10148500 Ga0207652_101485002 383
41 3300028556 Ga0265337_1006171 Ga0265337_10061712 383
42 3300028563 Ga0265319_1011253 Ga0265319_10112532 383
43 3300028577 Ga0265318_10024101 Ga0265318_100241012 383
44 3300028653 Ga0265323_10000434 Ga0265323_1000043425 383
45 3300028666 Ga0265336_10000649 Ga0265336_1000064918 383
46 3300028800 Ga0265338_10000280 Ga0265338_1000028051 383
47 3300029957 Ga0265324_10010387 Ga0265324_100103872 383
48 3300049823 Ga0501044_0001655 Ga0501044_0001655_7757_9037 383
49 iso_pu_bacteria 2824732956 2824735657 383
50 3300009176 Ga0105242_10212373 Ga0105242_102123732 384
51 3300045049 Ga0466959_0052521 Ga0466959_0052521_1754_2932 384
52 3300046660 Ga0495625_0164898 Ga0495625_0164898_277_1470 384
53 3300048915 Ga0496112_0000008 Ga0496112_0000008_112187_113356 384
54 3300048929 Ga0496126_0065897 Ga0496126_0065897_28_1200 384
55 iso_pu_bacteria 8019586578 8019592309 386
56 iso_pu_bacteria 2844533157 2844534782 387
57 3300053094 Ga0500566_0135551 Ga0500566_0135551_52_1236 389
58 3300061734 Ga0530510_0161046 Ga0530510_0161046_48_1340 389
59 3300006847 Ga0075431_100119215 Ga0075431_1001192153 390
60 3300006871 Ga0075434_100001946 Ga0075434_10000194613 390
61 3300007076 Ga0075435_100011949 Ga0075435_1000119493 390
62 3300025297 Ga0209758_1007270 Ga0209758_10072705 390
63 3300048918 Ga0496115_0119789 Ga0496115_0119789_923_2110 390
64 3300050507 nmdc:mga05p37_49620_c1 nmdc:mga05p37_49620_c1_3815_5086 390
65 3300050510 nmdc:mga06r32_253962_c1 nmdc:mga06r32_253962_c1_455_1726 390
66 3300050513 nmdc:mga0rr50_12121_c1 nmdc:mga0rr50_12121_c1_1256_2527 390
67 3300005983 Ga0081540_1000102 Ga0081540_100010213 391
68 3300006844 Ga0075428_100003814 Ga0075428_1000038149 391
69 3300006846 Ga0075430_100012744 Ga0075430_1000127443 391
70 3300006847 Ga0075431_100013553 Ga0075431_1000135537 391
71 3300006880 Ga0075429_100003786 Ga0075429_1000037868 391
72 3300009094 Ga0111539_10000852 Ga0111539_100008529 391
73 3300009147 Ga0114129_10001487 Ga0114129_1000148723 391
74 3300027907 Ga0207428_10005470 Ga0207428_100054706 391
75 3300048929 Ga0496126_0009242 Ga0496126_0009242_5354_6625 391
76 3300050507 nmdc:mga05p37_213_c1 nmdc:mga05p37_213_c1_21315_22610 391
77 3300050508 nmdc:mga09592_1171_c1 nmdc:mga09592_1171_c1_4263_5558 391
78 3300050509 nmdc:mga0qj67_31281_c1 nmdc:mga0qj67_31281_c1_1962_3257 391
79 3300050510 nmdc:mga06r32_1219_c1 nmdc:mga06r32_1219_c1_10021_11316 391
80 3300050511 nmdc:mga08y16_275_c1 nmdc:mga08y16_275_c1_36182_37477 391
81 3300005367 Ga0070667_100151855 Ga0070667_1001518552 392
82 3300025901 Ga0207688_10059711 Ga0207688_100597112 392
83 3300025940 Ga0207691_10186072 Ga0207691_101860722 392
84 3300033180 Ga0307510_10073832 Ga0307510_100738322 392
85 3300006846 Ga0075430_100004241 Ga0075430_1000042414 393
86 3300039450 Ga0436363_0698487 Ga0436363_0698487_14_1249 393
87 3300050509 nmdc:mga0qj67_129_c1 nmdc:mga0qj67_129_c1_3021_4322 393
88 3300049592 Ga0501076_0051612 Ga0501076_0051612_1308_2582 394
89 3300061734 Ga0530510_0090886 Ga0530510_0090886_681_1955 394
90 3300050493 nmdc:mga0k408_22090_c2 nmdc:mga0k408_22090_c2_566_1777 397
91 3300005937 Ga0081455_10003176 Ga0081455_1000317613 398
92 3300005983 Ga0081540_1000841 Ga0081540_100084111 399
93 3300046459 Ga0495629_0163739 Ga0495629_0163739_319_1533 399
94 3300046472 Ga0495580_0043983 Ga0495580_0043983_39_1253 399
95 3300046529 Ga0495652_0168431 Ga0495652_0168431_428_1642 399
96 3300053088 Ga0500644_0000771 Ga0500644_0000771_1259_2530 399
97 3300053093 Ga0500651_0031020 Ga0500651_0031020_473_1744 399
98 iso_pu_bacteria 8016530956 8016533660 399
99 3300006871 Ga0075434_100083230 Ga0075434_1000832301 400
100 3300007076 Ga0075435_100119473 Ga0075435_1001194733 400
101 3300031247 Ga0265340_10014569 Ga0265340_100145692 400
102 3300031249 Ga0265339_10035899 Ga0265339_100358992 400
103 3300050512 nmdc:mga0n895_179945_c1 nmdc:mga0n895_179945_c1_813_2087 400
104 3300050513 nmdc:mga0rr50_169464_c1 nmdc:mga0rr50_169464_c1_192_1466 400
105 iso_pu_bacteria 2937836603 2937837668 400
106 3300031242 Ga0265329_10042580 Ga0265329_100425801 401
107 3300050510 nmdc:mga06r32_6151_c1 nmdc:mga06r32_6151_c1_4679_5941 401
108 3300005471 Ga0070698_100240368 Ga0070698_1002403682 402
109 3300006942 Ga0099824_1018474 Ga0099824_10184744 402
110 3300027357 Ga0209589_1000011 Ga0209589_100001141 402
111 3300027361 Ga0209489_100012 Ga0209489_10001241 402
112 3300027363 Ga0209700_100019 Ga0209700_10001941 402
113 3300028786 Ga0307517_10000279 Ga0307517_1000027916 402
114 3300046543 Ga0495645_0007155 Ga0495645_0007155_3931_5193 402
115 3300053087 Ga0500643_002271 Ga0500643_002271_7470_8741 402
116 3300053119 Ga0500595_000003 Ga0500595_000003_415015_416286 402
117 3300053153 Ga0500616_0000002 Ga0500616_0000002_1601655_1602926 402
118 3300005365 Ga0070688_100026113 Ga0070688_1000261132 403
119 3300005436 Ga0070713_100001462 Ga0070713_10000146217 403
120 3300005456 Ga0070678_100162002 Ga0070678_1001620022 403
121 3300005459 Ga0068867_100059990 Ga0068867_1000599903 403
122 3300005548 Ga0070665_100073338 Ga0070665_1000733385 403
123 3300005615 Ga0070702_100034040 Ga0070702_1000340401 403
124 3300005618 Ga0068864_100049929 Ga0068864_1000499292 403
125 3300005841 Ga0068863_100074750 Ga0068863_1000747503 403
126 3300005842 Ga0068858_100031960 Ga0068858_1000319602 403
127 3300006028 Ga0070717_10006207 Ga0070717_1000620711 403
128 3300006038 Ga0075365_10033778 Ga0075365_100337784 403
129 3300006163 Ga0070715_10035264 Ga0070715_100352641 403
130 3300006237 Ga0097621_100040392 Ga0097621_1000403926 403
131 3300006358 Ga0068871_100001491 Ga0068871_1000014912 403
132 3300009098 Ga0105245_10078010 Ga0105245_100780102 403
133 3300009101 Ga0105247_10021886 Ga0105247_100218862 403
134 3300009148 Ga0105243_10178387 Ga0105243_101783871 403
135 3300009174 Ga0105241_10118948 Ga0105241_101189483 403
136 3300009177 Ga0105248_10027462 Ga0105248_100274629 403
137 3300013296 Ga0157374_10019281 Ga0157374_100192819 403
138 3300013306 Ga0163162_10281427 Ga0163162_102814272 403
139 3300013308 Ga0157375_10371170 Ga0157375_103711702 403
140 3300014969 Ga0157376_10292110 Ga0157376_102921102 403
141 3300025900 Ga0207710_10008721 Ga0207710_100087212 403
142 3300025906 Ga0207699_10004027 Ga0207699_100040277 403
143 3300025907 Ga0207645_10066067 Ga0207645_100660672 403
144 3300025915 Ga0207693_10000506 Ga0207693_1000050633 403
145 3300025916 Ga0207663_10004038 Ga0207663_100040382 403
146 3300025925 Ga0207650_10205616 Ga0207650_102056162 403
147 3300025927 Ga0207687_10021155 Ga0207687_100211552 403
148 3300025928 Ga0207700_10000668 Ga0207700_1000066815 403
149 3300025933 Ga0207706_10107404 Ga0207706_101074042 403
150 3300025934 Ga0207686_10040459 Ga0207686_100404592 403
151 3300025935 Ga0207709_10212003 Ga0207709_102120031 403
152 3300025937 Ga0207669_10107067 Ga0207669_101070672 403
153 3300025939 Ga0207665_10000528 Ga0207665_1000052812 403
154 3300025941 Ga0207711_10009654 Ga0207711_1000965412 403
155 3300025960 Ga0207651_10065505 Ga0207651_100655052 403
156 3300026089 Ga0207648_10184860 Ga0207648_101848602 403
157 3300026095 Ga0207676_10097698 Ga0207676_100976982 403
158 3300026121 Ga0207683_10009714 Ga0207683_100097149 403
159 3300035170 Ga0373943_0025222 Ga0373943_0025222_79_1311 403
160 3300035171 Ga0373946_0064791 Ga0373946_0064791_167_1399 403
