F485662
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 918 | 331 | 916 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100048099|Ga0070690_1000480993 |
| Length | 126 |
| Sequence | MPTPNQHPANCATGRPSMEFAMNTETEKEINSEKWELRLYTAGQTPKSLTAFANLKRLCEEHLKGRYSIEVIDLTRNPQLAAGDQIVAIPTLVRKLPEPLRRIVGDLRDTERTLVGLQLRPAKLDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 3 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 215 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 236 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 237 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 240 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 241 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 247 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 306 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 307 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 308 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 331 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.09 |
| Nodule | 0 |
| Rhizoplane | 5.12 |
| Rhizosphere | 90.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_11158489 | 2162886012 | Unclassified | 1138 |
| 2 | MBSR1b_contig_11923333 | 2162886012 | Bacteria | 1296 |
| 3 | ARSoilOldRDRAFT_c017047 | 3300000044 | Unclassified | 628 |
| 4 | JGI24735J21928_10040768 | 3300002067 | Bacteria | 1354 |
| 5 | Ga0058859_10049305 | 3300004798 | Bacteria | 972 |
| 6 | Ga0058860_12217052 | 3300004801 | Bacteria | 507 |
| 7 | Ga0065714_10250901 | 3300005288 | Unclassified | 775 |
| 8 | Ga0065715_10206516 | 3300005293 | Bacteria | 1334 |
| 9 | Ga0065707_10052148 | 3300005295 | Unclassified | 777 |
| 10 | Ga0070658_10041483 | 3300005327 | Bacteria | 3713 |
| 11 | Ga0070658_11137813 | 3300005327 | Unclassified | 679 |
| 12 | Ga0070676_10037256 | 3300005328 | Bacteria | 2805 |
| 13 | Ga0070676_10083564 | 3300005328 | Bacteria | 1942 |
| 14 | Ga0070676_10264388 | 3300005328 | Unclassified | 1153 |
| 15 | Ga0070676_10708686 | 3300005328 | Bacteria | 736 |
| 16 | Ga0070683_102198067 | 3300005329 | Bacteria | 530 |
| 17 | Ga0070690_100000584 | 3300005330 | Bacteria | 18375 |
| 18 | Ga0070690_100048099 | 3300005330 | Bacteria | 2715 |
| 19 | Ga0070690_100070176 | 3300005330 | Bacteria | 2275 |
| 20 | Ga0070690_100077402 | 3300005330 | Bacteria | 2171 |
| 21 | Ga0070690_100228768 | 3300005330 | Bacteria | 1306 |
| 22 | Ga0070690_100316387 | 3300005330 | Unclassified | 1123 |
| 23 | Ga0070690_100677352 | 3300005330 | Bacteria | 790 |
| 24 | Ga0070670_100043037 | 3300005331 | Bacteria | 3883 |
| 25 | Ga0070670_100222839 | 3300005331 | Unclassified | 1641 |
| 26 | Ga0070670_100318908 | 3300005331 | Bacteria | 1361 |
| 27 | Ga0068869_100103078 | 3300005334 | Bacteria | 2161 |
| 28 | Ga0068869_100216777 | 3300005334 | Unclassified | 1515 |
| 29 | Ga0068869_100373923 | 3300005334 | Bacteria | 1166 |
| 30 | Ga0068869_101875269 | 3300005334 | Bacteria | 537 |
| 31 | Ga0070666_10000001 | 3300005335 | Bacteria | 543080 |
| 32 | Ga0070666_10013113 | 3300005335 | Bacteria | 5251 |
| 33 | Ga0070666_10038796 | 3300005335 | Bacteria | 3171 |
| 34 | Ga0070666_10057777 | 3300005335 | Bacteria | 2622 |
| 35 | Ga0070666_10235751 | 3300005335 | Bacteria | 1293 |
| 36 | Ga0070666_11354917 | 3300005335 | Unclassified | 531 |
| 37 | Ga0070680_100040141 | 3300005336 | Bacteria | 3788 |
| 38 | Ga0070680_100159476 | 3300005336 | Bacteria | 1895 |
| 39 | Ga0070680_100310489 | 3300005336 | Bacteria | 1338 |
| 40 | Ga0070680_100469087 | 3300005336 | Bacteria | 1076 |
| 41 | Ga0070680_100630143 | 3300005336 | Bacteria | 921 |
| 42 | Ga0070680_101847718 | 3300005336 | Bacteria | 523 |
| 43 | Ga0070682_100028554 | 3300005337 | Bacteria | 3356 |
| 44 | Ga0070682_100065685 | 3300005337 | Unclassified | 2306 |
| 45 | Ga0070682_100409873 | 3300005337 | Bacteria | 1027 |
| 46 | Ga0068868_100002180 | 3300005338 | Bacteria | 13496 |
| 47 | Ga0068868_100321592 | 3300005338 | Bacteria | 1318 |
| 48 | Ga0068868_101254847 | 3300005338 | Bacteria | 687 |
| 49 | Ga0070660_100025605 | 3300005339 | Bacteria | 4385 |
| 50 | Ga0070660_100279456 | 3300005339 | Bacteria | 1366 |
| 51 | Ga0070660_100495618 | 3300005339 | Bacteria | 1016 |
| 52 | Ga0070689_100002469 | 3300005340 | Bacteria | 12073 |
| 53 | Ga0070689_100003146 | 3300005340 | Bacteria | 10917 |
| 54 | Ga0070689_100036377 | 3300005340 | Bacteria | 3766 |
| 55 | Ga0070689_100276266 | 3300005340 | Bacteria | 1392 |
| 56 | Ga0070689_100348203 | 3300005340 | Bacteria | 1242 |
| 57 | Ga0070689_100369763 | 3300005340 | Unclassified | 1206 |
| 58 | Ga0070689_101090685 | 3300005340 | Unclassified | 713 |
| 59 | Ga0070689_101159088 | 3300005340 | Bacteria | 692 |
| 60 | Ga0070691_10013229 | 3300005341 | Bacteria | 3780 |
| 61 | Ga0070691_11013767 | 3300005341 | Bacteria | 519 |
| 62 | Ga0070687_100048364 | 3300005343 | Bacteria | 2187 |
| 63 | Ga0070687_100052184 | 3300005343 | Bacteria | 2121 |
| 64 | Ga0070687_100104306 | 3300005343 | Bacteria | 1593 |
| 65 | Ga0070687_100138672 | 3300005343 | Unclassified | 1413 |
| 66 | Ga0070687_100165001 | 3300005343 | Bacteria | 1313 |
| 67 | Ga0070661_100009313 | 3300005344 | Bacteria | 6793 |
| 68 | Ga0070661_100027965 | 3300005344 | Bacteria | 4064 |
| 69 | Ga0070661_100108408 | 3300005344 | Bacteria | 2072 |
| 70 | Ga0070661_100114824 | 3300005344 | Bacteria | 2013 |
| 71 | Ga0070692_10013994 | 3300005345 | Bacteria | 3755 |
| 72 | Ga0070692_10042111 | 3300005345 | Bacteria | 2343 |
| 73 | Ga0070668_100050479 | 3300005347 | Bacteria | 3203 |
| 74 | Ga0070668_100128307 | 3300005347 | Bacteria | 2033 |
| 75 | Ga0070668_100249357 | 3300005347 | Bacteria | 1473 |
| 76 | Ga0070668_100516231 | 3300005347 | Bacteria | 1036 |
| 77 | Ga0070668_101648042 | 3300005347 | Unclassified | 588 |
| 78 | Ga0070669_100022973 | 3300005353 | Bacteria | 4462 |
| 79 | Ga0070669_100113429 | 3300005353 | Unclassified | 2059 |
| 80 | Ga0070669_100279091 | 3300005353 | Bacteria | 1338 |
| 81 | Ga0070669_100286896 | 3300005353 | Bacteria | 1320 |
| 82 | Ga0070669_100574183 | 3300005353 | Unclassified | 942 |
| 83 | Ga0070675_100000103 | 3300005354 | Bacteria | 50035 |
| 84 | Ga0070675_100017455 | 3300005354 | Bacteria | 5703 |
| 85 | Ga0070675_100021556 | 3300005354 | Bacteria | 5150 |
| 86 | Ga0070675_100027006 | 3300005354 | Bacteria | 4610 |
| 87 | Ga0070675_100035421 | 3300005354 | Bacteria | 4055 |
| 88 | Ga0070675_100113062 | 3300005354 | Bacteria | 2299 |
| 89 | Ga0070675_100143053 | 3300005354 | Bacteria | 2046 |
| 90 | Ga0070675_100951566 | 3300005354 | Bacteria | 788 |
| 91 | Ga0070675_101134324 | 3300005354 | Unclassified | 719 |
| 92 | Ga0070675_102178177 | 3300005354 | Bacteria | 511 |
| 93 | Ga0070671_100000445 | 3300005355 | Bacteria | 28732 |
| 94 | Ga0070671_100005336 | 3300005355 | Bacteria | 10248 |
| 95 | Ga0070671_100033557 | 3300005355 | Bacteria | 4246 |
| 96 | Ga0070671_100637912 | 3300005355 | Bacteria | 922 |
| 97 | Ga0070674_100177643 | 3300005356 | Bacteria | 1628 |
| 98 | Ga0070674_100580693 | 3300005356 | Bacteria | 944 |
| 99 | Ga0070673_100008378 | 3300005364 | Bacteria | 6873 |
| 100 | Ga0070673_100016190 | 3300005364 | Bacteria | 5264 |
| 101 | Ga0070673_100059962 | 3300005364 | Bacteria | 3014 |
| 102 | Ga0070673_100235410 | 3300005364 | Bacteria | 1590 |
| 103 | Ga0070673_101399431 | 3300005364 | Unclassified | 658 |
| 104 | Ga0070673_101724724 | 3300005364 | Bacteria | 593 |
| 105 | Ga0070673_102262967 | 3300005364 | Unclassified | 517 |
| 106 | Ga0070688_100015100 | 3300005365 | Bacteria | 4385 |
| 107 | Ga0070688_100071497 | 3300005365 | Unclassified | 2221 |
| 108 | Ga0070688_100097303 | 3300005365 | Unclassified | 1934 |
| 109 | Ga0070688_100517824 | 3300005365 | Bacteria | 902 |
| 110 | Ga0070688_100581292 | 3300005365 | Bacteria | 855 |
| 111 | Ga0070688_100996666 | 3300005365 | Unclassified | 665 |
| 112 | Ga0070659_100000939 | 3300005366 | Bacteria | 21418 |
| 113 | Ga0070659_100302240 | 3300005366 | Bacteria | 1335 |
| 114 | Ga0070659_100473397 | 3300005366 | Bacteria | 1065 |
| 115 | Ga0070667_100011691 | 3300005367 | Bacteria | 7256 |
| 116 | Ga0070667_100325718 | 3300005367 | Bacteria | 1387 |
| 117 | Ga0070703_10013905 | 3300005406 | Bacteria | 2287 |
| 118 | Ga0070703_10043198 | 3300005406 | Bacteria | 1413 |
| 119 | Ga0070709_10205455 | 3300005434 | Bacteria | 1397 |
| 120 | Ga0070714_100031734 | 3300005435 | Bacteria | 4409 |
| 121 | Ga0070714_100354919 | 3300005435 | Bacteria | 1377 |
| 122 | Ga0070714_100619867 | 3300005435 | Bacteria | 1040 |
| 123 | Ga0070701_10017381 | 3300005438 | Bacteria | 3360 |
| 124 | Ga0070701_10140843 | 3300005438 | Bacteria | 1379 |
| 125 | Ga0070701_10142807 | 3300005438 | Bacteria | 1371 |
| 126 | Ga0070711_100067264 | 3300005439 | Bacteria | 2513 |
| 127 | Ga0070705_100002630 | 3300005440 | Bacteria | 8983 |
| 128 | Ga0070705_100006334 | 3300005440 | Bacteria | 5797 |
| 129 | Ga0070705_100293846 | 3300005440 | Unclassified | 1161 |
| 130 | Ga0070705_100630651 | 3300005440 | Bacteria | 833 |
| 131 | Ga0070705_100994044 | 3300005440 | Bacteria | 680 |
| 132 | Ga0070700_100020679 | 3300005441 | Bacteria | 3817 |
| 133 | Ga0070700_100029638 | 3300005441 | Bacteria | 3265 |
| 134 | Ga0070700_101130486 | 3300005441 | Unclassified | 651 |
| 135 | Ga0070700_101672916 | 3300005441 | Unclassified | 545 |
| 136 | Ga0070694_100001106 | 3300005444 | Bacteria | 15430 |
| 137 | Ga0070694_100010520 | 3300005444 | Bacteria | 5711 |
| 138 | Ga0070694_100131174 | 3300005444 | Bacteria | 1810 |
| 139 | Ga0070694_100167598 | 3300005444 | Bacteria | 1616 |
| 140 | Ga0070708_100206472 | 3300005445 | Bacteria | 1840 |
| 141 | Ga0070663_100258294 | 3300005455 | Unclassified | 1381 |
| 142 | Ga0070663_100915219 | 3300005455 | Unclassified | 758 |
| 143 | Ga0070663_101072245 | 3300005455 | Unclassified | 703 |
| 144 | Ga0070678_100051022 | 3300005456 | Bacteria | 2996 |
| 145 | Ga0070678_100076595 | 3300005456 | Bacteria | 2520 |
| 146 | Ga0070678_100340049 | 3300005456 | Unclassified | 1287 |
| 147 | Ga0070678_100358808 | 3300005456 | Unclassified | 1255 |
| 148 | Ga0070678_100363726 | 3300005456 | Bacteria | 1247 |
| 149 | Ga0070662_100000104 | 3300005457 | Bacteria | 46608 |
| 150 | Ga0070662_100068410 | 3300005457 | Bacteria | 2611 |
| 151 | Ga0070662_100170044 | 3300005457 | Bacteria | 1711 |
| 152 | Ga0070662_100469769 | 3300005457 | Unclassified | 1046 |
| 153 | Ga0070662_100972821 | 3300005457 | Bacteria | 726 |
| 154 | Ga0070662_101650599 | 3300005457 | Unclassified | 553 |
| 155 | Ga0070681_10031164 | 3300005458 | Bacteria | 5352 |
| 156 | Ga0070681_10194045 | 3300005458 | Bacteria | 1950 |
| 157 | Ga0070681_10477434 | 3300005458 | Bacteria | 1159 |
| 158 | Ga0068867_100024059 | 3300005459 | Bacteria | 4364 |
| 159 | Ga0068867_100026985 | 3300005459 | Bacteria | 4126 |
| 160 | Ga0068867_100193293 | 3300005459 | Bacteria | 1625 |
| 161 | Ga0068867_100607219 | 3300005459 | Bacteria | 955 |
| 162 | Ga0068867_100607574 | 3300005459 | Bacteria | 954 |
| 163 | Ga0068867_100959330 | 3300005459 | Unclassified | 773 |
| 164 | Ga0070685_10011073 | 3300005466 | Bacteria | 4709 |
| 165 | Ga0070685_10031489 | 3300005466 | Bacteria | 2964 |
| 166 | Ga0070685_10160212 | 3300005466 | Bacteria | 1433 |
| 167 | Ga0070685_10263322 | 3300005466 | Bacteria | 1147 |
| 168 | Ga0070685_10500382 | 3300005466 | Bacteria | 860 |
| 169 | Ga0070698_101096892 | 3300005471 | Unclassified | 744 |
| 170 | Ga0070699_100403962 | 3300005518 | Unclassified | 1235 |
| 171 | Ga0070699_100416729 | 3300005518 | Bacteria | 1215 |
| 172 | Ga0070679_100031410 | 3300005530 | Bacteria | 5246 |
| 173 | Ga0070679_100102753 | 3300005530 | Bacteria | 2844 |
| 174 | Ga0070679_100160987 | 3300005530 | Bacteria | 2219 |
| 175 | Ga0070679_100301770 | 3300005530 | Bacteria | 1552 |
| 176 | Ga0070679_100470283 | 3300005530 | Bacteria | 1201 |
| 177 | Ga0070679_101080606 | 3300005530 | Bacteria | 747 |
| 178 | Ga0070679_101728117 | 3300005530 | Bacteria | 574 |
| 179 | Ga0070679_102043744 | 3300005530 | Unclassified | 522 |
| 180 | Ga0070697_101503480 | 3300005536 | Unclassified | 602 |
| 181 | Ga0068853_100026492 | 3300005539 | Bacteria | 4868 |
| 182 | Ga0068853_101693716 | 3300005539 | Bacteria | 613 |
| 183 | Ga0070672_100004186 | 3300005543 | Bacteria | 9419 |
| 184 | Ga0070672_100004426 | 3300005543 | Bacteria | 9195 |
| 185 | Ga0070672_100039289 | 3300005543 | Bacteria | 3623 |
| 186 | Ga0070672_100065796 | 3300005543 | Bacteria | 2868 |
| 187 | Ga0070672_100511775 | 3300005543 | Bacteria | 1039 |
| 188 | Ga0070672_100596995 | 3300005543 | Unclassified | 961 |
| 189 | Ga0070672_100752606 | 3300005543 | Unclassified | 855 |
| 190 | Ga0070672_101389598 | 3300005543 | Bacteria | 628 |
| 191 | Ga0070686_100002108 | 3300005544 | Bacteria | 10972 |
| 192 | Ga0070686_100085706 | 3300005544 | Bacteria | 2096 |
| 193 | Ga0070686_100144907 | 3300005544 | Bacteria | 1657 |
| 194 | Ga0070686_100155654 | 3300005544 | Bacteria | 1604 |
| 195 | Ga0070695_100000295 | 3300005545 | Bacteria | 25143 |
| 196 | Ga0070695_100009793 | 3300005545 | Bacteria | 5708 |
| 197 | Ga0070696_100005323 | 3300005546 | Bacteria | 8585 |
| 198 | Ga0070696_100011350 | 3300005546 | Bacteria | 5965 |
| 199 | Ga0070696_101736943 | 3300005546 | Unclassified | 538 |
| 200 | Ga0070693_100006341 | 3300005547 | Bacteria | 5734 |
| 201 | Ga0070665_100183776 | 3300005548 | Bacteria | 2091 |
| 202 | Ga0070665_100601089 | 3300005548 | Unclassified | 1113 |
| 203 | Ga0070704_100065054 | 3300005549 | Bacteria | 2623 |
| 204 | Ga0070704_100394294 | 3300005549 | Bacteria | 1179 |
| 205 | Ga0070704_100460895 | 3300005549 | Bacteria | 1096 |
| 206 | Ga0070704_102216211 | 3300005549 | Bacteria | 511 |
| 207 | Ga0068855_100001220 | 3300005563 | Bacteria | 31895 |
| 208 | Ga0068855_100027591 | 3300005563 | Bacteria | 6792 |
| 209 | Ga0068855_100089219 | 3300005563 | Bacteria | 3560 |
| 210 | Ga0068855_100234658 | 3300005563 | Bacteria | 2052 |
| 211 | Ga0070664_100002517 | 3300005564 | Bacteria | 14767 |
| 212 | Ga0070664_100164036 | 3300005564 | Bacteria | 1968 |
| 213 | Ga0070664_100272367 | 3300005564 | Bacteria | 1525 |
| 214 | Ga0070664_100548829 | 3300005564 | Bacteria | 1068 |
| 215 | Ga0070664_101132411 | 3300005564 | Unclassified | 737 |
| 216 | Ga0068857_100050892 | 3300005577 | Bacteria | 3674 |
| 217 | Ga0068857_100070006 | 3300005577 | Bacteria | 3124 |
| 218 | Ga0068857_100247470 | 3300005577 | Unclassified | 1633 |
| 219 | Ga0068857_100288769 | 3300005577 | Bacteria | 1510 |
| 220 | Ga0068857_100324107 | 3300005577 | Unclassified | 1423 |
| 221 | Ga0068857_100623749 | 3300005577 | Unclassified | 1020 |
| 222 | Ga0068857_101613937 | 3300005577 | Unclassified | 633 |
| 223 | Ga0068854_100327335 | 3300005578 | Bacteria | 1247 |
| 224 | Ga0068854_100827249 | 3300005578 | Bacteria | 809 |
| 225 | Ga0068856_100000606 | 3300005614 | Bacteria | 39272 |
| 226 | Ga0068856_100115020 | 3300005614 | Bacteria | 2689 |
| 227 | Ga0068856_100347362 | 3300005614 | Unclassified | 1502 |
| 228 | Ga0068856_100626792 | 3300005614 | Unclassified | 1096 |
| 229 | Ga0068856_102003907 | 3300005614 | Unclassified | 589 |
| 230 | Ga0070702_100004748 | 3300005615 | Bacteria | 6242 |
| 231 | Ga0070702_100250727 | 3300005615 | Bacteria | 1200 |
| 232 | Ga0070702_100503483 | 3300005615 | Bacteria | 890 |
| 233 | Ga0070702_101649899 | 3300005615 | Bacteria | 532 |
| 234 | Ga0068852_100021425 | 3300005616 | Bacteria | 5160 |
| 235 | Ga0068852_100031335 | 3300005616 | Bacteria | 4387 |
| 236 | Ga0068852_100135922 | 3300005616 | Bacteria | 2270 |
| 237 | Ga0068852_100501829 | 3300005616 | Bacteria | 1208 |
| 238 | Ga0068852_100747163 | 3300005616 | Bacteria | 990 |
| 239 | Ga0068852_102561953 | 3300005616 | Bacteria | 530 |
| 240 | Ga0068859_100001040 | 3300005617 | Bacteria | 28431 |
| 241 | Ga0068859_100001955 | 3300005617 | Bacteria | 21012 |
| 242 | Ga0068859_100031224 | 3300005617 | Bacteria | 5347 |
| 243 | Ga0068859_100083665 | 3300005617 | Bacteria | 3234 |
| 244 | Ga0068859_100652009 | 3300005617 | Bacteria | 1145 |
| 245 | Ga0068859_101488625 | 3300005617 | Unclassified | 747 |
| 246 | Ga0068859_101845690 | 3300005617 | Bacteria | 668 |
| 247 | Ga0068864_100071403 | 3300005618 | Bacteria | 3023 |
| 248 | Ga0068864_100407726 | 3300005618 | Unclassified | 1293 |
| 249 | Ga0068864_100692896 | 3300005618 | Bacteria | 995 |
| 250 | Ga0068864_100829063 | 3300005618 | Unclassified | 910 |
| 251 | Ga0068864_100856431 | 3300005618 | Bacteria | 896 |
| 252 | Ga0068864_101340479 | 3300005618 | Bacteria | 716 |
| 253 | Ga0068866_10101523 | 3300005718 | Bacteria | 1588 |
| 254 | Ga0068866_10108422 | 3300005718 | Bacteria | 1545 |
| 255 | Ga0068866_10618578 | 3300005718 | Unclassified | 733 |
| 256 | Ga0068861_100195597 | 3300005719 | Bacteria | 1694 |
| 257 | Ga0068861_100238642 | 3300005719 | Bacteria | 1545 |
| 258 | Ga0068861_100280552 | 3300005719 | Bacteria | 1434 |
| 259 | Ga0068861_101068890 | 3300005719 | Unclassified | 774 |
| 260 | Ga0068861_102178783 | 3300005719 | Bacteria | 555 |
| 261 | Ga0068851_10425341 | 3300005834 | Unclassified | 785 |
| 262 | Ga0068870_10196780 | 3300005840 | Bacteria | 1220 |
| 263 | Ga0068870_10470937 | 3300005840 | Unclassified | 832 |
| 264 | Ga0068870_10584839 | 3300005840 | Bacteria | 756 |
| 265 | Ga0068863_100000572 | 3300005841 | Bacteria | 37450 |
| 266 | Ga0068863_100087748 | 3300005841 | Bacteria | 2948 |
| 267 | Ga0068863_100153344 | 3300005841 | Bacteria | 2205 |
| 268 | Ga0068863_101038359 | 3300005841 | Bacteria | 823 |
| 269 | Ga0068863_101123835 | 3300005841 | Unclassified | 791 |
| 270 | Ga0068863_101298027 | 3300005841 | Bacteria | 735 |
| 271 | Ga0068863_101486900 | 3300005841 | Bacteria | 686 |
| 272 | Ga0068863_101981921 | 3300005841 | Unclassified | 592 |
| 273 | Ga0068858_100001626 | 3300005842 | Bacteria | 22912 |
| 274 | Ga0068858_100007255 | 3300005842 | Bacteria | 10738 |
| 275 | Ga0068858_100045656 | 3300005842 | Bacteria | 4061 |
| 276 | Ga0068858_100108823 | 3300005842 | Bacteria | 2587 |
| 277 | Ga0068858_101604191 | 3300005842 | Bacteria | 642 |
| 278 | Ga0068860_100010500 | 3300005843 | Bacteria | 9154 |
| 279 | Ga0068860_100086141 | 3300005843 | Bacteria | 2989 |
| 280 | Ga0068860_100131036 | 3300005843 | Bacteria | 2406 |
| 281 | Ga0068860_100216171 | 3300005843 | Bacteria | 1860 |
| 282 | Ga0068860_100388420 | 3300005843 | Bacteria | 1379 |
| 283 | Ga0068860_100502620 | 3300005843 | Bacteria | 1210 |
| 284 | Ga0068860_101453145 | 3300005843 | Unclassified | 707 |
| 285 | Ga0068862_100011828 | 3300005844 | Bacteria | 7207 |
| 286 | Ga0068862_100032236 | 3300005844 | Bacteria | 4427 |
| 287 | Ga0068862_100098913 | 3300005844 | Bacteria | 2549 |
| 288 | Ga0068862_100136327 | 3300005844 | Bacteria | 2175 |
| 289 | Ga0068862_100174706 | 3300005844 | Bacteria | 1925 |
| 290 | Ga0068862_100247405 | 3300005844 | Bacteria | 1624 |
| 291 | Ga0068862_100345736 | 3300005844 | Bacteria | 1379 |
| 292 | Ga0068862_101538239 | 3300005844 | Bacteria | 671 |
| 293 | Ga0068862_101919248 | 3300005844 | Unclassified | 602 |
| 294 | Ga0081539_10000332 | 3300005985 | Bacteria | 104677 |
| 295 | Ga0075365_10067465 | 3300006038 | Bacteria | 2402 |
| 296 | Ga0075363_100019497 | 3300006048 | Bacteria | 3392 |
| 297 | Ga0070715_10915635 | 3300006163 | Bacteria | 541 |
| 298 | Ga0070712_101141180 | 3300006175 | Unclassified | 677 |
| 299 | Ga0097621_100001291 | 3300006237 | Bacteria | 17227 |
| 300 | Ga0097621_100041838 | 3300006237 | Bacteria | 3690 |
| 301 | Ga0097621_100278357 | 3300006237 | Bacteria | 1472 |
| 302 | Ga0097621_100713422 | 3300006237 | Bacteria | 924 |
| 303 | Ga0068871_100014810 | 3300006358 | Bacteria | 5822 |
| 304 | Ga0068871_100510972 | 3300006358 | Unclassified | 1084 |
| 305 | Ga0075428_100130833 | 3300006844 | Bacteria | 2730 |
| 306 | Ga0075428_100262592 | 3300006844 | Bacteria | 1859 |
| 307 | Ga0075430_100024687 | 3300006846 | Bacteria | 5112 |
| 308 | Ga0075430_100027073 | 3300006846 | Unclassified | 4874 |
| 309 | Ga0075430_100335017 | 3300006846 | Unclassified | 1250 |
| 310 | Ga0075430_100486854 | 3300006846 | Bacteria | 1018 |
| 311 | Ga0075431_100010851 | 3300006847 | Bacteria | 9164 |
| 312 | Ga0075431_100687099 | 3300006847 | Bacteria | 1002 |
| 313 | Ga0075431_100871651 | 3300006847 | Bacteria | 871 |
| 314 | Ga0075431_101126274 | 3300006847 | Bacteria | 749 |
| 315 | Ga0075433_10010678 | 3300006852 | Bacteria | 7384 |
| 316 | Ga0075433_11128379 | 3300006852 | Bacteria | 681 |
| 317 | Ga0075433_11871136 | 3300006852 | Bacteria | 515 |
| 318 | Ga0075434_100000566 | 3300006871 | Bacteria | 28488 |
| 319 | Ga0075434_100011155 | 3300006871 | Bacteria | 8456 |
| 320 | Ga0075434_100504932 | 3300006871 | Bacteria | 1230 |
| 321 | Ga0075434_101999062 | 3300006871 | Bacteria | 585 |
| 322 | Ga0075429_100066667 | 3300006880 | Bacteria | 3134 |
| 323 | Ga0075429_100268907 | 3300006880 | Bacteria | 1493 |
| 324 | Ga0075429_101148496 | 3300006880 | Bacteria | 678 |
| 325 | Ga0068865_100037664 | 3300006881 | Bacteria | 3267 |
| 326 | Ga0068865_100081775 | 3300006881 | Bacteria | 2320 |
| 327 | Ga0068865_101261367 | 3300006881 | Unclassified | 656 |
| 328 | Ga0068865_101653644 | 3300006881 | Unclassified | 576 |
| 329 | Ga0075436_100001732 | 3300006914 | Bacteria | 14948 |
| 330 | Ga0075436_100642121 | 3300006914 | Unclassified | 784 |
| 331 | Ga0097620_100001040 | 3300006931 | Bacteria | 28431 |
| 332 | Ga0097620_100001955 | 3300006931 | Bacteria | 21012 |
| 333 | Ga0097620_100031226 | 3300006931 | Bacteria | 5347 |
| 334 | Ga0097620_100083671 | 3300006931 | Bacteria | 3234 |
| 335 | Ga0097620_100651994 | 3300006931 | Bacteria | 1145 |
| 336 | Ga0097620_101488707 | 3300006931 | Unclassified | 747 |
| 337 | Ga0097620_101845726 | 3300006931 | Bacteria | 668 |
| 338 | Ga0075435_100000249 | 3300007076 | Bacteria | 33358 |
| 339 | Ga0075435_100076092 | 3300007076 | Bacteria | 2750 |
| 340 | Ga0075435_100777364 | 3300007076 | Bacteria | 833 |
| 341 | Ga0075435_100915148 | 3300007076 | Bacteria | 765 |
| 342 | Ga0099795_10526707 | 3300007788 | Bacteria | 554 |
| 343 | Ga0105240_10174170 | 3300009093 | Bacteria | 2545 |
| 344 | Ga0105240_11755750 | 3300009093 | Unclassified | 647 |
| 345 | Ga0111539_10007483 | 3300009094 | Bacteria | 13983 |
| 346 | Ga0111539_10108841 | 3300009094 | Bacteria | 3252 |
| 347 | Ga0111539_10155806 | 3300009094 | Bacteria | 2673 |
| 348 | Ga0111539_10517813 | 3300009094 | Bacteria | 1389 |
| 349 | Ga0111539_11417318 | 3300009094 | Unclassified | 806 |
| 350 | Ga0105245_10001445 | 3300009098 | Bacteria | 21558 |
| 351 | Ga0105245_10051311 | 3300009098 | Bacteria | 3698 |
| 352 | Ga0105247_10087908 | 3300009101 | Unclassified | 1969 |
| 353 | Ga0105247_10186488 | 3300009101 | Bacteria | 1387 |
| 354 | Ga0114129_10319521 | 3300009147 | Bacteria | 2064 |
| 355 | Ga0114129_12713450 | 3300009147 | Bacteria | 590 |
| 356 | Ga0105243_10109129 | 3300009148 | Bacteria | 2311 |
| 357 | Ga0105243_10414498 | 3300009148 | Bacteria | 1254 |
| 358 | Ga0105243_10880546 | 3300009148 | Bacteria | 889 |
| 359 | Ga0105243_11829812 | 3300009148 | Unclassified | 639 |
| 360 | Ga0105241_10705170 | 3300009174 | Bacteria | 922 |
| 361 | Ga0105241_10890987 | 3300009174 | Bacteria | 826 |
| 362 | Ga0105242_10013405 | 3300009176 | Bacteria | 6334 |
| 363 | Ga0105242_10211994 | 3300009176 | Bacteria | 1727 |
| 364 | Ga0105242_10505620 | 3300009176 | Unclassified | 1150 |
| 365 | Ga0105248_10000527 | 3300009177 | Bacteria | 43614 |
| 366 | Ga0105248_10027187 | 3300009177 | Bacteria | 6364 |
| 367 | Ga0105248_10100182 | 3300009177 | Bacteria | 3265 |
| 368 | Ga0105248_10437044 | 3300009177 | Bacteria | 1474 |
| 369 | Ga0105248_10724865 | 3300009177 | Bacteria | 1122 |
| 370 | Ga0105248_10839989 | 3300009177 | Unclassified | 1037 |
| 371 | Ga0105237_10046451 | 3300009545 | Bacteria | 4368 |
| 372 | Ga0105237_10818031 | 3300009545 | Bacteria | 938 |
| 373 | Ga0105238_10000611 | 3300009551 | Bacteria | 37533 |
| 374 | Ga0105238_10005684 | 3300009551 | Bacteria | 12325 |
| 375 | Ga0105238_10033313 | 3300009551 | Bacteria | 5244 |
| 376 | Ga0105238_10185840 | 3300009551 | Bacteria | 2054 |
| 377 | Ga0105238_10896050 | 3300009551 | Bacteria | 905 |
| 378 | Ga0105238_12070853 | 3300009551 | Unclassified | 603 |
| 379 | Ga0105249_10010040 | 3300009553 | Bacteria | 8308 |
| 380 | Ga0105249_10442023 | 3300009553 | Bacteria | 1338 |
| 381 | Ga0105249_11085532 | 3300009553 | Bacteria | 870 |
| 382 | Ga0105249_11661127 | 3300009553 | Bacteria | 711 |
| 383 | Ga0105239_10029155 | 3300010375 | Bacteria | 6067 |
| 384 | Ga0105239_10141350 | 3300010375 | Bacteria | 2682 |
| 385 | Ga0105239_10258473 | 3300010375 | Bacteria | 1957 |
| 386 | Ga0105239_10281619 | 3300010375 | Bacteria | 1872 |
| 387 | Ga0105239_12639966 | 3300010375 | Unclassified | 586 |
| 388 | Ga0157373_10103587 | 3300013100 | Bacteria | 2001 |
| 389 | Ga0157373_10546426 | 3300013100 | Bacteria | 840 |
| 390 | Ga0157371_10000292 | 3300013102 | Bacteria | 67427 |
| 391 | Ga0157371_11181327 | 3300013102 | Bacteria | 589 |
| 392 | Ga0157370_10009685 | 3300013104 | Bacteria | 10246 |
| 393 | Ga0157370_10029514 | 3300013104 | Bacteria | 5379 |
| 394 | Ga0157370_10719335 | 3300013104 | Bacteria | 911 |
| 395 | Ga0157369_10010411 | 3300013105 | Bacteria | 10598 |
| 396 | Ga0157369_10502231 | 3300013105 | Bacteria | 1255 |
| 397 | Ga0157369_10535507 | 3300013105 | Unclassified | 1211 |
| 398 | Ga0157374_10013385 | 3300013296 | Bacteria | 7162 |
| 399 | Ga0157374_11093973 | 3300013296 | Unclassified | 817 |
| 400 | Ga0157374_12777156 | 3300013296 | Unclassified | 517 |
| 401 | Ga0157378_10001797 | 3300013297 | Bacteria | 19262 |
| 402 | Ga0157378_10163430 | 3300013297 | Unclassified | 2083 |
| 403 | Ga0157378_10553961 | 3300013297 | Bacteria | 1155 |
| 404 | Ga0163162_10000436 | 3300013306 | Bacteria | 38515 |
| 405 | Ga0163162_10006107 | 3300013306 | Bacteria | 11663 |
| 406 | Ga0163162_10122220 | 3300013306 | Bacteria | 2708 |
| 407 | Ga0163162_10131391 | 3300013306 | Bacteria | 2612 |
| 408 | Ga0163162_10158958 | 3300013306 | Unclassified | 2381 |
| 409 | Ga0163162_10691232 | 3300013306 | Unclassified | 1142 |
| 410 | Ga0163162_12011677 | 3300013306 | Unclassified | 662 |
| 411 | Ga0163162_12710285 | 3300013306 | Unclassified | 570 |
| 412 | Ga0157372_10017154 | 3300013307 | Bacteria | 7773 |
| 413 | Ga0157372_10207928 | 3300013307 | Bacteria | 2268 |
| 414 | Ga0157372_10623924 | 3300013307 | Unclassified | 1256 |
| 415 | Ga0157372_11623577 | 3300013307 | Bacteria | 744 |
| 416 | Ga0157372_13267995 | 3300013307 | Unclassified | 517 |
| 417 | Ga0157375_10000420 | 3300013308 | Bacteria | 38469 |
| 418 | Ga0157375_10026193 | 3300013308 | Bacteria | 5431 |
| 419 | Ga0157375_10068289 | 3300013308 | Bacteria | 3556 |
| 420 | Ga0157375_13176851 | 3300013308 | Unclassified | 548 |
| 421 | Ga0163163_10002143 | 3300014325 | Bacteria | 16673 |
| 422 | Ga0157380_10159998 | 3300014326 | Bacteria | 1956 |
| 423 | Ga0157380_10219948 | 3300014326 | Bacteria | 1698 |
| 424 | Ga0157380_10284879 | 3300014326 | Bacteria | 1514 |
| 425 | Ga0157380_11206854 | 3300014326 | Unclassified | 800 |
| 426 | Ga0157380_11331631 | 3300014326 | Bacteria | 766 |
| 427 | Ga0182008_10376884 | 3300014497 | Bacteria | 757 |
| 428 | Ga0182008_10386642 | 3300014497 | Bacteria | 749 |
| 429 | Ga0182008_10425803 | 3300014497 | Bacteria | 717 |
| 430 | Ga0157377_10191894 | 3300014745 | Bacteria | 1292 |
| 431 | Ga0157377_11012982 | 3300014745 | Bacteria | 630 |
| 432 | Ga0157379_10000292 | 3300014968 | Bacteria | 39662 |
| 433 | Ga0157379_10034650 | 3300014968 | Bacteria | 4502 |
| 434 | Ga0157379_10272436 | 3300014968 | Bacteria | 1539 |
| 435 | Ga0157379_10462117 | 3300014968 | Unclassified | 1173 |
| 436 | Ga0157379_11329916 | 3300014968 | Unclassified | 695 |
| 437 | Ga0157376_10000791 | 3300014969 | Bacteria | 20705 |
| 438 | Ga0157376_10146042 | 3300014969 | Bacteria | 2127 |
| 439 | Ga0182006_1000049 | 3300015261 | Bacteria | 184514 |
| 440 | Ga0182007_10036195 | 3300015262 | Bacteria | 1661 |
| 441 | Ga0182005_1030791 | 3300015265 | Bacteria | 1462 |
| 442 | Ga0182005_1030792 | 3300015265 | Bacteria | 1462 |
| 443 | Ga0163161_10028408 | 3300017792 | Bacteria | 3972 |
| 444 | Ga0163161_10108528 | 3300017792 | Bacteria | 2073 |
| 445 | Ga0213876_10439069 | 3300021384 | Unclassified | 694 |
| 446 | Ga0207656_10197057 | 3300025321 | Bacteria | 972 |
| 447 | Ga0207653_10005165 | 3300025885 | Bacteria | 4083 |
| 448 | Ga0207653_10010271 | 3300025885 | Bacteria | 2920 |
| 449 | Ga0207653_10012135 | 3300025885 | Bacteria | 2690 |
| 450 | Ga0207692_10219628 | 3300025898 | Unclassified | 1126 |
| 451 | Ga0207692_10334871 | 3300025898 | Unclassified | 929 |
| 452 | Ga0207642_10083377 | 3300025899 | Bacteria | 1559 |
| 453 | Ga0207642_10630676 | 3300025899 | Bacteria | 670 |
| 454 | Ga0207688_10213344 | 3300025901 | Bacteria | 1161 |
| 455 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 456 | Ga0207680_10053657 | 3300025903 | Bacteria | 2421 |
| 457 | Ga0207680_10161393 | 3300025903 | Unclassified | 1503 |
| 458 | Ga0207680_10185893 | 3300025903 | Bacteria | 1408 |
| 459 | Ga0207680_10269032 | 3300025903 | Unclassified | 1181 |
| 460 | Ga0207647_10038770 | 3300025904 | Bacteria | 3011 |
| 461 | Ga0207647_10224967 | 3300025904 | Bacteria | 1081 |
| 462 | Ga0207685_10175729 | 3300025905 | Bacteria | 989 |
| 463 | Ga0207699_10216550 | 3300025906 | Bacteria | 1305 |
| 464 | Ga0207645_10056004 | 3300025907 | Bacteria | 2517 |
| 465 | Ga0207645_10222385 | 3300025907 | Bacteria | 1245 |
| 466 | Ga0207645_10411234 | 3300025907 | Bacteria | 911 |
| 467 | Ga0207643_10499105 | 3300025908 | Bacteria | 778 |
| 468 | Ga0207705_10007544 | 3300025909 | Bacteria | 7992 |
| 469 | Ga0207684_10035743 | 3300025910 | Unclassified | 4218 |
| 470 | Ga0207684_10616631 | 3300025910 | Bacteria | 926 |
| 471 | Ga0207654_10177811 | 3300025911 | Bacteria | 1386 |
| 472 | Ga0207707_10023231 | 3300025912 | Bacteria | 5425 |
| 473 | Ga0207707_10072162 | 3300025912 | Bacteria | 3009 |
| 474 | Ga0207707_10109222 | 3300025912 | Bacteria | 2418 |
| 475 | Ga0207707_10281389 | 3300025912 | Bacteria | 1441 |
| 476 | Ga0207707_10408092 | 3300025912 | Bacteria | 1166 |
| 477 | Ga0207707_10452626 | 3300025912 | Bacteria | 1098 |
| 478 | Ga0207695_11592731 | 3300025913 | Bacteria | 534 |
| 479 | Ga0207671_10144733 | 3300025914 | Unclassified | 1833 |
| 480 | Ga0207693_10779286 | 3300025915 | Bacteria | 738 |
| 481 | Ga0207663_10258051 | 3300025916 | Bacteria | 1286 |
| 482 | Ga0207660_10129400 | 3300025917 | Bacteria | 1920 |
| 483 | Ga0207660_10223282 | 3300025917 | Bacteria | 1479 |
| 484 | Ga0207660_10378352 | 3300025917 | Bacteria | 1138 |
| 485 | Ga0207660_10521517 | 3300025917 | Bacteria | 965 |
| 486 | Ga0207662_10011880 | 3300025918 | Bacteria | 4841 |
| 487 | Ga0207662_10103569 | 3300025918 | Bacteria | 1766 |
| 488 | Ga0207662_10108991 | 3300025918 | Bacteria | 1724 |
| 489 | Ga0207662_10206758 | 3300025918 | Bacteria | 1273 |
| 490 | Ga0207662_10898614 | 3300025918 | Unclassified | 627 |
| 491 | Ga0207657_10003478 | 3300025919 | Bacteria | 16799 |
| 492 | Ga0207657_10518713 | 3300025919 | Bacteria | 933 |