161 3300035172 Ga0373955_0064066 Ga0373955_0064066_496_1728 403
162 3300035724 Ga0373933_0001821 Ga0373933_0001821_8797_10074 403
163 3300046461 Ga0495641_0011415 Ga0495641_0011415_1296_2528 403
164 3300046463 Ga0495653_0032304 Ga0495653_0032304_1122_2354 403
165 3300046475 Ga0495639_0015341 Ga0495639_0015341_2036_3268 403
166 3300046520 Ga0495637_0048728 Ga0495637_0048728_511_1743 403
167 3300046531 Ga0495665_0057438 Ga0495665_0057438_232_1464 403
168 3300046559 Ga0495667_0016295 Ga0495667_0016295_421_1653 403
169 3300046663 Ga0495635_0019273 Ga0495635_0019273_865_2097 403
170 3300046683 Ga0495658_0005502 Ga0495658_0005502_4277_5509 403
171 3300046689 Ga0495613_0025092 Ga0495613_0025092_2493_3725 403
172 3300046809 Ga0495600_0005381 Ga0495600_0005381_2874_4106 403
173 3300047315 Ga0495581_0018927 Ga0495581_0018927_1314_2546 403
174 3300047319 Ga0495674_0167781 Ga0495674_0167781_232_1464 403
175 3300047322 Ga0495680_0024280 Ga0495680_0024280_165_1397 403
176 3300047471 Ga0495684_0028321 Ga0495684_0028321_2612_3844 403
177 3300047472 Ga0495686_0057595 Ga0495686_0057595_1033_2316 403
178 3300048903 Ga0496100_0024358 Ga0496100_0024358_2305_3537 403
179 3300048904 Ga0496101_0143379 Ga0496101_0143379_22_1254 403
180 3300048905 Ga0496102_0405944 Ga0496102_0405944_22_1254 403
181 3300048907 Ga0496104_0047727 Ga0496104_0047727_219_1451 403
182 3300048907 Ga0496104_0156936 Ga0496104_0156936_930_2162 403
183 3300048908 Ga0496105_0047299 Ga0496105_0047299_2091_3323 403
184 3300048910 Ga0496107_0059812 Ga0496107_0059812_733_1965 403
185 3300048911 Ga0496108_0009810 Ga0496108_0009810_1165_2397 403
186 3300048912 Ga0496109_0009381 Ga0496109_0009381_5164_6396 403
187 3300048912 Ga0496109_0031864 Ga0496109_0031864_918_2150 403
188 3300048913 Ga0496110_0013781 Ga0496110_0013781_3183_4415 403
189 3300048913 Ga0496110_0033318 Ga0496110_0033318_2514_3746 403
190 3300048914 Ga0496111_0029039 Ga0496111_0029039_2670_3902 403
191 3300048915 Ga0496112_0034956 Ga0496112_0034956_2305_3537 403
192 3300048915 Ga0496112_0065820 Ga0496112_0065820_245_1477 403
193 3300048916 Ga0496113_0067913 Ga0496113_0067913_808_2040 403
194 3300048916 Ga0496113_0152713 Ga0496113_0152713_22_1254 403
195 3300048917 Ga0496114_0009690 Ga0496114_0009690_793_2025 403
196 3300048918 Ga0496115_0011581 Ga0496115_0011581_22_1254 403
197 3300048929 Ga0496126_0247949 Ga0496126_0247949_163_1395 403
198 3300050512 nmdc:mga0n895_72723_c1 nmdc:mga0n895_72723_c1_439_1671 403
199 3300053085 Ga0495619_0011258 Ga0495619_0011258_2111_3343 403
200 3300053131 Ga0500652_005161 Ga0500652_005161_1953_3224 403
201 3300053730 Ga0500645_000226 Ga0500645_000226_9523_10794 403
202 iso_pu_bacteria 2924754689 2924760248 403
203 3300033442 Ga0315911_1000003 Ga0315911_1000003447 404
204 3300046474 Ga0495605_0056668 Ga0495605_0056668_436_1719 404
205 3300048905 Ga0496102_0155765 Ga0496102_0155765_650_1939 404
206 3300048908 Ga0496105_0051555 Ga0496105_0051555_1265_2548 404
207 3300048910 Ga0496107_0116062 Ga0496107_0116062_652_1935 404
208 3300048916 Ga0496113_0139736 Ga0496113_0139736_395_1678 404
209 3300048918 Ga0496115_0176244 Ga0496115_0176244_279_1562 404
210 3300048922 Ga0496119_0006875 Ga0496119_0006875_1886_3154 404
211 3300048929 Ga0496126_0045158 Ga0496126_0045158_78_1361 404
212 3300005439 Ga0070711_100003772 Ga0070711_1000037722 405
213 3300006175 Ga0070712_100091514 Ga0070712_1000915141 405
214 3300025898 Ga0207692_10017877 Ga0207692_100178772 405
215 3300025915 Ga0207693_10062713 Ga0207693_100627132 405
216 3300048909 Ga0496106_0048244 Ga0496106_0048244_1136_2425 405
217 3300048916 Ga0496113_0038477 Ga0496113_0038477_305_1594 405
218 iso_pu_bacteria 3003665799 3003670217 405
219 3300005455 Ga0070663_100034033 Ga0070663_1000340332 406
220 3300005617 Ga0068859_100383909 Ga0068859_1003839091 406
221 3300006931 Ga0097620_100383932 Ga0097620_1003839322 406
222 3300026067 Ga0207678_10034200 Ga0207678_100342002 406
223 3300044658 Ga0466972_0000079 Ga0466972_0000079_69315_70601 406
224 3300046506 Ga0495583_0055522 Ga0495583_0055522_65_1348 406
225 3300048929 Ga0496126_0127252 Ga0496126_0127252_474_1760 406
226 3300053094 Ga0500566_0000011 Ga0500566_0000011_69105_70385 406
227 3300053095 Ga0500640_001527 Ga0500640_001527_2630_3910 406
228 3300053111 Ga0500572_000065 Ga0500572_000065_33_1313 406
229 3300053136 Ga0500559_0001798 Ga0500559_0001798_5465_6745 406
230 3300053150 Ga0500603_000269 Ga0500603_000269_9031_10311 406
231 3300053159 Ga0500630_000832 Ga0500630_000832_6014_7294 406
232 3300053163 Ga0500639_000079 Ga0500639_000079_11319_12599 406
233 3300053178 Ga0500637_0085364 Ga0500637_0085364_156_1436 406
234 3300053731 Ga0500609_002277 Ga0500609_002277_806_2080 406
235 3300053735 Ga0500596_000987 Ga0500596_000987_159_1439 406
236 3300003215 JGI25153J46596_10000317 JGI25153J46596_1000031712 407
237 3300025261 Ga0209233_1003610 Ga0209233_10036105 407
238 3300025272 Ga0209455_1005249 Ga0209455_10052492 407
239 3300025297 Ga0209758_1000120 Ga0209758_100012034 407
240 3300025297 Ga0209758_1018387 Ga0209758_10183872 407
241 3300047469 Ga0495673_0036405 Ga0495673_0036405_889_2166 407
242 3300048920 Ga0496117_0064449 Ga0496117_0064449_349_1632 407
243 3300048921 Ga0496118_0116503 Ga0496118_0116503_206_1489 407
244 3300053086 Ga0500578_0051297 Ga0500578_0051297_114_1397 407
245 3300053092 Ga0500583_0052684 Ga0500583_0052684_603_1874 407
246 3300053093 Ga0500651_0090684 Ga0500651_0090684_585_1868 407
247 3300053103 Ga0500555_001186 Ga0500555_001186_5219_6490 407
248 3300005344 Ga0070661_100148532 Ga0070661_1001485322 408
249 3300005367 Ga0070667_100111159 Ga0070667_1001111591 408
250 3300005548 Ga0070665_100053413 Ga0070665_1000534136 408
251 3300005577 Ga0068857_100059974 Ga0068857_1000599742 408
252 3300005614 Ga0068856_100079699 Ga0068856_1000796994 408
253 3300006051 Ga0075364_10074428 Ga0075364_100744283 408
254 3300009545 Ga0105237_10021234 Ga0105237_100212343 408
255 3300009551 Ga0105238_10027647 Ga0105238_100276477 408
256 3300013296 Ga0157374_10063878 Ga0157374_100638783 408
257 3300014325 Ga0163163_10200834 Ga0163163_102008342 408
258 3300025904 Ga0207647_10008820 Ga0207647_100088202 408
259 3300025914 Ga0207671_10056823 Ga0207671_100568231 408
260 3300025920 Ga0207649_10109100 Ga0207649_101091002 408
261 3300025932 Ga0207690_10172879 Ga0207690_101728792 408
262 3300025972 Ga0207668_10143392 Ga0207668_101433922 408
263 3300026067 Ga0207678_10022393 Ga0207678_100223932 408
264 3300026067 Ga0207678_10023935 Ga0207678_100239352 408
265 3300026116 Ga0207674_10078663 Ga0207674_100786635 408
266 3300026116 Ga0207674_10128182 Ga0207674_101281822 408
267 3300028380 Ga0268265_10118725 Ga0268265_101187253 408
268 3300031247 Ga0265340_10010905 Ga0265340_100109053 408
269 3300037068 Ga0373925_0038098 Ga0373925_0038098_1702_2976 408
270 3300046522 Ga0495643_0005954 Ga0495643_0005954_5911_7185 408
271 3300046542 Ga0495597_0031638 Ga0495597_0031638_815_2089 408
272 3300046616 Ga0495668_0066567 Ga0495668_0066567_473_1747 408
273 3300046694 Ga0495649_0059545 Ga0495649_0059545_132_1406 408
274 3300047443 Ga0495687_014302 Ga0495687_014302_1797_3071 408
275 3300048905 Ga0496102_0047832 Ga0496102_0047832_2172_3446 408
276 3300048906 Ga0496103_0056345 Ga0496103_0056345_820_2094 408
277 3300048927 Ga0496124_0190514 Ga0496124_0190514_77_1351 408
278 3300050492 nmdc:mga0yw44_134932_c1 nmdc:mga0yw44_134932_c1_91_1365 408
279 3300050494 nmdc:mga06z11_108051_c1 nmdc:mga06z11_108051_c1_237_1511 408
280 3300050495 nmdc:mga04h51_25898_c1 nmdc:mga04h51_25898_c1_250_1524 408
281 3300050496 nmdc:mga07m45_63476_c1 nmdc:mga07m45_63476_c1_89_1363 408
282 3300003771 Ga0055526_1025395 Ga0055526_10253951 409
283 3300005434 Ga0070709_10026207 Ga0070709_100262071 409
284 3300005437 Ga0070710_10007682 Ga0070710_100076823 409
285 3300005983 Ga0081540_1008125 Ga0081540_10081252 409
286 3300011119 Ga0105246_10013775 Ga0105246_100137752 409
287 3300025297 Ga0209758_1032806 Ga0209758_10328063 409
288 3300025905 Ga0207685_10028315 Ga0207685_100283152 409
289 3300025915 Ga0207693_10007874 Ga0207693_100078747 409
290 3300025929 Ga0207664_10102478 Ga0207664_101024783 409
291 3300025939 Ga0207665_10001385 Ga0207665_100013858 409
292 3300035170 Ga0373943_0037571 Ga0373943_0037571_615_1895 409
293 3300037068 Ga0373925_0027047 Ga0373925_0027047_12_1292 409
294 3300044694 Ga0466963_0007491 Ga0466963_0007491_3744_5018 409
295 3300046459 Ga0495629_0009871 Ga0495629_0009871_5592_6875 409
296 3300046460 Ga0495638_0020090 Ga0495638_0020090_155_1438 409
297 3300046529 Ga0495652_0097969 Ga0495652_0097969_504_1787 409
298 3300048923 Ga0496120_0005140 Ga0496120_0005140_8875_10158 409
299 3300053085 Ga0495619_0058742 Ga0495619_0058742_159_1439 409
300 3300053153 Ga0500616_0002075 Ga0500616_0002075_8423_9700 409
301 3300053736 Ga0500599_002636 Ga0500599_002636_791_2074 409
302 3300053737 Ga0500601_005302 Ga0500601_005302_99_1394 409
303 iso_pu_bacteria 2508501127 2509140462 409
304 iso_pu_bacteria 2524023205 2524436080 409
305 iso_pu_bacteria 2597489875 2597813935 409
306 iso_pu_bacteria 2744054633 2745080024 409
307 iso_pu_bacteria 2841734538 2841740203 409
308 iso_pu_bacteria 2856342000 2856344111 409
309 iso_pu_bacteria 2871474448 2871480009 409
310 iso_pu_bacteria 2885312484 2885315494 409
311 iso_pu_bacteria 2888343758 2888347628 409
312 iso_pu_bacteria 2958071322 2958077696 409
313 iso_pu_bacteria 2970524798 2970530301 409
314 iso_pu_bacteria 2970540015 2970542806 409
315 iso_pu_bacteria 8004395343 8004401455 409
316 iso_pu_bacteria 8004633249 8004637161 409
317 3300014325 Ga0163163_10334734 Ga0163163_103347341 410
318 3300021321 Ga0214542_1001925 Ga0214542_100192535 410
319 3300021324 Ga0214545_1000003 Ga0214545_1000003214 410
320 3300021327 Ga0214543_1000002 Ga0214543_1000002552 410
321 3300025907 Ga0207645_10081474 Ga0207645_100814741 410
322 3300033180 Ga0307510_10037733 Ga0307510_100377334 410
323 3300037312 Ga0395899_0060103 Ga0395899_0060103_774_2045 410
324 3300037418 Ga0395900_0003092 Ga0395900_0003092_5509_6780 410
325 3300038443 Ga0395901_0001902 Ga0395901_0001902_16849_18120 410
326 3300038443 Ga0395901_0209340 Ga0395901_0209340_755_2026 410
327 3300046507 Ga0495606_0006998 Ga0495606_0006998_4677_5960 410
328 3300046694 Ga0495649_0038307 Ga0495649_0038307_231_1514 410
329 3300049460 Ga0495682_0018342 Ga0495682_0018342_25_1308 410
330 3300053121 Ga0500607_022647 Ga0500607_022647_955_2238 410
331 3300053123 Ga0500614_017278 Ga0500614_017278_35_1318 410
332 3300053177 Ga0500636_0000041 Ga0500636_0000041_15716_16999 410
333 iso_pu_bacteria 2849076700 2849078190 410
334 3300005471 Ga0070698_100080213 Ga0070698_1000802133 411
335 3300006028 Ga0070717_10007544 Ga0070717_100075446 411
336 3300006175 Ga0070712_100173947 Ga0070712_1001739472 411
337 3300013306 Ga0163162_10225195 Ga0163162_102251952 411
338 3300025254 Ga0209148_1000812 Ga0209148_100081219 411
339 3300025272 Ga0209455_1005452 Ga0209455_10054523 411
340 3300025297 Ga0209758_1002848 Ga0209758_10028488 411
341 3300025915 Ga0207693_10095504 Ga0207693_100955042 411
342 3300035207 Ga0373942_0003177 Ga0373942_0003177_1441_2700 411
343 3300035695 Ga0373927_0045712 Ga0373927_0045712_1269_2549 411
344 3300046507 Ga0495606_0003362 Ga0495606_0003362_223_1500 411
345 3300048929 Ga0496126_0239357 Ga0496126_0239357_212_1495 411
346 3300009101 Ga0105247_10081130 Ga0105247_100811303 412
347 3300046516 Ga0495628_0042625 Ga0495628_0042625_2156_3517 412
348 3300046535 Ga0495586_0056589 Ga0495586_0056589_420_1781 412
349 3300046536 Ga0495587_0044824 Ga0495587_0044824_205_1566 412
350 3300005457 Ga0070662_100256264 Ga0070662_1002562641 413
351 3300006048 Ga0075363_100009226 Ga0075363_1000092264 413
352 3300006051 Ga0075364_10023541 Ga0075364_100235413 413
353 3300006177 Ga0075362_10019648 Ga0075362_100196482 413
354 3300006186 Ga0075369_10032411 Ga0075369_100324112 413
355 3300006195 Ga0075366_10038702 Ga0075366_100387023 413
356 3300025933 Ga0207706_10015391 Ga0207706_100153913 413
357 3300050489 nmdc:mga03683_32601_c1 nmdc:mga03683_32601_c1_718_1977 413
358 3300050493 nmdc:mga0k408_25121_c1 nmdc:mga0k408_25121_c1_1670_2929 413
359 3300050516 nmdc:mga0sz30_34204_c1 nmdc:mga0sz30_34204_c1_203_1462 413
360 iso_pu_bacteria 2513237104 2513721517 413
361 iso_pu_bacteria 2922393267 2922396860 413
362 3300005329 Ga0070683_100035975 Ga0070683_1000359753 414
363 3300005458 Ga0070681_10147603 Ga0070681_101476032 414
364 3300005530 Ga0070679_100139466 Ga0070679_1001394662 414
365 3300005535 Ga0070684_100009391 Ga0070684_1000093917 414
366 3300009553 Ga0105249_10295488 Ga0105249_102954881 414
367 3300010159 Ga0099796_10046613 Ga0099796_100466131 414
368 3300025912 Ga0207707_10031075 Ga0207707_100310756 414
369 3300025916 Ga0207663_10006243 Ga0207663_100062435 414
370 3300025921 Ga0207652_10115718 Ga0207652_101157182 414
371 3300025944 Ga0207661_10008452 Ga0207661_100084525 414
372 3300025944 Ga0207661_10291186 Ga0207661_102911861 414
373 3300053094 Ga0500566_0000412 Ga0500566_0000412_11390_12649 414
374 3300053105 Ga0500557_000062 Ga0500557_000062_37347_38606 414
375 3300053130 Ga0500642_0000127 Ga0500642_0000127_18935_20194 414
376 iso_pu_bacteria 2507262055 2507507463 414
377 iso_pu_bacteria 2508501009 2508541577 414
378 iso_pu_bacteria 2508501042 2508692880 414
379 iso_pu_bacteria 2511231028 2511398979 414
380 iso_pu_bacteria 2513237092 2513621669 414
381 iso_pu_bacteria 2513237096 2513657139 414
382 iso_pu_bacteria 2513237137 2513857027 414
383 iso_pu_bacteria 2513237139 2513878358 414
384 iso_pu_bacteria 2513237145 2513919147 414
385 iso_pu_bacteria 2513237161 2514011715 414
386 iso_pu_bacteria 2515154112 2515626270 414
387 iso_pu_bacteria 2517572143 2517891159 414
388 iso_pu_bacteria 2617270735 2617352718 414
389 iso_pu_bacteria 2728368998 2728755524 414
390 iso_pu_bacteria 2791355196 2793061081 414
391 iso_pu_bacteria 2791355197 2793066502 414
392 iso_pu_bacteria 2802429603 2805920581 414
393 iso_pu_bacteria 2816332527 2818236767 414
394 iso_pu_bacteria 2824609381 2824611778 414
395 iso_pu_bacteria 2824653114 2824655014 414
396 iso_pu_bacteria 2824671348 2824675199 414
397 iso_pu_bacteria 2824679649 2824681575 414
398 iso_pu_bacteria 2824687955 2824690053 414
399 iso_pu_bacteria 2824696289 2824701150 414
400 iso_pu_bacteria 2824773399 2824776677 414
401 iso_pu_bacteria 2838122688 2838127373 414
402 iso_pu_bacteria 2841941048 2841946392 414
403 iso_pu_bacteria 2841949485 2841957111 414
404 iso_pu_bacteria 2841966195 2841972902 414
405 iso_pu_bacteria 2841974524 2841978426 414
406 iso_pu_bacteria 2841983080 2841987472 414
407 iso_pu_bacteria 2842038055 2842040855 414