| 493 | Ga0207649_10001011 | 3300025920 | Bacteria | 17366 |
| 494 | Ga0207649_10233735 | 3300025920 | Bacteria | 1316 |
| 495 | Ga0207649_10625185 | 3300025920 | Bacteria | 830 |
| 496 | Ga0207649_10949747 | 3300025920 | Unclassified | 675 |
| 497 | Ga0207652_10056235 | 3300025921 | Bacteria | 3387 |
| 498 | Ga0207652_10065817 | 3300025921 | Bacteria | 3139 |
| 499 | Ga0207652_10070235 | 3300025921 | Bacteria | 3041 |
| 500 | Ga0207652_10328961 | 3300025921 | Bacteria | 1380 |
| 501 | Ga0207652_10376149 | 3300025921 | Bacteria | 1282 |
| 502 | Ga0207652_10404021 | 3300025921 | Bacteria | 1232 |
| 503 | Ga0207646_10995919 | 3300025922 | Bacteria | 741 |
| 504 | Ga0207681_10305930 | 3300025923 | Bacteria | 1259 |
| 505 | Ga0207681_10406637 | 3300025923 | Unclassified | 1100 |
| 506 | Ga0207681_10420889 | 3300025923 | Unclassified | 1082 |
| 507 | Ga0207681_10754757 | 3300025923 | Unclassified | 811 |
| 508 | Ga0207694_10000068 | 3300025924 | Bacteria | 126377 |
| 509 | Ga0207694_10010911 | 3300025924 | Bacteria | 6862 |
| 510 | Ga0207694_10030330 | 3300025924 | Bacteria | 4130 |
| 511 | Ga0207694_10416605 | 3300025924 | Bacteria | 1119 |
| 512 | Ga0207650_10090014 | 3300025925 | Bacteria | 2343 |
| 513 | Ga0207650_10188911 | 3300025925 | Unclassified | 1645 |
| 514 | Ga0207659_10006200 | 3300025926 | Bacteria | 7314 |
| 515 | Ga0207659_10015205 | 3300025926 | Unclassified | 4981 |
| 516 | Ga0207659_10023985 | 3300025926 | Bacteria | 4081 |
| 517 | Ga0207659_10039841 | 3300025926 | Bacteria | 3281 |
| 518 | Ga0207659_10079709 | 3300025926 | Bacteria | 2417 |
| 519 | Ga0207659_10661458 | 3300025926 | Unclassified | 893 |
| 520 | Ga0207659_11083482 | 3300025926 | Bacteria | 689 |
| 521 | Ga0207659_11486313 | 3300025926 | Unclassified | 580 |
| 522 | Ga0207687_10047547 | 3300025927 | Bacteria | 2975 |
| 523 | Ga0207687_10730789 | 3300025927 | Unclassified | 842 |
| 524 | Ga0207687_10963443 | 3300025927 | Unclassified | 731 |
| 525 | Ga0207644_10001203 | 3300025931 | Bacteria | 16666 |
| 526 | Ga0207644_10083771 | 3300025931 | Bacteria | 2362 |
| 527 | Ga0207644_10125951 | 3300025931 | Bacteria | 1955 |
| 528 | Ga0207644_10659163 | 3300025931 | Unclassified | 871 |
| 529 | Ga0207690_10009415 | 3300025932 | Bacteria | 5802 |
| 530 | Ga0207690_10127323 | 3300025932 | Bacteria | 1859 |
| 531 | Ga0207706_10000040 | 3300025933 | Bacteria | 132285 |
| 532 | Ga0207706_10065800 | 3300025933 | Bacteria | 3191 |
| 533 | Ga0207706_10076423 | 3300025933 | Bacteria | 2945 |
| 534 | Ga0207706_11452177 | 3300025933 | Unclassified | 561 |
| 535 | Ga0207706_11689748 | 3300025933 | Bacteria | 510 |
| 536 | Ga0207686_10194117 | 3300025934 | Bacteria | 1449 |
| 537 | Ga0207686_11105453 | 3300025934 | Unclassified | 646 |
| 538 | Ga0207709_10273281 | 3300025935 | Bacteria | 1245 |
| 539 | Ga0207709_10868469 | 3300025935 | Bacteria | 732 |
| 540 | Ga0207709_10912297 | 3300025935 | Unclassified | 714 |
| 541 | Ga0207670_10017620 | 3300025936 | Bacteria | 4320 |
| 542 | Ga0207670_10081405 | 3300025936 | Bacteria | 2266 |
| 543 | Ga0207670_10098407 | 3300025936 | Unclassified | 2084 |
| 544 | Ga0207670_10163888 | 3300025936 | Bacteria | 1662 |
| 545 | Ga0207670_10259758 | 3300025936 | Bacteria | 1346 |
| 546 | Ga0207670_10270063 | 3300025936 | Bacteria | 1322 |
| 547 | Ga0207669_10267572 | 3300025937 | Bacteria | 1282 |
| 548 | Ga0207669_10383878 | 3300025937 | Bacteria | 1095 |
| 549 | Ga0207669_10685964 | 3300025937 | Unclassified | 841 |
| 550 | Ga0207669_11019009 | 3300025937 | Unclassified | 696 |
| 551 | Ga0207704_10110379 | 3300025938 | Bacteria | 1858 |
| 552 | Ga0207704_11227510 | 3300025938 | Unclassified | 640 |
| 553 | Ga0207704_11796233 | 3300025938 | Bacteria | 527 |
| 554 | Ga0207691_10005503 | 3300025940 | Bacteria | 12239 |
| 555 | Ga0207691_10009766 | 3300025940 | Bacteria | 9212 |
| 556 | Ga0207691_10084045 | 3300025940 | Bacteria | 2858 |
| 557 | Ga0207691_10362045 | 3300025940 | Bacteria | 1240 |
| 558 | Ga0207691_10530604 | 3300025940 | Unclassified | 999 |
| 559 | Ga0207691_10708905 | 3300025940 | Unclassified | 848 |
| 560 | Ga0207691_11531999 | 3300025940 | Bacteria | 544 |
| 561 | Ga0207711_10003479 | 3300025941 | Bacteria | 13621 |
| 562 | Ga0207711_10047042 | 3300025941 | Bacteria | 3687 |
| 563 | Ga0207711_10133561 | 3300025941 | Bacteria | 2227 |
| 564 | Ga0207711_10218595 | 3300025941 | Bacteria | 1742 |
| 565 | Ga0207711_10235760 | 3300025941 | Bacteria | 1677 |
| 566 | Ga0207689_10086869 | 3300025942 | Bacteria | 2570 |
| 567 | Ga0207689_10121204 | 3300025942 | Bacteria | 2151 |
| 568 | Ga0207689_10248375 | 3300025942 | Bacteria | 1471 |
| 569 | Ga0207689_10271195 | 3300025942 | Bacteria | 1405 |
| 570 | Ga0207689_10367852 | 3300025942 | Bacteria | 1196 |
| 571 | Ga0207689_10388023 | 3300025942 | Bacteria | 1163 |
| 572 | Ga0207689_10870802 | 3300025942 | Bacteria | 760 |
| 573 | Ga0207661_10168536 | 3300025944 | Bacteria | 1905 |
| 574 | Ga0207679_10003236 | 3300025945 | Bacteria | 10047 |
| 575 | Ga0207679_10073377 | 3300025945 | Bacteria | 2589 |
| 576 | Ga0207679_10090961 | 3300025945 | Bacteria | 2360 |
| 577 | Ga0207679_10340459 | 3300025945 | Bacteria | 1304 |
| 578 | Ga0207679_10718651 | 3300025945 | Bacteria | 907 |
| 579 | Ga0207679_10719935 | 3300025945 | Unclassified | 906 |
| 580 | Ga0207667_10003220 | 3300025949 | Bacteria | 20159 |
| 581 | Ga0207667_10010861 | 3300025949 | Bacteria | 10618 |
| 582 | Ga0207667_10026526 | 3300025949 | Bacteria | 6327 |
| 583 | Ga0207651_10004091 | 3300025960 | Bacteria | 7276 |
| 584 | Ga0207651_10122559 | 3300025960 | Bacteria | 1974 |
| 585 | Ga0207651_10323955 | 3300025960 | Unclassified | 1289 |
| 586 | Ga0207651_11186129 | 3300025960 | Bacteria | 685 |
| 587 | Ga0207712_10013035 | 3300025961 | Bacteria | 5326 |
| 588 | Ga0207712_10249321 | 3300025961 | Bacteria | 1434 |
| 589 | Ga0207712_10633318 | 3300025961 | Bacteria | 928 |
| 590 | Ga0207712_10778802 | 3300025961 | Bacteria | 840 |
| 591 | Ga0207712_10938756 | 3300025961 | Unclassified | 766 |
| 592 | Ga0207668_10079587 | 3300025972 | Bacteria | 2371 |
| 593 | Ga0207668_10130222 | 3300025972 | Bacteria | 1920 |
| 594 | Ga0207668_10213493 | 3300025972 | Bacteria | 1545 |
| 595 | Ga0207668_10240663 | 3300025972 | Bacteria | 1464 |
| 596 | Ga0207668_10538979 | 3300025972 | Bacteria | 1009 |
| 597 | Ga0207640_10424231 | 3300025981 | Bacteria | 1089 |
| 598 | Ga0207640_10798763 | 3300025981 | Bacteria | 817 |
| 599 | Ga0207658_10014896 | 3300025986 | Bacteria | 5329 |
| 600 | Ga0207658_10080511 | 3300025986 | Bacteria | 2495 |
| 601 | Ga0207658_11670726 | 3300025986 | Unclassified | 582 |
| 602 | Ga0207658_11709860 | 3300025986 | Unclassified | 575 |
| 603 | Ga0207658_12132399 | 3300025986 | Unclassified | 509 |
| 604 | Ga0207677_10104633 | 3300026023 | Bacteria | 2092 |
| 605 | Ga0207677_10155430 | 3300026023 | Bacteria | 1771 |
| 606 | Ga0207677_10159653 | 3300026023 | Bacteria | 1750 |
| 607 | Ga0207677_10304483 | 3300026023 | Bacteria | 1318 |
| 608 | Ga0207677_10673615 | 3300026023 | Unclassified | 915 |
| 609 | Ga0207703_10037133 | 3300026035 | Bacteria | 3881 |
| 610 | Ga0207703_10063042 | 3300026035 | Bacteria | 3038 |
| 611 | Ga0207703_10339289 | 3300026035 | Bacteria | 1381 |
| 612 | Ga0207703_10381154 | 3300026035 | Unclassified | 1304 |
| 613 | Ga0207703_10726823 | 3300026035 | Bacteria | 945 |
| 614 | Ga0207703_11474475 | 3300026035 | Unclassified | 655 |
| 615 | Ga0207703_11491796 | 3300026035 | Bacteria | 650 |
| 616 | Ga0207703_11799577 | 3300026035 | Bacteria | 589 |
| 617 | Ga0207639_10025024 | 3300026041 | Bacteria | 4326 |
| 618 | Ga0207639_10502470 | 3300026041 | Bacteria | 1108 |
| 619 | Ga0207639_10654616 | 3300026041 | Unclassified | 972 |
| 620 | Ga0207639_11133301 | 3300026041 | Bacteria | 734 |
| 621 | Ga0207678_10816170 | 3300026067 | Unclassified | 824 |
| 622 | Ga0207708_10019180 | 3300026075 | Bacteria | 5151 |
| 623 | Ga0207708_10035470 | 3300026075 | Bacteria | 3795 |
| 624 | Ga0207708_10069118 | 3300026075 | Bacteria | 2704 |
| 625 | Ga0207708_10345598 | 3300026075 | Bacteria | 1219 |
| 626 | Ga0207708_10412434 | 3300026075 | Unclassified | 1119 |
| 627 | Ga0207708_10469516 | 3300026075 | Unclassified | 1050 |
| 628 | Ga0207708_10983287 | 3300026075 | Bacteria | 733 |
| 629 | Ga0207702_10079906 | 3300026078 | Bacteria | 2836 |
| 630 | Ga0207702_10156062 | 3300026078 | Bacteria | 2080 |
| 631 | Ga0207702_12069344 | 3300026078 | Bacteria | 559 |
| 632 | Ga0207641_10001943 | 3300026088 | Bacteria | 19841 |
| 633 | Ga0207641_10324202 | 3300026088 | Bacteria | 1461 |
| 634 | Ga0207641_10973840 | 3300026088 | Bacteria | 844 |
| 635 | Ga0207641_11104943 | 3300026088 | Unclassified | 791 |
| 636 | Ga0207641_12202321 | 3300026088 | Bacteria | 551 |
| 637 | Ga0207648_10011132 | 3300026089 | Bacteria | 8485 |
| 638 | Ga0207648_10011648 | 3300026089 | Bacteria | 8278 |
| 639 | Ga0207648_10664151 | 3300026089 | Bacteria | 964 |
| 640 | Ga0207648_11351901 | 3300026089 | Unclassified | 669 |
| 641 | Ga0207648_11789152 | 3300026089 | Unclassified | 576 |
| 642 | Ga0207676_10048887 | 3300026095 | Bacteria | 3286 |
| 643 | Ga0207676_10415739 | 3300026095 | Bacteria | 1260 |
| 644 | Ga0207676_10436550 | 3300026095 | Unclassified | 1231 |
| 645 | Ga0207676_10701575 | 3300026095 | Bacteria | 980 |
| 646 | Ga0207676_12317861 | 3300026095 | Bacteria | 534 |
| 647 | Ga0207676_12334943 | 3300026095 | Unclassified | 532 |
| 648 | Ga0207674_10002747 | 3300026116 | Bacteria | 21950 |
| 649 | Ga0207674_10034136 | 3300026116 | Bacteria | 5321 |
| 650 | Ga0207674_10049854 | 3300026116 | Bacteria | 4279 |
| 651 | Ga0207674_10210991 | 3300026116 | Unclassified | 1891 |
| 652 | Ga0207674_10304981 | 3300026116 | Bacteria | 1541 |
| 653 | Ga0207674_10498547 | 3300026116 | Unclassified | 1176 |
| 654 | Ga0207675_100001083 | 3300026118 | Bacteria | 26980 |
| 655 | Ga0207675_100049015 | 3300026118 | Bacteria | 3943 |
| 656 | Ga0207675_100089160 | 3300026118 | Bacteria | 2898 |
| 657 | Ga0207675_101159567 | 3300026118 | Bacteria | 793 |
| 658 | Ga0207675_102337699 | 3300026118 | Unclassified | 548 |
| 659 | Ga0207683_10100572 | 3300026121 | Bacteria | 2581 |
| 660 | Ga0207683_10264867 | 3300026121 | Bacteria | 1569 |
| 661 | Ga0207683_11393707 | 3300026121 | Unclassified | 648 |
| 662 | Ga0207698_10027355 | 3300026142 | Bacteria | 4047 |
| 663 | Ga0207698_10158064 | 3300026142 | Bacteria | 1978 |
| 664 | Ga0207698_10223423 | 3300026142 | Bacteria | 1704 |
| 665 | Ga0207698_10275305 | 3300026142 | Bacteria | 1554 |
| 666 | Ga0207698_10653752 | 3300026142 | Bacteria | 1042 |
| 667 | Ga0209969_1039443 | 3300027360 | Bacteria | 731 |
| 668 | Ga0209967_1023655 | 3300027364 | Bacteria | 905 |
| 669 | Ga0209996_1022530 | 3300027395 | Bacteria | 891 |
| 670 | Ga0209996_1063784 | 3300027395 | Bacteria | 568 |
| 671 | Ga0209984_1006490 | 3300027424 | Bacteria | 1435 |
| 672 | Ga0209984_1011020 | 3300027424 | Bacteria | 1167 |
| 673 | Ga0209982_1003304 | 3300027552 | Bacteria | 2287 |
| 674 | Ga0209982_1030509 | 3300027552 | Bacteria | 847 |
| 675 | Ga0209970_1044969 | 3300027614 | Bacteria | 791 |
| 676 | Ga0209983_1004970 | 3300027665 | Bacteria | 2778 |
| 677 | Ga0209971_1051660 | 3300027682 | Bacteria | 993 |
| 678 | Ga0209998_10001424 | 3300027717 | Bacteria | 5791 |
| 679 | Ga0209998_10012232 | 3300027717 | Bacteria | 1782 |
| 680 | Ga0209813_10364280 | 3300027866 | Unclassified | 575 |
| 681 | Ga0209974_10008144 | 3300027876 | Bacteria | 3589 |
| 682 | Ga0209974_10020177 | 3300027876 | Bacteria | 2209 |
| 683 | Ga0207428_10031609 | 3300027907 | Bacteria | 4365 |
| 684 | Ga0207428_10149621 | 3300027907 | Bacteria | 1777 |
| 685 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 686 | Ga0268266_10183825 | 3300028379 | Bacteria | 1905 |
| 687 | Ga0268265_10006006 | 3300028380 | Bacteria | 8260 |
| 688 | Ga0268265_10048973 | 3300028380 | Bacteria | 3175 |
| 689 | Ga0268265_10080616 | 3300028380 | Bacteria | 2567 |
| 690 | Ga0268265_10559621 | 3300028380 | Unclassified | 1087 |
| 691 | Ga0268265_10726508 | 3300028380 | Unclassified | 962 |
| 692 | Ga0268265_10779522 | 3300028380 | Bacteria | 930 |
| 693 | Ga0268265_11879733 | 3300028380 | Unclassified | 605 |
| 694 | Ga0268264_10003700 | 3300028381 | Bacteria | 13128 |
| 695 | Ga0268264_10005822 | 3300028381 | Bacteria | 10448 |
| 696 | Ga0268264_10045472 | 3300028381 | Bacteria | 3644 |
| 697 | Ga0268264_10070313 | 3300028381 | Bacteria | 2963 |
| 698 | Ga0268264_10175839 | 3300028381 | Bacteria | 1940 |
| 699 | Ga0268264_10464210 | 3300028381 | Bacteria | 1229 |
| 700 | Ga0268264_11174508 | 3300028381 | Bacteria | 777 |
| 701 | Ga0307408_101371002 | 3300031548 | Unclassified | 665 |
| 702 | Ga0307410_11429435 | 3300031852 | Unclassified | 608 |
| 703 | Ga0307416_103265362 | 3300032002 | Bacteria | 543 |
| 704 | Ga0307415_102235173 | 3300032126 | Bacteria | 536 |
| 705 | Ga0307510_10005162 | 3300033180 | Bacteria | 15516 |
| 706 | Ga0307510_10039726 | 3300033180 | Bacteria | 5178 |
| 707 | Ga0373926_0005105 | 3300035083 | Bacteria | 4310 |
| 708 | Ga0373926_0332509 | 3300035083 | Bacteria | 595 |
| 709 | Ga0373929_0023690 | 3300035085 | Bacteria | 1263 |
| 710 | Ga0373929_0056945 | 3300035085 | Bacteria | 907 |
| 711 | Ga0373940_0183855 | 3300035088 | Bacteria | 681 |
| 712 | Ga0373940_0296423 | 3300035088 | Bacteria | 556 |
| 713 | Ga0373944_0046463 | 3300035089 | Bacteria | 1357 |
| 714 | Ga0373932_0217833 | 3300035112 | Bacteria | 685 |
| 715 | Ga0373936_0004621 | 3300035113 | Bacteria | 5209 |
| 716 | Ga0373936_0105502 | 3300035113 | Bacteria | 1192 |
| 717 | Ga0373941_0393208 | 3300035115 | Unclassified | 572 |
| 718 | Ga0373945_0157089 | 3300035116 | Bacteria | 925 |
| 719 | Ga0373960_0257344 | 3300035121 | Unclassified | 636 |
| 720 | Ga0373943_0007551 | 3300035170 | Bacteria | 4883 |
| 721 | Ga0373943_0012517 | 3300035170 | Bacteria | 3822 |
| 722 | Ga0373943_0040632 | 3300035170 | Bacteria | 2246 |
| 723 | Ga0373942_0012462 | 3300035207 | Bacteria | 2031 |
| 724 | Ga0373961_0187249 | 3300035241 | Bacteria | 724 |
| 725 | Ga0373961_0285438 | 3300035241 | Bacteria | 607 |
| 726 | Ga0373931_0051612 | 3300035691 | Bacteria | 2191 |
| 727 | Ga0373931_0094161 | 3300035691 | Bacteria | 1674 |
| 728 | Ga0373931_0161305 | 3300035691 | Bacteria | 1314 |
| 729 | Ga0373931_0496539 | 3300035691 | Bacteria | 786 |
| 730 | Ga0373935_0034779 | 3300035692 | Bacteria | 3142 |
| 731 | Ga0373935_0138236 | 3300035692 | Bacteria | 1643 |
| 732 | Ga0373927_0007467 | 3300035695 | Bacteria | 7393 |
| 733 | Ga0373927_0087291 | 3300035695 | Bacteria | 2025 |
| 734 | Ga0373927_0569921 | 3300035695 | Bacteria | 748 |
| 735 | Ga0373947_0026159 | 3300035725 | Bacteria | 3407 |
| 736 | Ga0373947_0026474 | 3300035725 | Bacteria | 3390 |
| 737 | Ga0373947_0031034 | 3300035725 | Bacteria | 3142 |
| 738 | Ga0373947_0472494 | 3300035725 | Bacteria | 850 |
| 739 | Ga0373937_0217938 | 3300036401 | Bacteria | 1796 |
| 740 | Ga0373925_0010664 | 3300037068 | Bacteria | 6664 |
| 741 | Ga0373925_0058273 | 3300037068 | Bacteria | 2896 |
| 742 | Ga0395898_1200643 | 3300037466 | Unclassified | 690 |
| 743 | Ga0436364_0341842 | 3300037853 | Bacteria | 520 |
| 744 | Ga0436365_0731537 | 3300039437 | Unclassified | 673 |
| 745 | Ga0451795_0174589 | 3300041456 | Bacteria | 1627 |
| 746 | Ga0451845_0152272 | 3300041501 | Unclassified | 634 |
| 747 | Ga0451853_1856925 | 3300041512 | Bacteria | 567 |
| 748 | Ga0451853_2507703 | 3300041512 | Bacteria | 634 |
| 749 | Ga0439441_101259 | 3300042001 | Unclassified | 646 |
| 750 | Ga0439448_0134438 | 3300042005 | Bacteria | 854 |