408 iso_pu_bacteria 2842045827 2842046200 414
409 iso_pu_bacteria 2847930680 2847937534 414
410 iso_pu_bacteria 2847939898 2847947962 414
411 iso_pu_bacteria 2857509624 2857511351 414
412 iso_pu_bacteria 2874590934 2874598579 414
413 iso_pu_bacteria 2874612657 2874616764 414
414 iso_pu_bacteria 2874620515 2874628286 414
415 iso_pu_bacteria 2874645413 2874652032 414
416 iso_pu_bacteria 2876761206 2876768291 414
417 iso_pu_bacteria 2876771140 2876778617 414
418 iso_pu_bacteria 2876818435 2876823422 414
419 iso_pu_bacteria 2879074833 2879082410 414
420 iso_pu_bacteria 2879083081 2879084947 414
421 iso_pu_bacteria 2879127579 2879131809 414
422 iso_pu_bacteria 2879142872 2879150145 414
423 iso_pu_bacteria 2881364244 2881370114 414
424 iso_pu_bacteria 2881665667 2881670114 414
425 iso_pu_bacteria 2885366525 2885370179 414
426 iso_pu_bacteria 2885409591 2885414370 414
427 iso_pu_bacteria 2888378607 2888385690 414
428 iso_pu_bacteria 2888388044 2888392577 414
429 iso_pu_bacteria 2888419890 2888425813 414
430 iso_pu_bacteria 2903748898 2903752222 414
431 iso_pu_bacteria 2904666416 2904674095 414
432 iso_pu_bacteria 2906610324 2906616339 414
433 iso_pu_bacteria 2906643746 2906651217 414
434 iso_pu_bacteria 2906660503 2906662878 414
435 iso_pu_bacteria 2908775508 2908781388 414
436 iso_pu_bacteria 2922361189 2922361758 414
437 iso_pu_bacteria 2922386360 2922386997 414
438 iso_pu_bacteria 2922425934 2922431663 414
439 iso_pu_bacteria 2935608549 2935610033 414
440 iso_pu_bacteria 2935630451 2935635787 414
441 iso_pu_bacteria 2935648319 2935656357 414
442 iso_pu_bacteria 2935656913 2935660087 414
443 iso_pu_bacteria 2935769743 2935776444 414
444 iso_pu_bacteria 2935777560 2935780837 414
445 iso_pu_bacteria 2935785616 2935792331 414
446 iso_pu_bacteria 2935793552 2935800494 414
447 iso_pu_bacteria 2935819856 2935823193 414
448 iso_pu_bacteria 2935847175 2935848775 414
449 iso_pu_bacteria 2935908558 2935909423 414
450 iso_pu_bacteria 2935916978 2935917145 414
451 iso_pu_bacteria 2935926038 2935926904 414
452 iso_pu_bacteria 2935934488 2935937252 414
453 iso_pu_bacteria 2935942939 2935944445 414
454 iso_pu_bacteria 2935951376 2935952882 414
455 iso_pu_bacteria 2935967501 2935969722 414
456 iso_pu_bacteria 2935975950 2935976333 414
457 iso_pu_bacteria 2935984226 2935991826 414
458 iso_pu_bacteria 2936011229 2936014503 414
459 iso_pu_bacteria 2936019824 2936027830 414
460 iso_pu_bacteria 2936028420 2936031300 414
461 iso_pu_bacteria 2936046547 2936049609 414
462 iso_pu_bacteria 2936055302 2936061175 414
463 iso_pu_bacteria 2941507105 2941512376 414
464 iso_pu_bacteria 2941515067 2941520119 414
465 iso_pu_bacteria 2941523033 2941528268 414
466 iso_pu_bacteria 3005474847 3005481462 414
467 iso_pu_bacteria 3005483717 3005488442 414
468 iso_pu_bacteria 3005506211 3005508231 414
469 iso_pu_bacteria 3005587118 3005588267 414
470 iso_pu_bacteria 8016522445 8016528501 414
471 iso_pu_bacteria 8016539877 8016546882 414
472 iso_pu_bacteria 8016548790 8016555237 414
473 iso_pu_bacteria 8016575299 8016576195 414
474 iso_pu_bacteria 8016595262 8016601334 414
475 iso_pu_bacteria 8016603502 8016609096 414
476 iso_pu_bacteria 8016613128 8016615808 414
477 iso_pu_bacteria 8019530166 8019533440 414
478 iso_pu_bacteria 8019547302 8019552473 414
479 iso_pu_bacteria 8019555841 8019565116 414
480 iso_pu_bacteria 8019565922 8019575218 414
481 iso_pu_bacteria 8019619141 8019620022 414
482 iso_pu_bacteria 8019629233 8019633082 414
483 iso_pu_bacteria 8019659431 8019660964 414
484 iso_pu_bacteria 8019668869 8019670524 414
485 iso_pu_bacteria 8019678201 8019685708 414
486 iso_pu_bacteria 8019687851 8019691285 414
487 iso_pu_bacteria 8056689827 8056690619 414
488 3300005445 Ga0070708_100029298 Ga0070708_1000292983 415
489 3300005468 Ga0070707_100022473 Ga0070707_1000224735 415
490 3300005530 Ga0070679_100228455 Ga0070679_1002284552 415
491 3300005536 Ga0070697_100061449 Ga0070697_1000614493 415
492 3300006028 Ga0070717_10021364 Ga0070717_100213644 415
493 3300006852 Ga0075433_10036313 Ga0075433_100363132 415
494 3300006880 Ga0075429_100012545 Ga0075429_1000125453 415
495 3300009147 Ga0114129_10007257 Ga0114129_100072575 415
496 3300009147 Ga0114129_10021318 Ga0114129_100213183 415
497 3300013297 Ga0157378_10004961 Ga0157378_100049617 415
498 3300025910 Ga0207684_10003339 Ga0207684_100033395 415
499 3300025912 Ga0207707_10027833 Ga0207707_100278332 415
500 3300025922 Ga0207646_10002996 Ga0207646_1000299615 415
501 3300026121 Ga0207683_10262268 Ga0207683_102622682 415
502 3300046455 Ga0495603_0086322 Ga0495603_0086322_277_1539 415
503 3300048924 Ga0496121_0014245 Ga0496121_0014245_825_2108 415
504 3300050515 nmdc:mga0a205_5452_c1 nmdc:mga0a205_5452_c1_7161_8432 415
505 iso_pu_bacteria 2513237094 2513636902 415
506 iso_pu_bacteria 2528768022 2528852873 415
507 iso_pu_bacteria 2667528175 2671123239 415
508 iso_pu_bacteria 2824661429 2824664031 415
509 iso_pu_bacteria 2824704595 2824711111 415
510 iso_pu_bacteria 2824753945 2824760454 415
511 iso_pu_bacteria 2824763712 2824766557 415
512 iso_pu_bacteria 2841957949 2841965633 415
513 iso_pu_bacteria 2844315083 2844320212 415
514 iso_pu_bacteria 2874628541 2874630117 415
515 iso_pu_bacteria 2879099564 2879107930 415
516 iso_pu_bacteria 2903727486 2903731198 415
517 iso_pu_bacteria 2904690495 2904698941 415
518 iso_pu_bacteria 2904711408 2904711745 415
519 iso_pu_bacteria 2906602504 2906610035 415
520 iso_pu_bacteria 2906626472 2906629224 415
521 iso_pu_bacteria 2929615660 2929621250 415
522 iso_pu_bacteria 2929624759 2929625919 415
523 iso_pu_bacteria 2932784394 2932785196 415
524 iso_pu_bacteria 2932809354 2932810230 415
525 iso_pu_bacteria 2932818245 2932821802 415
526 iso_pu_bacteria 2932828146 2932829032 415
527 iso_pu_bacteria 2933577622 2933582881 415
528 iso_pu_bacteria 2935616580 2935619548 415
529 iso_pu_bacteria 2935638405 2935638528 415
530 iso_pu_bacteria 2935665750 2935666620 415
531 iso_pu_bacteria 2935675223 2935682190 415
532 iso_pu_bacteria 2935684952 2935691154 415
533 iso_pu_bacteria 2935694250 2935694421 415
534 iso_pu_bacteria 2935703347 2935703534 415
535 iso_pu_bacteria 2935713505 2935718535 415
536 iso_pu_bacteria 2935722832 2935727485 415
537 iso_pu_bacteria 2935732158 2935736188 415
538 iso_pu_bacteria 2935741537 2935745568 415
539 iso_pu_bacteria 2935750917 2935755949 415
540 iso_pu_bacteria 2935760218 2935760789 415
541 iso_pu_bacteria 2935801545 2935801671 415
542 iso_pu_bacteria 2935810662 2935814919 415
543 iso_pu_bacteria 2935827899 2935828022 415
544 iso_pu_bacteria 2935837841 2935842228 415
545 iso_pu_bacteria 2935855204 2935858136 415
546 iso_pu_bacteria 2935864058 2935868041 415
547 iso_pu_bacteria 2935873716 2935873936 415
548 iso_pu_bacteria 2935992306 2935993140 415
549 iso_pu_bacteria 2936002035 2936003077 415
550 iso_pu_bacteria 2936037263 2936040438 415
551 iso_pu_bacteria 2940556831 2940562076 415
552 iso_pu_bacteria 2941531003 2941531402 415
553 iso_pu_bacteria 2941538514 2941542276 415
554 iso_pu_bacteria 3005594810 3005600525 415
555 iso_pu_bacteria 3005710791 3005715999 415
556 iso_pu_bacteria 8006973647 8006978913 415
557 iso_pu_bacteria 8016511872 8016520429 415
558 iso_pu_bacteria 8016583857 8016594597 415
559 iso_pu_bacteria 8017057580 8017065146 415
560 iso_pu_bacteria 8019576017 8019584536 415