| 751 | Ga0439455_0199467 | 3300042012 | Bacteria | 579 |
| 752 | Ga0439458_0209334 | 3300042157 | Bacteria | 535 |
| 753 | Ga0439435_0174198 | 3300042436 | Bacteria | 700 |
| 754 | Ga0451577_0097039 | 3300042876 | Bacteria | 2632 |
| 755 | Ga0451577_0126210 | 3300042876 | Bacteria | 2293 |
| 756 | Ga0466969_0211540 | 3300044656 | Unclassified | 883 |
| 757 | Ga0466961_0214584 | 3300044693 | Unclassified | 1187 |
| 758 | Ga0466963_0311464 | 3300044694 | Bacteria | 1108 |
| 759 | Ga0466964_0206973 | 3300044706 | Bacteria | 945 |
| 760 | Ga0453684_1020152 | 3300044712 | Bacteria | 879 |
| 761 | Ga0453684_1662365 | 3300044712 | Unclassified | 653 |
| 762 | Ga0466970_0598883 | 3300044765 | Unclassified | 639 |
| 763 | Ga0466957_0855852 | 3300044842 | Bacteria | 648 |
| 764 | Ga0451576_0061365 | 3300045051 | Bacteria | 3920 |
| 765 | Ga0451576_0092226 | 3300045051 | Bacteria | 3150 |
| 766 | Ga0451576_0582779 | 3300045051 | Bacteria | 1175 |
| 767 | Ga0451576_0836213 | 3300045051 | Bacteria | 966 |
| 768 | Ga0451576_1059929 | 3300045051 | Bacteria | 849 |
| 769 | Ga0466967_0078056 | 3300045976 | Bacteria | 2982 |
| 770 | Ga0495603_0309940 | 3300046455 | Bacteria | 906 |
| 771 | Ga0495638_0123666 | 3300046460 | Bacteria | 1526 |
| 772 | Ga0495650_0000724 | 3300046471 | Bacteria | 41841 |
| 773 | Ga0495650_0000912 | 3300046471 | Bacteria | 34832 |
| 774 | Ga0495650_0010534 | 3300046471 | Bacteria | 5150 |
| 775 | Ga0495580_0000432 | 3300046472 | Bacteria | 34580 |
| 776 | Ga0495582_0024878 | 3300046473 | Bacteria | 3279 |
| 777 | Ga0495584_0007234 | 3300046491 | Bacteria | 5792 |
| 778 | Ga0495585_0001003 | 3300046492 | Bacteria | 23550 |
| 779 | Ga0495607_0000002 | 3300046501 | Bacteria | 414833 |
| 780 | Ga0495606_0000333 | 3300046507 | Bacteria | 81527 |
| 781 | Ga0495606_0009282 | 3300046507 | Bacteria | 8347 |
| 782 | Ga0495610_0120007 | 3300046512 | Bacteria | 1153 |
| 783 | Ga0495616_0000001 | 3300046513 | Bacteria | 780061 |
| 784 | Ga0495620_0000401 | 3300046515 | Bacteria | 28963 |
| 785 | Ga0495628_0001076 | 3300046516 | Bacteria | 25062 |
| 786 | Ga0495631_0000410 | 3300046518 | Bacteria | 29585 |
| 787 | Ga0495632_0000003 | 3300046519 | Bacteria | 396071 |
| 788 | Ga0495632_0004605 | 3300046519 | Bacteria | 9337 |
| 789 | Ga0495632_0013771 | 3300046519 | Bacteria | 4600 |
| 790 | Ga0495648_0009496 | 3300046524 | Bacteria | 7523 |
| 791 | Ga0495666_0010381 | 3300046526 | Bacteria | 4642 |
| 792 | Ga0495642_0229807 | 3300046528 | Bacteria | 810 |
| 793 | Ga0495665_0170293 | 3300046531 | Bacteria | 1134 |
| 794 | Ga0495586_0018234 | 3300046535 | Bacteria | 3736 |
| 795 | Ga0495598_0011875 | 3300046537 | Bacteria | 2122 |
| 796 | Ga0495656_0012406 | 3300046615 | Bacteria | 3144 |
| 797 | Ga0495668_0015436 | 3300046616 | Bacteria | 4459 |
| 798 | Ga0495634_0691931 | 3300046642 | Unclassified | 587 |
| 799 | Ga0495611_0000008 | 3300046648 | Bacteria | 218134 |
| 800 | Ga0495625_0003154 | 3300046660 | Bacteria | 16790 |
| 801 | Ga0495625_0304637 | 3300046660 | Bacteria | 1018 |
| 802 | Ga0495647_0004038 | 3300046681 | Bacteria | 4739 |
| 803 | Ga0495658_0028461 | 3300046683 | Bacteria | 3017 |
| 804 | Ga0495670_0170698 | 3300046691 | Bacteria | 1145 |
| 805 | Ga0495660_0000009 | 3300046810 | Bacteria | 427395 |
| 806 | Ga0495581_0028165 | 3300047315 | Bacteria | 3257 |
| 807 | Ga0495636_0117749 | 3300047318 | Bacteria | 1173 |
| 808 | Ga0495676_0024633 | 3300047321 | Bacteria | 5206 |
| 809 | Ga0495683_0020056 | 3300047323 | Bacteria | 3449 |
| 810 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 811 | Ga0495673_0000030 | 3300047469 | Bacteria | 468915 |
| 812 | Ga0495686_0000077 | 3300047472 | Bacteria | 205924 |
| 813 | Ga0495686_0005194 | 3300047472 | Bacteria | 10368 |
| 814 | Ga0495686_0017160 | 3300047472 | Bacteria | 4886 |
| 815 | Ga0496100_0020465 | 3300048903 | Bacteria | 3967 |
| 816 | Ga0496100_0026869 | 3300048903 | Bacteria | 3534 |
| 817 | Ga0496100_0160018 | 3300048903 | Unclassified | 1613 |
| 818 | Ga0496101_0001666 | 3300048904 | Bacteria | 13336 |
| 819 | Ga0496101_0074238 | 3300048904 | Bacteria | 2501 |
| 820 | Ga0496101_0194066 | 3300048904 | Bacteria | 1568 |
| 821 | Ga0496102_0002744 | 3300048905 | Bacteria | 15010 |
| 822 | Ga0496102_0011114 | 3300048905 | Bacteria | 7755 |
| 823 | Ga0496102_0012607 | 3300048905 | Bacteria | 7323 |
| 824 | Ga0496102_0717489 | 3300048905 | Bacteria | 923 |
| 825 | Ga0496102_1756648 | 3300048905 | Bacteria | 538 |
| 826 | Ga0496103_0078203 | 3300048906 | Bacteria | 2077 |
| 827 | Ga0496103_0127038 | 3300048906 | Bacteria | 1626 |
| 828 | Ga0496105_0133554 | 3300048908 | Bacteria | 2045 |
| 829 | Ga0496106_0002229 | 3300048909 | Bacteria | 14454 |
| 830 | Ga0496106_0005702 | 3300048909 | Bacteria | 9209 |
| 831 | Ga0496106_0029054 | 3300048909 | Bacteria | 4119 |
| 832 | Ga0496106_0195586 | 3300048909 | Bacteria | 1608 |
| 833 | Ga0496106_1138456 | 3300048909 | Bacteria | 610 |
| 834 | Ga0496107_0002621 | 3300048910 | Bacteria | 11756 |
| 835 | Ga0496107_0010881 | 3300048910 | Bacteria | 6330 |
| 836 | Ga0496107_0106352 | 3300048910 | Bacteria | 2061 |
| 837 | Ga0496107_0170373 | 3300048910 | Bacteria | 1615 |
| 838 | Ga0496107_0185159 | 3300048910 | Bacteria | 1546 |
| 839 | Ga0496108_0009040 | 3300048911 | Bacteria | 8072 |
| 840 | Ga0496108_0115156 | 3300048911 | Bacteria | 2302 |
| 841 | Ga0496108_0130664 | 3300048911 | Bacteria | 2159 |
| 842 | Ga0496108_0332096 | 3300048911 | Bacteria | 1326 |
| 843 | Ga0496108_1333691 | 3300048911 | Unclassified | 602 |
| 844 | Ga0496109_0001784 | 3300048912 | Bacteria | 17897 |
| 845 | Ga0496109_0696808 | 3300048912 | Bacteria | 953 |
| 846 | Ga0496109_0920074 | 3300048912 | Bacteria | 812 |
| 847 | Ga0496109_1062092 | 3300048912 | Unclassified | 747 |
| 848 | Ga0496110_0034991 | 3300048913 | Bacteria | 4355 |
| 849 | Ga0496110_0797142 | 3300048913 | Bacteria | 849 |
| 850 | Ga0496110_0974685 | 3300048913 | Unclassified | 755 |
| 851 | Ga0496111_0022218 | 3300048914 | Bacteria | 4438 |
| 852 | Ga0496112_0051471 | 3300048915 | Bacteria | 4040 |
| 853 | Ga0496113_0091981 | 3300048916 | Bacteria | 2339 |
| 854 | Ga0496114_0265278 | 3300048917 | Bacteria | 1513 |
| 855 | Ga0496114_0314183 | 3300048917 | Unclassified | 1384 |
| 856 | Ga0496114_0712885 | 3300048917 | Unclassified | 879 |
| 857 | Ga0496115_0082573 | 3300048918 | Bacteria | 2618 |
| 858 | Ga0496115_0255087 | 3300048918 | Bacteria | 1443 |
| 859 | Ga0496115_0278581 | 3300048918 | Unclassified | 1373 |
| 860 | Ga0496115_0489199 | 3300048918 | Bacteria | 990 |
| 861 | Ga0496118_0111732 | 3300048921 | Bacteria | 1811 |
| 862 | Ga0496118_0138419 | 3300048921 | Bacteria | 1549 |
| 863 | Ga0496121_0000368 | 3300048924 | Bacteria | 92730 |
| 864 | Ga0496121_0000390 | 3300048924 | Bacteria | 89674 |
| 865 | Ga0496121_0078690 | 3300048924 | Bacteria | 2620 |
| 866 | Ga0496121_0338478 | 3300048924 | Unclassified | 1006 |
| 867 | Ga0496122_0035640 | 3300048925 | Bacteria | 4042 |
| 868 | Ga0496123_0020397 | 3300048926 | Bacteria | 5186 |
| 869 | Ga0496123_0504644 | 3300048926 | Bacteria | 528 |
| 870 | Ga0496124_0064399 | 3300048927 | Bacteria | 3060 |
| 871 | Ga0496125_0026949 | 3300048928 | Bacteria | 5219 |
| 872 | Ga0496126_0009926 | 3300048929 | Bacteria | 10051 |
| 873 | Ga0496126_0026115 | 3300048929 | Bacteria | 5606 |
| 874 | Ga0496126_0061821 | 3300048929 | Bacteria | 3362 |
| 875 | Ga0496126_0901836 | 3300048929 | Unclassified | 670 |
| 876 | Ga0501039_0344397 | 3300049575 | Bacteria | 1171 |
| 877 | Ga0501039_1588599 | 3300049575 | Bacteria | 502 |
| 878 | Ga0501067_0028799 | 3300049583 | Bacteria | 3078 |
| 879 | Ga0501069_0717591 | 3300049585 | Bacteria | 604 |
| 880 | Ga0501072_0238289 | 3300049588 | Bacteria | 1449 |
| 881 | Ga0501045_1417356 | 3300049824 | Bacteria | 504 |
| 882 | nmdc:mga03n38_7495_c1 | 3300050490 | Bacteria | 3864 |
| 883 | nmdc:mga0yw44_56564_c1 | 3300050492 | Bacteria | 2390 |
| 884 | nmdc:mga06z11_606569_c1 | 3300050494 | Unclassified | 666 |
| 885 | nmdc:mga05p37_2198907_c1 | 3300050507 | Unclassified | 512 |
| 886 | nmdc:mga05p37_264431_c1 | 3300050507 | Bacteria | 2057 |
| 887 | nmdc:mga09592_16816_c1 | 3300050508 | Bacteria | 5987 |
| 888 | nmdc:mga09592_793621_c1 | 3300050508 | Archaea | 801 |
| 889 | nmdc:mga09592_91338_c1 | 3300050508 | Bacteria | 2602 |
| 890 | nmdc:mga0qj67_213444_c1 | 3300050509 | Bacteria | 1567 |
| 891 | nmdc:mga0qj67_25908_c1 | 3300050509 | Unclassified | 4536 |
| 892 | nmdc:mga06r32_620395_c1 | 3300050510 | Bacteria | 1051 |
| 893 | nmdc:mga06r32_65621_c1 | 3300050510 | Bacteria | 3501 |
| 894 | nmdc:mga06r32_8403_c1 | 3300050510 | Bacteria | 9300 |
| 895 | nmdc:mga06r32_926097_c1 | 3300050510 | Bacteria | 827 |
| 896 | nmdc:mga08y16_43202_c1 | 3300050511 | Bacteria | 4722 |
| 897 | nmdc:mga08y16_447805_c1 | 3300050511 | Bacteria | 1317 |
| 898 | nmdc:mga08y16_513385_c1 | 3300050511 | Bacteria | 1216 |
| 899 | nmdc:mga08y16_596211_c1 | 3300050511 | Bacteria | 1114 |
| 900 | nmdc:mga08y16_85745_c1 | 3300050511 | Bacteria | 3282 |
| 901 | nmdc:mga0n895_1598914_c1 | 3300050512 | Bacteria | 616 |
| 902 | nmdc:mga0n895_58924_c1 | 3300050512 | Bacteria | 3788 |
| 903 | nmdc:mga0n895_68896_c1 | 3300050512 | Bacteria | 3505 |
| 904 | nmdc:mga0n895_933456_c1 | 3300050512 | Bacteria | 852 |
| 905 | nmdc:mga0n895_956145_c1 | 3300050512 | Bacteria | 840 |
| 906 | nmdc:mga0rr50_384824_c1 | 3300050513 | Archaea | 1183 |
| 907 | nmdc:mga0rr50_452472_c1 | 3300050513 | Bacteria | 1089 |
| 908 | nmdc:mga08x19_1634_c1 | 3300050514 | Bacteria | 13867 |
| 909 | nmdc:mga0a205_13067_c1 | 3300050515 | Bacteria | 7711 |
| 910 | nmdc:mga0a205_428461_c1 | 3300050515 | Bacteria | 1184 |
| 911 | nmdc:mga0a205_821288_c1 | 3300050515 | Unclassified | 777 |
| 912 | Ga0500646_0015830 | 3300053090 | Bacteria | 1966 |
| 913 | Ga0500568_0029049 | 3300053139 | Bacteria | 2299 |
| 914 | Ga0500616_0109048 | 3300053153 | Unclassified | 1340 |
| 915 | Ga0500633_0039139 | 3300053160 | Bacteria | 1583 |
| 916 | Ga0590077_019746 | 3300059426 | Bacteria | 1429 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100619867 | Ga0070714_1006198672 | 92 |
| 2 | 3300025912 | Ga0207707_10408092 | Ga0207707_104080922 | 92 |
| 3 | 3300025924 | Ga0207694_10416605 | Ga0207694_104166052 | 92 |
| 4 | 3300026116 | Ga0207674_10002747 | Ga0207674_1000274719 | 92 |
| 5 | 3300037466 | Ga0395898_1200643 | Ga0395898_1200643_19_330 | 92 |
| 6 | 3300005335 | Ga0070666_11354917 | Ga0070666_113549172 | 94 |
| 7 | 3300005355 | Ga0070671_100000445 | Ga0070671_1000004455 | 94 |
| 8 | 3300005841 | Ga0068863_100153344 | Ga0068863_1001533442 | 94 |
| 9 | 3300014326 | Ga0157380_10284879 | Ga0157380_102848793 | 94 |
| 10 | 3300025931 | Ga0207644_10001203 | Ga0207644_100012035 | 94 |
| 11 | 3300006163 | Ga0070715_10915635 | Ga0070715_109156352 | 97 |
| 12 | 3300007076 | Ga0075435_100915148 | Ga0075435_1009151482 | 97 |
| 13 | 3300025905 | Ga0207685_10175729 | Ga0207685_101757292 | 97 |
| 14 | 3300035085 | Ga0373929_0023690 | Ga0373929_0023690_901_1215 | 97 |
| 15 | 3300045051 | Ga0451576_0092226 | Ga0451576_0092226_1813_2127 | 97 |
| 16 | 3300048911 | Ga0496108_0130664 | Ga0496108_0130664_1813_2148 | 97 |
| 17 | 3300026118 | Ga0207675_102337699 | Ga0207675_1023376992 | 98 |
| 18 | 3300049585 | Ga0501069_0717591 | Ga0501069_0717591_228_536 | 98 |
| 19 | 3300004801 | Ga0058860_12217052 | Ga0058860_122170521 | 99 |
| 20 | 3300005327 | Ga0070658_11137813 | Ga0070658_111378132 | 99 |
| 21 | 3300005330 | Ga0070690_100000584 | Ga0070690_1000005841 | 99 |
| 22 | 3300005334 | Ga0068869_100103078 | Ga0068869_1001030783 | 99 |
| 23 | 3300005336 | Ga0070680_100040141 | Ga0070680_1000401413 | 99 |
| 24 | 3300005338 | Ga0068868_100002180 | Ga0068868_1000021805 | 99 |
| 25 | 3300005340 | Ga0070689_100003146 | Ga0070689_1000031462 | 99 |
| 26 | 3300005341 | Ga0070691_11013767 | Ga0070691_110137671 | 99 |
| 27 | 3300005343 | Ga0070687_100048364 | Ga0070687_1000483642 | 99 |
| 28 | 3300005345 | Ga0070692_10013994 | Ga0070692_100139945 | 99 |
| 29 | 3300005347 | Ga0070668_101648042 | Ga0070668_1016480422 | 99 |
| 30 | 3300005354 | Ga0070675_100951566 | Ga0070675_1009515662 | 99 |
| 31 | 3300005354 | Ga0070675_102178177 | Ga0070675_1021781771 | 99 |
| 32 | 3300005406 | Ga0070703_10013905 | Ga0070703_100139052 | 99 |
| 33 | 3300005440 | Ga0070705_100994044 | Ga0070705_1009940441 | 99 |
| 34 | 3300005444 | Ga0070694_100001106 | Ga0070694_10000110617 | 99 |
| 35 | 3300005444 | Ga0070694_100167598 | Ga0070694_1001675982 | 99 |
| 36 | 3300005458 | Ga0070681_10477434 | Ga0070681_104774342 | 99 |
| 37 | 3300005459 | Ga0068867_100024059 | Ga0068867_1000240595 | 99 |
| 38 | 3300005459 | Ga0068867_100193293 | Ga0068867_1001932933 | 99 |
| 39 | 3300005530 | Ga0070679_100470283 | Ga0070679_1004702832 | 99 |
| 40 | 3300005530 | Ga0070679_101080606 | Ga0070679_1010806062 | 99 |
| 41 | 3300005543 | Ga0070672_101389598 | Ga0070672_1013895982 | 99 |
| 42 | 3300005544 | Ga0070686_100002108 | Ga0070686_1000021082 | 99 |
| 43 | 3300005545 | Ga0070695_100000295 | Ga0070695_1000002952 | 99 |
| 44 | 3300005546 | Ga0070696_100011350 | Ga0070696_1000113502 | 99 |
| 45 | 3300005547 | Ga0070693_100006341 | Ga0070693_1000063415 | 99 |
| 46 | 3300005549 | Ga0070704_100460895 | Ga0070704_1004608951 | 99 |
| 47 | 3300005577 | Ga0068857_100050892 | Ga0068857_1000508923 | 99 |
| 48 | 3300005615 | Ga0070702_100004748 | Ga0070702_1000047482 | 99 |
| 49 | 3300005615 | Ga0070702_101649899 | Ga0070702_1016498992 | 99 |
| 50 | 3300005616 | Ga0068852_100135922 | Ga0068852_1001359222 | 99 |
| 51 | 3300005617 | Ga0068859_101845690 | Ga0068859_1018456902 | 99 |
| 52 | 3300005718 | Ga0068866_10108422 | Ga0068866_101084221 | 99 |
| 53 | 3300005841 | Ga0068863_101298027 | Ga0068863_1012980272 | 99 |
| 54 | 3300005842 | Ga0068858_100007255 | Ga0068858_1000072551 | 99 |
| 55 | 3300005843 | Ga0068860_100131036 | Ga0068860_1001310362 | 99 |
| 56 | 3300005844 | Ga0068862_100247405 | Ga0068862_1002474051 | 99 |
| 57 | 3300005844 | Ga0068862_101538239 | Ga0068862_1015382392 | 99 |
| 58 | 3300006237 | Ga0097621_100001291 | Ga0097621_1000012918 | 99 |
| 59 | 3300006358 | Ga0068871_100014810 | Ga0068871_1000148105 | 99 |
| 60 | 3300006847 | Ga0075431_101126274 | Ga0075431_1011262742 | 99 |
| 61 | 3300006880 | Ga0075429_101148496 | Ga0075429_1011484962 | 99 |
| 62 | 3300006881 | Ga0068865_100081775 | Ga0068865_1000817752 | 99 |
| 63 | 3300006931 | Ga0097620_101845726 | Ga0097620_1018457262 | 99 |
| 64 | 3300009098 | Ga0105245_10001445 | Ga0105245_1000144526 | 99 |
| 65 | 3300009148 | Ga0105243_10414498 | Ga0105243_104144981 | 99 |
| 66 | 3300009174 | Ga0105241_10890987 | Ga0105241_108909871 | 99 |
| 67 | 3300009176 | Ga0105242_10013405 | Ga0105242_100134052 | 99 |
| 68 | 3300009177 | Ga0105248_10724865 | Ga0105248_107248652 | 99 |
| 69 | 3300009551 | Ga0105238_10896050 | Ga0105238_108960501 | 99 |
| 70 | 3300009553 | Ga0105249_11085532 | Ga0105249_110855321 | 99 |
| 71 | 3300013105 | Ga0157369_10535507 | Ga0157369_105355072 | 99 |
| 72 | 3300013297 | Ga0157378_10001797 | Ga0157378_1000179724 | 99 |
| 73 | 3300013307 | Ga0157372_13267995 | Ga0157372_132679951 | 99 |
| 74 | 3300014745 | Ga0157377_10191894 | Ga0157377_101918942 | 99 |
| 75 | 3300014969 | Ga0157376_10000791 | Ga0157376_100007914 | 99 |
| 76 | 3300025885 | Ga0207653_10012135 | Ga0207653_100121354 | 99 |
| 77 | 3300025898 | Ga0207692_10219628 | Ga0207692_102196282 | 99 |
| 78 | 3300025899 | Ga0207642_10083377 | Ga0207642_100833772 | 99 |
| 79 | 3300025904 | Ga0207647_10224967 | Ga0207647_102249672 | 99 |
| 80 | 3300025912 | Ga0207707_10452626 | Ga0207707_104526262 | 99 |