561 iso_pu_bacteria 8019597564 8019598978 415
562 iso_pu_bacteria 8019608314 8019609399 415
563 iso_pu_bacteria 8019648815 8019649593 415
564 iso_pu_bacteria 8055742211 8055744889 415
565 3300005436 Ga0070713_100052936 Ga0070713_1000529362 416
566 3300005471 Ga0070698_100013803 Ga0070698_1000138032 416
567 3300006846 Ga0075430_100002189 Ga0075430_1000021893 416
568 3300006846 Ga0075430_100044526 Ga0075430_1000445265 416
569 3300006847 Ga0075431_100021216 Ga0075431_1000212163 416
570 3300006880 Ga0075429_100000055 Ga0075429_10000005533 416
571 3300009147 Ga0114129_10012532 Ga0114129_100125325 416
572 3300009147 Ga0114129_10060555 Ga0114129_100605557 416
573 3300025910 Ga0207684_10019497 Ga0207684_100194977 416
574 3300025922 Ga0207646_10003246 Ga0207646_1000324615 416
575 3300025928 Ga0207700_10083120 Ga0207700_100831202 416
576 3300026088 Ga0207641_10198815 Ga0207641_101988152 416
577 3300028381 Ga0268264_10163025 Ga0268264_101630252 416
578 3300031241 Ga0265325_10000599 Ga0265325_1000059911 416
579 3300036401 Ga0373937_0139955 Ga0373937_0139955_462_1733 416
580 3300048918 Ga0496115_0242729 Ga0496115_0242729_154_1425 416
581 3300049592 Ga0501076_0010510 Ga0501076_0010510_1923_3197 416
582 3300050507 nmdc:mga05p37_24611_c1 nmdc:mga05p37_24611_c1_2549_3820 416
583 3300050507 nmdc:mga05p37_54085_c1 nmdc:mga05p37_54085_c1_660_1931 416
584 3300050508 nmdc:mga09592_1606_c1 nmdc:mga09592_1606_c1_1146_2417 416
585 3300050509 nmdc:mga0qj67_885_c1 nmdc:mga0qj67_885_c1_1949_3220 416
586 iso_pu_bacteria 2508501128 2509152283 416
587 iso_pu_bacteria 2513237141 2513892563 416
588 iso_pu_bacteria 2721755755 2723843502 416
589 iso_pu_bacteria 2791355199 2793083970 416
590 3300003215 JGI25153J46596_10005866 JGI25153J46596_100058668 417
591 3300005983 Ga0081540_1008941 Ga0081540_10089415 417
592 3300006038 Ga0075365_10096957 Ga0075365_100969572 417
593 3300006175 Ga0070712_100038780 Ga0070712_1000387802 417
594 3300014325 Ga0163163_10135612 Ga0163163_101356123 417
595 3300025906 Ga0207699_10014207 Ga0207699_100142075 417
596 3300025915 Ga0207693_10002637 Ga0207693_100026374 417
597 3300025916 Ga0207663_10062817 Ga0207663_100628173 417
598 3300026067 Ga0207678_10035164 Ga0207678_100351645 417
599 3300028379 Ga0268266_10007625 Ga0268266_100076257 417
600 3300039437 Ga0436365_1571642 Ga0436365_1571642_14_1285 417
601 3300039450 Ga0436363_0621011 Ga0436363_0621011_848_2119 417
602 3300048907 Ga0496104_0209150 Ga0496104_0209150_472_1746 417
603 3300048929 Ga0496126_0073717 Ga0496126_0073717_1124_2398 417
604 3300005262 Ga0065165_1004585 Ga0065165_10045856 418
605 3300005329 Ga0070683_100244080 Ga0070683_1002440802 418
606 3300005340 Ga0070689_100056909 Ga0070689_1000569091 418
607 3300005434 Ga0070709_10002197 Ga0070709_100021977 418
608 3300005434 Ga0070709_10010839 Ga0070709_100108394 418
609 3300005436 Ga0070713_100115088 Ga0070713_1001150882 418
610 3300005436 Ga0070713_100166983 Ga0070713_1001669833 418
611 3300005437 Ga0070710_10000678 Ga0070710_100006784 418
612 3300005437 Ga0070710_10003896 Ga0070710_100038965 418
613 3300005439 Ga0070711_100000465 Ga0070711_1000004653 418
614 3300005439 Ga0070711_100087288 Ga0070711_1000872882 418
615 3300005563 Ga0068855_100306921 Ga0068855_1003069212 418
616 3300005616 Ga0068852_100038198 Ga0068852_1000381986 418
617 3300005718 Ga0068866_10087823 Ga0068866_100878232 418
618 3300005985 Ga0081539_10055131 Ga0081539_100551312 418
619 3300006028 Ga0070717_10134682 Ga0070717_101346822 418
620 3300006038 Ga0075365_10038742 Ga0075365_100387423 418
621 3300006175 Ga0070712_100022680 Ga0070712_1000226806 418
622 3300006237 Ga0097621_100094887 Ga0097621_1000948872 418
623 3300006844 Ga0075428_100269582 Ga0075428_1002695822 418
624 3300006871 Ga0075434_100260056 Ga0075434_1002600562 418
625 3300006942 Ga0099824_1011502 Ga0099824_10115025 418
626 3300009098 Ga0105245_10048961 Ga0105245_100489612 418
627 3300009174 Ga0105241_10029756 Ga0105241_100297565 418
628 3300009545 Ga0105237_10228750 Ga0105237_102287501 418
629 3300009545 Ga0105237_10380401 Ga0105237_103804011 418
630 3300013296 Ga0157374_10129211 Ga0157374_101292112 418
631 3300013297 Ga0157378_10038833 Ga0157378_100388332 418
632 3300014968 Ga0157379_10136897 Ga0157379_101368972 418
633 3300025230 Ga0209563_100325 Ga0209563_1003252 418
634 3300025302 Ga0207426_1000328 Ga0207426_10003285 418
635 3300025898 Ga0207692_10000797 Ga0207692_100007976 418
636 3300025898 Ga0207692_10006627 Ga0207692_100066275 418
637 3300025905 Ga0207685_10002427 Ga0207685_100024272 418
638 3300025906 Ga0207699_10001610 Ga0207699_100016107 418
639 3300025908 Ga0207643_10058265 Ga0207643_100582652 418
640 3300025911 Ga0207654_10120122 Ga0207654_101201222 418
641 3300025912 Ga0207707_10141869 Ga0207707_101418692 418
642 3300025915 Ga0207693_10034047 Ga0207693_100340476 418
643 3300025916 Ga0207663_10021217 Ga0207663_100212172 418
644 3300025916 Ga0207663_10065540 Ga0207663_100655402 418
645 3300025921 Ga0207652_10178835 Ga0207652_101788352 418
646 3300025927 Ga0207687_10053608 Ga0207687_100536084 418
647 3300025928 Ga0207700_10041345 Ga0207700_100413452 418
648 3300025942 Ga0207689_10036827 Ga0207689_100368276 418
649 3300025944 Ga0207661_10018951 Ga0207661_100189515 418
650 3300025944 Ga0207661_10083044 Ga0207661_100830442 418
651 3300025972 Ga0207668_10186534 Ga0207668_101865342 418
652 3300026035 Ga0207703_10045836 Ga0207703_100458362 418
653 3300026041 Ga0207639_10034032 Ga0207639_100340325 418
654 3300026067 Ga0207678_10033211 Ga0207678_100332117 418
655 3300026121 Ga0207683_10091282 Ga0207683_100912822 418
656 3300027296 Ga0209389_1000043 Ga0209389_100004316 418
657 3300027296 Ga0209389_1000077 Ga0209389_100007782 418
658 3300027357 Ga0209589_1000047 Ga0209589_100004795 418
659 3300027361 Ga0209489_100075 Ga0209489_100075127 418
660 3300027361 Ga0209489_100251 Ga0209489_10025182 418
661 3300027363 Ga0209700_100271 Ga0209700_10027182 418
662 3300028379 Ga0268266_10234117 Ga0268266_102341172 418
663 3300035115 Ga0373941_0005728 Ga0373941_0005728_1503_2777 418
664 3300035121 Ga0373960_0014063 Ga0373960_0014063_343_1617 418
665 3300036401 Ga0373937_0216891 Ga0373937_0216891_358_1635 418
666 3300037471 Ga0395905_0084980 Ga0395905_0084980_667_1938 418
667 3300044683 Ga0466965_0068555 Ga0466965_0068555_467_1738 418
668 3300044901 Ga0466960_0006472 Ga0466960_0006472_2539_3810 418
669 3300046477 Ga0495664_0063064 Ga0495664_0063064_647_1933 418
670 3300046533 Ga0495640_0143197 Ga0495640_0143197_221_1498 418
671 3300046679 Ga0495623_0045020 Ga0495623_0045020_645_1931 418
672 3300047317 Ga0495604_0082749 Ga0495604_0082749_86_1372 418
673 3300048905 Ga0496102_0135445 Ga0496102_0135445_217_1488 418
674 3300048907 Ga0496104_0191109 Ga0496104_0191109_352_1623 418
675 3300048909 Ga0496106_0223856 Ga0496106_0223856_107_1378 418
676 3300048915 Ga0496112_0029131 Ga0496112_0029131_3268_4638 418
677 3300048924 Ga0496121_0152966 Ga0496121_0152966_165_1436 418
678 3300048928 Ga0496125_0071057 Ga0496125_0071057_275_1552 418
679 3300049586 Ga0501070_0119773 Ga0501070_0119773_856_2127 418
680 3300049823 Ga0501044_0049412 Ga0501044_0049412_169_1440 418
681 3300053084 Ga0495595_0033994 Ga0495595_0033994_211_1488 418
682 3300053086 Ga0500578_0110590 Ga0500578_0110590_13_1284 418
683 3300003659 JGI25404J52841_10006155 JGI25404J52841_100061551 419
684 3300004625 Ga0055543_1009959 Ga0055543_10099592 419
685 3300005262 Ga0065165_1000747 Ga0065165_100074720 419
686 3300005336 Ga0070680_100093332 Ga0070680_1000933322 419
687 3300005344 Ga0070661_100069576 Ga0070661_1000695763 419
688 3300005456 Ga0070678_100064623 Ga0070678_1000646233 419
689 3300005458 Ga0070681_10103984 Ga0070681_101039842 419
690 3300005548 Ga0070665_100023384 Ga0070665_1000233848 419
691 3300005563 Ga0068855_100210946 Ga0068855_1002109462 419
692 3300005564 Ga0070664_100165643 Ga0070664_1001656432 419
693 3300005614 Ga0068856_100172420 Ga0068856_1001724203 419
694 3300005614 Ga0068856_100268782 Ga0068856_1002687822 419
695 3300005937 Ga0081455_10005955 Ga0081455_1000595510 419
696 3300005983 Ga0081540_1003418 Ga0081540_10034186 419
697 3300005983 Ga0081540_1009558 Ga0081540_10095582 419
698 3300005983 Ga0081540_1021006 Ga0081540_10210066 419
699 3300005983 Ga0081540_1021049 Ga0081540_10210492 419
700 3300005983 Ga0081540_1035588 Ga0081540_10355882 419
701 3300005985 Ga0081539_10000220 Ga0081539_1000022060 419
702 3300006237 Ga0097621_100112416 Ga0097621_1001124162 419
703 3300009093 Ga0105240_10021941 Ga0105240_100219414 419
704 3300009093 Ga0105240_10024721 Ga0105240_100247216 419
705 3300009545 Ga0105237_10031207 Ga0105237_100312074 419
706 3300010375 Ga0105239_10150755 Ga0105239_101507553 419
707 3300013104 Ga0157370_10053036 Ga0157370_100530362 419
708 3300013296 Ga0157374_10024785 Ga0157374_100247852 419
709 3300013306 Ga0163162_10060239 Ga0163162_100602395 419
710 3300013308 Ga0157375_10128467 Ga0157375_101284672 419
711 3300014325 Ga0163163_10060452 Ga0163163_100604526 419
712 3300014969 Ga0157376_10050368 Ga0157376_100503682 419
713 3300025261 Ga0209233_1008563 Ga0209233_10085634 419
714 3300025912 Ga0207707_10117125 Ga0207707_101171252 419
715 3300025913 Ga0207695_10000163 Ga0207695_100001636 419
716 3300025915 Ga0207693_10014584 Ga0207693_100145842 419
717 3300025917 Ga0207660_10022287 Ga0207660_100222872 419
718 3300025920 Ga0207649_10040161 Ga0207649_100401612 419
719 3300025927 Ga0207687_10117944 Ga0207687_101179442 419
720 3300025941 Ga0207711_10018144 Ga0207711_100181447 419
721 3300025949 Ga0207667_10019974 Ga0207667_100199744 419
722 3300026121 Ga0207683_10003797 Ga0207683_100037973 419
723 3300026142 Ga0207698_10060190 Ga0207698_100601902 419
724 3300028794 Ga0307515_10152056 Ga0307515_101520562 419
725 3300035084 Ga0373928_0004389 Ga0373928_0004389_551_1840 419
726 3300035113 Ga0373936_0003178 Ga0373936_0003178_4183_5457 419
727 3300035117 Ga0373953_0003406 Ga0373953_0003406_612_1886 419
728 3300035118 Ga0373954_0068936 Ga0373954_0068936_70_1344 419
729 3300035119 Ga0373956_0007041 Ga0373956_0007041_1335_2696 419
730 3300035120 Ga0373957_0020281 Ga0373957_0020281_34_1308 419
731 3300035170 Ga0373943_0000795 Ga0373943_0000795_12132_13406 419
732 3300035691 Ga0373931_0006081 Ga0373931_0006081_671_1951 419
733 3300035692 Ga0373935_0000536 Ga0373935_0000536_6482_7756 419
734 3300035692 Ga0373935_0017022 Ga0373935_0017022_1547_2908 419
735 3300035695 Ga0373927_0000898 Ga0373927_0000898_8184_9458 419
736 3300035724 Ga0373933_0056140 Ga0373933_0056140_379_1653 419
737 3300035725 Ga0373947_0010479 Ga0373947_0010479_3664_4938 419
738 3300036401 Ga0373937_0054540 Ga0373937_0054540_2105_3379 419
739 3300037068 Ga0373925_0001796 Ga0373925_0001796_2337_3611 419
740 3300037068 Ga0373925_0227748 Ga0373925_0227748_195_1469 419
741 3300045976 Ga0466967_0249181 Ga0466967_0249181_93_1373 419
742 3300046454 Ga0495592_0008855 Ga0495592_0008855_4877_6238 419
743 3300046454 Ga0495592_0029907 Ga0495592_0029907_1452_2726 419
744 3300046455 Ga0495603_0000046 Ga0495603_0000046_44122_45396 419
745 3300046459 Ga0495629_0000071 Ga0495629_0000071_25293_26567 419
746 3300046461 Ga0495641_0009896 Ga0495641_0009896_563_1837 419
747 3300046472 Ga0495580_0000057 Ga0495580_0000057_36335_37609 419
748 3300046473 Ga0495582_0000111 Ga0495582_0000111_14594_15868 419
749 3300046475 Ga0495639_0000108 Ga0495639_0000108_16806_18080 419
750 3300046476 Ga0495662_0000992 Ga0495662_0000992_2353_3627 419
751 3300046477 Ga0495664_0002718 Ga0495664_0002718_2616_3890 419
752 3300046477 Ga0495664_0007884 Ga0495664_0007884_2640_4001 419
753 3300046477 Ga0495664_0030650 Ga0495664_0030650_785_2059 419
754 3300046499 Ga0495594_0000133 Ga0495594_0000133_11825_13099 419
755 3300046507 Ga0495606_0080559 Ga0495606_0080559_161_1441 419
756 3300046507 Ga0495606_0138832 Ga0495606_0138832_45_1319 419
757 3300046517 Ga0495630_0000959 Ga0495630_0000959_7044_8318 419
758 3300046526 Ga0495666_0005822 Ga0495666_0005822_1240_2601 419
759 3300046526 Ga0495666_0032607 Ga0495666_0032607_456_1730 419
760 3300046529 Ga0495652_0042099 Ga0495652_0042099_2455_3729 419
761 3300046531 Ga0495665_0000001 Ga0495665_0000001_53713_54987 419
762 3300046533 Ga0495640_0012179 Ga0495640_0012179_1000_2274 419
763 3300046557 Ga0495622_0001363 Ga0495622_0001363_10246_11520 419
764 3300046558 Ga0495633_0041177 Ga0495633_0041177_489_1850 419
765 3300046559 Ga0495667_0032071 Ga0495667_0032071_2145_3419 419
766 3300046642 Ga0495634_0000046 Ga0495634_0000046_26835_28109 419
767 3300046663 Ga0495635_0000338 Ga0495635_0000338_23709_24983 419
768 3300046674 Ga0495588_0001464 Ga0495588_0001464_6178_7452 419
769 3300046678 Ga0495599_0007149 Ga0495599_0007149_1222_2583 419
770 3300046678 Ga0495599_0124670 Ga0495599_0124670_311_1585 419
771 3300046680 Ga0495646_0007433 Ga0495646_0007433_3272_4633 419
772 3300046680 Ga0495646_0008580 Ga0495646_0008580_4170_5444 419
773 3300046681 Ga0495647_0000754 Ga0495647_0000754_3602_4876 419
774 3300046683 Ga0495658_0000994 Ga0495658_0000994_4469_5743 419
775 3300046689 Ga0495613_0005517 Ga0495613_0005517_1128_2402 419
776 3300046690 Ga0495624_0003652 Ga0495624_0003652_6345_7619 419
777 3300046690 Ga0495624_0050265 Ga0495624_0050265_860_2221 419
778 3300046691 Ga0495670_0004308 Ga0495670_0004308_1508_2869 419
779 3300047315 Ga0495581_0000012 Ga0495581_0000012_18380_19654 419
780 3300047315 Ga0495581_0019391 Ga0495581_0019391_1859_3133 419
781 3300047317 Ga0495604_0009096 Ga0495604_0009096_1760_3121 419
782 3300047319 Ga0495674_0000031 Ga0495674_0000031_21320_22594 419
783 3300047471 Ga0495684_0087681 Ga0495684_0087681_432_1706 419
784 3300047673 Ga0495593_0000008 Ga0495593_0000008_33310_34584 419
785 3300047673 Ga0495593_0089256 Ga0495593_0089256_216_1577 419
786 3300048903 Ga0496100_0048201 Ga0496100_0048201_923_2203 419
787 3300048903 Ga0496100_0057600 Ga0496100_0057600_680_1969 419
788 3300048904 Ga0496101_0006365 Ga0496101_0006365_4338_5618 419
789 3300048905 Ga0496102_0003595 Ga0496102_0003595_6427_7707 419
790 3300048906 Ga0496103_0013766 Ga0496103_0013766_1594_2874 419
791 3300048907 Ga0496104_0091600 Ga0496104_0091600_1243_2523 419
792 3300048907 Ga0496104_0105275 Ga0496104_0105275_1386_2666 419
793 3300048908 Ga0496105_0019331 Ga0496105_0019331_3338_4618 419
794 3300048910 Ga0496107_0000947 Ga0496107_0000947_6920_8200 419
795 3300048911 Ga0496108_0013705 Ga0496108_0013705_3943_5223 419
796 3300048912 Ga0496109_0008951 Ga0496109_0008951_4217_5497 419
797 3300048912 Ga0496109_0048452 Ga0496109_0048452_1330_2619 419
798 3300048913 Ga0496110_0126144 Ga0496110_0126144_636_1916 419
799 3300048915 Ga0496112_0165206 Ga0496112_0165206_153_1433 419