| 81 | 3300025917 | Ga0207660_10223282 | Ga0207660_102232822 | 99 |
| 82 | 3300025918 | Ga0207662_10011880 | Ga0207662_100118805 | 99 |
| 83 | 3300025921 | Ga0207652_10070235 | Ga0207652_100702354 | 99 |
| 84 | 3300025927 | Ga0207687_10047547 | Ga0207687_100475474 | 99 |
| 85 | 3300025934 | Ga0207686_10194117 | Ga0207686_101941172 | 99 |
| 86 | 3300025938 | Ga0207704_10110379 | Ga0207704_101103792 | 99 |
| 87 | 3300025941 | Ga0207711_10235760 | Ga0207711_102357602 | 99 |
| 88 | 3300025942 | Ga0207689_10121204 | Ga0207689_101212042 | 99 |
| 89 | 3300025944 | Ga0207661_10168536 | Ga0207661_101685362 | 99 |
| 90 | 3300025961 | Ga0207712_10778802 | Ga0207712_107788021 | 99 |
| 91 | 3300026023 | Ga0207677_10155430 | Ga0207677_101554302 | 99 |
| 92 | 3300026075 | Ga0207708_10345598 | Ga0207708_103455981 | 99 |
| 93 | 3300026088 | Ga0207641_12202321 | Ga0207641_122023211 | 99 |
| 94 | 3300026089 | Ga0207648_10011648 | Ga0207648_100116488 | 99 |
| 95 | 3300026118 | Ga0207675_101159567 | Ga0207675_1011595672 | 99 |
| 96 | 3300026142 | Ga0207698_10275305 | Ga0207698_102753052 | 99 |
| 97 | 3300028381 | Ga0268264_10003700 | Ga0268264_100037005 | 99 |
| 98 | 3300028381 | Ga0268264_11174508 | Ga0268264_111745082 | 99 |
| 99 | 3300035083 | Ga0373926_0005105 | Ga0373926_0005105_1998_2309 | 99 |
| 100 | 3300035083 | Ga0373926_0332509 | Ga0373926_0332509_51_362 | 99 |
| 101 | 3300035085 | Ga0373929_0056945 | Ga0373929_0056945_382_693 | 99 |
| 102 | 3300035089 | Ga0373944_0046463 | Ga0373944_0046463_353_664 | 99 |
| 103 | 3300035112 | Ga0373932_0217833 | Ga0373932_0217833_265_576 | 99 |
| 104 | 3300035113 | Ga0373936_0004621 | Ga0373936_0004621_2710_3021 | 99 |
| 105 | 3300035113 | Ga0373936_0105502 | Ga0373936_0105502_108_419 | 99 |
| 106 | 3300035116 | Ga0373945_0157089 | Ga0373945_0157089_354_665 | 99 |
| 107 | 3300035170 | Ga0373943_0007551 | Ga0373943_0007551_1732_2043 | 99 |
| 108 | 3300035170 | Ga0373943_0012517 | Ga0373943_0012517_590_901 | 99 |
| 109 | 3300035170 | Ga0373943_0040632 | Ga0373943_0040632_1286_1597 | 99 |
| 110 | 3300035241 | Ga0373961_0187249 | Ga0373961_0187249_63_374 | 99 |
| 111 | 3300035691 | Ga0373931_0161305 | Ga0373931_0161305_949_1260 | 99 |
| 112 | 3300035691 | Ga0373931_0496539 | Ga0373931_0496539_406_717 | 99 |
| 113 | 3300035692 | Ga0373935_0034779 | Ga0373935_0034779_2502_2813 | 99 |
| 114 | 3300035692 | Ga0373935_0138236 | Ga0373935_0138236_218_529 | 99 |
| 115 | 3300035695 | Ga0373927_0007467 | Ga0373927_0007467_7052_7363 | 99 |
| 116 | 3300035695 | Ga0373927_0087291 | Ga0373927_0087291_344_655 | 99 |
| 117 | 3300035695 | Ga0373927_0569921 | Ga0373927_0569921_351_662 | 99 |
| 118 | 3300035725 | Ga0373947_0026159 | Ga0373947_0026159_2711_3022 | 99 |
| 119 | 3300035725 | Ga0373947_0026474 | Ga0373947_0026474_2542_2853 | 99 |
| 120 | 3300035725 | Ga0373947_0031034 | Ga0373947_0031034_2699_3010 | 99 |
| 121 | 3300035725 | Ga0373947_0472494 | Ga0373947_0472494_377_688 | 99 |
| 122 | 3300036401 | Ga0373937_0217938 | Ga0373937_0217938_475_783 | 99 |
| 123 | 3300037068 | Ga0373925_0010664 | Ga0373925_0010664_3955_4266 | 99 |
| 124 | 3300037068 | Ga0373925_0058273 | Ga0373925_0058273_663_974 | 99 |
| 125 | 3300042436 | Ga0439435_0174198 | Ga0439435_0174198_83_412 | 99 |
| 126 | 3300046455 | Ga0495603_0309940 | Ga0495603_0309940_460_771 | 99 |
| 127 | 3300046472 | Ga0495580_0000432 | Ga0495580_0000432_25668_25979 | 99 |
| 128 | 3300046473 | Ga0495582_0024878 | Ga0495582_0024878_2173_2484 | 99 |
| 129 | 3300046526 | Ga0495666_0010381 | Ga0495666_0010381_3325_3636 | 99 |
| 130 | 3300046531 | Ga0495665_0170293 | Ga0495665_0170293_205_516 | 99 |
| 131 | 3300046535 | Ga0495586_0018234 | Ga0495586_0018234_3412_3723 | 99 |
| 132 | 3300046537 | Ga0495598_0011875 | Ga0495598_0011875_710_1021 | 99 |
| 133 | 3300046615 | Ga0495656_0012406 | Ga0495656_0012406_390_701 | 99 |
| 134 | 3300046681 | Ga0495647_0004038 | Ga0495647_0004038_3436_3747 | 99 |
| 135 | 3300046683 | Ga0495658_0028461 | Ga0495658_0028461_1204_1515 | 99 |
| 136 | 3300047315 | Ga0495581_0028165 | Ga0495581_0028165_168_479 | 99 |
| 137 | 3300047321 | Ga0495676_0024633 | Ga0495676_0024633_1170_1481 | 99 |
| 138 | 3300050510 | nmdc:mga06r32_926097_c1 | nmdc:mga06r32_926097_c1_85_396 | 99 |
| 139 | 3300050511 | nmdc:mga08y16_596211_c1 | nmdc:mga08y16_596211_c1_679_1005 | 99 |
| 140 | 3300000044 | ARSoilOldRDRAFT_c017047 | ARSoilOldRDRAFT_0170472 | 100 |
| 141 | 3300004798 | Ga0058859_10049305 | Ga0058859_100493052 | 100 |
| 142 | 3300005295 | Ga0065707_10052148 | Ga0065707_100521482 | 100 |
| 143 | 3300005330 | Ga0070690_100070176 | Ga0070690_1000701762 | 100 |
| 144 | 3300005330 | Ga0070690_100077402 | Ga0070690_1000774021 | 100 |
| 145 | 3300005331 | Ga0070670_100222839 | Ga0070670_1002228392 | 100 |
| 146 | 3300005334 | Ga0068869_100216777 | Ga0068869_1002167772 | 100 |
| 147 | 3300005334 | Ga0068869_100373923 | Ga0068869_1003739232 | 100 |
| 148 | 3300005334 | Ga0068869_101875269 | Ga0068869_1018752691 | 100 |
| 149 | 3300005335 | Ga0070666_10235751 | Ga0070666_102357512 | 100 |
| 150 | 3300005336 | Ga0070680_100310489 | Ga0070680_1003104892 | 100 |
| 151 | 3300005336 | Ga0070680_101847718 | Ga0070680_1018477181 | 100 |
| 152 | 3300005337 | Ga0070682_100028554 | Ga0070682_1000285542 | 100 |
| 153 | 3300005340 | Ga0070689_101159088 | Ga0070689_1011590882 | 100 |
| 154 | 3300005343 | Ga0070687_100165001 | Ga0070687_1001650012 | 100 |
| 155 | 3300005353 | Ga0070669_100113429 | Ga0070669_1001134292 | 100 |
| 156 | 3300005364 | Ga0070673_101399431 | Ga0070673_1013994312 | 100 |
| 157 | 3300005364 | Ga0070673_101724724 | Ga0070673_1017247242 | 100 |
| 158 | 3300005434 | Ga0070709_10205455 | Ga0070709_102054552 | 100 |
| 159 | 3300005435 | Ga0070714_100354919 | Ga0070714_1003549192 | 100 |
| 160 | 3300005438 | Ga0070701_10017381 | Ga0070701_100173814 | 100 |
| 161 | 3300005438 | Ga0070701_10142807 | Ga0070701_101428071 | 100 |
| 162 | 3300005440 | Ga0070705_100002630 | Ga0070705_1000026301 | 100 |
| 163 | 3300005441 | Ga0070700_100029638 | Ga0070700_1000296384 | 100 |
| 164 | 3300005444 | Ga0070694_100131174 | Ga0070694_1001311741 | 100 |
| 165 | 3300005456 | Ga0070678_100340049 | Ga0070678_1003400492 | 100 |
| 166 | 3300005457 | Ga0070662_100972821 | Ga0070662_1009728212 | 100 |
| 167 | 3300005457 | Ga0070662_101650599 | Ga0070662_1016505991 | 100 |
| 168 | 3300005459 | Ga0068867_100607219 | Ga0068867_1006072191 | 100 |
| 169 | 3300005459 | Ga0068867_100607574 | Ga0068867_1006075742 | 100 |
| 170 | 3300005530 | Ga0070679_100301770 | Ga0070679_1003017702 | 100 |
| 171 | 3300005543 | Ga0070672_100596995 | Ga0070672_1005969952 | 100 |
| 172 | 3300005544 | Ga0070686_100155654 | Ga0070686_1001556542 | 100 |
| 173 | 3300005549 | Ga0070704_100394294 | Ga0070704_1003942942 | 100 |
| 174 | 3300005549 | Ga0070704_102216211 | Ga0070704_1022162111 | 100 |
| 175 | 3300005563 | Ga0068855_100089219 | Ga0068855_1000892192 | 100 |
| 176 | 3300005577 | Ga0068857_100288769 | Ga0068857_1002887692 | 100 |
| 177 | 3300005614 | Ga0068856_100115020 | Ga0068856_1001150202 | 100 |
| 178 | 3300005614 | Ga0068856_102003907 | Ga0068856_1020039072 | 100 |
| 179 | 3300005615 | Ga0070702_100503483 | Ga0070702_1005034832 | 100 |
| 180 | 3300005616 | Ga0068852_100747163 | Ga0068852_1007471632 | 100 |
| 181 | 3300005616 | Ga0068852_102561953 | Ga0068852_1025619532 | 100 |
| 182 | 3300005617 | Ga0068859_100083665 | Ga0068859_1000836652 | 100 |
| 183 | 3300005617 | Ga0068859_101488625 | Ga0068859_1014886252 | 100 |
| 184 | 3300005618 | Ga0068864_100071403 | Ga0068864_1000714032 | 100 |
| 185 | 3300005718 | Ga0068866_10101523 | Ga0068866_101015232 | 100 |
| 186 | 3300005719 | Ga0068861_100280552 | Ga0068861_1002805522 | 100 |
| 187 | 3300005841 | Ga0068863_101038359 | Ga0068863_1010383592 | 100 |
| 188 | 3300005842 | Ga0068858_100108823 | Ga0068858_1001088232 | 100 |
| 189 | 3300005843 | Ga0068860_100086141 | Ga0068860_1000861412 | 100 |
| 190 | 3300005844 | Ga0068862_100011828 | Ga0068862_1000118283 | 100 |
| 191 | 3300006846 | Ga0075430_100486854 | Ga0075430_1004868542 | 100 |
| 192 | 3300006847 | Ga0075431_100687099 | Ga0075431_1006870992 | 100 |
| 193 | 3300006852 | Ga0075433_10010678 | Ga0075433_100106782 | 100 |
| 194 | 3300006871 | Ga0075434_100000566 | Ga0075434_10000056616 | 100 |
| 195 | 3300006871 | Ga0075434_100011155 | Ga0075434_1000111559 | 100 |
| 196 | 3300006881 | Ga0068865_100037664 | Ga0068865_1000376645 | 100 |
| 197 | 3300006914 | Ga0075436_100001732 | Ga0075436_1000017322 | 100 |
| 198 | 3300006914 | Ga0075436_100642121 | Ga0075436_1006421212 | 100 |
| 199 | 3300006931 | Ga0097620_100083671 | Ga0097620_1000836714 | 100 |
| 200 | 3300006931 | Ga0097620_101488707 | Ga0097620_1014887072 | 100 |
| 201 | 3300007076 | Ga0075435_100000249 | Ga0075435_10000024923 | 100 |
| 202 | 3300009094 | Ga0111539_10007483 | Ga0111539_1000748311 | 100 |
| 203 | 3300009094 | Ga0111539_10517813 | Ga0111539_105178132 | 100 |
| 204 | 3300009148 | Ga0105243_10109129 | Ga0105243_101091292 | 100 |
| 205 | 3300009176 | Ga0105242_10211994 | Ga0105242_102119942 | 100 |
| 206 | 3300009177 | Ga0105248_10437044 | Ga0105248_104370442 | 100 |
| 207 | 3300009545 | Ga0105237_10818031 | Ga0105237_108180312 | 100 |
| 208 | 3300009551 | Ga0105238_10033313 | Ga0105238_100333134 | 100 |
| 209 | 3300010375 | Ga0105239_10258473 | Ga0105239_102584732 | 100 |
| 210 | 3300013296 | Ga0157374_12777156 | Ga0157374_127771562 | 100 |
| 211 | 3300013297 | Ga0157378_10163430 | Ga0157378_101634302 | 100 |
| 212 | 3300013297 | Ga0157378_10553961 | Ga0157378_105539612 | 100 |
| 213 | 3300013306 | Ga0163162_10158958 | Ga0163162_101589582 | 100 |
| 214 | 3300014745 | Ga0157377_11012982 | Ga0157377_110129822 | 100 |
| 215 | 3300014968 | Ga0157379_10272436 | Ga0157379_102724362 | 100 |
| 216 | 3300021384 | Ga0213876_10439069 | Ga0213876_104390692 | 100 |
| 217 | 3300025899 | Ga0207642_10630676 | Ga0207642_106306761 | 100 |
| 218 | 3300025901 | Ga0207688_10213344 | Ga0207688_102133442 | 100 |
| 219 | 3300025903 | Ga0207680_10185893 | Ga0207680_101858932 | 100 |
| 220 | 3300025906 | Ga0207699_10216550 | Ga0207699_102165502 | 100 |
| 221 | 3300025913 | Ga0207695_11592731 | Ga0207695_115927312 | 100 |
| 222 | 3300025917 | Ga0207660_10521517 | Ga0207660_105215172 | 100 |
| 223 | 3300025918 | Ga0207662_10206758 | Ga0207662_102067582 | 100 |
| 224 | 3300025921 | Ga0207652_10328961 | Ga0207652_103289612 | 100 |
| 225 | 3300025921 | Ga0207652_10404021 | Ga0207652_104040212 | 100 |
| 226 | 3300025924 | Ga0207694_10030330 | Ga0207694_100303303 | 100 |
| 227 | 3300025925 | Ga0207650_10188911 | Ga0207650_101889112 | 100 |
| 228 | 3300025926 | Ga0207659_11083482 | Ga0207659_110834822 | 100 |
| 229 | 3300025933 | Ga0207706_11452177 | Ga0207706_114521772 | 100 |
| 230 | 3300025933 | Ga0207706_11689748 | Ga0207706_116897482 | 100 |
| 231 | 3300025935 | Ga0207709_10868469 | Ga0207709_108684691 | 100 |
| 232 | 3300025936 | Ga0207670_10017620 | Ga0207670_100176205 | 100 |
| 233 | 3300025936 | Ga0207670_10081405 | Ga0207670_100814052 | 100 |
| 234 | 3300025938 | Ga0207704_11796233 | Ga0207704_117962331 | 100 |
| 235 | 3300025940 | Ga0207691_10530604 | Ga0207691_105306042 | 100 |
| 236 | 3300025940 | Ga0207691_11531999 | Ga0207691_115319992 | 100 |
| 237 | 3300025941 | Ga0207711_10218595 | Ga0207711_102185952 | 100 |
| 238 | 3300025942 | Ga0207689_10248375 | Ga0207689_102483752 | 100 |
| 239 | 3300025942 | Ga0207689_10388023 | Ga0207689_103880232 | 100 |
| 240 | 3300025945 | Ga0207679_10719935 | Ga0207679_107199351 | 100 |
| 241 | 3300025949 | Ga0207667_10010861 | Ga0207667_1001086111 | 100 |
| 242 | 3300025949 | Ga0207667_10026526 | Ga0207667_100265265 | 100 |
| 243 | 3300025960 | Ga0207651_11186129 | Ga0207651_111861292 | 100 |
| 244 | 3300025981 | Ga0207640_10798763 | Ga0207640_107987632 | 100 |
| 245 | 3300025986 | Ga0207658_11709860 | Ga0207658_117098601 | 100 |
| 246 | 3300026023 | Ga0207677_10159653 | Ga0207677_101596532 | 100 |
| 247 | 3300026023 | Ga0207677_10673615 | Ga0207677_106736152 | 100 |
| 248 | 3300026035 | Ga0207703_10381154 | Ga0207703_103811542 | 100 |
| 249 | 3300026035 | Ga0207703_10726823 | Ga0207703_107268232 | 100 |
| 250 | 3300026035 | Ga0207703_11799577 | Ga0207703_117995772 | 100 |
| 251 | 3300026041 | Ga0207639_11133301 | Ga0207639_111333012 | 100 |
| 252 | 3300026075 | Ga0207708_10035470 | Ga0207708_100354702 | 100 |
| 253 | 3300026078 | Ga0207702_10079906 | Ga0207702_100799062 | 100 |
| 254 | 3300026089 | Ga0207648_10664151 | Ga0207648_106641512 | 100 |
| 255 | 3300026089 | Ga0207648_11351901 | Ga0207648_113519012 | 100 |
| 256 | 3300026116 | Ga0207674_10304981 | Ga0207674_103049812 | 100 |
| 257 | 3300026118 | Ga0207675_100001083 | Ga0207675_1000010832 | 100 |
| 258 | 3300026142 | Ga0207698_10653752 | Ga0207698_106537522 | 100 |
| 259 | 3300027907 | Ga0207428_10149621 | Ga0207428_101496212 | 100 |
| 260 | 3300028380 | Ga0268265_10080616 | Ga0268265_100806162 | 100 |
| 261 | 3300031548 | Ga0307408_101371002 | Ga0307408_1013710022 | 100 |
| 262 | 3300031852 | Ga0307410_11429435 | Ga0307410_114294352 | 100 |
| 263 | 3300039437 | Ga0436365_0731537 | Ga0436365_0731537_123_458 | 100 |
| 264 | 3300045051 | Ga0451576_0061365 | Ga0451576_0061365_2965_3288 | 100 |
| 265 | 3300045051 | Ga0451576_0582779 | Ga0451576_0582779_554_874 | 100 |
| 266 | 3300046471 | Ga0495650_0010534 | Ga0495650_0010534_2620_2955 | 100 |
| 267 | 3300046491 | Ga0495584_0007234 | Ga0495584_0007234_2817_3152 | 100 |
| 268 | 3300046492 | Ga0495585_0001003 | Ga0495585_0001003_4682_5017 | 100 |
| 269 | 3300046507 | Ga0495606_0000333 | Ga0495606_0000333_17172_17507 | 100 |
| 270 | 3300046513 | Ga0495616_0000001 | Ga0495616_0000001_175743_176078 | 100 |
| 271 | 3300046519 | Ga0495632_0013771 | Ga0495632_0013771_3043_3378 | 100 |
| 272 | 3300046691 | Ga0495670_0170698 | Ga0495670_0170698_776_1111 | 100 |
| 273 | 3300047323 | Ga0495683_0020056 | Ga0495683_0020056_2643_2978 | 100 |
| 274 | 3300047472 | Ga0495686_0005194 | Ga0495686_0005194_2156_2491 | 100 |
| 275 | 3300048905 | Ga0496102_1756648 | Ga0496102_1756648_41_358 | 100 |
| 276 | 3300048924 | Ga0496121_0000390 | Ga0496121_0000390_88863_89198 | 100 |
| 277 | 3300049575 | Ga0501039_0344397 | Ga0501039_0344397_638_961 | 100 |
| 278 | 3300049588 | Ga0501072_0238289 | Ga0501072_0238289_320_643 | 100 |
| 279 | 3300050507 | nmdc:mga05p37_2198907_c1 | nmdc:mga05p37_2198907_c1_84_407 | 100 |
| 280 | 3300050510 | nmdc:mga06r32_620395_c1 | nmdc:mga06r32_620395_c1_51_374 | 100 |
| 281 | 3300050511 | nmdc:mga08y16_447805_c1 | nmdc:mga08y16_447805_c1_117_434 | 100 |
| 282 | 3300050512 | nmdc:mga0n895_1598914_c1 | nmdc:mga0n895_1598914_c1_108_428 | 100 |
| 283 | 3300050512 | nmdc:mga0n895_58924_c1 | nmdc:mga0n895_58924_c1_68_379 | 100 |
| 284 | 3300050512 | nmdc:mga0n895_68896_c1 | nmdc:mga0n895_68896_c1_452_769 | 100 |
| 285 | 3300050513 | nmdc:mga0rr50_452472_c1 | nmdc:mga0rr50_452472_c1_452_769 | 100 |
| 286 | 3300050514 | nmdc:mga08x19_1634_c1 | nmdc:mga08x19_1634_c1_12448_12765 | 100 |
| 287 | 3300050515 | nmdc:mga0a205_13067_c1 | nmdc:mga0a205_13067_c1_4658_4975 | 100 |
| 288 | 3300050515 | nmdc:mga0a205_428461_c1 | nmdc:mga0a205_428461_c1_758_1069 | 100 |
| 289 | iso_pu_bacteria | 2734482264 | 2735836894 | 100 |
| 290 | iso_pu_bacteria | 2738543009 | 2739226309 | 100 |
| 291 | 3300005340 | Ga0070689_100002469 | Ga0070689_1000024695 | 101 |
| 292 | 3300005365 | Ga0070688_100097303 | Ga0070688_1000973032 | 101 |
| 293 | 3300005466 | Ga0070685_10031489 | Ga0070685_100314893 | 101 |
| 294 | 3300005563 | Ga0068855_100027591 | Ga0068855_1000275915 | 101 |