800 3300048916 Ga0496113_0001327 Ga0496113_0001327_5070_6350 419
801 3300048917 Ga0496114_0024353 Ga0496114_0024353_1489_2769 419
802 3300048918 Ga0496115_0000604 Ga0496115_0000604_6960_8240 419
803 3300048918 Ga0496115_0071313 Ga0496115_0071313_386_1660 419
804 3300048924 Ga0496121_0020183 Ga0496121_0020183_3535_4809 419
805 3300048928 Ga0496125_0000048 Ga0496125_0000048_155865_157142 419
806 3300048928 Ga0496125_0000746 Ga0496125_0000746_35837_37114 419
807 3300048929 Ga0496126_0008677 Ga0496126_0008677_2495_3769 419
808 3300050516 nmdc:mga0sz30_50717_c1 nmdc:mga0sz30_50717_c1_434_1708 419
809 3300053077 Ga0495601_0067367 Ga0495601_0067367_591_1952 419
810 3300053084 Ga0495595_0027742 Ga0495595_0027742_1035_2396 419
811 3300053085 Ga0495619_0017972 Ga0495619_0017972_1826_3100 419
812 3300053085 Ga0495619_0062539 Ga0495619_0062539_1054_2343 419
813 3300053094 Ga0500566_0000293 Ga0500566_0000293_15237_16511 419
814 3300053102 Ga0500554_020862 Ga0500554_020862_504_1778 419
815 3300053119 Ga0500595_000395 Ga0500595_000395_26689_27963 419
816 3300053119 Ga0500595_003500 Ga0500595_003500_706_1980 419
817 3300053162 Ga0500638_000370 Ga0500638_000370_8653_9927 419
818 3300053178 Ga0500637_0000026 Ga0500637_0000026_37491_38765 419
819 3300053178 Ga0500637_0053059 Ga0500637_0053059_430_1704 419
820 3300053729 Ga0500625_015998 Ga0500625_015998_1683_2957 419
821 3300055283 Ga0500661_001127 Ga0500661_001127_1457_2731 419
822 3300003203 JGI25406J46586_10000138 JGI25406J46586_100001382 420
823 3300003794 Ga0055531_10008821 Ga0055531_100088212 420
824 3300005262 Ga0065165_1012243 Ga0065165_10122432 420
825 3300005436 Ga0070713_100014026 Ga0070713_1000140263 420
826 3300005436 Ga0070713_100026138 Ga0070713_1000261382 420
827 3300005530 Ga0070679_100100769 Ga0070679_1001007694 420
828 3300005535 Ga0070684_100007961 Ga0070684_1000079616 420
829 3300005563 Ga0068855_100112512 Ga0068855_1001125122 420
830 3300005577 Ga0068857_100037748 Ga0068857_1000377485 420
831 3300005834 Ga0068851_10009836 Ga0068851_100098363 420
832 3300005842 Ga0068858_100202761 Ga0068858_1002027612 420
833 3300005843 Ga0068860_100000360 Ga0068860_10000036041 420
834 3300005985 Ga0081539_10000008 Ga0081539_1000000870 420
835 3300006186 Ga0075369_10005844 Ga0075369_100058443 420
836 3300006353 Ga0075370_10038846 Ga0075370_100388462 420
837 3300007788 Ga0099795_10037437 Ga0099795_100374372 420
838 3300009093 Ga0105240_10192740 Ga0105240_101927402 420
839 3300009098 Ga0105245_10081675 Ga0105245_100816753 420
840 3300009545 Ga0105237_10009950 Ga0105237_100099506 420
841 3300009551 Ga0105238_10014750 Ga0105238_100147502 420
842 3300010375 Ga0105239_10084742 Ga0105239_100847422 420
843 3300013105 Ga0157369_10012423 Ga0157369_100124237 420
844 3300021361 Ga0213872_10040411 Ga0213872_100404113 420
845 3300021384 Ga0213876_10003579 Ga0213876_100035792 420
846 3300021388 Ga0213875_10062030 Ga0213875_100620301 420
847 3300025253 Ga0209677_102245 Ga0209677_1022455 420
848 3300025272 Ga0209455_1002923 Ga0209455_10029234 420
849 3300025297 Ga0209758_1000011 Ga0209758_1000011535 420
850 3300025297 Ga0209758_1001848 Ga0209758_100184812 420
851 3300025302 Ga0207426_1000458 Ga0207426_100045817 420
852 3300025302 Ga0207426_1019068 Ga0207426_10190682 420
853 3300025304 Ga0209257_1001101 Ga0209257_100110111 420
854 3300025912 Ga0207707_10000886 Ga0207707_1000088619 420
855 3300025912 Ga0207707_10023656 Ga0207707_100236564 420
856 3300025912 Ga0207707_10235770 Ga0207707_102357702 420
857 3300025917 Ga0207660_10010388 Ga0207660_100103884 420
858 3300025919 Ga0207657_10008437 Ga0207657_100084379 420
859 3300025921 Ga0207652_10019601 Ga0207652_100196014 420
860 3300025924 Ga0207694_10071234 Ga0207694_100712344 420
861 3300025928 Ga0207700_10007466 Ga0207700_100074665 420
862 3300025928 Ga0207700_10158000 Ga0207700_101580001 420
863 3300026116 Ga0207674_10007720 Ga0207674_100077208 420
864 3300027512 Ga0209179_1001680 Ga0209179_10016803 420
865 3300028381 Ga0268264_10000030 Ga0268264_10000030242 420
866 3300031235 Ga0265330_10006697 Ga0265330_100066978 420
867 3300031247 Ga0265340_10025159 Ga0265340_100251592 420
868 3300031249 Ga0265339_10020885 Ga0265339_100208854 420
869 3300031507 Ga0307509_10204543 Ga0307509_102045432 420
870 3300031616 Ga0307508_10003532 Ga0307508_100035329 420
871 3300031616 Ga0307508_10140808 Ga0307508_101408082 420
872 3300031711 Ga0265314_10014967 Ga0265314_100149675 420
873 3300031712 Ga0265342_10009847 Ga0265342_100098474 420
874 3300031730 Ga0307516_10097075 Ga0307516_100970754 420
875 3300033179 Ga0307507_10043063 Ga0307507_100430632 420
876 3300037068 Ga0373925_0166865 Ga0373925_0166865_336_1613 420
877 3300037853 Ga0436364_0356418 Ga0436364_0356418_194_1477 420
878 3300039437 Ga0436365_1236739 Ga0436365_1236739_20472_21749 420
879 3300039447 Ga0436361_0535015 Ga0436361_0535015_527_1813 420
880 3300039447 Ga0436361_0632240 Ga0436361_0632240_2100_3383 420
881 3300039453 Ga0436362_0652931 Ga0436362_0652931_2106_3383 420
882 3300044735 Ga0466968_0010560 Ga0466968_0010560_220_1503 420
883 3300045049 Ga0466959_0033466 Ga0466959_0033466_2212_3498 420
884 3300045049 Ga0466959_0154985 Ga0466959_0154985_260_1543 420
885 3300045976 Ga0466967_0295043 Ga0466967_0295043_158_1465 420
886 3300046454 Ga0495592_0011606 Ga0495592_0011606_911_2194 420
887 3300046476 Ga0495662_0020305 Ga0495662_0020305_778_2097 420
888 3300046516 Ga0495628_0012530 Ga0495628_0012530_5622_6905 420
889 3300046524 Ga0495648_0046019 Ga0495648_0046019_1239_2522 420
890 3300046533 Ga0495640_0023983 Ga0495640_0023983_1766_3052 420
891 3300046533 Ga0495640_0028223 Ga0495640_0028223_1424_2707 420
892 3300046543 Ga0495645_0009374 Ga0495645_0009374_5441_6724 420
893 3300046559 Ga0495667_0006892 Ga0495667_0006892_5036_6319 420
894 3300046642 Ga0495634_0076372 Ga0495634_0076372_84_1367 420
895 3300046663 Ga0495635_0051638 Ga0495635_0051638_361_1644 420
896 3300046675 Ga0495657_0054792 Ga0495657_0054792_30_1316 420
897 3300047317 Ga0495604_0004988 Ga0495604_0004988_8075_9358 420
898 3300047319 Ga0495674_0042923 Ga0495674_0042923_1289_2572 420
899 3300047471 Ga0495684_0010711 Ga0495684_0010711_390_1676 420
900 3300047471 Ga0495684_0106060 Ga0495684_0106060_260_1543 420
901 3300048088 Ga0495602_0011752 Ga0495602_0011752_1154_2437 420
902 3300048915 Ga0496112_0030083 Ga0496112_0030083_3701_4984 420
903 3300048920 Ga0496117_0010071 Ga0496117_0010071_1422_2747 420
904 3300048921 Ga0496118_0008611 Ga0496118_0008611_819_2144 420
905 3300048921 Ga0496118_0009891 Ga0496118_0009891_5734_7017 420
906 3300048922 Ga0496119_0072328 Ga0496119_0072328_67_1350 420
907 3300048924 Ga0496121_0002635 Ga0496121_0002635_19353_20678 420
908 3300048924 Ga0496121_0048593 Ga0496121_0048593_174_1457 420
909 3300048927 Ga0496124_0011581 Ga0496124_0011581_2261_3586 420
910 3300048929 Ga0496126_0022113 Ga0496126_0022113_3046_4329 420
911 3300053111 Ga0500572_001006 Ga0500572_001006_419_1702 420
912 3300053136 Ga0500559_0001342 Ga0500559_0001342_12816_14099 420
913 3300053163 Ga0500639_004522 Ga0500639_004522_5343_6626 420
914 3300053177 Ga0500636_0037290 Ga0500636_0037290_328_1611 420
915 3300053735 Ga0500596_004947 Ga0500596_004947_386_1669 420
916 iso_pu_bacteria 2932801729 2932808765 420
917 iso_pu_bacteria 2935883170 2935885695 420
918 iso_pu_bacteria 2935959822 2935962905 420

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09242

FCSD-flav_bind

Flavocytochrome c sulphide dehydrogenase, flavin-binding

346

415

0.98

PF21706

FCSD_central

Sulfide dehydrogenase [flavocytochrome c] flavoprotein chain, central

156

271

0.97

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

27

154

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n1t-assembly1.cif.gz_A crystal structure of complex between flavocytochrome c and copper chaperone copc from t. paradoxus 0.9615 34 420
1fcd-assembly2.cif.gz_B the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution 0.9552 33 420
3vrd-assembly1.cif.gz_B crystal structure of flavocytochrome c from thermochromatium tepidum 0.9534 35 420
5n1t-assembly1.cif.gz_A crystal structure of complex between flavocytochrome c and copper chaperone copc from t. paradoxus 0.9472 34 420
3vrd-assembly1.cif.gz_B crystal structure of flavocytochrome c from thermochromatium tepidum 0.9231 35 420
ID Description Score Start End Superfamily
af_Q10062_1_488_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9615 36 67 3.50.50.60
af_P40012_11_539_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9598 35 68 3.50.50.60
5n1tA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9517 149 282 3.50.50.60
5n1tA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9448 149 282 3.50.50.60
5n1tA03 Alpha Beta;Alpha-Beta Complex;Flavocytochrome C Sulfide Dehydrogenase; Chain A Domain 3;Flavocytochrome c sulphide dehydrogenase, flavin-binding domain 0.9408 350 420 3.90.760.10
ID Description Score Start End GO Terms
AF-A0A7C1WBB1-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9632 36 375 GO:0016491
GO:0050660
AF-A0A3M0YCT5-F1-model_v4 Cytochrome C 0.9623 33 420 GO:0016491
GO:0050660
AF-A0A5C7T8X0-F1-model_v4 Cytochrome C 0.9611 85 420 GO:0016491
GO:0050660
AF-A0A537TJZ6-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.96 26 231 GO:0016491
AF-A0A661C3F5-F1-model_v4 Cytochrome C 0.9578 40 420 GO:0016491
GO:0050660

Feature Viewer

pLDDT pTM Quality
89.78 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map