| 295 | 3300005577 | Ga0068857_100247470 | Ga0068857_1002474703 | 101 |
| 296 | 3300005841 | Ga0068863_101981921 | Ga0068863_1019819212 | 101 |
| 297 | 3300006846 | Ga0075430_100027073 | Ga0075430_1000270734 | 101 |
| 298 | 3300006880 | Ga0075429_100066667 | Ga0075429_1000666673 | 101 |
| 299 | 3300007076 | Ga0075435_100076092 | Ga0075435_1000760922 | 101 |
| 300 | 3300009551 | Ga0105238_10185840 | Ga0105238_101858401 | 101 |
| 301 | 3300013104 | Ga0157370_10029514 | Ga0157370_100295142 | 101 |
| 302 | 3300013105 | Ga0157369_10010411 | Ga0157369_100104113 | 101 |
| 303 | 3300013306 | Ga0163162_10691232 | Ga0163162_106912322 | 101 |
| 304 | 3300014497 | Ga0182008_10376884 | Ga0182008_103768841 | 101 |
| 305 | 3300025936 | Ga0207670_10098407 | Ga0207670_100984073 | 101 |
| 306 | 3300026041 | Ga0207639_10502470 | Ga0207639_105024702 | 101 |
| 307 | 3300026116 | Ga0207674_10210991 | Ga0207674_102109913 | 101 |
| 308 | 3300027364 | Ga0209967_1023655 | Ga0209967_10236551 | 101 |
| 309 | 3300035691 | Ga0373931_0051612 | Ga0373931_0051612_960_1277 | 101 |
| 310 | 3300041501 | Ga0451845_0152272 | Ga0451845_0152272_49_360 | 101 |
| 311 | 3300046516 | Ga0495628_0001076 | Ga0495628_0001076_8180_8497 | 101 |
| 312 | 3300046642 | Ga0495634_0691931 | Ga0495634_0691931_224_532 | 101 |
| 313 | 3300049583 | Ga0501067_0028799 | Ga0501067_0028799_646_963 | 101 |
| 314 | 3300050508 | nmdc:mga09592_91338_c1 | nmdc:mga09592_91338_c1_2273_2581 | 101 |
| 315 | 3300050509 | nmdc:mga0qj67_25908_c1 | nmdc:mga0qj67_25908_c1_1234_1545 | 101 |
| 316 | 3300050513 | nmdc:mga0rr50_384824_c1 | nmdc:mga0rr50_384824_c1_120_464 | 101 |
| 317 | 3300059426 | Ga0590077_019746 | Ga0590077_019746_821_1147 | 101 |
| 318 | 2162886012 | MBSR1b_contig_11923333 | MBSR1b_0208.00007120 | 102 |
| 319 | 3300005293 | Ga0065715_10206516 | Ga0065715_102065162 | 102 |
| 320 | 3300005328 | Ga0070676_10037256 | Ga0070676_100372562 | 102 |
| 321 | 3300005328 | Ga0070676_10708686 | Ga0070676_107086862 | 102 |
| 322 | 3300005330 | Ga0070690_100316387 | Ga0070690_1003163871 | 102 |
| 323 | 3300005330 | Ga0070690_100677352 | Ga0070690_1006773522 | 102 |
| 324 | 3300005335 | Ga0070666_10038796 | Ga0070666_100387962 | 102 |
| 325 | 3300005335 | Ga0070666_10057777 | Ga0070666_100577772 | 102 |
| 326 | 3300005336 | Ga0070680_100630143 | Ga0070680_1006301432 | 102 |
| 327 | 3300005337 | Ga0070682_100409873 | Ga0070682_1004098732 | 102 |
| 328 | 3300005338 | Ga0068868_100321592 | Ga0068868_1003215922 | 102 |
| 329 | 3300005338 | Ga0068868_101254847 | Ga0068868_1012548471 | 102 |
| 330 | 3300005339 | Ga0070660_100025605 | Ga0070660_1000256052 | 102 |
| 331 | 3300005339 | Ga0070660_100279456 | Ga0070660_1002794562 | 102 |
| 332 | 3300005339 | Ga0070660_100495618 | Ga0070660_1004956182 | 102 |
| 333 | 3300005340 | Ga0070689_100369763 | Ga0070689_1003697632 | 102 |
| 334 | 3300005344 | Ga0070661_100009313 | Ga0070661_1000093132 | 102 |
| 335 | 3300005347 | Ga0070668_100050479 | Ga0070668_1000504792 | 102 |
| 336 | 3300005347 | Ga0070668_100128307 | Ga0070668_1001283072 | 102 |
| 337 | 3300005353 | Ga0070669_100279091 | Ga0070669_1002790912 | 102 |
| 338 | 3300005354 | Ga0070675_100017455 | Ga0070675_1000174553 | 102 |
| 339 | 3300005355 | Ga0070671_100005336 | Ga0070671_1000053366 | 102 |
| 340 | 3300005355 | Ga0070671_100637912 | Ga0070671_1006379122 | 102 |
| 341 | 3300005356 | Ga0070674_100580693 | Ga0070674_1005806932 | 102 |
| 342 | 3300005364 | Ga0070673_100008378 | Ga0070673_1000083782 | 102 |
| 343 | 3300005364 | Ga0070673_100059962 | Ga0070673_1000599623 | 102 |
| 344 | 3300005365 | Ga0070688_100517824 | Ga0070688_1005178242 | 102 |
| 345 | 3300005366 | Ga0070659_100000939 | Ga0070659_10000093917 | 102 |
| 346 | 3300005366 | Ga0070659_100302240 | Ga0070659_1003022402 | 102 |
| 347 | 3300005366 | Ga0070659_100473397 | Ga0070659_1004733972 | 102 |
| 348 | 3300005367 | Ga0070667_100325718 | Ga0070667_1003257182 | 102 |
| 349 | 3300005435 | Ga0070714_100031734 | Ga0070714_1000317344 | 102 |
| 350 | 3300005439 | Ga0070711_100067264 | Ga0070711_1000672643 | 102 |
| 351 | 3300005440 | Ga0070705_100630651 | Ga0070705_1006306512 | 102 |
| 352 | 3300005455 | Ga0070663_100258294 | Ga0070663_1002582942 | 102 |
| 353 | 3300005456 | Ga0070678_100051022 | Ga0070678_1000510222 | 102 |
| 354 | 3300005457 | Ga0070662_100000104 | Ga0070662_1000001044 | 102 |
| 355 | 3300005457 | Ga0070662_100068410 | Ga0070662_1000684102 | 102 |
| 356 | 3300005458 | Ga0070681_10194045 | Ga0070681_101940452 | 102 |
| 357 | 3300005459 | Ga0068867_100959330 | Ga0068867_1009593302 | 102 |
| 358 | 3300005530 | Ga0070679_100102753 | Ga0070679_1001027532 | 102 |
| 359 | 3300005530 | Ga0070679_100160987 | Ga0070679_1001609872 | 102 |
| 360 | 3300005530 | Ga0070679_101728117 | Ga0070679_1017281171 | 102 |
| 361 | 3300005539 | Ga0068853_100026492 | Ga0068853_1000264922 | 102 |
| 362 | 3300005539 | Ga0068853_101693716 | Ga0068853_1016937162 | 102 |
| 363 | 3300005543 | Ga0070672_100039289 | Ga0070672_1000392893 | 102 |
| 364 | 3300005543 | Ga0070672_100065796 | Ga0070672_1000657963 | 102 |
| 365 | 3300005546 | Ga0070696_101736943 | Ga0070696_1017369431 | 102 |
| 366 | 3300005548 | Ga0070665_100601089 | Ga0070665_1006010892 | 102 |
| 367 | 3300005563 | Ga0068855_100001220 | Ga0068855_10000122016 | 102 |
| 368 | 3300005563 | Ga0068855_100234658 | Ga0068855_1002346582 | 102 |
| 369 | 3300005564 | Ga0070664_100002517 | Ga0070664_1000025172 | 102 |
| 370 | 3300005564 | Ga0070664_100164036 | Ga0070664_1001640362 | 102 |
| 371 | 3300005564 | Ga0070664_100548829 | Ga0070664_1005488292 | 102 |
| 372 | 3300005578 | Ga0068854_100327335 | Ga0068854_1003273352 | 102 |
| 373 | 3300005578 | Ga0068854_100827249 | Ga0068854_1008272492 | 102 |
| 374 | 3300005614 | Ga0068856_100000606 | Ga0068856_1000006065 | 102 |
| 375 | 3300005614 | Ga0068856_100347362 | Ga0068856_1003473622 | 102 |
| 376 | 3300005614 | Ga0068856_100626792 | Ga0068856_1006267922 | 102 |
| 377 | 3300005616 | Ga0068852_100021425 | Ga0068852_1000214252 | 102 |
| 378 | 3300005616 | Ga0068852_100031335 | Ga0068852_1000313353 | 102 |
| 379 | 3300005616 | Ga0068852_100501829 | Ga0068852_1005018292 | 102 |
| 380 | 3300005618 | Ga0068864_100692896 | Ga0068864_1006928962 | 102 |
| 381 | 3300005718 | Ga0068866_10618578 | Ga0068866_106185782 | 102 |
| 382 | 3300005719 | Ga0068861_100195597 | Ga0068861_1001955972 | 102 |
| 383 | 3300005719 | Ga0068861_100238642 | Ga0068861_1002386422 | 102 |
| 384 | 3300005834 | Ga0068851_10425341 | Ga0068851_104253412 | 102 |
| 385 | 3300005840 | Ga0068870_10196780 | Ga0068870_101967802 | 102 |
| 386 | 3300005840 | Ga0068870_10584839 | Ga0068870_105848392 | 102 |
| 387 | 3300005842 | Ga0068858_101604191 | Ga0068858_1016041912 | 102 |
| 388 | 3300005843 | Ga0068860_101453145 | Ga0068860_1014531452 | 102 |
| 389 | 3300005844 | Ga0068862_100174706 | Ga0068862_1001747062 | 102 |
| 390 | 3300005985 | Ga0081539_10000332 | Ga0081539_1000033254 | 102 |
| 391 | 3300006038 | Ga0075365_10067465 | Ga0075365_100674653 | 102 |
| 392 | 3300006048 | Ga0075363_100019497 | Ga0075363_1000194973 | 102 |
| 393 | 3300006175 | Ga0070712_101141180 | Ga0070712_1011411802 | 102 |
| 394 | 3300006237 | Ga0097621_100713422 | Ga0097621_1007134222 | 102 |
| 395 | 3300006846 | Ga0075430_100335017 | Ga0075430_1003350173 | 102 |
| 396 | 3300006847 | Ga0075431_100010851 | Ga0075431_1000108519 | 102 |
| 397 | 3300006852 | Ga0075433_11871136 | Ga0075433_118711361 | 102 |
| 398 | 3300006871 | Ga0075434_101999062 | Ga0075434_1019990622 | 102 |
| 399 | 3300006880 | Ga0075429_100268907 | Ga0075429_1002689072 | 102 |
| 400 | 3300006881 | Ga0068865_101653644 | Ga0068865_1016536442 | 102 |
| 401 | 3300007076 | Ga0075435_100777364 | Ga0075435_1007773641 | 102 |
| 402 | 3300009093 | Ga0105240_10174170 | Ga0105240_101741702 | 102 |
| 403 | 3300009093 | Ga0105240_11755750 | Ga0105240_117557501 | 102 |
| 404 | 3300009101 | Ga0105247_10186488 | Ga0105247_101864883 | 102 |
| 405 | 3300009147 | Ga0114129_12713450 | Ga0114129_127134502 | 102 |
| 406 | 3300009177 | Ga0105248_10027187 | Ga0105248_100271874 | 102 |
| 407 | 3300009545 | Ga0105237_10046451 | Ga0105237_100464514 | 102 |
| 408 | 3300009551 | Ga0105238_10005684 | Ga0105238_100056846 | 102 |
| 409 | 3300009553 | Ga0105249_10442023 | Ga0105249_104420232 | 102 |
| 410 | 3300010375 | Ga0105239_10029155 | Ga0105239_100291554 | 102 |
| 411 | 3300010375 | Ga0105239_10141350 | Ga0105239_101413502 | 102 |
| 412 | 3300010375 | Ga0105239_12639966 | Ga0105239_126399661 | 102 |
| 413 | 3300013100 | Ga0157373_10103587 | Ga0157373_101035872 | 102 |
| 414 | 3300013100 | Ga0157373_10546426 | Ga0157373_105464262 | 102 |
| 415 | 3300013102 | Ga0157371_10000292 | Ga0157371_1000029231 | 102 |
| 416 | 3300013102 | Ga0157371_11181327 | Ga0157371_111813272 | 102 |
| 417 | 3300013104 | Ga0157370_10009685 | Ga0157370_100096856 | 102 |
| 418 | 3300013104 | Ga0157370_10719335 | Ga0157370_107193352 | 102 |
| 419 | 3300013105 | Ga0157369_10502231 | Ga0157369_105022312 | 102 |
| 420 | 3300013296 | Ga0157374_10013385 | Ga0157374_100133854 | 102 |
| 421 | 3300013306 | Ga0163162_10122220 | Ga0163162_101222202 | 102 |
| 422 | 3300013306 | Ga0163162_12710285 | Ga0163162_127102852 | 102 |
| 423 | 3300013307 | Ga0157372_10017154 | Ga0157372_100171542 | 102 |
| 424 | 3300013307 | Ga0157372_10207928 | Ga0157372_102079281 | 102 |
| 425 | 3300013307 | Ga0157372_10623924 | Ga0157372_106239242 | 102 |
| 426 | 3300013307 | Ga0157372_11623577 | Ga0157372_116235771 | 102 |
| 427 | 3300013308 | Ga0157375_10026193 | Ga0157375_100261933 | 102 |
| 428 | 3300014326 | Ga0157380_11331631 | Ga0157380_113316312 | 102 |
| 429 | 3300014968 | Ga0157379_10034650 | Ga0157379_100346504 | 102 |
| 430 | 3300014968 | Ga0157379_10462117 | Ga0157379_104621172 | 102 |
| 431 | 3300017792 | Ga0163161_10108528 | Ga0163161_101085283 | 102 |
| 432 | 3300025321 | Ga0207656_10197057 | Ga0207656_101970571 | 102 |
| 433 | 3300025885 | Ga0207653_10010271 | Ga0207653_100102712 | 102 |
| 434 | 3300025898 | Ga0207692_10334871 | Ga0207692_103348713 | 102 |
| 435 | 3300025903 | Ga0207680_10053657 | Ga0207680_100536572 | 102 |
| 436 | 3300025903 | Ga0207680_10161393 | Ga0207680_101613932 | 102 |
| 437 | 3300025907 | Ga0207645_10056004 | Ga0207645_100560042 | 102 |
| 438 | 3300025907 | Ga0207645_10222385 | Ga0207645_102223852 | 102 |
| 439 | 3300025907 | Ga0207645_10411234 | Ga0207645_104112342 | 102 |
| 440 | 3300025908 | Ga0207643_10499105 | Ga0207643_104991052 | 102 |
| 441 | 3300025910 | Ga0207684_10616631 | Ga0207684_106166313 | 102 |
| 442 | 3300025912 | Ga0207707_10109222 | Ga0207707_101092223 | 102 |
| 443 | 3300025912 | Ga0207707_10281389 | Ga0207707_102813892 | 102 |
| 444 | 3300025914 | Ga0207671_10144733 | Ga0207671_101447333 | 102 |
| 445 | 3300025915 | Ga0207693_10779286 | Ga0207693_107792862 | 102 |
| 446 | 3300025916 | Ga0207663_10258051 | Ga0207663_102580513 | 102 |
| 447 | 3300025917 | Ga0207660_10378352 | Ga0207660_103783522 | 102 |
| 448 | 3300025918 | Ga0207662_10103569 | Ga0207662_101035692 | 102 |
| 449 | 3300025919 | Ga0207657_10003478 | Ga0207657_1000347812 | 102 |
| 450 | 3300025919 | Ga0207657_10518713 | Ga0207657_105187132 | 102 |
| 451 | 3300025920 | Ga0207649_10001011 | Ga0207649_1000101112 | 102 |
| 452 | 3300025920 | Ga0207649_10233735 | Ga0207649_102337352 | 102 |
| 453 | 3300025920 | Ga0207649_10949747 | Ga0207649_109497472 | 102 |
| 454 | 3300025921 | Ga0207652_10065817 | Ga0207652_100658174 | 102 |
| 455 | 3300025921 | Ga0207652_10376149 | Ga0207652_103761492 | 102 |
| 456 | 3300025922 | Ga0207646_10995919 | Ga0207646_109959192 | 102 |
| 457 | 3300025923 | Ga0207681_10305930 | Ga0207681_103059302 | 102 |
| 458 | 3300025923 | Ga0207681_10406637 | Ga0207681_104066372 | 102 |
| 459 | 3300025924 | Ga0207694_10010911 | Ga0207694_100109117 | 102 |
| 460 | 3300025927 | Ga0207687_10963443 | Ga0207687_109634432 | 102 |
| 461 | 3300025931 | Ga0207644_10083771 | Ga0207644_100837712 | 102 |
| 462 | 3300025931 | Ga0207644_10659163 | Ga0207644_106591632 | 102 |
| 463 | 3300025932 | Ga0207690_10009415 | Ga0207690_100094154 | 102 |
| 464 | 3300025932 | Ga0207690_10127323 | Ga0207690_101273232 | 102 |
| 465 | 3300025933 | Ga0207706_10000040 | Ga0207706_1000004055 | 102 |
| 466 | 3300025933 | Ga0207706_10076423 | Ga0207706_100764232 | 102 |
| 467 | 3300025935 | Ga0207709_10273281 | Ga0207709_102732812 | 102 |
| 468 | 3300025936 | Ga0207670_10163888 | Ga0207670_101638882 | 102 |
| 469 | 3300025936 | Ga0207670_10259758 | Ga0207670_102597582 | 102 |
| 470 | 3300025937 | Ga0207669_10267572 | Ga0207669_102675722 | 102 |
| 471 | 3300025940 | Ga0207691_10084045 | Ga0207691_100840452 | 102 |
| 472 | 3300025941 | Ga0207711_10047042 | Ga0207711_100470422 | 102 |
| 473 | 3300025942 | Ga0207689_10086869 | Ga0207689_100868692 | 102 |
| 474 | 3300025942 | Ga0207689_10271195 | Ga0207689_102711951 | 102 |
| 475 | 3300025942 | Ga0207689_10367852 | Ga0207689_103678522 | 102 |
| 476 | 3300025945 | Ga0207679_10003236 | Ga0207679_100032363 | 102 |
| 477 | 3300025945 | Ga0207679_10073377 | Ga0207679_100733772 | 102 |
| 478 | 3300025945 | Ga0207679_10718651 | Ga0207679_107186512 | 102 |
| 479 | 3300025949 | Ga0207667_10003220 | Ga0207667_100032208 | 102 |
| 480 | 3300025960 | Ga0207651_10122559 | Ga0207651_101225591 | 102 |
| 481 | 3300025961 | Ga0207712_10249321 | Ga0207712_102493212 | 102 |
| 482 | 3300025961 | Ga0207712_10633318 | Ga0207712_106333182 | 102 |
| 483 | 3300025972 | Ga0207668_10079587 | Ga0207668_100795872 | 102 |
| 484 | 3300025972 | Ga0207668_10240663 | Ga0207668_102406632 | 102 |
| 485 | 3300025981 | Ga0207640_10424231 | Ga0207640_104242312 | 102 |
| 486 | 3300025986 | Ga0207658_10080511 | Ga0207658_100805112 | 102 |
| 487 | 3300025986 | Ga0207658_12132399 | Ga0207658_121323992 | 102 |
| 488 | 3300026023 | Ga0207677_10104633 | Ga0207677_101046332 | 102 |
| 489 | 3300026023 | Ga0207677_10304483 | Ga0207677_103044832 | 102 |
| 490 | 3300026035 | Ga0207703_10063042 | Ga0207703_100630422 | 102 |
| 491 | 3300026035 | Ga0207703_11491796 | Ga0207703_114917962 | 102 |
| 492 | 3300026041 | Ga0207639_10025024 | Ga0207639_100250242 | 102 |
| 493 | 3300026041 | Ga0207639_10654616 | Ga0207639_106546162 | 102 |
| 494 | 3300026067 | Ga0207678_10816170 | Ga0207678_108161702 | 102 |
| 495 | 3300026075 | Ga0207708_10069118 | Ga0207708_100691182 | 102 |
| 496 | 3300026078 | Ga0207702_10156062 | Ga0207702_101560622 | 102 |
| 497 | 3300026078 | Ga0207702_12069344 | Ga0207702_120693441 | 102 |
| 498 | 3300026089 | Ga0207648_11789152 | Ga0207648_117891522 | 102 |
| 499 | 3300026095 | Ga0207676_10048887 | Ga0207676_100488872 | 102 |
| 500 | 3300026095 | Ga0207676_10415739 | Ga0207676_104157392 | 102 |
| 501 | 3300026116 | Ga0207674_10034136 | Ga0207674_100341366 | 102 |
| 502 | 3300026118 | Ga0207675_100049015 | Ga0207675_1000490152 | 102 |
| 503 | 3300026118 | Ga0207675_100089160 | Ga0207675_1000891603 | 102 |
| 504 | 3300026121 | Ga0207683_10264867 | Ga0207683_102648671 | 102 |
| 505 | 3300026142 | Ga0207698_10027355 | Ga0207698_100273553 | 102 |
| 506 | 3300026142 | Ga0207698_10158064 | Ga0207698_101580642 | 102 |
| 507 | 3300026142 | Ga0207698_10223423 | Ga0207698_102234232 | 102 |
| 508 | 3300027360 | Ga0209969_1039443 | Ga0209969_10394432 | 102 |
| 509 | 3300027395 | Ga0209996_1022530 | Ga0209996_10225302 | 102 |
| 510 | 3300027395 | Ga0209996_1063784 | Ga0209996_10637841 | 102 |
| 511 | 3300027424 | Ga0209984_1006490 | Ga0209984_10064902 | 102 |
| 512 | 3300027424 | Ga0209984_1011020 | Ga0209984_10110202 | 102 |
| 513 | 3300027552 | Ga0209982_1003304 | Ga0209982_10033042 | 102 |
| 514 | 3300027552 | Ga0209982_1030509 | Ga0209982_10305092 | 102 |
| 515 | 3300027614 | Ga0209970_1044969 | Ga0209970_10449692 | 102 |
| 516 | 3300027665 | Ga0209983_1004970 | Ga0209983_10049702 | 102 |
| 517 | 3300027682 | Ga0209971_1051660 | Ga0209971_10516602 | 102 |
| 518 | 3300027717 | Ga0209998_10001424 | Ga0209998_100014246 | 102 |
| 519 | 3300027717 | Ga0209998_10012232 | Ga0209998_100122322 | 102 |
| 520 | 3300027866 | Ga0209813_10364280 | Ga0209813_103642802 | 102 |
| 521 | 3300027876 | Ga0209974_10008144 | Ga0209974_100081442 | 102 |
| 522 | 3300027876 | Ga0209974_10020177 | Ga0209974_100201772 | 102 |
| 523 | 3300028380 | Ga0268265_10048973 | Ga0268265_100489733 | 102 |
| 524 | 3300028380 | Ga0268265_10559621 | Ga0268265_105596211 | 102 |
| 525 | 3300028381 | Ga0268264_10045472 | Ga0268264_100454724 | 102 |
| 526 | 3300035121 | Ga0373960_0257344 | Ga0373960_0257344_227_577 | 102 |
| 527 | 3300035207 | Ga0373942_0012462 | Ga0373942_0012462_101_421 | 102 |
| 528 | 3300035241 | Ga0373961_0285438 | Ga0373961_0285438_176_529 | 102 |
| 529 | 3300042005 | Ga0439448_0134438 | Ga0439448_0134438_136_486 | 102 |
| 530 | 3300042012 | Ga0439455_0199467 | Ga0439455_0199467_134_484 | 102 |
| 531 | 3300042157 | Ga0439458_0209334 | Ga0439458_0209334_39_389 | 102 |
| 532 | 3300042876 | Ga0451577_0097039 | Ga0451577_0097039_1301_1645 | 102 |
| 533 | 3300042876 | Ga0451577_0126210 | Ga0451577_0126210_311_664 | 102 |
| 534 | 3300044656 | Ga0466969_0211540 | Ga0466969_0211540_22_339 | 102 |
| 535 | 3300044693 | Ga0466961_0214584 | Ga0466961_0214584_196_513 | 102 |
| 536 | 3300044694 | Ga0466963_0311464 | Ga0466963_0311464_80_421 | 102 |
| 537 | 3300044706 | Ga0466964_0206973 | Ga0466964_0206973_423_764 | 102 |
| 538 | 3300044712 | Ga0453684_1020152 | Ga0453684_1020152_173_526 | 102 |
| 539 | 3300044712 | Ga0453684_1662365 | Ga0453684_1662365_105_449 | 102 |
| 540 | 3300044765 | Ga0466970_0598883 | Ga0466970_0598883_84_401 | 102 |
| 541 | 3300044842 | Ga0466957_0855852 | Ga0466957_0855852_167_508 | 102 |
| 542 | 3300045051 | Ga0451576_0836213 | Ga0451576_0836213_426_770 | 102 |
| 543 | 3300045051 | Ga0451576_1059929 | Ga0451576_1059929_440_793 | 102 |
| 544 | 3300045976 | Ga0466967_0078056 | Ga0466967_0078056_292_633 | 102 |
| 545 | 3300046519 | Ga0495632_0000003 | Ga0495632_0000003_269151_269465 | 102 |
| 546 | 3300046616 | Ga0495668_0015436 | Ga0495668_0015436_3147_3461 | 102 |
| 547 | 3300046810 | Ga0495660_0000009 | Ga0495660_0000009_102011_102325 | 102 |
| 548 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_918377_918691 | 102 |
| 549 | 3300048903 | Ga0496100_0020465 | Ga0496100_0020465_911_1225 | 102 |
| 550 | 3300048903 | Ga0496100_0160018 | Ga0496100_0160018_289_609 | 102 |
| 551 | 3300048904 | Ga0496101_0001666 | Ga0496101_0001666_4214_4528 | 102 |
| 552 | 3300048904 | Ga0496101_0074238 | Ga0496101_0074238_35_385 | 102 |
| 553 | 3300048904 | Ga0496101_0194066 | Ga0496101_0194066_1193_1510 | 102 |
| 554 | 3300048905 | Ga0496102_0002744 | Ga0496102_0002744_5808_6125 | 102 |
| 555 | 3300048905 | Ga0496102_0011114 | Ga0496102_0011114_3328_3678 | 102 |
| 556 | 3300048905 | Ga0496102_0717489 | Ga0496102_0717489_206_559 | 102 |
| 557 | 3300048906 | Ga0496103_0078203 | Ga0496103_0078203_381_698 | 102 |
| 558 | 3300048908 | Ga0496105_0133554 | Ga0496105_0133554_1266_1586 | 102 |
| 559 | 3300048909 | Ga0496106_0002229 | Ga0496106_0002229_11112_11462 | 102 |
| 560 | 3300048909 | Ga0496106_0005702 | Ga0496106_0005702_4035_4355 | 102 |
| 561 | 3300048909 | Ga0496106_0195586 | Ga0496106_0195586_523_840 | 102 |
| 562 | 3300048909 | Ga0496106_1138456 | Ga0496106_1138456_44_397 | 102 |
| 563 | 3300048910 | Ga0496107_0002621 | Ga0496107_0002621_10161_10481 | 102 |
| 564 | 3300048910 | Ga0496107_0010881 | Ga0496107_0010881_3537_3887 | 102 |
| 565 | 3300048910 | Ga0496107_0106352 | Ga0496107_0106352_64_378 | 102 |
| 566 | 3300048910 | Ga0496107_0170373 | Ga0496107_0170373_490_807 | 102 |
| 567 | 3300048911 | Ga0496108_0009040 | Ga0496108_0009040_5225_5545 | 102 |
| 568 | 3300048911 | Ga0496108_0115156 | Ga0496108_0115156_364_681 | 102 |
| 569 | 3300048912 | Ga0496109_0001784 | Ga0496109_0001784_3420_3740 | 102 |
| 570 | 3300048912 | Ga0496109_0696808 | Ga0496109_0696808_244_594 | 102 |
| 571 | 3300048912 | Ga0496109_0920074 | Ga0496109_0920074_469_786 | 102 |
| 572 | 3300048912 | Ga0496109_1062092 | Ga0496109_1062092_279_629 | 102 |
| 573 | 3300048913 | Ga0496110_0034991 | Ga0496110_0034991_1369_1689 | 102 |
| 574 | 3300048913 | Ga0496110_0797142 | Ga0496110_0797142_178_495 | 102 |
| 575 | 3300048913 | Ga0496110_0974685 | Ga0496110_0974685_285_635 | 102 |
| 576 | 3300048914 | Ga0496111_0022218 | Ga0496111_0022218_1953_2273 | 102 |
| 577 | 3300048915 | Ga0496112_0051471 | Ga0496112_0051471_693_1013 | 102 |
| 578 | 3300048916 | Ga0496113_0091981 | Ga0496113_0091981_834_1154 | 102 |
| 579 | 3300048917 | Ga0496114_0265278 | Ga0496114_0265278_1069_1389 | 102 |
| 580 | 3300048917 | Ga0496114_0314183 | Ga0496114_0314183_483_803 | 102 |
| 581 | 3300048917 | Ga0496114_0712885 | Ga0496114_0712885_193_543 | 102 |
| 582 | 3300048918 | Ga0496115_0255087 | Ga0496115_0255087_136_453 | 102 |
| 583 | 3300048918 | Ga0496115_0278581 | Ga0496115_0278581_93_413 | 102 |
| 584 | 3300048918 | Ga0496115_0489199 | Ga0496115_0489199_240_560 | 102 |
| 585 | 3300048921 | Ga0496118_0111732 | Ga0496118_0111732_693_1013 | 102 |
| 586 | 3300048921 | Ga0496118_0138419 | Ga0496118_0138419_671_988 | 102 |
| 587 | 3300048924 | Ga0496121_0000368 | Ga0496121_0000368_3239_3553 | 102 |
| 588 | 3300048924 | Ga0496121_0338478 | Ga0496121_0338478_303_623 | 102 |
| 589 | 3300048925 | Ga0496122_0035640 | Ga0496122_0035640_588_902 | 102 |
| 590 | 3300048926 | Ga0496123_0020397 | Ga0496123_0020397_1408_1722 | 102 |
| 591 | 3300048926 | Ga0496123_0504644 | Ga0496123_0504644_175_492 | 102 |
| 592 | 3300048927 | Ga0496124_0064399 | Ga0496124_0064399_131_448 | 102 |
| 593 | 3300048929 | Ga0496126_0009926 | Ga0496126_0009926_7279_7599 | 102 |
| 594 | 3300048929 | Ga0496126_0061821 | Ga0496126_0061821_1343_1663 | 102 |
| 595 | 3300048929 | Ga0496126_0901836 | Ga0496126_0901836_90_410 | 102 |
| 596 | 3300050490 | nmdc:mga03n38_7495_c1 | nmdc:mga03n38_7495_c1_1869_2189 | 102 |
| 597 | 3300050492 | nmdc:mga0yw44_56564_c1 | nmdc:mga0yw44_56564_c1_1275_1595 | 102 |
| 598 | 3300050494 | nmdc:mga06z11_606569_c1 | nmdc:mga06z11_606569_c1_62_382 | 102 |
| 599 | 3300050508 | nmdc:mga09592_16816_c1 | nmdc:mga09592_16816_c1_3468_3791 | 102 |
| 600 | 3300050508 | nmdc:mga09592_793621_c1 | nmdc:mga09592_793621_c1_355_705 | 102 |
| 601 | 3300050509 | nmdc:mga0qj67_213444_c1 | nmdc:mga0qj67_213444_c1_1107_1430 | 102 |
| 602 | 3300050510 | nmdc:mga06r32_8403_c1 | nmdc:mga06r32_8403_c1_6419_6742 | 102 |
| 603 | 3300050512 | nmdc:mga0n895_933456_c1 | nmdc:mga0n895_933456_c1_442_795 | 102 |
| 604 | 3300053139 | Ga0500568_0029049 | Ga0500568_0029049_1194_1514 | 102 |
| 605 | 3300002067 | JGI24735J21928_10040768 | JGI24735J21928_100407683 | 103 |
| 606 | 3300005327 | Ga0070658_10041483 | Ga0070658_100414833 | 103 |
| 607 | 3300005331 | Ga0070670_100318908 | Ga0070670_1003189082 | 103 |
| 608 | 3300005335 | Ga0070666_10000001 | Ga0070666_10000001346 | 103 |
| 609 | 3300005336 | Ga0070680_100469087 | Ga0070680_1004690872 | 103 |
| 610 | 3300005341 | Ga0070691_10013229 | Ga0070691_100132294 | 103 |
| 611 | 3300005344 | Ga0070661_100027965 | Ga0070661_1000279651 | 103 |
| 612 | 3300005344 | Ga0070661_100114824 | Ga0070661_1001148241 | 103 |
| 613 | 3300005345 | Ga0070692_10042111 | Ga0070692_100421111 | 103 |
| 614 | 3300005354 | Ga0070675_100113062 | Ga0070675_1001130623 | 103 |
| 615 | 3300005406 | Ga0070703_10043198 | Ga0070703_100431982 | 103 |
| 616 | 3300005438 | Ga0070701_10140843 | Ga0070701_101408432 | 103 |
| 617 | 3300005440 | Ga0070705_100006334 | Ga0070705_1000063348 | 103 |
| 618 | 3300005441 | Ga0070700_100020679 | Ga0070700_1000206792 | 103 |
| 619 | 3300005444 | Ga0070694_100010520 | Ga0070694_1000105208 | 103 |
| 620 | 3300005445 | Ga0070708_100206472 | Ga0070708_1002064721 | 103 |
| 621 | 3300005456 | Ga0070678_100363726 | Ga0070678_1003637262 | 103 |
| 622 | 3300005457 | Ga0070662_100170044 | Ga0070662_1001700443 | 103 |
| 623 | 3300005466 | Ga0070685_10160212 | Ga0070685_101602123 | 103 |
| 624 | 3300005518 | Ga0070699_100403962 | Ga0070699_1004039621 | 103 |
| 625 | 3300005518 | Ga0070699_100416729 | Ga0070699_1004167292 | 103 |
| 626 | 3300005530 | Ga0070679_102043744 | Ga0070679_1020437441 | 103 |
| 627 | 3300005536 | Ga0070697_101503480 | Ga0070697_1015034801 | 103 |
| 628 | 3300005545 | Ga0070695_100009793 | Ga0070695_1000097938 | 103 |
| 629 | 3300005546 | Ga0070696_100005323 | Ga0070696_1000053236 | 103 |
| 630 | 3300005549 | Ga0070704_100065054 | Ga0070704_1000650542 | 103 |
| 631 | 3300005577 | Ga0068857_100070006 | Ga0068857_1000700063 | 103 |
| 632 | 3300005615 | Ga0070702_100250727 | Ga0070702_1002507272 | 103 |
| 633 | 3300005617 | Ga0068859_100031224 | Ga0068859_1000312244 | 103 |
| 634 | 3300005618 | Ga0068864_100856431 | Ga0068864_1008564312 | 103 |
| 635 | 3300005841 | Ga0068863_101486900 | Ga0068863_1014869001 | 103 |
| 636 | 3300005842 | Ga0068858_100045656 | Ga0068858_1000456563 | 103 |
| 637 | 3300005843 | Ga0068860_100388420 | Ga0068860_1003884202 | 103 |
| 638 | 3300005843 | Ga0068860_100502620 | Ga0068860_1005026202 | 103 |
| 639 | 3300005844 | Ga0068862_100345736 | Ga0068862_1003457362 | 103 |
| 640 | 3300005844 | Ga0068862_101919248 | Ga0068862_1019192482 | 103 |
| 641 | 3300006852 | Ga0075433_11128379 | Ga0075433_111283792 | 103 |
| 642 | 3300006881 | Ga0068865_101261367 | Ga0068865_1012613672 | 103 |
| 643 | 3300006931 | Ga0097620_100031226 | Ga0097620_1000312265 | 103 |
| 644 | 3300009101 | Ga0105247_10087908 | Ga0105247_100879083 | 103 |
| 645 | 3300009148 | Ga0105243_11829812 | Ga0105243_118298122 | 103 |
| 646 | 3300009174 | Ga0105241_10705170 | Ga0105241_107051702 | 103 |
| 647 | 3300009551 | Ga0105238_10000611 | Ga0105238_1000061120 | 103 |
| 648 | 3300009553 | Ga0105249_10010040 | Ga0105249_100100404 | 103 |
| 649 | 3300010375 | Ga0105239_10281619 | Ga0105239_102816192 | 103 |
| 650 | 3300013306 | Ga0163162_10000436 | Ga0163162_1000043632 | 103 |
| 651 | 3300014326 | Ga0157380_10159998 | Ga0157380_101599982 | 103 |
| 652 | 3300014497 | Ga0182008_10425803 | Ga0182008_104258031 | 103 |
| 653 | 3300015261 | Ga0182006_1000049 | Ga0182006_100004940 | 103 |
| 654 | 3300015262 | Ga0182007_10036195 | Ga0182007_100361953 | 103 |
| 655 | 3300015265 | Ga0182005_1030791 | Ga0182005_10307912 | 103 |
| 656 | 3300015265 | Ga0182005_1030792 | Ga0182005_10307922 | 103 |
| 657 | 3300025885 | Ga0207653_10005165 | Ga0207653_100051652 | 103 |
| 658 | 3300025903 | Ga0207680_10000003 | Ga0207680_10000003391 | 103 |
| 659 | 3300025904 | Ga0207647_10038770 | Ga0207647_100387703 | 103 |
| 660 | 3300025909 | Ga0207705_10007544 | Ga0207705_100075442 | 103 |
| 661 | 3300025910 | Ga0207684_10035743 | Ga0207684_100357436 | 103 |
| 662 | 3300025911 | Ga0207654_10177811 | Ga0207654_101778112 | 103 |
| 663 | 3300025912 | Ga0207707_10072162 | Ga0207707_100721623 | 103 |
| 664 | 3300025920 | Ga0207649_10625185 | Ga0207649_106251852 | 103 |
| 665 | 3300025924 | Ga0207694_10000068 | Ga0207694_1000006854 | 103 |
| 666 | 3300025926 | Ga0207659_10661458 | Ga0207659_106614582 | 103 |
| 667 | 3300025933 | Ga0207706_10065800 | Ga0207706_100658003 | 103 |
| 668 | 3300025935 | Ga0207709_10912297 | Ga0207709_109122972 | 103 |
| 669 | 3300025938 | Ga0207704_11227510 | Ga0207704_112275102 | 103 |
| 670 | 3300025961 | Ga0207712_10013035 | Ga0207712_100130356 | 103 |
| 671 | 3300025972 | Ga0207668_10538979 | Ga0207668_105389792 | 103 |
| 672 | 3300026035 | Ga0207703_10339289 | Ga0207703_103392892 | 103 |
| 673 | 3300026075 | Ga0207708_10019180 | Ga0207708_100191806 | 103 |
| 674 | 3300026088 | Ga0207641_10973840 | Ga0207641_109738402 | 103 |
| 675 | 3300026095 | Ga0207676_10701575 | Ga0207676_107015752 | 103 |
| 676 | 3300026116 | Ga0207674_10049854 | Ga0207674_100498545 | 103 |
| 677 | 3300026121 | Ga0207683_11393707 | Ga0207683_113937072 | 103 |
| 678 | 3300028379 | Ga0268266_10000011 | Ga0268266_10000011336 | 103 |
| 679 | 3300028380 | Ga0268265_10006006 | Ga0268265_100060064 | 103 |
| 680 | 3300028380 | Ga0268265_11879733 | Ga0268265_118797332 | 103 |
| 681 | 3300028381 | Ga0268264_10070313 | Ga0268264_100703132 | 103 |
| 682 | 3300028381 | Ga0268264_10464210 | Ga0268264_104642102 | 103 |
| 683 | 3300032126 | Ga0307415_102235173 | Ga0307415_1022351732 | 103 |
| 684 | 3300033180 | Ga0307510_10005162 | Ga0307510_100051624 | 103 |
| 685 | 3300033180 | Ga0307510_10039726 | Ga0307510_100397263 | 103 |
| 686 | 3300035088 | Ga0373940_0296423 | Ga0373940_0296423_109_435 | 103 |
| 687 | 3300041456 | Ga0451795_0174589 | Ga0451795_0174589_609_929 | 103 |
| 688 | 3300041512 | Ga0451853_1856925 | Ga0451853_1856925_189_545 | 103 |
| 689 | 3300041512 | Ga0451853_2507703 | Ga0451853_2507703_211_561 | 103 |
| 690 | 3300046460 | Ga0495638_0123666 | Ga0495638_0123666_783_1103 | 103 |
| 691 | 3300046471 | Ga0495650_0000724 | Ga0495650_0000724_12854_13174 | 103 |
| 692 | 3300046471 | Ga0495650_0000912 | Ga0495650_0000912_20724_21044 | 103 |
| 693 | 3300046501 | Ga0495607_0000002 | Ga0495607_0000002_320131_320451 | 103 |
| 694 | 3300046507 | Ga0495606_0009282 | Ga0495606_0009282_6580_6900 | 103 |
| 695 | 3300046512 | Ga0495610_0120007 | Ga0495610_0120007_680_1000 | 103 |
| 696 | 3300046515 | Ga0495620_0000401 | Ga0495620_0000401_14084_14404 | 103 |
| 697 | 3300046518 | Ga0495631_0000410 | Ga0495631_0000410_5268_5588 | 103 |
| 698 | 3300046519 | Ga0495632_0004605 | Ga0495632_0004605_7999_8319 | 103 |
| 699 | 3300046524 | Ga0495648_0009496 | Ga0495648_0009496_6140_6460 | 103 |
| 700 | 3300046648 | Ga0495611_0000008 | Ga0495611_0000008_47895_48215 | 103 |
| 701 | 3300046660 | Ga0495625_0003154 | Ga0495625_0003154_4703_5023 | 103 |
| 702 | 3300046660 | Ga0495625_0304637 | Ga0495625_0304637_216_536 | 103 |
| 703 | 3300047469 | Ga0495673_0000030 | Ga0495673_0000030_286098_286418 | 103 |
| 704 | 3300047472 | Ga0495686_0000077 | Ga0495686_0000077_185704_186024 | 103 |
| 705 | 3300047472 | Ga0495686_0017160 | Ga0495686_0017160_2431_2751 | 103 |
| 706 | 3300048903 | Ga0496100_0026869 | Ga0496100_0026869_1568_1894 | 103 |
| 707 | 3300048905 | Ga0496102_0012607 | Ga0496102_0012607_193_519 | 103 |
| 708 | 3300048906 | Ga0496103_0127038 | Ga0496103_0127038_211_537 | 103 |
| 709 | 3300048909 | Ga0496106_0029054 | Ga0496106_0029054_3274_3600 | 103 |
| 710 | 3300048910 | Ga0496107_0185159 | Ga0496107_0185159_186_512 | 103 |
| 711 | 3300048911 | Ga0496108_1333691 | Ga0496108_1333691_104_430 | 103 |
| 712 | 3300048918 | Ga0496115_0082573 | Ga0496115_0082573_684_1010 | 103 |
| 713 | 3300048924 | Ga0496121_0078690 | Ga0496121_0078690_1501_1821 | 103 |
| 714 | 3300048928 | Ga0496125_0026949 | Ga0496125_0026949_1695_2015 | 103 |
| 715 | 3300048929 | Ga0496126_0026115 | Ga0496126_0026115_4707_5027 | 103 |
| 716 | 3300049824 | Ga0501045_1417356 | Ga0501045_1417356_85_429 | 103 |
| 717 | 3300050515 | nmdc:mga0a205_821288_c1 | nmdc:mga0a205_821288_c1_175_516 | 103 |
| 718 | 3300053090 | Ga0500646_0015830 | Ga0500646_0015830_1115_1435 | 103 |
| 719 | 3300053160 | Ga0500633_0039139 | Ga0500633_0039139_1122_1442 | 103 |
| 720 | 3300005328 | Ga0070676_10083564 | Ga0070676_100835642 | 104 |
| 721 | 3300005340 | Ga0070689_100348203 | Ga0070689_1003482032 | 104 |
| 722 | 3300005340 | Ga0070689_101090685 | Ga0070689_1010906852 | 104 |
| 723 | 3300005343 | Ga0070687_100104306 | Ga0070687_1001043061 | 104 |
| 724 | 3300005347 | Ga0070668_100516231 | Ga0070668_1005162312 | 104 |
| 725 | 3300005353 | Ga0070669_100022973 | Ga0070669_1000229733 | 104 |
| 726 | 3300005354 | Ga0070675_100021556 | Ga0070675_1000215563 | 104 |
| 727 | 3300005365 | Ga0070688_100996666 | Ga0070688_1009966661 | 104 |
| 728 | 3300005441 | Ga0070700_101130486 | Ga0070700_1011304862 | 104 |
| 729 | 3300005455 | Ga0070663_101072245 | Ga0070663_1010722451 | 104 |
| 730 | 3300005456 | Ga0070678_100076595 | Ga0070678_1000765952 | 104 |
| 731 | 3300005459 | Ga0068867_100026985 | Ga0068867_1000269854 | 104 |
| 732 | 3300005466 | Ga0070685_10263322 | Ga0070685_102633222 | 104 |
| 733 | 3300005471 | Ga0070698_101096892 | Ga0070698_1010968921 | 104 |
| 734 | 3300005543 | Ga0070672_100004186 | Ga0070672_1000041867 | 104 |
| 735 | 3300005577 | Ga0068857_101613937 | Ga0068857_1016139371 | 104 |
| 736 | 3300005617 | Ga0068859_100652009 | Ga0068859_1006520091 | 104 |
| 737 | 3300005618 | Ga0068864_100829063 | Ga0068864_1008290632 | 104 |
| 738 | 3300005618 | Ga0068864_101340479 | Ga0068864_1013404792 | 104 |
| 739 | 3300005719 | Ga0068861_102178783 | Ga0068861_1021787832 | 104 |
| 740 | 3300005841 | Ga0068863_100087748 | Ga0068863_1000877483 | 104 |
| 741 | 3300005841 | Ga0068863_101123835 | Ga0068863_1011238352 | 104 |
| 742 | 3300005843 | Ga0068860_100216171 | Ga0068860_1002161713 | 104 |
| 743 | 3300005844 | Ga0068862_100032236 | Ga0068862_1000322363 | 104 |
| 744 | 3300006237 | Ga0097621_100278357 | Ga0097621_1002783572 | 104 |
| 745 | 3300006844 | Ga0075428_100130833 | Ga0075428_1001308332 | 104 |
| 746 | 3300006844 | Ga0075428_100262592 | Ga0075428_1002625922 | 104 |
| 747 | 3300006846 | Ga0075430_100024687 | Ga0075430_1000246874 | 104 |
| 748 | 3300006847 | Ga0075431_100871651 | Ga0075431_1008716512 | 104 |
| 749 | 3300006871 | Ga0075434_100504932 | Ga0075434_1005049322 | 104 |
| 750 | 3300006931 | Ga0097620_100651994 | Ga0097620_1006519941 | 104 |
| 751 | 3300007788 | Ga0099795_10526707 | Ga0099795_105267072 | 104 |
| 752 | 3300009147 | Ga0114129_10319521 | Ga0114129_103195212 | 104 |
| 753 | 3300009551 | Ga0105238_12070853 | Ga0105238_120708531 | 104 |
| 754 | 3300013306 | Ga0163162_10131391 | Ga0163162_101313912 | 104 |
| 755 | 3300013308 | Ga0157375_10068289 | Ga0157375_100682893 | 104 |
| 756 | 3300014326 | Ga0157380_11206854 | Ga0157380_112068541 | 104 |
| 757 | 3300014497 | Ga0182008_10386642 | Ga0182008_103866422 | 104 |
| 758 | 3300025918 | Ga0207662_10108991 | Ga0207662_101089913 | 104 |
| 759 | 3300025926 | Ga0207659_10079709 | Ga0207659_100797092 | 104 |
| 760 | 3300025926 | Ga0207659_11486313 | Ga0207659_114863131 | 104 |
| 761 | 3300025937 | Ga0207669_10383878 | Ga0207669_103838781 | 104 |
| 762 | 3300025940 | Ga0207691_10005503 | Ga0207691_100055039 | 104 |
| 763 | 3300025961 | Ga0207712_10938756 | Ga0207712_109387562 | 104 |
| 764 | 3300025972 | Ga0207668_10213493 | Ga0207668_102134933 | 104 |
| 765 | 3300026075 | Ga0207708_10412434 | Ga0207708_104124342 | 104 |
| 766 | 3300026088 | Ga0207641_10324202 | Ga0207641_103242022 | 104 |
| 767 | 3300026088 | Ga0207641_11104943 | Ga0207641_111049432 | 104 |
| 768 | 3300026089 | Ga0207648_10011132 | Ga0207648_100111327 | 104 |
| 769 | 3300026095 | Ga0207676_12317861 | Ga0207676_123178611 | 104 |
| 770 | 3300026121 | Ga0207683_10100572 | Ga0207683_101005723 | 104 |
| 771 | 3300028380 | Ga0268265_10779522 | Ga0268265_107795222 | 104 |
| 772 | 3300028381 | Ga0268264_10175839 | Ga0268264_101758392 | 104 |
| 773 | 3300035088 | Ga0373940_0183855 | Ga0373940_0183855_97_420 | 104 |
| 774 | 3300035115 | Ga0373941_0393208 | Ga0373941_0393208_125_463 | 104 |
| 775 | 3300035691 | Ga0373931_0094161 | Ga0373931_0094161_443_766 | 104 |
| 776 | 3300037853 | Ga0436364_0341842 | Ga0436364_0341842_129_470 | 104 |
| 777 | 3300042001 | Ga0439441_101259 | Ga0439441_101259_249_578 | 104 |
| 778 | 3300046528 | Ga0495642_0229807 | Ga0495642_0229807_70_405 | 104 |
| 779 | 3300050507 | nmdc:mga05p37_264431_c1 | nmdc:mga05p37_264431_c1_416_760 | 104 |
| 780 | 3300050510 | nmdc:mga06r32_65621_c1 | nmdc:mga06r32_65621_c1_2848_3189 | 104 |
| 781 | 3300050511 | nmdc:mga08y16_513385_c1 | nmdc:mga08y16_513385_c1_825_1145 | 104 |
| 782 | 3300050512 | nmdc:mga0n895_956145_c1 | nmdc:mga0n895_956145_c1_31_354 | 104 |
| 783 | 3300005328 | Ga0070676_10264388 | Ga0070676_102643882 | 105 |
| 784 | 3300005329 | Ga0070683_102198067 | Ga0070683_1021980671 | 105 |
| 785 | 3300005330 | Ga0070690_100228768 | Ga0070690_1002287682 | 105 |
| 786 | 3300005335 | Ga0070666_10013113 | Ga0070666_100131132 | 105 |
| 787 | 3300005337 | Ga0070682_100065685 | Ga0070682_1000656852 | 105 |
| 788 | 3300005340 | Ga0070689_100276266 | Ga0070689_1002762662 | 105 |
| 789 | 3300005343 | Ga0070687_100052184 | Ga0070687_1000521841 | 105 |
| 790 | 3300005343 | Ga0070687_100138672 | Ga0070687_1001386722 | 105 |
| 791 | 3300005344 | Ga0070661_100108408 | Ga0070661_1001084082 | 105 |
| 792 | 3300005347 | Ga0070668_100249357 | Ga0070668_1002493572 | 105 |
| 793 | 3300005353 | Ga0070669_100286896 | Ga0070669_1002868962 | 105 |
| 794 | 3300005353 | Ga0070669_100574183 | Ga0070669_1005741832 | 105 |
| 795 | 3300005354 | Ga0070675_100000103 | Ga0070675_10000010327 | 105 |
| 796 | 3300005354 | Ga0070675_100035421 | Ga0070675_1000354213 | 105 |
| 797 | 3300005354 | Ga0070675_101134324 | Ga0070675_1011343242 | 105 |
| 798 | 3300005355 | Ga0070671_100033557 | Ga0070671_1000335573 | 105 |
| 799 | 3300005356 | Ga0070674_100177643 | Ga0070674_1001776433 | 105 |
| 800 | 3300005364 | Ga0070673_100016190 | Ga0070673_1000161903 | 105 |
| 801 | 3300005365 | Ga0070688_100071497 | Ga0070688_1000714973 | 105 |
| 802 | 3300005367 | Ga0070667_100011691 | Ga0070667_1000116913 | 105 |
| 803 | 3300005440 | Ga0070705_100293846 | Ga0070705_1002938462 | 105 |
| 804 | 3300005455 | Ga0070663_100915219 | Ga0070663_1009152191 | 105 |
| 805 | 3300005456 | Ga0070678_100358808 | Ga0070678_1003588082 | 105 |
| 806 | 3300005466 | Ga0070685_10011073 | Ga0070685_100110734 | 105 |
| 807 | 3300005466 | Ga0070685_10500382 | Ga0070685_105003822 | 105 |
| 808 | 3300005543 | Ga0070672_100004426 | Ga0070672_1000044268 | 105 |
| 809 | 3300005543 | Ga0070672_100511775 | Ga0070672_1005117753 | 105 |
| 810 | 3300005543 | Ga0070672_100752606 | Ga0070672_1007526062 | 105 |
| 811 | 3300005544 | Ga0070686_100144907 | Ga0070686_1001449072 | 105 |
| 812 | 3300005548 | Ga0070665_100183776 | Ga0070665_1001837762 | 105 |
| 813 | 3300005564 | Ga0070664_101132411 | Ga0070664_1011324112 | 105 |
| 814 | 3300005577 | Ga0068857_100623749 | Ga0068857_1006237492 | 105 |
| 815 | 3300005617 | Ga0068859_100001040 | Ga0068859_1000010408 | 105 |
| 816 | 3300005617 | Ga0068859_100001955 | Ga0068859_1000019559 | 105 |
| 817 | 3300005618 | Ga0068864_100407726 | Ga0068864_1004077262 | 105 |
| 818 | 3300005719 | Ga0068861_101068890 | Ga0068861_1010688902 | 105 |
| 819 | 3300005840 | Ga0068870_10470937 | Ga0068870_104709372 | 105 |
| 820 | 3300005841 | Ga0068863_100000572 | Ga0068863_10000057214 | 105 |
| 821 | 3300005842 | Ga0068858_100001626 | Ga0068858_10000162611 | 105 |
| 822 | 3300005843 | Ga0068860_100010500 | Ga0068860_1000105007 | 105 |
| 823 | 3300005844 | Ga0068862_100098913 | Ga0068862_1000989132 | 105 |
| 824 | 3300005844 | Ga0068862_100136327 | Ga0068862_1001363273 | 105 |
| 825 | 3300006237 | Ga0097621_100041838 | Ga0097621_1000418384 | 105 |
| 826 | 3300006358 | Ga0068871_100510972 | Ga0068871_1005109722 | 105 |
| 827 | 3300006931 | Ga0097620_100001040 | Ga0097620_10000104016 | 105 |
| 828 | 3300006931 | Ga0097620_100001955 | Ga0097620_1000019559 | 105 |
| 829 | 3300009098 | Ga0105245_10051311 | Ga0105245_100513114 | 105 |
| 830 | 3300009148 | Ga0105243_10880546 | Ga0105243_108805462 | 105 |
| 831 | 3300009176 | Ga0105242_10505620 | Ga0105242_105056203 | 105 |
| 832 | 3300009177 | Ga0105248_10000527 | Ga0105248_1000052721 | 105 |
| 833 | 3300009553 | Ga0105249_11661127 | Ga0105249_116611272 | 105 |
| 834 | 3300013296 | Ga0157374_11093973 | Ga0157374_110939732 | 105 |
| 835 | 3300013306 | Ga0163162_10006107 | Ga0163162_100061079 | 105 |
| 836 | 3300013308 | Ga0157375_10000420 | Ga0157375_1000042015 | 105 |
| 837 | 3300014325 | Ga0163163_10002143 | Ga0163163_1000214312 | 105 |
| 838 | 3300014968 | Ga0157379_10000292 | Ga0157379_1000029216 | 105 |
| 839 | 3300014969 | Ga0157376_10146042 | Ga0157376_101460422 | 105 |
| 840 | 3300017792 | Ga0163161_10028408 | Ga0163161_100284083 | 105 |
| 841 | 3300025903 | Ga0207680_10269032 | Ga0207680_102690322 | 105 |
| 842 | 3300025918 | Ga0207662_10898614 | Ga0207662_108986142 | 105 |
| 843 | 3300025923 | Ga0207681_10420889 | Ga0207681_104208892 | 105 |
| 844 | 3300025923 | Ga0207681_10754757 | Ga0207681_107547572 | 105 |
| 845 | 3300025925 | Ga0207650_10090014 | Ga0207650_100900142 | 105 |
| 846 | 3300025926 | Ga0207659_10006200 | Ga0207659_100062002 | 105 |
| 847 | 3300025926 | Ga0207659_10015205 | Ga0207659_100152053 | 105 |
| 848 | 3300025926 | Ga0207659_10023985 | Ga0207659_100239853 | 105 |
| 849 | 3300025926 | Ga0207659_10039841 | Ga0207659_100398412 | 105 |
| 850 | 3300025927 | Ga0207687_10730789 | Ga0207687_107307892 | 105 |
| 851 | 3300025931 | Ga0207644_10125951 | Ga0207644_101259513 | 105 |
| 852 | 3300025934 | Ga0207686_11105453 | Ga0207686_111054532 | 105 |
| 853 | 3300025936 | Ga0207670_10270063 | Ga0207670_102700633 | 105 |
| 854 | 3300025937 | Ga0207669_10685964 | Ga0207669_106859642 | 105 |
| 855 | 3300025937 | Ga0207669_11019009 | Ga0207669_110190092 | 105 |
| 856 | 3300025940 | Ga0207691_10009766 | Ga0207691_100097662 | 105 |
| 857 | 3300025940 | Ga0207691_10362045 | Ga0207691_103620451 | 105 |
| 858 | 3300025940 | Ga0207691_10708905 | Ga0207691_107089052 | 105 |
| 859 | 3300025941 | Ga0207711_10003479 | Ga0207711_100034793 | 105 |
| 860 | 3300025941 | Ga0207711_10133561 | Ga0207711_101335613 | 105 |
| 861 | 3300025942 | Ga0207689_10870802 | Ga0207689_108708021 | 105 |
| 862 | 3300025945 | Ga0207679_10090961 | Ga0207679_100909613 | 105 |
| 863 | 3300025960 | Ga0207651_10004091 | Ga0207651_100040915 | 105 |
| 864 | 3300025960 | Ga0207651_10323955 | Ga0207651_103239552 | 105 |
| 865 | 3300025972 | Ga0207668_10130222 | Ga0207668_101302222 | 105 |
| 866 | 3300025986 | Ga0207658_10014896 | Ga0207658_100148963 | 105 |
| 867 | 3300026035 | Ga0207703_10037133 | Ga0207703_100371333 | 105 |
| 868 | 3300026075 | Ga0207708_10469516 | Ga0207708_104695162 | 105 |
| 869 | 3300026075 | Ga0207708_10983287 | Ga0207708_109832871 | 105 |
| 870 | 3300026088 | Ga0207641_10001943 | Ga0207641_100019434 | 105 |
| 871 | 3300026095 | Ga0207676_10436550 | Ga0207676_104365502 | 105 |
| 872 | 3300026116 | Ga0207674_10498547 | Ga0207674_104985473 | 105 |
| 873 | 3300027907 | Ga0207428_10031609 | Ga0207428_100316091 | 105 |
| 874 | 3300028379 | Ga0268266_10183825 | Ga0268266_101838253 | 105 |
| 875 | 3300028380 | Ga0268265_10726508 | Ga0268265_107265081 | 105 |
| 876 | 3300028381 | Ga0268264_10005822 | Ga0268264_100058223 | 105 |
| 877 | 3300032002 | Ga0307416_103265362 | Ga0307416_1032653621 | 105 |
| 878 | 3300047318 | Ga0495636_0117749 | Ga0495636_0117749_194_538 | 105 |
| 879 | 3300048911 | Ga0496108_0332096 | Ga0496108_0332096_418_765 | 105 |
| 880 | 3300049575 | Ga0501039_1588599 | Ga0501039_1588599_31_381 | 105 |
| 881 | 3300005336 | Ga0070680_100159476 | Ga0070680_1001594762 | 106 |
| 882 | 3300005458 | Ga0070681_10031164 | Ga0070681_100311645 | 106 |
| 883 | 3300005530 | Ga0070679_100031410 | Ga0070679_1000314105 | 106 |
| 884 | 3300014968 | Ga0157379_11329916 | Ga0157379_113299161 | 106 |
| 885 | 3300025912 | Ga0207707_10023231 | Ga0207707_100232314 | 106 |
| 886 | 3300025917 | Ga0207660_10129400 | Ga0207660_101294002 | 106 |
| 887 | 3300025921 | Ga0207652_10056235 | Ga0207652_100562353 | 106 |
| 888 | 3300025986 | Ga0207658_11670726 | Ga0207658_116707261 | 106 |
| 889 | 3300026035 | Ga0207703_11474475 | Ga0207703_114744752 | 106 |
| 890 | 3300026095 | Ga0207676_12334943 | Ga0207676_123349431 | 106 |
| 891 | 3300053153 | Ga0500616_0109048 | Ga0500616_0109048_426_758 | 107 |
| 892 | 3300005354 | Ga0070675_100143053 | Ga0070675_1001430532 | 108 |
| 893 | 3300005364 | Ga0070673_100235410 | Ga0070673_1002354103 | 108 |
| 894 | 3300005365 | Ga0070688_100581292 | Ga0070688_1005812922 | 108 |
| 895 | 3300005564 | Ga0070664_100272367 | Ga0070664_1002723672 | 108 |
| 896 | 3300009177 | Ga0105248_10839989 | Ga0105248_108399892 | 108 |
| 897 | 3300025945 | Ga0207679_10340459 | Ga0207679_103404592 | 108 |
| 898 | 2162886012 | MBSR1b_contig_11158489 | MBSR1b_0986.00003590 | 109 |
| 899 | 3300005288 | Ga0065714_10250901 | Ga0065714_102509012 | 109 |
| 900 | 3300005330 | Ga0070690_100048099 | Ga0070690_1000480993 | 109 |
| 901 | 3300005331 | Ga0070670_100043037 | Ga0070670_1000430372 | 109 |
| 902 | 3300005340 | Ga0070689_100036377 | Ga0070689_1000363773 | 109 |
| 903 | 3300005354 | Ga0070675_100027006 | Ga0070675_1000270063 | 109 |
| 904 | 3300005364 | Ga0070673_102262967 | Ga0070673_1022629671 | 109 |
| 905 | 3300005365 | Ga0070688_100015100 | Ga0070688_1000151002 | 109 |
| 906 | 3300005441 | Ga0070700_101672916 | Ga0070700_1016729162 | 109 |
| 907 | 3300005457 | Ga0070662_100469769 | Ga0070662_1004697692 | 109 |
| 908 | 3300005544 | Ga0070686_100085706 | Ga0070686_1000857062 | 109 |
| 909 | 3300005577 | Ga0068857_100324107 | Ga0068857_1003241072 | 109 |
| 910 | 3300009094 | Ga0111539_10108841 | Ga0111539_101088412 | 109 |
| 911 | 3300009094 | Ga0111539_10155806 | Ga0111539_101558063 | 109 |
| 912 | 3300009094 | Ga0111539_11417318 | Ga0111539_114173182 | 109 |
| 913 | 3300009177 | Ga0105248_10100182 | Ga0105248_101001823 | 109 |
| 914 | 3300013306 | Ga0163162_12011677 | Ga0163162_120116772 | 109 |
| 915 | 3300013308 | Ga0157375_13176851 | Ga0157375_131768512 | 109 |
| 916 | 3300014326 | Ga0157380_10219948 | Ga0157380_102199482 | 109 |
| 917 | 3300050511 | nmdc:mga08y16_43202_c1 | nmdc:mga08y16_43202_c1_3964_4308 | 109 |
| 918 | 3300050511 | nmdc:mga08y16_85745_c1 | nmdc:mga08y16_85745_c1_1572_1901 | 109 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5n8y-assembly1.cif.gz_G | kaicba circadian clock backbone model based on a cryo-em density | 0.819 | 20 | 66 |
| 4kun-assembly1.cif.gz_B | crystal structure of legionella pneumophila lpp1115 / kaib | 0.7656 | 17 | 71 |
| 6iev-assembly1.cif.gz_C | crystal structure of a designed protein | 0.761 | 16 | 58 |
| 6iev-assembly1.cif.gz_A | crystal structure of a designed protein | 0.7594 | 16 | 63 |
| 5jwr-assembly1.cif.gz_B | crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus | 0.7552 | 17 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t4zA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7664 | 18 | 71 | 3.40.30.10 |
| 4kunB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7656 | 17 | 71 | 3.40.30.10 |
| af_P82890_1_152_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7383 | 19 | 57 | 3.40.50.2300 |
| 5jwoB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7351 | 17 | 71 | 3.40.30.10 |
| 1urgA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.735 | 19 | 62 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V1PC86-F1-model_v4 | Circadian clock protein KaiB | 0.9482 | 18 | 66 |
GO:0048511
|
| AF-A0A1F9PH16-F1-model_v4 | KaiB domain-containing protein | 0.9408 | 18 | 66 |
GO:0048511
|
| AF-A0A657Q190-F1-model_v4 | Circadian clock protein KaiB | 0.9286 | 13 | 66 |
GO:0048511
|
| AF-A0A7V9KD35-F1-model_v4 | Circadian clock protein KaiB | 0.9268 | 13 | 66 |
GO:0048511
|
| AF-A0A7X6AH67-F1-model_v4 | deleted | 0.9205 | 17 | 66 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar