F485662

General Info

Members Datasets Scaffolds Average Seq Length
918 331 916 109

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100048099|Ga0070690_1000480993
Length 126
Sequence MPTPNQHPANCATGRPSMEFAMNTETEKEINSEKWELRLYTAGQTPKSLTAFANLKRLCEEHLKGRYSIEVIDLTRNPQLAAGDQIVAIPTLVRKLPEPLRRIVGDLRDTERTLVGLQLRPAKLDR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2734482264 Dyella sp. AD052 Isolate Unclassified
3 2738543009 Luteibacter sp. OK325 Isolate Unclassified
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
215 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
235 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
240 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
241 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
284 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
331 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.22
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 5.12
Rhizosphere 90.85
Stem 0
Stem Tuber 0
Unclassified 2.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11158489 2162886012 Unclassified 1138
2 MBSR1b_contig_11923333 2162886012 Bacteria 1296
3 ARSoilOldRDRAFT_c017047 3300000044 Unclassified 628
4 JGI24735J21928_10040768 3300002067 Bacteria 1354
5 Ga0058859_10049305 3300004798 Bacteria 972
6 Ga0058860_12217052 3300004801 Bacteria 507
7 Ga0065714_10250901 3300005288 Unclassified 775
8 Ga0065715_10206516 3300005293 Bacteria 1334
9 Ga0065707_10052148 3300005295 Unclassified 777
10 Ga0070658_10041483 3300005327 Bacteria 3713
11 Ga0070658_11137813 3300005327 Unclassified 679
12 Ga0070676_10037256 3300005328 Bacteria 2805
13 Ga0070676_10083564 3300005328 Bacteria 1942
14 Ga0070676_10264388 3300005328 Unclassified 1153
15 Ga0070676_10708686 3300005328 Bacteria 736
16 Ga0070683_102198067 3300005329 Bacteria 530
17 Ga0070690_100000584 3300005330 Bacteria 18375
18 Ga0070690_100048099 3300005330 Bacteria 2715
19 Ga0070690_100070176 3300005330 Bacteria 2275
20 Ga0070690_100077402 3300005330 Bacteria 2171
21 Ga0070690_100228768 3300005330 Bacteria 1306
22 Ga0070690_100316387 3300005330 Unclassified 1123
23 Ga0070690_100677352 3300005330 Bacteria 790
24 Ga0070670_100043037 3300005331 Bacteria 3883
25 Ga0070670_100222839 3300005331 Unclassified 1641
26 Ga0070670_100318908 3300005331 Bacteria 1361
27 Ga0068869_100103078 3300005334 Bacteria 2161
28 Ga0068869_100216777 3300005334 Unclassified 1515
29 Ga0068869_100373923 3300005334 Bacteria 1166
30 Ga0068869_101875269 3300005334 Bacteria 537
31 Ga0070666_10000001 3300005335 Bacteria 543080
32 Ga0070666_10013113 3300005335 Bacteria 5251
33 Ga0070666_10038796 3300005335 Bacteria 3171
34 Ga0070666_10057777 3300005335 Bacteria 2622
35 Ga0070666_10235751 3300005335 Bacteria 1293
36 Ga0070666_11354917 3300005335 Unclassified 531
37 Ga0070680_100040141 3300005336 Bacteria 3788
38 Ga0070680_100159476 3300005336 Bacteria 1895
39 Ga0070680_100310489 3300005336 Bacteria 1338
40 Ga0070680_100469087 3300005336 Bacteria 1076
41 Ga0070680_100630143 3300005336 Bacteria 921
42 Ga0070680_101847718 3300005336 Bacteria 523
43 Ga0070682_100028554 3300005337 Bacteria 3356
44 Ga0070682_100065685 3300005337 Unclassified 2306
45 Ga0070682_100409873 3300005337 Bacteria 1027
46 Ga0068868_100002180 3300005338 Bacteria 13496
47 Ga0068868_100321592 3300005338 Bacteria 1318
48 Ga0068868_101254847 3300005338 Bacteria 687
49 Ga0070660_100025605 3300005339 Bacteria 4385
50 Ga0070660_100279456 3300005339 Bacteria 1366
51 Ga0070660_100495618 3300005339 Bacteria 1016
52 Ga0070689_100002469 3300005340 Bacteria 12073
53 Ga0070689_100003146 3300005340 Bacteria 10917
54 Ga0070689_100036377 3300005340 Bacteria 3766
55 Ga0070689_100276266 3300005340 Bacteria 1392
56 Ga0070689_100348203 3300005340 Bacteria 1242
57 Ga0070689_100369763 3300005340 Unclassified 1206
58 Ga0070689_101090685 3300005340 Unclassified 713
59 Ga0070689_101159088 3300005340 Bacteria 692
60 Ga0070691_10013229 3300005341 Bacteria 3780
61 Ga0070691_11013767 3300005341 Bacteria 519
62 Ga0070687_100048364 3300005343 Bacteria 2187
63 Ga0070687_100052184 3300005343 Bacteria 2121
64 Ga0070687_100104306 3300005343 Bacteria 1593
65 Ga0070687_100138672 3300005343 Unclassified 1413
66 Ga0070687_100165001 3300005343 Bacteria 1313
67 Ga0070661_100009313 3300005344 Bacteria 6793
68 Ga0070661_100027965 3300005344 Bacteria 4064
69 Ga0070661_100108408 3300005344 Bacteria 2072
70 Ga0070661_100114824 3300005344 Bacteria 2013
71 Ga0070692_10013994 3300005345 Bacteria 3755
72 Ga0070692_10042111 3300005345 Bacteria 2343
73 Ga0070668_100050479 3300005347 Bacteria 3203
74 Ga0070668_100128307 3300005347 Bacteria 2033
75 Ga0070668_100249357 3300005347 Bacteria 1473
76 Ga0070668_100516231 3300005347 Bacteria 1036
77 Ga0070668_101648042 3300005347 Unclassified 588
78 Ga0070669_100022973 3300005353 Bacteria 4462
79 Ga0070669_100113429 3300005353 Unclassified 2059
80 Ga0070669_100279091 3300005353 Bacteria 1338
81 Ga0070669_100286896 3300005353 Bacteria 1320
82 Ga0070669_100574183 3300005353 Unclassified 942
83 Ga0070675_100000103 3300005354 Bacteria 50035
84 Ga0070675_100017455 3300005354 Bacteria 5703
85 Ga0070675_100021556 3300005354 Bacteria 5150
86 Ga0070675_100027006 3300005354 Bacteria 4610
87 Ga0070675_100035421 3300005354 Bacteria 4055
88 Ga0070675_100113062 3300005354 Bacteria 2299
89 Ga0070675_100143053 3300005354 Bacteria 2046
90 Ga0070675_100951566 3300005354 Bacteria 788
91 Ga0070675_101134324 3300005354 Unclassified 719
92 Ga0070675_102178177 3300005354 Bacteria 511
93 Ga0070671_100000445 3300005355 Bacteria 28732
94 Ga0070671_100005336 3300005355 Bacteria 10248
95 Ga0070671_100033557 3300005355 Bacteria 4246
96 Ga0070671_100637912 3300005355 Bacteria 922
97 Ga0070674_100177643 3300005356 Bacteria 1628
98 Ga0070674_100580693 3300005356 Bacteria 944
99 Ga0070673_100008378 3300005364 Bacteria 6873
100 Ga0070673_100016190 3300005364 Bacteria 5264
101 Ga0070673_100059962 3300005364 Bacteria 3014
102 Ga0070673_100235410 3300005364 Bacteria 1590
103 Ga0070673_101399431 3300005364 Unclassified 658
104 Ga0070673_101724724 3300005364 Bacteria 593
105 Ga0070673_102262967 3300005364 Unclassified 517
106 Ga0070688_100015100 3300005365 Bacteria 4385
107 Ga0070688_100071497 3300005365 Unclassified 2221
108 Ga0070688_100097303 3300005365 Unclassified 1934
109 Ga0070688_100517824 3300005365 Bacteria 902
110 Ga0070688_100581292 3300005365 Bacteria 855
111 Ga0070688_100996666 3300005365 Unclassified 665
112 Ga0070659_100000939 3300005366 Bacteria 21418
113 Ga0070659_100302240 3300005366 Bacteria 1335
114 Ga0070659_100473397 3300005366 Bacteria 1065
115 Ga0070667_100011691 3300005367 Bacteria 7256
116 Ga0070667_100325718 3300005367 Bacteria 1387
117 Ga0070703_10013905 3300005406 Bacteria 2287
118 Ga0070703_10043198 3300005406 Bacteria 1413
119 Ga0070709_10205455 3300005434 Bacteria 1397
120 Ga0070714_100031734 3300005435 Bacteria 4409
121 Ga0070714_100354919 3300005435 Bacteria 1377
122 Ga0070714_100619867 3300005435 Bacteria 1040
123 Ga0070701_10017381 3300005438 Bacteria 3360
124 Ga0070701_10140843 3300005438 Bacteria 1379
125 Ga0070701_10142807 3300005438 Bacteria 1371
126 Ga0070711_100067264 3300005439 Bacteria 2513
127 Ga0070705_100002630 3300005440 Bacteria 8983
128 Ga0070705_100006334 3300005440 Bacteria 5797
129 Ga0070705_100293846 3300005440 Unclassified 1161
130 Ga0070705_100630651 3300005440 Bacteria 833
131 Ga0070705_100994044 3300005440 Bacteria 680
132 Ga0070700_100020679 3300005441 Bacteria 3817
133 Ga0070700_100029638 3300005441 Bacteria 3265
134 Ga0070700_101130486 3300005441 Unclassified 651
135 Ga0070700_101672916 3300005441 Unclassified 545
136 Ga0070694_100001106 3300005444 Bacteria 15430
137 Ga0070694_100010520 3300005444 Bacteria 5711
138 Ga0070694_100131174 3300005444 Bacteria 1810
139 Ga0070694_100167598 3300005444 Bacteria 1616
140 Ga0070708_100206472 3300005445 Bacteria 1840
141 Ga0070663_100258294 3300005455 Unclassified 1381
142 Ga0070663_100915219 3300005455 Unclassified 758
143 Ga0070663_101072245 3300005455 Unclassified 703
144 Ga0070678_100051022 3300005456 Bacteria 2996
145 Ga0070678_100076595 3300005456 Bacteria 2520
146 Ga0070678_100340049 3300005456 Unclassified 1287
147 Ga0070678_100358808 3300005456 Unclassified 1255
148 Ga0070678_100363726 3300005456 Bacteria 1247
149 Ga0070662_100000104 3300005457 Bacteria 46608
150 Ga0070662_100068410 3300005457 Bacteria 2611
151 Ga0070662_100170044 3300005457 Bacteria 1711
152 Ga0070662_100469769 3300005457 Unclassified 1046
153 Ga0070662_100972821 3300005457 Bacteria 726
154 Ga0070662_101650599 3300005457 Unclassified 553
155 Ga0070681_10031164 3300005458 Bacteria 5352
156 Ga0070681_10194045 3300005458 Bacteria 1950
157 Ga0070681_10477434 3300005458 Bacteria 1159
158 Ga0068867_100024059 3300005459 Bacteria 4364
159 Ga0068867_100026985 3300005459 Bacteria 4126
160 Ga0068867_100193293 3300005459 Bacteria 1625
161 Ga0068867_100607219 3300005459 Bacteria 955
162 Ga0068867_100607574 3300005459 Bacteria 954
163 Ga0068867_100959330 3300005459 Unclassified 773
164 Ga0070685_10011073 3300005466 Bacteria 4709
165 Ga0070685_10031489 3300005466 Bacteria 2964
166 Ga0070685_10160212 3300005466 Bacteria 1433
167 Ga0070685_10263322 3300005466 Bacteria 1147
168 Ga0070685_10500382 3300005466 Bacteria 860
169 Ga0070698_101096892 3300005471 Unclassified 744
170 Ga0070699_100403962 3300005518 Unclassified 1235
171 Ga0070699_100416729 3300005518 Bacteria 1215
172 Ga0070679_100031410 3300005530 Bacteria 5246
173 Ga0070679_100102753 3300005530 Bacteria 2844
174 Ga0070679_100160987 3300005530 Bacteria 2219
175 Ga0070679_100301770 3300005530 Bacteria 1552
176 Ga0070679_100470283 3300005530 Bacteria 1201
177 Ga0070679_101080606 3300005530 Bacteria 747
178 Ga0070679_101728117 3300005530 Bacteria 574
179 Ga0070679_102043744 3300005530 Unclassified 522
180 Ga0070697_101503480 3300005536 Unclassified 602
181 Ga0068853_100026492 3300005539 Bacteria 4868
182 Ga0068853_101693716 3300005539 Bacteria 613
183 Ga0070672_100004186 3300005543 Bacteria 9419
184 Ga0070672_100004426 3300005543 Bacteria 9195
185 Ga0070672_100039289 3300005543 Bacteria 3623
186 Ga0070672_100065796 3300005543 Bacteria 2868
187 Ga0070672_100511775 3300005543 Bacteria 1039
188 Ga0070672_100596995 3300005543 Unclassified 961
189 Ga0070672_100752606 3300005543 Unclassified 855
190 Ga0070672_101389598 3300005543 Bacteria 628
191 Ga0070686_100002108 3300005544 Bacteria 10972
192 Ga0070686_100085706 3300005544 Bacteria 2096
193 Ga0070686_100144907 3300005544 Bacteria 1657
194 Ga0070686_100155654 3300005544 Bacteria 1604
195 Ga0070695_100000295 3300005545 Bacteria 25143
196 Ga0070695_100009793 3300005545 Bacteria 5708
197 Ga0070696_100005323 3300005546 Bacteria 8585
198 Ga0070696_100011350 3300005546 Bacteria 5965
199 Ga0070696_101736943 3300005546 Unclassified 538
200 Ga0070693_100006341 3300005547 Bacteria 5734
201 Ga0070665_100183776 3300005548 Bacteria 2091
202 Ga0070665_100601089 3300005548 Unclassified 1113
203 Ga0070704_100065054 3300005549 Bacteria 2623
204 Ga0070704_100394294 3300005549 Bacteria 1179
205 Ga0070704_100460895 3300005549 Bacteria 1096
206 Ga0070704_102216211 3300005549 Bacteria 511
207 Ga0068855_100001220 3300005563 Bacteria 31895
208 Ga0068855_100027591 3300005563 Bacteria 6792
209 Ga0068855_100089219 3300005563 Bacteria 3560
210 Ga0068855_100234658 3300005563 Bacteria 2052
211 Ga0070664_100002517 3300005564 Bacteria 14767
212 Ga0070664_100164036 3300005564 Bacteria 1968
213 Ga0070664_100272367 3300005564 Bacteria 1525
214 Ga0070664_100548829 3300005564 Bacteria 1068
215 Ga0070664_101132411 3300005564 Unclassified 737
216 Ga0068857_100050892 3300005577 Bacteria 3674
217 Ga0068857_100070006 3300005577 Bacteria 3124
218 Ga0068857_100247470 3300005577 Unclassified 1633
219 Ga0068857_100288769 3300005577 Bacteria 1510
220 Ga0068857_100324107 3300005577 Unclassified 1423
221 Ga0068857_100623749 3300005577 Unclassified 1020
222 Ga0068857_101613937 3300005577 Unclassified 633
223 Ga0068854_100327335 3300005578 Bacteria 1247
224 Ga0068854_100827249 3300005578 Bacteria 809
225 Ga0068856_100000606 3300005614 Bacteria 39272
226 Ga0068856_100115020 3300005614 Bacteria 2689
227 Ga0068856_100347362 3300005614 Unclassified 1502
228 Ga0068856_100626792 3300005614 Unclassified 1096
229 Ga0068856_102003907 3300005614 Unclassified 589
230 Ga0070702_100004748 3300005615 Bacteria 6242
231 Ga0070702_100250727 3300005615 Bacteria 1200
232 Ga0070702_100503483 3300005615 Bacteria 890
233 Ga0070702_101649899 3300005615 Bacteria 532
234 Ga0068852_100021425 3300005616 Bacteria 5160
235 Ga0068852_100031335 3300005616 Bacteria 4387
236 Ga0068852_100135922 3300005616 Bacteria 2270
237 Ga0068852_100501829 3300005616 Bacteria 1208
238 Ga0068852_100747163 3300005616 Bacteria 990
239 Ga0068852_102561953 3300005616 Bacteria 530
240 Ga0068859_100001040 3300005617 Bacteria 28431
241 Ga0068859_100001955 3300005617 Bacteria 21012
242 Ga0068859_100031224 3300005617 Bacteria 5347
243 Ga0068859_100083665 3300005617 Bacteria 3234
244 Ga0068859_100652009 3300005617 Bacteria 1145
245 Ga0068859_101488625 3300005617 Unclassified 747
246 Ga0068859_101845690 3300005617 Bacteria 668
247 Ga0068864_100071403 3300005618 Bacteria 3023
248 Ga0068864_100407726 3300005618 Unclassified 1293
249 Ga0068864_100692896 3300005618 Bacteria 995
250 Ga0068864_100829063 3300005618 Unclassified 910
251 Ga0068864_100856431 3300005618 Bacteria 896
252 Ga0068864_101340479 3300005618 Bacteria 716
253 Ga0068866_10101523 3300005718 Bacteria 1588
254 Ga0068866_10108422 3300005718 Bacteria 1545
255 Ga0068866_10618578 3300005718 Unclassified 733
256 Ga0068861_100195597 3300005719 Bacteria 1694
257 Ga0068861_100238642 3300005719 Bacteria 1545
258 Ga0068861_100280552 3300005719 Bacteria 1434
259 Ga0068861_101068890 3300005719 Unclassified 774
260 Ga0068861_102178783 3300005719 Bacteria 555
261 Ga0068851_10425341 3300005834 Unclassified 785
262 Ga0068870_10196780 3300005840 Bacteria 1220
263 Ga0068870_10470937 3300005840 Unclassified 832
264 Ga0068870_10584839 3300005840 Bacteria 756
265 Ga0068863_100000572 3300005841 Bacteria 37450
266 Ga0068863_100087748 3300005841 Bacteria 2948
267 Ga0068863_100153344 3300005841 Bacteria 2205
268 Ga0068863_101038359 3300005841 Bacteria 823
269 Ga0068863_101123835 3300005841 Unclassified 791
270 Ga0068863_101298027 3300005841 Bacteria 735
271 Ga0068863_101486900 3300005841 Bacteria 686
272 Ga0068863_101981921 3300005841 Unclassified 592
273 Ga0068858_100001626 3300005842 Bacteria 22912
274 Ga0068858_100007255 3300005842 Bacteria 10738
275 Ga0068858_100045656 3300005842 Bacteria 4061
276 Ga0068858_100108823 3300005842 Bacteria 2587
277 Ga0068858_101604191 3300005842 Bacteria 642
278 Ga0068860_100010500 3300005843 Bacteria 9154
279 Ga0068860_100086141 3300005843 Bacteria 2989
280 Ga0068860_100131036 3300005843 Bacteria 2406
281 Ga0068860_100216171 3300005843 Bacteria 1860
282 Ga0068860_100388420 3300005843 Bacteria 1379
283 Ga0068860_100502620 3300005843 Bacteria 1210
284 Ga0068860_101453145 3300005843 Unclassified 707
285 Ga0068862_100011828 3300005844 Bacteria 7207
286 Ga0068862_100032236 3300005844 Bacteria 4427
287 Ga0068862_100098913 3300005844 Bacteria 2549
288 Ga0068862_100136327 3300005844 Bacteria 2175
289 Ga0068862_100174706 3300005844 Bacteria 1925
290 Ga0068862_100247405 3300005844 Bacteria 1624
291 Ga0068862_100345736 3300005844 Bacteria 1379
292 Ga0068862_101538239 3300005844 Bacteria 671
293 Ga0068862_101919248 3300005844 Unclassified 602
294 Ga0081539_10000332 3300005985 Bacteria 104677
295 Ga0075365_10067465 3300006038 Bacteria 2402
296 Ga0075363_100019497 3300006048 Bacteria 3392
297 Ga0070715_10915635 3300006163 Bacteria 541
298 Ga0070712_101141180 3300006175 Unclassified 677
299 Ga0097621_100001291 3300006237 Bacteria 17227
300 Ga0097621_100041838 3300006237 Bacteria 3690
301 Ga0097621_100278357 3300006237 Bacteria 1472
302 Ga0097621_100713422 3300006237 Bacteria 924
303 Ga0068871_100014810 3300006358 Bacteria 5822
304 Ga0068871_100510972 3300006358 Unclassified 1084
305 Ga0075428_100130833 3300006844 Bacteria 2730
306 Ga0075428_100262592 3300006844 Bacteria 1859
307 Ga0075430_100024687 3300006846 Bacteria 5112
308 Ga0075430_100027073 3300006846 Unclassified 4874
309 Ga0075430_100335017 3300006846 Unclassified 1250
310 Ga0075430_100486854 3300006846 Bacteria 1018
311 Ga0075431_100010851 3300006847 Bacteria 9164
312 Ga0075431_100687099 3300006847 Bacteria 1002
313 Ga0075431_100871651 3300006847 Bacteria 871
314 Ga0075431_101126274 3300006847 Bacteria 749
315 Ga0075433_10010678 3300006852 Bacteria 7384
316 Ga0075433_11128379 3300006852 Bacteria 681
317 Ga0075433_11871136 3300006852 Bacteria 515
318 Ga0075434_100000566 3300006871 Bacteria 28488
319 Ga0075434_100011155 3300006871 Bacteria 8456
320 Ga0075434_100504932 3300006871 Bacteria 1230
321 Ga0075434_101999062 3300006871 Bacteria 585
322 Ga0075429_100066667 3300006880 Bacteria 3134
323 Ga0075429_100268907 3300006880 Bacteria 1493
324 Ga0075429_101148496 3300006880 Bacteria 678
325 Ga0068865_100037664 3300006881 Bacteria 3267
326 Ga0068865_100081775 3300006881 Bacteria 2320
327 Ga0068865_101261367 3300006881 Unclassified 656
328 Ga0068865_101653644 3300006881 Unclassified 576
329 Ga0075436_100001732 3300006914 Bacteria 14948
330 Ga0075436_100642121 3300006914 Unclassified 784
331 Ga0097620_100001040 3300006931 Bacteria 28431
332 Ga0097620_100001955 3300006931 Bacteria 21012
333 Ga0097620_100031226 3300006931 Bacteria 5347
334 Ga0097620_100083671 3300006931 Bacteria 3234
335 Ga0097620_100651994 3300006931 Bacteria 1145
336 Ga0097620_101488707 3300006931 Unclassified 747
337 Ga0097620_101845726 3300006931 Bacteria 668
338 Ga0075435_100000249 3300007076 Bacteria 33358
339 Ga0075435_100076092 3300007076 Bacteria 2750
340 Ga0075435_100777364 3300007076 Bacteria 833
341 Ga0075435_100915148 3300007076 Bacteria 765
342 Ga0099795_10526707 3300007788 Bacteria 554
343 Ga0105240_10174170 3300009093 Bacteria 2545
344 Ga0105240_11755750 3300009093 Unclassified 647
345 Ga0111539_10007483 3300009094 Bacteria 13983
346 Ga0111539_10108841 3300009094 Bacteria 3252
347 Ga0111539_10155806 3300009094 Bacteria 2673
348 Ga0111539_10517813 3300009094 Bacteria 1389
349 Ga0111539_11417318 3300009094 Unclassified 806
350 Ga0105245_10001445 3300009098 Bacteria 21558
351 Ga0105245_10051311 3300009098 Bacteria 3698
352 Ga0105247_10087908 3300009101 Unclassified 1969
353 Ga0105247_10186488 3300009101 Bacteria 1387
354 Ga0114129_10319521 3300009147 Bacteria 2064
355 Ga0114129_12713450 3300009147 Bacteria 590
356 Ga0105243_10109129 3300009148 Bacteria 2311
357 Ga0105243_10414498 3300009148 Bacteria 1254
358 Ga0105243_10880546 3300009148 Bacteria 889
359 Ga0105243_11829812 3300009148 Unclassified 639
360 Ga0105241_10705170 3300009174 Bacteria 922
361 Ga0105241_10890987 3300009174 Bacteria 826
362 Ga0105242_10013405 3300009176 Bacteria 6334
363 Ga0105242_10211994 3300009176 Bacteria 1727
364 Ga0105242_10505620 3300009176 Unclassified 1150
365 Ga0105248_10000527 3300009177 Bacteria 43614
366 Ga0105248_10027187 3300009177 Bacteria 6364
367 Ga0105248_10100182 3300009177 Bacteria 3265
368 Ga0105248_10437044 3300009177 Bacteria 1474
369 Ga0105248_10724865 3300009177 Bacteria 1122
370 Ga0105248_10839989 3300009177 Unclassified 1037
371 Ga0105237_10046451 3300009545 Bacteria 4368
372 Ga0105237_10818031 3300009545 Bacteria 938
373 Ga0105238_10000611 3300009551 Bacteria 37533
374 Ga0105238_10005684 3300009551 Bacteria 12325
375 Ga0105238_10033313 3300009551 Bacteria 5244
376 Ga0105238_10185840 3300009551 Bacteria 2054
377 Ga0105238_10896050 3300009551 Bacteria 905
378 Ga0105238_12070853 3300009551 Unclassified 603
379 Ga0105249_10010040 3300009553 Bacteria 8308
380 Ga0105249_10442023 3300009553 Bacteria 1338
381 Ga0105249_11085532 3300009553 Bacteria 870
382 Ga0105249_11661127 3300009553 Bacteria 711
383 Ga0105239_10029155 3300010375 Bacteria 6067
384 Ga0105239_10141350 3300010375 Bacteria 2682
385 Ga0105239_10258473 3300010375 Bacteria 1957
386 Ga0105239_10281619 3300010375 Bacteria 1872
387 Ga0105239_12639966 3300010375 Unclassified 586
388 Ga0157373_10103587 3300013100 Bacteria 2001
389 Ga0157373_10546426 3300013100 Bacteria 840
390 Ga0157371_10000292 3300013102 Bacteria 67427
391 Ga0157371_11181327 3300013102 Bacteria 589
392 Ga0157370_10009685 3300013104 Bacteria 10246
393 Ga0157370_10029514 3300013104 Bacteria 5379
394 Ga0157370_10719335 3300013104 Bacteria 911
395 Ga0157369_10010411 3300013105 Bacteria 10598
396 Ga0157369_10502231 3300013105 Bacteria 1255
397 Ga0157369_10535507 3300013105 Unclassified 1211
398 Ga0157374_10013385 3300013296 Bacteria 7162
399 Ga0157374_11093973 3300013296 Unclassified 817
400 Ga0157374_12777156 3300013296 Unclassified 517
401 Ga0157378_10001797 3300013297 Bacteria 19262
402 Ga0157378_10163430 3300013297 Unclassified 2083
403 Ga0157378_10553961 3300013297 Bacteria 1155
404 Ga0163162_10000436 3300013306 Bacteria 38515
405 Ga0163162_10006107 3300013306 Bacteria 11663
406 Ga0163162_10122220 3300013306 Bacteria 2708
407 Ga0163162_10131391 3300013306 Bacteria 2612
408 Ga0163162_10158958 3300013306 Unclassified 2381
409 Ga0163162_10691232 3300013306 Unclassified 1142
410 Ga0163162_12011677 3300013306 Unclassified 662
411 Ga0163162_12710285 3300013306 Unclassified 570
412 Ga0157372_10017154 3300013307 Bacteria 7773
413 Ga0157372_10207928 3300013307 Bacteria 2268
414 Ga0157372_10623924 3300013307 Unclassified 1256
415 Ga0157372_11623577 3300013307 Bacteria 744
416 Ga0157372_13267995 3300013307 Unclassified 517
417 Ga0157375_10000420 3300013308 Bacteria 38469
418 Ga0157375_10026193 3300013308 Bacteria 5431
419 Ga0157375_10068289 3300013308 Bacteria 3556
420 Ga0157375_13176851 3300013308 Unclassified 548
421 Ga0163163_10002143 3300014325 Bacteria 16673
422 Ga0157380_10159998 3300014326 Bacteria 1956
423 Ga0157380_10219948 3300014326 Bacteria 1698
424 Ga0157380_10284879 3300014326 Bacteria 1514
425 Ga0157380_11206854 3300014326 Unclassified 800
426 Ga0157380_11331631 3300014326 Bacteria 766
427 Ga0182008_10376884 3300014497 Bacteria 757
428 Ga0182008_10386642 3300014497 Bacteria 749
429 Ga0182008_10425803 3300014497 Bacteria 717
430 Ga0157377_10191894 3300014745 Bacteria 1292
431 Ga0157377_11012982 3300014745 Bacteria 630
432 Ga0157379_10000292 3300014968 Bacteria 39662
433 Ga0157379_10034650 3300014968 Bacteria 4502
434 Ga0157379_10272436 3300014968 Bacteria 1539
435 Ga0157379_10462117 3300014968 Unclassified 1173
436 Ga0157379_11329916 3300014968 Unclassified 695
437 Ga0157376_10000791 3300014969 Bacteria 20705
438 Ga0157376_10146042 3300014969 Bacteria 2127
439 Ga0182006_1000049 3300015261 Bacteria 184514
440 Ga0182007_10036195 3300015262 Bacteria 1661
441 Ga0182005_1030791 3300015265 Bacteria 1462
442 Ga0182005_1030792 3300015265 Bacteria 1462
443 Ga0163161_10028408 3300017792 Bacteria 3972
444 Ga0163161_10108528 3300017792 Bacteria 2073
445 Ga0213876_10439069 3300021384 Unclassified 694
446 Ga0207656_10197057 3300025321 Bacteria 972
447 Ga0207653_10005165 3300025885 Bacteria 4083
448 Ga0207653_10010271 3300025885 Bacteria 2920
449 Ga0207653_10012135 3300025885 Bacteria 2690
450 Ga0207692_10219628 3300025898 Unclassified 1126
451 Ga0207692_10334871 3300025898 Unclassified 929
452 Ga0207642_10083377 3300025899 Bacteria 1559
453 Ga0207642_10630676 3300025899 Bacteria 670
454 Ga0207688_10213344 3300025901 Bacteria 1161
455 Ga0207680_10000003 3300025903 Bacteria 925264
456 Ga0207680_10053657 3300025903 Bacteria 2421
457 Ga0207680_10161393 3300025903 Unclassified 1503
458 Ga0207680_10185893 3300025903 Bacteria 1408
459 Ga0207680_10269032 3300025903 Unclassified 1181
460 Ga0207647_10038770 3300025904 Bacteria 3011
461 Ga0207647_10224967 3300025904 Bacteria 1081
462 Ga0207685_10175729 3300025905 Bacteria 989
463 Ga0207699_10216550 3300025906 Bacteria 1305
464 Ga0207645_10056004 3300025907 Bacteria 2517
465 Ga0207645_10222385 3300025907 Bacteria 1245
466 Ga0207645_10411234 3300025907 Bacteria 911
467 Ga0207643_10499105 3300025908 Bacteria 778
468 Ga0207705_10007544 3300025909 Bacteria 7992
469 Ga0207684_10035743 3300025910 Unclassified 4218
470 Ga0207684_10616631 3300025910 Bacteria 926
471 Ga0207654_10177811 3300025911 Bacteria 1386
472 Ga0207707_10023231 3300025912 Bacteria 5425
473 Ga0207707_10072162 3300025912 Bacteria 3009
474 Ga0207707_10109222 3300025912 Bacteria 2418
475 Ga0207707_10281389 3300025912 Bacteria 1441
476 Ga0207707_10408092 3300025912 Bacteria 1166
477 Ga0207707_10452626 3300025912 Bacteria 1098
478 Ga0207695_11592731 3300025913 Bacteria 534
479 Ga0207671_10144733 3300025914 Unclassified 1833
480 Ga0207693_10779286 3300025915 Bacteria 738
481 Ga0207663_10258051 3300025916 Bacteria 1286
482 Ga0207660_10129400 3300025917 Bacteria 1920
483 Ga0207660_10223282 3300025917 Bacteria 1479
484 Ga0207660_10378352 3300025917 Bacteria 1138
485 Ga0207660_10521517 3300025917 Bacteria 965
486 Ga0207662_10011880 3300025918 Bacteria 4841
487 Ga0207662_10103569 3300025918 Bacteria 1766
488 Ga0207662_10108991 3300025918 Bacteria 1724
489 Ga0207662_10206758 3300025918 Bacteria 1273
490 Ga0207662_10898614 3300025918 Unclassified 627
491 Ga0207657_10003478 3300025919 Bacteria 16799
492 Ga0207657_10518713 3300025919 Bacteria 933
493 Ga0207649_10001011 3300025920 Bacteria 17366
494 Ga0207649_10233735 3300025920 Bacteria 1316
495 Ga0207649_10625185 3300025920 Bacteria 830
496 Ga0207649_10949747 3300025920 Unclassified 675
497 Ga0207652_10056235 3300025921 Bacteria 3387
498 Ga0207652_10065817 3300025921 Bacteria 3139
499 Ga0207652_10070235 3300025921 Bacteria 3041
500 Ga0207652_10328961 3300025921 Bacteria 1380
501 Ga0207652_10376149 3300025921 Bacteria 1282
502 Ga0207652_10404021 3300025921 Bacteria 1232
503 Ga0207646_10995919 3300025922 Bacteria 741
504 Ga0207681_10305930 3300025923 Bacteria 1259
505 Ga0207681_10406637 3300025923 Unclassified 1100
506 Ga0207681_10420889 3300025923 Unclassified 1082
507 Ga0207681_10754757 3300025923 Unclassified 811
508 Ga0207694_10000068 3300025924 Bacteria 126377
509 Ga0207694_10010911 3300025924 Bacteria 6862
510 Ga0207694_10030330 3300025924 Bacteria 4130
511 Ga0207694_10416605 3300025924 Bacteria 1119
512 Ga0207650_10090014 3300025925 Bacteria 2343
513 Ga0207650_10188911 3300025925 Unclassified 1645
514 Ga0207659_10006200 3300025926 Bacteria 7314
515 Ga0207659_10015205 3300025926 Unclassified 4981
516 Ga0207659_10023985 3300025926 Bacteria 4081
517 Ga0207659_10039841 3300025926 Bacteria 3281
518 Ga0207659_10079709 3300025926 Bacteria 2417
519 Ga0207659_10661458 3300025926 Unclassified 893
520 Ga0207659_11083482 3300025926 Bacteria 689
521 Ga0207659_11486313 3300025926 Unclassified 580
522 Ga0207687_10047547 3300025927 Bacteria 2975
523 Ga0207687_10730789 3300025927 Unclassified 842
524 Ga0207687_10963443 3300025927 Unclassified 731
525 Ga0207644_10001203 3300025931 Bacteria 16666
526 Ga0207644_10083771 3300025931 Bacteria 2362
527 Ga0207644_10125951 3300025931 Bacteria 1955
528 Ga0207644_10659163 3300025931 Unclassified 871
529 Ga0207690_10009415 3300025932 Bacteria 5802
530 Ga0207690_10127323 3300025932 Bacteria 1859
531 Ga0207706_10000040 3300025933 Bacteria 132285
532 Ga0207706_10065800 3300025933 Bacteria 3191
533 Ga0207706_10076423 3300025933 Bacteria 2945
534 Ga0207706_11452177 3300025933 Unclassified 561
535 Ga0207706_11689748 3300025933 Bacteria 510
536 Ga0207686_10194117 3300025934 Bacteria 1449
537 Ga0207686_11105453 3300025934 Unclassified 646
538 Ga0207709_10273281 3300025935 Bacteria 1245
539 Ga0207709_10868469 3300025935 Bacteria 732
540 Ga0207709_10912297 3300025935 Unclassified 714
541 Ga0207670_10017620 3300025936 Bacteria 4320
542 Ga0207670_10081405 3300025936 Bacteria 2266
543 Ga0207670_10098407 3300025936 Unclassified 2084
544 Ga0207670_10163888 3300025936 Bacteria 1662
545 Ga0207670_10259758 3300025936 Bacteria 1346
546 Ga0207670_10270063 3300025936 Bacteria 1322
547 Ga0207669_10267572 3300025937 Bacteria 1282
548 Ga0207669_10383878 3300025937 Bacteria 1095
549 Ga0207669_10685964 3300025937 Unclassified 841
550 Ga0207669_11019009 3300025937 Unclassified 696
551 Ga0207704_10110379 3300025938 Bacteria 1858
552 Ga0207704_11227510 3300025938 Unclassified 640
553 Ga0207704_11796233 3300025938 Bacteria 527
554 Ga0207691_10005503 3300025940 Bacteria 12239
555 Ga0207691_10009766 3300025940 Bacteria 9212
556 Ga0207691_10084045 3300025940 Bacteria 2858
557 Ga0207691_10362045 3300025940 Bacteria 1240
558 Ga0207691_10530604 3300025940 Unclassified 999
559 Ga0207691_10708905 3300025940 Unclassified 848
560 Ga0207691_11531999 3300025940 Bacteria 544
561 Ga0207711_10003479 3300025941 Bacteria 13621
562 Ga0207711_10047042 3300025941 Bacteria 3687
563 Ga0207711_10133561 3300025941 Bacteria 2227
564 Ga0207711_10218595 3300025941 Bacteria 1742
565 Ga0207711_10235760 3300025941 Bacteria 1677
566 Ga0207689_10086869 3300025942 Bacteria 2570
567 Ga0207689_10121204 3300025942 Bacteria 2151
568 Ga0207689_10248375 3300025942 Bacteria 1471
569 Ga0207689_10271195 3300025942 Bacteria 1405
570 Ga0207689_10367852 3300025942 Bacteria 1196
571 Ga0207689_10388023 3300025942 Bacteria 1163
572 Ga0207689_10870802 3300025942 Bacteria 760
573 Ga0207661_10168536 3300025944 Bacteria 1905
574 Ga0207679_10003236 3300025945 Bacteria 10047
575 Ga0207679_10073377 3300025945 Bacteria 2589
576 Ga0207679_10090961 3300025945 Bacteria 2360
577 Ga0207679_10340459 3300025945 Bacteria 1304
578 Ga0207679_10718651 3300025945 Bacteria 907
579 Ga0207679_10719935 3300025945 Unclassified 906
580 Ga0207667_10003220 3300025949 Bacteria 20159
581 Ga0207667_10010861 3300025949 Bacteria 10618
582 Ga0207667_10026526 3300025949 Bacteria 6327
583 Ga0207651_10004091 3300025960 Bacteria 7276
584 Ga0207651_10122559 3300025960 Bacteria 1974
585 Ga0207651_10323955 3300025960 Unclassified 1289
586 Ga0207651_11186129 3300025960 Bacteria 685
587 Ga0207712_10013035 3300025961 Bacteria 5326
588 Ga0207712_10249321 3300025961 Bacteria 1434
589 Ga0207712_10633318 3300025961 Bacteria 928
590 Ga0207712_10778802 3300025961 Bacteria 840
591 Ga0207712_10938756 3300025961 Unclassified 766
592 Ga0207668_10079587 3300025972 Bacteria 2371
593 Ga0207668_10130222 3300025972 Bacteria 1920
594 Ga0207668_10213493 3300025972 Bacteria 1545
595 Ga0207668_10240663 3300025972 Bacteria 1464
596 Ga0207668_10538979 3300025972 Bacteria 1009
597 Ga0207640_10424231 3300025981 Bacteria 1089
598 Ga0207640_10798763 3300025981 Bacteria 817
599 Ga0207658_10014896 3300025986 Bacteria 5329
600 Ga0207658_10080511 3300025986 Bacteria 2495
601 Ga0207658_11670726 3300025986 Unclassified 582
602 Ga0207658_11709860 3300025986 Unclassified 575
603 Ga0207658_12132399 3300025986 Unclassified 509
604 Ga0207677_10104633 3300026023 Bacteria 2092
605 Ga0207677_10155430 3300026023 Bacteria 1771
606 Ga0207677_10159653 3300026023 Bacteria 1750
607 Ga0207677_10304483 3300026023 Bacteria 1318
608 Ga0207677_10673615 3300026023 Unclassified 915
609 Ga0207703_10037133 3300026035 Bacteria 3881
610 Ga0207703_10063042 3300026035 Bacteria 3038
611 Ga0207703_10339289 3300026035 Bacteria 1381
612 Ga0207703_10381154 3300026035 Unclassified 1304
613 Ga0207703_10726823 3300026035 Bacteria 945
614 Ga0207703_11474475 3300026035 Unclassified 655
615 Ga0207703_11491796 3300026035 Bacteria 650
616 Ga0207703_11799577 3300026035 Bacteria 589
617 Ga0207639_10025024 3300026041 Bacteria 4326
618 Ga0207639_10502470 3300026041 Bacteria 1108
619 Ga0207639_10654616 3300026041 Unclassified 972
620 Ga0207639_11133301 3300026041 Bacteria 734
621 Ga0207678_10816170 3300026067 Unclassified 824
622 Ga0207708_10019180 3300026075 Bacteria 5151
623 Ga0207708_10035470 3300026075 Bacteria 3795
624 Ga0207708_10069118 3300026075 Bacteria 2704
625 Ga0207708_10345598 3300026075 Bacteria 1219
626 Ga0207708_10412434 3300026075 Unclassified 1119
627 Ga0207708_10469516 3300026075 Unclassified 1050
628 Ga0207708_10983287 3300026075 Bacteria 733
629 Ga0207702_10079906 3300026078 Bacteria 2836
630 Ga0207702_10156062 3300026078 Bacteria 2080
631 Ga0207702_12069344 3300026078 Bacteria 559
632 Ga0207641_10001943 3300026088 Bacteria 19841
633 Ga0207641_10324202 3300026088 Bacteria 1461
634 Ga0207641_10973840 3300026088 Bacteria 844
635 Ga0207641_11104943 3300026088 Unclassified 791
636 Ga0207641_12202321 3300026088 Bacteria 551
637 Ga0207648_10011132 3300026089 Bacteria 8485
638 Ga0207648_10011648 3300026089 Bacteria 8278
639 Ga0207648_10664151 3300026089 Bacteria 964
640 Ga0207648_11351901 3300026089 Unclassified 669
641 Ga0207648_11789152 3300026089 Unclassified 576
642 Ga0207676_10048887 3300026095 Bacteria 3286
643 Ga0207676_10415739 3300026095 Bacteria 1260
644 Ga0207676_10436550 3300026095 Unclassified 1231
645 Ga0207676_10701575 3300026095 Bacteria 980
646 Ga0207676_12317861 3300026095 Bacteria 534
647 Ga0207676_12334943 3300026095 Unclassified 532
648 Ga0207674_10002747 3300026116 Bacteria 21950
649 Ga0207674_10034136 3300026116 Bacteria 5321
650 Ga0207674_10049854 3300026116 Bacteria 4279
651 Ga0207674_10210991 3300026116 Unclassified 1891
652 Ga0207674_10304981 3300026116 Bacteria 1541
653 Ga0207674_10498547 3300026116 Unclassified 1176
654 Ga0207675_100001083 3300026118 Bacteria 26980
655 Ga0207675_100049015 3300026118 Bacteria 3943
656 Ga0207675_100089160 3300026118 Bacteria 2898
657 Ga0207675_101159567 3300026118 Bacteria 793
658 Ga0207675_102337699 3300026118 Unclassified 548
659 Ga0207683_10100572 3300026121 Bacteria 2581
660 Ga0207683_10264867 3300026121 Bacteria 1569
661 Ga0207683_11393707 3300026121 Unclassified 648
662 Ga0207698_10027355 3300026142 Bacteria 4047
663 Ga0207698_10158064 3300026142 Bacteria 1978
664 Ga0207698_10223423 3300026142 Bacteria 1704
665 Ga0207698_10275305 3300026142 Bacteria 1554
666 Ga0207698_10653752 3300026142 Bacteria 1042
667 Ga0209969_1039443 3300027360 Bacteria 731
668 Ga0209967_1023655 3300027364 Bacteria 905
669 Ga0209996_1022530 3300027395 Bacteria 891
670 Ga0209996_1063784 3300027395 Bacteria 568
671 Ga0209984_1006490 3300027424 Bacteria 1435
672 Ga0209984_1011020 3300027424 Bacteria 1167
673 Ga0209982_1003304 3300027552 Bacteria 2287
674 Ga0209982_1030509 3300027552 Bacteria 847
675 Ga0209970_1044969 3300027614 Bacteria 791
676 Ga0209983_1004970 3300027665 Bacteria 2778
677 Ga0209971_1051660 3300027682 Bacteria 993
678 Ga0209998_10001424 3300027717 Bacteria 5791
679 Ga0209998_10012232 3300027717 Bacteria 1782
680 Ga0209813_10364280 3300027866 Unclassified 575
681 Ga0209974_10008144 3300027876 Bacteria 3589
682 Ga0209974_10020177 3300027876 Bacteria 2209
683 Ga0207428_10031609 3300027907 Bacteria 4365
684 Ga0207428_10149621 3300027907 Bacteria 1777
685 Ga0268266_10000011 3300028379 Bacteria 757403
686 Ga0268266_10183825 3300028379 Bacteria 1905
687 Ga0268265_10006006 3300028380 Bacteria 8260
688 Ga0268265_10048973 3300028380 Bacteria 3175
689 Ga0268265_10080616 3300028380 Bacteria 2567
690 Ga0268265_10559621 3300028380 Unclassified 1087
691 Ga0268265_10726508 3300028380 Unclassified 962
692 Ga0268265_10779522 3300028380 Bacteria 930
693 Ga0268265_11879733 3300028380 Unclassified 605
694 Ga0268264_10003700 3300028381 Bacteria 13128
695 Ga0268264_10005822 3300028381 Bacteria 10448
696 Ga0268264_10045472 3300028381 Bacteria 3644
697 Ga0268264_10070313 3300028381 Bacteria 2963
698 Ga0268264_10175839 3300028381 Bacteria 1940
699 Ga0268264_10464210 3300028381 Bacteria 1229
700 Ga0268264_11174508 3300028381 Bacteria 777
701 Ga0307408_101371002 3300031548 Unclassified 665
702 Ga0307410_11429435 3300031852 Unclassified 608
703 Ga0307416_103265362 3300032002 Bacteria 543
704 Ga0307415_102235173 3300032126 Bacteria 536
705 Ga0307510_10005162 3300033180 Bacteria 15516
706 Ga0307510_10039726 3300033180 Bacteria 5178
707 Ga0373926_0005105 3300035083 Bacteria 4310
708 Ga0373926_0332509 3300035083 Bacteria 595
709 Ga0373929_0023690 3300035085 Bacteria 1263
710 Ga0373929_0056945 3300035085 Bacteria 907
711 Ga0373940_0183855 3300035088 Bacteria 681
712 Ga0373940_0296423 3300035088 Bacteria 556
713 Ga0373944_0046463 3300035089 Bacteria 1357
714 Ga0373932_0217833 3300035112 Bacteria 685
715 Ga0373936_0004621 3300035113 Bacteria 5209
716 Ga0373936_0105502 3300035113 Bacteria 1192
717 Ga0373941_0393208 3300035115 Unclassified 572
718 Ga0373945_0157089 3300035116 Bacteria 925
719 Ga0373960_0257344 3300035121 Unclassified 636
720 Ga0373943_0007551 3300035170 Bacteria 4883
721 Ga0373943_0012517 3300035170 Bacteria 3822
722 Ga0373943_0040632 3300035170 Bacteria 2246
723 Ga0373942_0012462 3300035207 Bacteria 2031
724 Ga0373961_0187249 3300035241 Bacteria 724
725 Ga0373961_0285438 3300035241 Bacteria 607
726 Ga0373931_0051612 3300035691 Bacteria 2191
727 Ga0373931_0094161 3300035691 Bacteria 1674
728 Ga0373931_0161305 3300035691 Bacteria 1314
729 Ga0373931_0496539 3300035691 Bacteria 786
730 Ga0373935_0034779 3300035692 Bacteria 3142
731 Ga0373935_0138236 3300035692 Bacteria 1643
732 Ga0373927_0007467 3300035695 Bacteria 7393
733 Ga0373927_0087291 3300035695 Bacteria 2025
734 Ga0373927_0569921 3300035695 Bacteria 748
735 Ga0373947_0026159 3300035725 Bacteria 3407
736 Ga0373947_0026474 3300035725 Bacteria 3390
737 Ga0373947_0031034 3300035725 Bacteria 3142
738 Ga0373947_0472494 3300035725 Bacteria 850
739 Ga0373937_0217938 3300036401 Bacteria 1796
740 Ga0373925_0010664 3300037068 Bacteria 6664
741 Ga0373925_0058273 3300037068 Bacteria 2896
742 Ga0395898_1200643 3300037466 Unclassified 690
743 Ga0436364_0341842 3300037853 Bacteria 520
744 Ga0436365_0731537 3300039437 Unclassified 673
745 Ga0451795_0174589 3300041456 Bacteria 1627
746 Ga0451845_0152272 3300041501 Unclassified 634
747 Ga0451853_1856925 3300041512 Bacteria 567
748 Ga0451853_2507703 3300041512 Bacteria 634
749 Ga0439441_101259 3300042001 Unclassified 646
750 Ga0439448_0134438 3300042005 Bacteria 854
751 Ga0439455_0199467 3300042012 Bacteria 579
752 Ga0439458_0209334 3300042157 Bacteria 535
753 Ga0439435_0174198 3300042436 Bacteria 700
754 Ga0451577_0097039 3300042876 Bacteria 2632
755 Ga0451577_0126210 3300042876 Bacteria 2293
756 Ga0466969_0211540 3300044656 Unclassified 883
757 Ga0466961_0214584 3300044693 Unclassified 1187
758 Ga0466963_0311464 3300044694 Bacteria 1108
759 Ga0466964_0206973 3300044706 Bacteria 945
760 Ga0453684_1020152 3300044712 Bacteria 879
761 Ga0453684_1662365 3300044712 Unclassified 653
762 Ga0466970_0598883 3300044765 Unclassified 639
763 Ga0466957_0855852 3300044842 Bacteria 648
764 Ga0451576_0061365 3300045051 Bacteria 3920
765 Ga0451576_0092226 3300045051 Bacteria 3150
766 Ga0451576_0582779 3300045051 Bacteria 1175
767 Ga0451576_0836213 3300045051 Bacteria 966
768 Ga0451576_1059929 3300045051 Bacteria 849
769 Ga0466967_0078056 3300045976 Bacteria 2982
770 Ga0495603_0309940 3300046455 Bacteria 906
771 Ga0495638_0123666 3300046460 Bacteria 1526
772 Ga0495650_0000724 3300046471 Bacteria 41841
773 Ga0495650_0000912 3300046471 Bacteria 34832
774 Ga0495650_0010534 3300046471 Bacteria 5150
775 Ga0495580_0000432 3300046472 Bacteria 34580
776 Ga0495582_0024878 3300046473 Bacteria 3279
777 Ga0495584_0007234 3300046491 Bacteria 5792
778 Ga0495585_0001003 3300046492 Bacteria 23550
779 Ga0495607_0000002 3300046501 Bacteria 414833
780 Ga0495606_0000333 3300046507 Bacteria 81527
781 Ga0495606_0009282 3300046507 Bacteria 8347
782 Ga0495610_0120007 3300046512 Bacteria 1153
783 Ga0495616_0000001 3300046513 Bacteria 780061
784 Ga0495620_0000401 3300046515 Bacteria 28963
785 Ga0495628_0001076 3300046516 Bacteria 25062
786 Ga0495631_0000410 3300046518 Bacteria 29585
787 Ga0495632_0000003 3300046519 Bacteria 396071
788 Ga0495632_0004605 3300046519 Bacteria 9337
789 Ga0495632_0013771 3300046519 Bacteria 4600
790 Ga0495648_0009496 3300046524 Bacteria 7523
791 Ga0495666_0010381 3300046526 Bacteria 4642
792 Ga0495642_0229807 3300046528 Bacteria 810
793 Ga0495665_0170293 3300046531 Bacteria 1134
794 Ga0495586_0018234 3300046535 Bacteria 3736
795 Ga0495598_0011875 3300046537 Bacteria 2122
796 Ga0495656_0012406 3300046615 Bacteria 3144
797 Ga0495668_0015436 3300046616 Bacteria 4459
798 Ga0495634_0691931 3300046642 Unclassified 587
799 Ga0495611_0000008 3300046648 Bacteria 218134
800 Ga0495625_0003154 3300046660 Bacteria 16790
801 Ga0495625_0304637 3300046660 Bacteria 1018
802 Ga0495647_0004038 3300046681 Bacteria 4739
803 Ga0495658_0028461 3300046683 Bacteria 3017
804 Ga0495670_0170698 3300046691 Bacteria 1145
805 Ga0495660_0000009 3300046810 Bacteria 427395
806 Ga0495581_0028165 3300047315 Bacteria 3257
807 Ga0495636_0117749 3300047318 Bacteria 1173
808 Ga0495676_0024633 3300047321 Bacteria 5206
809 Ga0495683_0020056 3300047323 Bacteria 3449
810 Ga0495673_0000001 3300047469 Bacteria 1630730
811 Ga0495673_0000030 3300047469 Bacteria 468915
812 Ga0495686_0000077 3300047472 Bacteria 205924
813 Ga0495686_0005194 3300047472 Bacteria 10368
814 Ga0495686_0017160 3300047472 Bacteria 4886
815 Ga0496100_0020465 3300048903 Bacteria 3967
816 Ga0496100_0026869 3300048903 Bacteria 3534
817 Ga0496100_0160018 3300048903 Unclassified 1613
818 Ga0496101_0001666 3300048904 Bacteria 13336
819 Ga0496101_0074238 3300048904 Bacteria 2501
820 Ga0496101_0194066 3300048904 Bacteria 1568
821 Ga0496102_0002744 3300048905 Bacteria 15010
822 Ga0496102_0011114 3300048905 Bacteria 7755
823 Ga0496102_0012607 3300048905 Bacteria 7323
824 Ga0496102_0717489 3300048905 Bacteria 923
825 Ga0496102_1756648 3300048905 Bacteria 538
826 Ga0496103_0078203 3300048906 Bacteria 2077
827 Ga0496103_0127038 3300048906 Bacteria 1626
828 Ga0496105_0133554 3300048908 Bacteria 2045
829 Ga0496106_0002229 3300048909 Bacteria 14454
830 Ga0496106_0005702 3300048909 Bacteria 9209
831 Ga0496106_0029054 3300048909 Bacteria 4119
832 Ga0496106_0195586 3300048909 Bacteria 1608
833 Ga0496106_1138456 3300048909 Bacteria 610
834 Ga0496107_0002621 3300048910 Bacteria 11756
835 Ga0496107_0010881 3300048910 Bacteria 6330
836 Ga0496107_0106352 3300048910 Bacteria 2061
837 Ga0496107_0170373 3300048910 Bacteria 1615
838 Ga0496107_0185159 3300048910 Bacteria 1546
839 Ga0496108_0009040 3300048911 Bacteria 8072
840 Ga0496108_0115156 3300048911 Bacteria 2302
841 Ga0496108_0130664 3300048911 Bacteria 2159
842 Ga0496108_0332096 3300048911 Bacteria 1326
843 Ga0496108_1333691 3300048911 Unclassified 602
844 Ga0496109_0001784 3300048912 Bacteria 17897
845 Ga0496109_0696808 3300048912 Bacteria 953
846 Ga0496109_0920074 3300048912 Bacteria 812
847 Ga0496109_1062092 3300048912 Unclassified 747
848 Ga0496110_0034991 3300048913 Bacteria 4355
849 Ga0496110_0797142 3300048913 Bacteria 849
850 Ga0496110_0974685 3300048913 Unclassified 755
851 Ga0496111_0022218 3300048914 Bacteria 4438
852 Ga0496112_0051471 3300048915 Bacteria 4040
853 Ga0496113_0091981 3300048916 Bacteria 2339
854 Ga0496114_0265278 3300048917 Bacteria 1513
855 Ga0496114_0314183 3300048917 Unclassified 1384
856 Ga0496114_0712885 3300048917 Unclassified 879
857 Ga0496115_0082573 3300048918 Bacteria 2618
858 Ga0496115_0255087 3300048918 Bacteria 1443
859 Ga0496115_0278581 3300048918 Unclassified 1373
860 Ga0496115_0489199 3300048918 Bacteria 990
861 Ga0496118_0111732 3300048921 Bacteria 1811
862 Ga0496118_0138419 3300048921 Bacteria 1549
863 Ga0496121_0000368 3300048924 Bacteria 92730
864 Ga0496121_0000390 3300048924 Bacteria 89674
865 Ga0496121_0078690 3300048924 Bacteria 2620
866 Ga0496121_0338478 3300048924 Unclassified 1006
867 Ga0496122_0035640 3300048925 Bacteria 4042
868 Ga0496123_0020397 3300048926 Bacteria 5186
869 Ga0496123_0504644 3300048926 Bacteria 528
870 Ga0496124_0064399 3300048927 Bacteria 3060
871 Ga0496125_0026949 3300048928 Bacteria 5219
872 Ga0496126_0009926 3300048929 Bacteria 10051
873 Ga0496126_0026115 3300048929 Bacteria 5606
874 Ga0496126_0061821 3300048929 Bacteria 3362
875 Ga0496126_0901836 3300048929 Unclassified 670
876 Ga0501039_0344397 3300049575 Bacteria 1171
877 Ga0501039_1588599 3300049575 Bacteria 502
878 Ga0501067_0028799 3300049583 Bacteria 3078
879 Ga0501069_0717591 3300049585 Bacteria 604
880 Ga0501072_0238289 3300049588 Bacteria 1449
881 Ga0501045_1417356 3300049824 Bacteria 504
882 nmdc:mga03n38_7495_c1 3300050490 Bacteria 3864
883 nmdc:mga0yw44_56564_c1 3300050492 Bacteria 2390
884 nmdc:mga06z11_606569_c1 3300050494 Unclassified 666
885 nmdc:mga05p37_2198907_c1 3300050507 Unclassified 512
886 nmdc:mga05p37_264431_c1 3300050507 Bacteria 2057
887 nmdc:mga09592_16816_c1 3300050508 Bacteria 5987
888 nmdc:mga09592_793621_c1 3300050508 Archaea 801
889 nmdc:mga09592_91338_c1 3300050508 Bacteria 2602
890 nmdc:mga0qj67_213444_c1 3300050509 Bacteria 1567
891 nmdc:mga0qj67_25908_c1 3300050509 Unclassified 4536
892 nmdc:mga06r32_620395_c1 3300050510 Bacteria 1051
893 nmdc:mga06r32_65621_c1 3300050510 Bacteria 3501
894 nmdc:mga06r32_8403_c1 3300050510 Bacteria 9300
895 nmdc:mga06r32_926097_c1 3300050510 Bacteria 827
896 nmdc:mga08y16_43202_c1 3300050511 Bacteria 4722
897 nmdc:mga08y16_447805_c1 3300050511 Bacteria 1317
898 nmdc:mga08y16_513385_c1 3300050511 Bacteria 1216
899 nmdc:mga08y16_596211_c1 3300050511 Bacteria 1114
900 nmdc:mga08y16_85745_c1 3300050511 Bacteria 3282
901 nmdc:mga0n895_1598914_c1 3300050512 Bacteria 616
902 nmdc:mga0n895_58924_c1 3300050512 Bacteria 3788
903 nmdc:mga0n895_68896_c1 3300050512 Bacteria 3505
904 nmdc:mga0n895_933456_c1 3300050512 Bacteria 852
905 nmdc:mga0n895_956145_c1 3300050512 Bacteria 840
906 nmdc:mga0rr50_384824_c1 3300050513 Archaea 1183
907 nmdc:mga0rr50_452472_c1 3300050513 Bacteria 1089
908 nmdc:mga08x19_1634_c1 3300050514 Bacteria 13867
909 nmdc:mga0a205_13067_c1 3300050515 Bacteria 7711
910 nmdc:mga0a205_428461_c1 3300050515 Bacteria 1184
911 nmdc:mga0a205_821288_c1 3300050515 Unclassified 777
912 Ga0500646_0015830 3300053090 Bacteria 1966
913 Ga0500568_0029049 3300053139 Bacteria 2299
914 Ga0500616_0109048 3300053153 Unclassified 1340
915 Ga0500633_0039139 3300053160 Bacteria 1583
916 Ga0590077_019746 3300059426 Bacteria 1429

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100619867 Ga0070714_1006198672 92
2 3300025912 Ga0207707_10408092 Ga0207707_104080922 92
3 3300025924 Ga0207694_10416605 Ga0207694_104166052 92
4 3300026116 Ga0207674_10002747 Ga0207674_1000274719 92
5 3300037466 Ga0395898_1200643 Ga0395898_1200643_19_330 92
6 3300005335 Ga0070666_11354917 Ga0070666_113549172 94
7 3300005355 Ga0070671_100000445 Ga0070671_1000004455 94
8 3300005841 Ga0068863_100153344 Ga0068863_1001533442 94
9 3300014326 Ga0157380_10284879 Ga0157380_102848793 94
10 3300025931 Ga0207644_10001203 Ga0207644_100012035 94
11 3300006163 Ga0070715_10915635 Ga0070715_109156352 97
12 3300007076 Ga0075435_100915148 Ga0075435_1009151482 97
13 3300025905 Ga0207685_10175729 Ga0207685_101757292 97
14 3300035085 Ga0373929_0023690 Ga0373929_0023690_901_1215 97
15 3300045051 Ga0451576_0092226 Ga0451576_0092226_1813_2127 97
16 3300048911 Ga0496108_0130664 Ga0496108_0130664_1813_2148 97
17 3300026118 Ga0207675_102337699 Ga0207675_1023376992 98
18 3300049585 Ga0501069_0717591 Ga0501069_0717591_228_536 98
19 3300004801 Ga0058860_12217052 Ga0058860_122170521 99
20 3300005327 Ga0070658_11137813 Ga0070658_111378132 99
21 3300005330 Ga0070690_100000584 Ga0070690_1000005841 99
22 3300005334 Ga0068869_100103078 Ga0068869_1001030783 99
23 3300005336 Ga0070680_100040141 Ga0070680_1000401413 99
24 3300005338 Ga0068868_100002180 Ga0068868_1000021805 99
25 3300005340 Ga0070689_100003146 Ga0070689_1000031462 99
26 3300005341 Ga0070691_11013767 Ga0070691_110137671 99
27 3300005343 Ga0070687_100048364 Ga0070687_1000483642 99
28 3300005345 Ga0070692_10013994 Ga0070692_100139945 99
29 3300005347 Ga0070668_101648042 Ga0070668_1016480422 99
30 3300005354 Ga0070675_100951566 Ga0070675_1009515662 99
31 3300005354 Ga0070675_102178177 Ga0070675_1021781771 99
32 3300005406 Ga0070703_10013905 Ga0070703_100139052 99
33 3300005440 Ga0070705_100994044 Ga0070705_1009940441 99
34 3300005444 Ga0070694_100001106 Ga0070694_10000110617 99
35 3300005444 Ga0070694_100167598 Ga0070694_1001675982 99
36 3300005458 Ga0070681_10477434 Ga0070681_104774342 99
37 3300005459 Ga0068867_100024059 Ga0068867_1000240595 99
38 3300005459 Ga0068867_100193293 Ga0068867_1001932933 99
39 3300005530 Ga0070679_100470283 Ga0070679_1004702832 99
40 3300005530 Ga0070679_101080606 Ga0070679_1010806062 99
41 3300005543 Ga0070672_101389598 Ga0070672_1013895982 99
42 3300005544 Ga0070686_100002108 Ga0070686_1000021082 99
43 3300005545 Ga0070695_100000295 Ga0070695_1000002952 99
44 3300005546 Ga0070696_100011350 Ga0070696_1000113502 99
45 3300005547 Ga0070693_100006341 Ga0070693_1000063415 99
46 3300005549 Ga0070704_100460895 Ga0070704_1004608951 99
47 3300005577 Ga0068857_100050892 Ga0068857_1000508923 99
48 3300005615 Ga0070702_100004748 Ga0070702_1000047482 99
49 3300005615 Ga0070702_101649899 Ga0070702_1016498992 99
50 3300005616 Ga0068852_100135922 Ga0068852_1001359222 99
51 3300005617 Ga0068859_101845690 Ga0068859_1018456902 99
52 3300005718 Ga0068866_10108422 Ga0068866_101084221 99
53 3300005841 Ga0068863_101298027 Ga0068863_1012980272 99
54 3300005842 Ga0068858_100007255 Ga0068858_1000072551 99
55 3300005843 Ga0068860_100131036 Ga0068860_1001310362 99
56 3300005844 Ga0068862_100247405 Ga0068862_1002474051 99
57 3300005844 Ga0068862_101538239 Ga0068862_1015382392 99
58 3300006237 Ga0097621_100001291 Ga0097621_1000012918 99
59 3300006358 Ga0068871_100014810 Ga0068871_1000148105 99
60 3300006847 Ga0075431_101126274 Ga0075431_1011262742 99
61 3300006880 Ga0075429_101148496 Ga0075429_1011484962 99
62 3300006881 Ga0068865_100081775 Ga0068865_1000817752 99
63 3300006931 Ga0097620_101845726 Ga0097620_1018457262 99
64 3300009098 Ga0105245_10001445 Ga0105245_1000144526 99
65 3300009148 Ga0105243_10414498 Ga0105243_104144981 99
66 3300009174 Ga0105241_10890987 Ga0105241_108909871 99
67 3300009176 Ga0105242_10013405 Ga0105242_100134052 99
68 3300009177 Ga0105248_10724865 Ga0105248_107248652 99
69 3300009551 Ga0105238_10896050 Ga0105238_108960501 99
70 3300009553 Ga0105249_11085532 Ga0105249_110855321 99
71 3300013105 Ga0157369_10535507 Ga0157369_105355072 99
72 3300013297 Ga0157378_10001797 Ga0157378_1000179724 99
73 3300013307 Ga0157372_13267995 Ga0157372_132679951 99
74 3300014745 Ga0157377_10191894 Ga0157377_101918942 99
75 3300014969 Ga0157376_10000791 Ga0157376_100007914 99
76 3300025885 Ga0207653_10012135 Ga0207653_100121354 99
77 3300025898 Ga0207692_10219628 Ga0207692_102196282 99
78 3300025899 Ga0207642_10083377 Ga0207642_100833772 99
79 3300025904 Ga0207647_10224967 Ga0207647_102249672 99
80 3300025912 Ga0207707_10452626 Ga0207707_104526262 99
81 3300025917 Ga0207660_10223282 Ga0207660_102232822 99
82 3300025918 Ga0207662_10011880 Ga0207662_100118805 99
83 3300025921 Ga0207652_10070235 Ga0207652_100702354 99
84 3300025927 Ga0207687_10047547 Ga0207687_100475474 99
85 3300025934 Ga0207686_10194117 Ga0207686_101941172 99
86 3300025938 Ga0207704_10110379 Ga0207704_101103792 99
87 3300025941 Ga0207711_10235760 Ga0207711_102357602 99
88 3300025942 Ga0207689_10121204 Ga0207689_101212042 99
89 3300025944 Ga0207661_10168536 Ga0207661_101685362 99
90 3300025961 Ga0207712_10778802 Ga0207712_107788021 99
91 3300026023 Ga0207677_10155430 Ga0207677_101554302 99
92 3300026075 Ga0207708_10345598 Ga0207708_103455981 99
93 3300026088 Ga0207641_12202321 Ga0207641_122023211 99
94 3300026089 Ga0207648_10011648 Ga0207648_100116488 99
95 3300026118 Ga0207675_101159567 Ga0207675_1011595672 99
96 3300026142 Ga0207698_10275305 Ga0207698_102753052 99
97 3300028381 Ga0268264_10003700 Ga0268264_100037005 99
98 3300028381 Ga0268264_11174508 Ga0268264_111745082 99
99 3300035083 Ga0373926_0005105 Ga0373926_0005105_1998_2309 99
100 3300035083 Ga0373926_0332509 Ga0373926_0332509_51_362 99
101 3300035085 Ga0373929_0056945 Ga0373929_0056945_382_693 99
102 3300035089 Ga0373944_0046463 Ga0373944_0046463_353_664 99
103 3300035112 Ga0373932_0217833 Ga0373932_0217833_265_576 99
104 3300035113 Ga0373936_0004621 Ga0373936_0004621_2710_3021 99
105 3300035113 Ga0373936_0105502 Ga0373936_0105502_108_419 99
106 3300035116 Ga0373945_0157089 Ga0373945_0157089_354_665 99
107 3300035170 Ga0373943_0007551 Ga0373943_0007551_1732_2043 99
108 3300035170 Ga0373943_0012517 Ga0373943_0012517_590_901 99
109 3300035170 Ga0373943_0040632 Ga0373943_0040632_1286_1597 99
110 3300035241 Ga0373961_0187249 Ga0373961_0187249_63_374 99
111 3300035691 Ga0373931_0161305 Ga0373931_0161305_949_1260 99
112 3300035691 Ga0373931_0496539 Ga0373931_0496539_406_717 99
113 3300035692 Ga0373935_0034779 Ga0373935_0034779_2502_2813 99
114 3300035692 Ga0373935_0138236 Ga0373935_0138236_218_529 99
115 3300035695 Ga0373927_0007467 Ga0373927_0007467_7052_7363 99
116 3300035695 Ga0373927_0087291 Ga0373927_0087291_344_655 99
117 3300035695 Ga0373927_0569921 Ga0373927_0569921_351_662 99
118 3300035725 Ga0373947_0026159 Ga0373947_0026159_2711_3022 99
119 3300035725 Ga0373947_0026474 Ga0373947_0026474_2542_2853 99
120 3300035725 Ga0373947_0031034 Ga0373947_0031034_2699_3010 99
121 3300035725 Ga0373947_0472494 Ga0373947_0472494_377_688 99
122 3300036401 Ga0373937_0217938 Ga0373937_0217938_475_783 99
123 3300037068 Ga0373925_0010664 Ga0373925_0010664_3955_4266 99
124 3300037068 Ga0373925_0058273 Ga0373925_0058273_663_974 99
125 3300042436 Ga0439435_0174198 Ga0439435_0174198_83_412 99
126 3300046455 Ga0495603_0309940 Ga0495603_0309940_460_771 99
127 3300046472 Ga0495580_0000432 Ga0495580_0000432_25668_25979 99
128 3300046473 Ga0495582_0024878 Ga0495582_0024878_2173_2484 99
129 3300046526 Ga0495666_0010381 Ga0495666_0010381_3325_3636 99
130 3300046531 Ga0495665_0170293 Ga0495665_0170293_205_516 99
131 3300046535 Ga0495586_0018234 Ga0495586_0018234_3412_3723 99
132 3300046537 Ga0495598_0011875 Ga0495598_0011875_710_1021 99
133 3300046615 Ga0495656_0012406 Ga0495656_0012406_390_701 99
134 3300046681 Ga0495647_0004038 Ga0495647_0004038_3436_3747 99
135 3300046683 Ga0495658_0028461 Ga0495658_0028461_1204_1515 99
136 3300047315 Ga0495581_0028165 Ga0495581_0028165_168_479 99
137 3300047321 Ga0495676_0024633 Ga0495676_0024633_1170_1481 99
138 3300050510 nmdc:mga06r32_926097_c1 nmdc:mga06r32_926097_c1_85_396 99
139 3300050511 nmdc:mga08y16_596211_c1 nmdc:mga08y16_596211_c1_679_1005 99
140 3300000044 ARSoilOldRDRAFT_c017047 ARSoilOldRDRAFT_0170472 100
141 3300004798 Ga0058859_10049305 Ga0058859_100493052 100
142 3300005295 Ga0065707_10052148 Ga0065707_100521482 100
143 3300005330 Ga0070690_100070176 Ga0070690_1000701762 100
144 3300005330 Ga0070690_100077402 Ga0070690_1000774021 100
145 3300005331 Ga0070670_100222839 Ga0070670_1002228392 100
146 3300005334 Ga0068869_100216777 Ga0068869_1002167772 100
147 3300005334 Ga0068869_100373923 Ga0068869_1003739232 100
148 3300005334 Ga0068869_101875269 Ga0068869_1018752691 100
149 3300005335 Ga0070666_10235751 Ga0070666_102357512 100
150 3300005336 Ga0070680_100310489 Ga0070680_1003104892 100
151 3300005336 Ga0070680_101847718 Ga0070680_1018477181 100
152 3300005337 Ga0070682_100028554 Ga0070682_1000285542 100
153 3300005340 Ga0070689_101159088 Ga0070689_1011590882 100
154 3300005343 Ga0070687_100165001 Ga0070687_1001650012 100
155 3300005353 Ga0070669_100113429 Ga0070669_1001134292 100
156 3300005364 Ga0070673_101399431 Ga0070673_1013994312 100
157 3300005364 Ga0070673_101724724 Ga0070673_1017247242 100
158 3300005434 Ga0070709_10205455 Ga0070709_102054552 100
159 3300005435 Ga0070714_100354919 Ga0070714_1003549192 100
160 3300005438 Ga0070701_10017381 Ga0070701_100173814 100
161 3300005438 Ga0070701_10142807 Ga0070701_101428071 100
162 3300005440 Ga0070705_100002630 Ga0070705_1000026301 100
163 3300005441 Ga0070700_100029638 Ga0070700_1000296384 100
164 3300005444 Ga0070694_100131174 Ga0070694_1001311741 100
165 3300005456 Ga0070678_100340049 Ga0070678_1003400492 100
166 3300005457 Ga0070662_100972821 Ga0070662_1009728212 100
167 3300005457 Ga0070662_101650599 Ga0070662_1016505991 100
168 3300005459 Ga0068867_100607219 Ga0068867_1006072191 100
169 3300005459 Ga0068867_100607574 Ga0068867_1006075742 100
170 3300005530 Ga0070679_100301770 Ga0070679_1003017702 100
171 3300005543 Ga0070672_100596995 Ga0070672_1005969952 100
172 3300005544 Ga0070686_100155654 Ga0070686_1001556542 100
173 3300005549 Ga0070704_100394294 Ga0070704_1003942942 100
174 3300005549 Ga0070704_102216211 Ga0070704_1022162111 100
175 3300005563 Ga0068855_100089219 Ga0068855_1000892192 100
176 3300005577 Ga0068857_100288769 Ga0068857_1002887692 100
177 3300005614 Ga0068856_100115020 Ga0068856_1001150202 100
178 3300005614 Ga0068856_102003907 Ga0068856_1020039072 100
179 3300005615 Ga0070702_100503483 Ga0070702_1005034832 100
180 3300005616 Ga0068852_100747163 Ga0068852_1007471632 100
181 3300005616 Ga0068852_102561953 Ga0068852_1025619532 100
182 3300005617 Ga0068859_100083665 Ga0068859_1000836652 100
183 3300005617 Ga0068859_101488625 Ga0068859_1014886252 100
184 3300005618 Ga0068864_100071403 Ga0068864_1000714032 100
185 3300005718 Ga0068866_10101523 Ga0068866_101015232 100
186 3300005719 Ga0068861_100280552 Ga0068861_1002805522 100
187 3300005841 Ga0068863_101038359 Ga0068863_1010383592 100
188 3300005842 Ga0068858_100108823 Ga0068858_1001088232 100
189 3300005843 Ga0068860_100086141 Ga0068860_1000861412 100
190 3300005844 Ga0068862_100011828 Ga0068862_1000118283 100
191 3300006846 Ga0075430_100486854 Ga0075430_1004868542 100
192 3300006847 Ga0075431_100687099 Ga0075431_1006870992 100
193 3300006852 Ga0075433_10010678 Ga0075433_100106782 100
194 3300006871 Ga0075434_100000566 Ga0075434_10000056616 100
195 3300006871 Ga0075434_100011155 Ga0075434_1000111559 100
196 3300006881 Ga0068865_100037664 Ga0068865_1000376645 100
197 3300006914 Ga0075436_100001732 Ga0075436_1000017322 100
198 3300006914 Ga0075436_100642121 Ga0075436_1006421212 100
199 3300006931 Ga0097620_100083671 Ga0097620_1000836714 100
200 3300006931 Ga0097620_101488707 Ga0097620_1014887072 100
201 3300007076 Ga0075435_100000249 Ga0075435_10000024923 100
202 3300009094 Ga0111539_10007483 Ga0111539_1000748311 100
203 3300009094 Ga0111539_10517813 Ga0111539_105178132 100
204 3300009148 Ga0105243_10109129 Ga0105243_101091292 100
205 3300009176 Ga0105242_10211994 Ga0105242_102119942 100
206 3300009177 Ga0105248_10437044 Ga0105248_104370442 100
207 3300009545 Ga0105237_10818031 Ga0105237_108180312 100
208 3300009551 Ga0105238_10033313 Ga0105238_100333134 100
209 3300010375 Ga0105239_10258473 Ga0105239_102584732 100
210 3300013296 Ga0157374_12777156 Ga0157374_127771562 100
211 3300013297 Ga0157378_10163430 Ga0157378_101634302 100
212 3300013297 Ga0157378_10553961 Ga0157378_105539612 100
213 3300013306 Ga0163162_10158958 Ga0163162_101589582 100
214 3300014745 Ga0157377_11012982 Ga0157377_110129822 100
215 3300014968 Ga0157379_10272436 Ga0157379_102724362 100
216 3300021384 Ga0213876_10439069 Ga0213876_104390692 100
217 3300025899 Ga0207642_10630676 Ga0207642_106306761 100
218 3300025901 Ga0207688_10213344 Ga0207688_102133442 100
219 3300025903 Ga0207680_10185893 Ga0207680_101858932 100
220 3300025906 Ga0207699_10216550 Ga0207699_102165502 100
221 3300025913 Ga0207695_11592731 Ga0207695_115927312 100
222 3300025917 Ga0207660_10521517 Ga0207660_105215172 100
223 3300025918 Ga0207662_10206758 Ga0207662_102067582 100
224 3300025921 Ga0207652_10328961 Ga0207652_103289612 100
225 3300025921 Ga0207652_10404021 Ga0207652_104040212 100
226 3300025924 Ga0207694_10030330 Ga0207694_100303303 100
227 3300025925 Ga0207650_10188911 Ga0207650_101889112 100
228 3300025926 Ga0207659_11083482 Ga0207659_110834822 100
229 3300025933 Ga0207706_11452177 Ga0207706_114521772 100
230 3300025933 Ga0207706_11689748 Ga0207706_116897482 100
231 3300025935 Ga0207709_10868469 Ga0207709_108684691 100
232 3300025936 Ga0207670_10017620 Ga0207670_100176205 100
233 3300025936 Ga0207670_10081405 Ga0207670_100814052 100
234 3300025938 Ga0207704_11796233 Ga0207704_117962331 100
235 3300025940 Ga0207691_10530604 Ga0207691_105306042 100
236 3300025940 Ga0207691_11531999 Ga0207691_115319992 100
237 3300025941 Ga0207711_10218595 Ga0207711_102185952 100
238 3300025942 Ga0207689_10248375 Ga0207689_102483752 100
239 3300025942 Ga0207689_10388023 Ga0207689_103880232 100
240 3300025945 Ga0207679_10719935 Ga0207679_107199351 100
241 3300025949 Ga0207667_10010861 Ga0207667_1001086111 100
242 3300025949 Ga0207667_10026526 Ga0207667_100265265 100
243 3300025960 Ga0207651_11186129 Ga0207651_111861292 100
244 3300025981 Ga0207640_10798763 Ga0207640_107987632 100
245 3300025986 Ga0207658_11709860 Ga0207658_117098601 100
246 3300026023 Ga0207677_10159653 Ga0207677_101596532 100
247 3300026023 Ga0207677_10673615 Ga0207677_106736152 100
248 3300026035 Ga0207703_10381154 Ga0207703_103811542 100
249 3300026035 Ga0207703_10726823 Ga0207703_107268232 100
250 3300026035 Ga0207703_11799577 Ga0207703_117995772 100
251 3300026041 Ga0207639_11133301 Ga0207639_111333012 100
252 3300026075 Ga0207708_10035470 Ga0207708_100354702 100
253 3300026078 Ga0207702_10079906 Ga0207702_100799062 100
254 3300026089 Ga0207648_10664151 Ga0207648_106641512 100
255 3300026089 Ga0207648_11351901 Ga0207648_113519012 100
256 3300026116 Ga0207674_10304981 Ga0207674_103049812 100
257 3300026118 Ga0207675_100001083 Ga0207675_1000010832 100
258 3300026142 Ga0207698_10653752 Ga0207698_106537522 100
259 3300027907 Ga0207428_10149621 Ga0207428_101496212 100
260 3300028380 Ga0268265_10080616 Ga0268265_100806162 100
261 3300031548 Ga0307408_101371002 Ga0307408_1013710022 100
262 3300031852 Ga0307410_11429435 Ga0307410_114294352 100
263 3300039437 Ga0436365_0731537 Ga0436365_0731537_123_458 100
264 3300045051 Ga0451576_0061365 Ga0451576_0061365_2965_3288 100
265 3300045051 Ga0451576_0582779 Ga0451576_0582779_554_874 100
266 3300046471 Ga0495650_0010534 Ga0495650_0010534_2620_2955 100
267 3300046491 Ga0495584_0007234 Ga0495584_0007234_2817_3152 100
268 3300046492 Ga0495585_0001003 Ga0495585_0001003_4682_5017 100
269 3300046507 Ga0495606_0000333 Ga0495606_0000333_17172_17507 100
270 3300046513 Ga0495616_0000001 Ga0495616_0000001_175743_176078 100
271 3300046519 Ga0495632_0013771 Ga0495632_0013771_3043_3378 100
272 3300046691 Ga0495670_0170698 Ga0495670_0170698_776_1111 100
273 3300047323 Ga0495683_0020056 Ga0495683_0020056_2643_2978 100
274 3300047472 Ga0495686_0005194 Ga0495686_0005194_2156_2491 100
275 3300048905 Ga0496102_1756648 Ga0496102_1756648_41_358 100
276 3300048924 Ga0496121_0000390 Ga0496121_0000390_88863_89198 100
277 3300049575 Ga0501039_0344397 Ga0501039_0344397_638_961 100
278 3300049588 Ga0501072_0238289 Ga0501072_0238289_320_643 100
279 3300050507 nmdc:mga05p37_2198907_c1 nmdc:mga05p37_2198907_c1_84_407 100
280 3300050510 nmdc:mga06r32_620395_c1 nmdc:mga06r32_620395_c1_51_374 100
281 3300050511 nmdc:mga08y16_447805_c1 nmdc:mga08y16_447805_c1_117_434 100
282 3300050512 nmdc:mga0n895_1598914_c1 nmdc:mga0n895_1598914_c1_108_428 100
283 3300050512 nmdc:mga0n895_58924_c1 nmdc:mga0n895_58924_c1_68_379 100
284 3300050512 nmdc:mga0n895_68896_c1 nmdc:mga0n895_68896_c1_452_769 100
285 3300050513 nmdc:mga0rr50_452472_c1 nmdc:mga0rr50_452472_c1_452_769 100
286 3300050514 nmdc:mga08x19_1634_c1 nmdc:mga08x19_1634_c1_12448_12765 100
287 3300050515 nmdc:mga0a205_13067_c1 nmdc:mga0a205_13067_c1_4658_4975 100
288 3300050515 nmdc:mga0a205_428461_c1 nmdc:mga0a205_428461_c1_758_1069 100
289 iso_pu_bacteria 2734482264 2735836894 100
290 iso_pu_bacteria 2738543009 2739226309 100
291 3300005340 Ga0070689_100002469 Ga0070689_1000024695 101
292 3300005365 Ga0070688_100097303 Ga0070688_1000973032 101
293 3300005466 Ga0070685_10031489 Ga0070685_100314893 101
294 3300005563 Ga0068855_100027591 Ga0068855_1000275915 101
295 3300005577 Ga0068857_100247470 Ga0068857_1002474703 101
296 3300005841 Ga0068863_101981921 Ga0068863_1019819212 101
297 3300006846 Ga0075430_100027073 Ga0075430_1000270734 101
298 3300006880 Ga0075429_100066667 Ga0075429_1000666673 101
299 3300007076 Ga0075435_100076092 Ga0075435_1000760922 101
300 3300009551 Ga0105238_10185840 Ga0105238_101858401 101
301 3300013104 Ga0157370_10029514 Ga0157370_100295142 101
302 3300013105 Ga0157369_10010411 Ga0157369_100104113 101
303 3300013306 Ga0163162_10691232 Ga0163162_106912322 101
304 3300014497 Ga0182008_10376884 Ga0182008_103768841 101
305 3300025936 Ga0207670_10098407 Ga0207670_100984073 101
306 3300026041 Ga0207639_10502470 Ga0207639_105024702 101
307 3300026116 Ga0207674_10210991 Ga0207674_102109913 101
308 3300027364 Ga0209967_1023655 Ga0209967_10236551 101
309 3300035691 Ga0373931_0051612 Ga0373931_0051612_960_1277 101
310 3300041501 Ga0451845_0152272 Ga0451845_0152272_49_360 101
311 3300046516 Ga0495628_0001076 Ga0495628_0001076_8180_8497 101
312 3300046642 Ga0495634_0691931 Ga0495634_0691931_224_532 101
313 3300049583 Ga0501067_0028799 Ga0501067_0028799_646_963 101
314 3300050508 nmdc:mga09592_91338_c1 nmdc:mga09592_91338_c1_2273_2581 101
315 3300050509 nmdc:mga0qj67_25908_c1 nmdc:mga0qj67_25908_c1_1234_1545 101
316 3300050513 nmdc:mga0rr50_384824_c1 nmdc:mga0rr50_384824_c1_120_464 101
317 3300059426 Ga0590077_019746 Ga0590077_019746_821_1147 101
318 2162886012 MBSR1b_contig_11923333 MBSR1b_0208.00007120 102
319 3300005293 Ga0065715_10206516 Ga0065715_102065162 102
320 3300005328 Ga0070676_10037256 Ga0070676_100372562 102
321 3300005328 Ga0070676_10708686 Ga0070676_107086862 102
322 3300005330 Ga0070690_100316387 Ga0070690_1003163871 102
323 3300005330 Ga0070690_100677352 Ga0070690_1006773522 102
324 3300005335 Ga0070666_10038796 Ga0070666_100387962 102
325 3300005335 Ga0070666_10057777 Ga0070666_100577772 102
326 3300005336 Ga0070680_100630143 Ga0070680_1006301432 102
327 3300005337 Ga0070682_100409873 Ga0070682_1004098732 102
328 3300005338 Ga0068868_100321592 Ga0068868_1003215922 102
329 3300005338 Ga0068868_101254847 Ga0068868_1012548471 102
330 3300005339 Ga0070660_100025605 Ga0070660_1000256052 102
331 3300005339 Ga0070660_100279456 Ga0070660_1002794562 102
332 3300005339 Ga0070660_100495618 Ga0070660_1004956182 102
333 3300005340 Ga0070689_100369763 Ga0070689_1003697632 102
334 3300005344 Ga0070661_100009313 Ga0070661_1000093132 102
335 3300005347 Ga0070668_100050479 Ga0070668_1000504792 102
336 3300005347 Ga0070668_100128307 Ga0070668_1001283072 102
337 3300005353 Ga0070669_100279091 Ga0070669_1002790912 102
338 3300005354 Ga0070675_100017455 Ga0070675_1000174553 102
339 3300005355 Ga0070671_100005336 Ga0070671_1000053366 102
340 3300005355 Ga0070671_100637912 Ga0070671_1006379122 102
341 3300005356 Ga0070674_100580693 Ga0070674_1005806932 102
342 3300005364 Ga0070673_100008378 Ga0070673_1000083782 102
343 3300005364 Ga0070673_100059962 Ga0070673_1000599623 102
344 3300005365 Ga0070688_100517824 Ga0070688_1005178242 102
345 3300005366 Ga0070659_100000939 Ga0070659_10000093917 102
346 3300005366 Ga0070659_100302240 Ga0070659_1003022402 102
347 3300005366 Ga0070659_100473397 Ga0070659_1004733972 102
348 3300005367 Ga0070667_100325718 Ga0070667_1003257182 102
349 3300005435 Ga0070714_100031734 Ga0070714_1000317344 102
350 3300005439 Ga0070711_100067264 Ga0070711_1000672643 102
351 3300005440 Ga0070705_100630651 Ga0070705_1006306512 102
352 3300005455 Ga0070663_100258294 Ga0070663_1002582942 102
353 3300005456 Ga0070678_100051022 Ga0070678_1000510222 102
354 3300005457 Ga0070662_100000104 Ga0070662_1000001044 102
355 3300005457 Ga0070662_100068410 Ga0070662_1000684102 102
356 3300005458 Ga0070681_10194045 Ga0070681_101940452 102
357 3300005459 Ga0068867_100959330 Ga0068867_1009593302 102
358 3300005530 Ga0070679_100102753 Ga0070679_1001027532 102
359 3300005530 Ga0070679_100160987 Ga0070679_1001609872 102
360 3300005530 Ga0070679_101728117 Ga0070679_1017281171 102
361 3300005539 Ga0068853_100026492 Ga0068853_1000264922 102
362 3300005539 Ga0068853_101693716 Ga0068853_1016937162 102
363 3300005543 Ga0070672_100039289 Ga0070672_1000392893 102
364 3300005543 Ga0070672_100065796 Ga0070672_1000657963 102
365 3300005546 Ga0070696_101736943 Ga0070696_1017369431 102
366 3300005548 Ga0070665_100601089 Ga0070665_1006010892 102
367 3300005563 Ga0068855_100001220 Ga0068855_10000122016 102
368 3300005563 Ga0068855_100234658 Ga0068855_1002346582 102
369 3300005564 Ga0070664_100002517 Ga0070664_1000025172 102
370 3300005564 Ga0070664_100164036 Ga0070664_1001640362 102
371 3300005564 Ga0070664_100548829 Ga0070664_1005488292 102
372 3300005578 Ga0068854_100327335 Ga0068854_1003273352 102
373 3300005578 Ga0068854_100827249 Ga0068854_1008272492 102
374 3300005614 Ga0068856_100000606 Ga0068856_1000006065 102
375 3300005614 Ga0068856_100347362 Ga0068856_1003473622 102
376 3300005614 Ga0068856_100626792 Ga0068856_1006267922 102
377 3300005616 Ga0068852_100021425 Ga0068852_1000214252 102
378 3300005616 Ga0068852_100031335 Ga0068852_1000313353 102
379 3300005616 Ga0068852_100501829 Ga0068852_1005018292 102
380 3300005618 Ga0068864_100692896 Ga0068864_1006928962 102
381 3300005718 Ga0068866_10618578 Ga0068866_106185782 102
382 3300005719 Ga0068861_100195597 Ga0068861_1001955972 102
383 3300005719 Ga0068861_100238642 Ga0068861_1002386422 102
384 3300005834 Ga0068851_10425341 Ga0068851_104253412 102
385 3300005840 Ga0068870_10196780 Ga0068870_101967802 102
386 3300005840 Ga0068870_10584839 Ga0068870_105848392 102
387 3300005842 Ga0068858_101604191 Ga0068858_1016041912 102
388 3300005843 Ga0068860_101453145 Ga0068860_1014531452 102
389 3300005844 Ga0068862_100174706 Ga0068862_1001747062 102
390 3300005985 Ga0081539_10000332 Ga0081539_1000033254 102
391 3300006038 Ga0075365_10067465 Ga0075365_100674653 102
392 3300006048 Ga0075363_100019497 Ga0075363_1000194973 102
393 3300006175 Ga0070712_101141180 Ga0070712_1011411802 102
394 3300006237 Ga0097621_100713422 Ga0097621_1007134222 102
395 3300006846 Ga0075430_100335017 Ga0075430_1003350173 102
396 3300006847 Ga0075431_100010851 Ga0075431_1000108519 102
397 3300006852 Ga0075433_11871136 Ga0075433_118711361 102
398 3300006871 Ga0075434_101999062 Ga0075434_1019990622 102
399 3300006880 Ga0075429_100268907 Ga0075429_1002689072 102
400 3300006881 Ga0068865_101653644 Ga0068865_1016536442 102
401 3300007076 Ga0075435_100777364 Ga0075435_1007773641 102
402 3300009093 Ga0105240_10174170 Ga0105240_101741702 102
403 3300009093 Ga0105240_11755750 Ga0105240_117557501 102
404 3300009101 Ga0105247_10186488 Ga0105247_101864883 102
405 3300009147 Ga0114129_12713450 Ga0114129_127134502 102
406 3300009177 Ga0105248_10027187 Ga0105248_100271874 102
407 3300009545 Ga0105237_10046451 Ga0105237_100464514 102
408 3300009551 Ga0105238_10005684 Ga0105238_100056846 102
409 3300009553 Ga0105249_10442023 Ga0105249_104420232 102
410 3300010375 Ga0105239_10029155 Ga0105239_100291554 102
411 3300010375 Ga0105239_10141350 Ga0105239_101413502 102
412 3300010375 Ga0105239_12639966 Ga0105239_126399661 102
413 3300013100 Ga0157373_10103587 Ga0157373_101035872 102
414 3300013100 Ga0157373_10546426 Ga0157373_105464262 102
415 3300013102 Ga0157371_10000292 Ga0157371_1000029231 102
416 3300013102 Ga0157371_11181327 Ga0157371_111813272 102
417 3300013104 Ga0157370_10009685 Ga0157370_100096856 102
418 3300013104 Ga0157370_10719335 Ga0157370_107193352 102
419 3300013105 Ga0157369_10502231 Ga0157369_105022312 102
420 3300013296 Ga0157374_10013385 Ga0157374_100133854 102
421 3300013306 Ga0163162_10122220 Ga0163162_101222202 102
422 3300013306 Ga0163162_12710285 Ga0163162_127102852 102
423 3300013307 Ga0157372_10017154 Ga0157372_100171542 102
424 3300013307 Ga0157372_10207928 Ga0157372_102079281 102
425 3300013307 Ga0157372_10623924 Ga0157372_106239242 102
426 3300013307 Ga0157372_11623577 Ga0157372_116235771 102
427 3300013308 Ga0157375_10026193 Ga0157375_100261933 102
428 3300014326 Ga0157380_11331631 Ga0157380_113316312 102
429 3300014968 Ga0157379_10034650 Ga0157379_100346504 102
430 3300014968 Ga0157379_10462117 Ga0157379_104621172 102
431 3300017792 Ga0163161_10108528 Ga0163161_101085283 102
432 3300025321 Ga0207656_10197057 Ga0207656_101970571 102
433 3300025885 Ga0207653_10010271 Ga0207653_100102712 102
434 3300025898 Ga0207692_10334871 Ga0207692_103348713 102
435 3300025903 Ga0207680_10053657 Ga0207680_100536572 102
436 3300025903 Ga0207680_10161393 Ga0207680_101613932 102
437 3300025907 Ga0207645_10056004 Ga0207645_100560042 102
438 3300025907 Ga0207645_10222385 Ga0207645_102223852 102
439 3300025907 Ga0207645_10411234 Ga0207645_104112342 102
440 3300025908 Ga0207643_10499105 Ga0207643_104991052 102
441 3300025910 Ga0207684_10616631 Ga0207684_106166313 102
442 3300025912 Ga0207707_10109222 Ga0207707_101092223 102
443 3300025912 Ga0207707_10281389 Ga0207707_102813892 102
444 3300025914 Ga0207671_10144733 Ga0207671_101447333 102
445 3300025915 Ga0207693_10779286 Ga0207693_107792862 102
446 3300025916 Ga0207663_10258051 Ga0207663_102580513 102
447 3300025917 Ga0207660_10378352 Ga0207660_103783522 102
448 3300025918 Ga0207662_10103569 Ga0207662_101035692 102
449 3300025919 Ga0207657_10003478 Ga0207657_1000347812 102
450 3300025919 Ga0207657_10518713 Ga0207657_105187132 102
451 3300025920 Ga0207649_10001011 Ga0207649_1000101112 102
452 3300025920 Ga0207649_10233735 Ga0207649_102337352 102
453 3300025920 Ga0207649_10949747 Ga0207649_109497472 102
454 3300025921 Ga0207652_10065817 Ga0207652_100658174 102
455 3300025921 Ga0207652_10376149 Ga0207652_103761492 102
456 3300025922 Ga0207646_10995919 Ga0207646_109959192 102
457 3300025923 Ga0207681_10305930 Ga0207681_103059302 102
458 3300025923 Ga0207681_10406637 Ga0207681_104066372 102
459 3300025924 Ga0207694_10010911 Ga0207694_100109117 102
460 3300025927 Ga0207687_10963443 Ga0207687_109634432 102
461 3300025931 Ga0207644_10083771 Ga0207644_100837712 102
462 3300025931 Ga0207644_10659163 Ga0207644_106591632 102
463 3300025932 Ga0207690_10009415 Ga0207690_100094154 102
464 3300025932 Ga0207690_10127323 Ga0207690_101273232 102
465 3300025933 Ga0207706_10000040 Ga0207706_1000004055 102
466 3300025933 Ga0207706_10076423 Ga0207706_100764232 102
467 3300025935 Ga0207709_10273281 Ga0207709_102732812 102
468 3300025936 Ga0207670_10163888 Ga0207670_101638882 102
469 3300025936 Ga0207670_10259758 Ga0207670_102597582 102
470 3300025937 Ga0207669_10267572 Ga0207669_102675722 102
471 3300025940 Ga0207691_10084045 Ga0207691_100840452 102
472 3300025941 Ga0207711_10047042 Ga0207711_100470422 102
473 3300025942 Ga0207689_10086869 Ga0207689_100868692 102
474 3300025942 Ga0207689_10271195 Ga0207689_102711951 102
475 3300025942 Ga0207689_10367852 Ga0207689_103678522 102
476 3300025945 Ga0207679_10003236 Ga0207679_100032363 102
477 3300025945 Ga0207679_10073377 Ga0207679_100733772 102
478 3300025945 Ga0207679_10718651 Ga0207679_107186512 102
479 3300025949 Ga0207667_10003220 Ga0207667_100032208 102
480 3300025960 Ga0207651_10122559 Ga0207651_101225591 102
481 3300025961 Ga0207712_10249321 Ga0207712_102493212 102
482 3300025961 Ga0207712_10633318 Ga0207712_106333182 102
483 3300025972 Ga0207668_10079587 Ga0207668_100795872 102
484 3300025972 Ga0207668_10240663 Ga0207668_102406632 102
485 3300025981 Ga0207640_10424231 Ga0207640_104242312 102
486 3300025986 Ga0207658_10080511 Ga0207658_100805112 102
487 3300025986 Ga0207658_12132399 Ga0207658_121323992 102
488 3300026023 Ga0207677_10104633 Ga0207677_101046332 102
489 3300026023 Ga0207677_10304483 Ga0207677_103044832 102
490 3300026035 Ga0207703_10063042 Ga0207703_100630422 102
491 3300026035 Ga0207703_11491796 Ga0207703_114917962 102
492 3300026041 Ga0207639_10025024 Ga0207639_100250242 102
493 3300026041 Ga0207639_10654616 Ga0207639_106546162 102
494 3300026067 Ga0207678_10816170 Ga0207678_108161702 102
495 3300026075 Ga0207708_10069118 Ga0207708_100691182 102
496 3300026078 Ga0207702_10156062 Ga0207702_101560622 102
497 3300026078 Ga0207702_12069344 Ga0207702_120693441 102
498 3300026089 Ga0207648_11789152 Ga0207648_117891522 102
499 3300026095 Ga0207676_10048887 Ga0207676_100488872 102
500 3300026095 Ga0207676_10415739 Ga0207676_104157392 102
501 3300026116 Ga0207674_10034136 Ga0207674_100341366 102
502 3300026118 Ga0207675_100049015 Ga0207675_1000490152 102
503 3300026118 Ga0207675_100089160 Ga0207675_1000891603 102
504 3300026121 Ga0207683_10264867 Ga0207683_102648671 102
505 3300026142 Ga0207698_10027355 Ga0207698_100273553 102
506 3300026142 Ga0207698_10158064 Ga0207698_101580642 102
507 3300026142 Ga0207698_10223423 Ga0207698_102234232 102
508 3300027360 Ga0209969_1039443 Ga0209969_10394432 102
509 3300027395 Ga0209996_1022530 Ga0209996_10225302 102
510 3300027395 Ga0209996_1063784 Ga0209996_10637841 102
511 3300027424 Ga0209984_1006490 Ga0209984_10064902 102
512 3300027424 Ga0209984_1011020 Ga0209984_10110202 102
513 3300027552 Ga0209982_1003304 Ga0209982_10033042 102
514 3300027552 Ga0209982_1030509 Ga0209982_10305092 102
515 3300027614 Ga0209970_1044969 Ga0209970_10449692 102
516 3300027665 Ga0209983_1004970 Ga0209983_10049702 102
517 3300027682 Ga0209971_1051660 Ga0209971_10516602 102
518 3300027717 Ga0209998_10001424 Ga0209998_100014246 102
519 3300027717 Ga0209998_10012232 Ga0209998_100122322 102
520 3300027866 Ga0209813_10364280 Ga0209813_103642802 102
521 3300027876 Ga0209974_10008144 Ga0209974_100081442 102
522 3300027876 Ga0209974_10020177 Ga0209974_100201772 102
523 3300028380 Ga0268265_10048973 Ga0268265_100489733 102
524 3300028380 Ga0268265_10559621 Ga0268265_105596211 102
525 3300028381 Ga0268264_10045472 Ga0268264_100454724 102
526 3300035121 Ga0373960_0257344 Ga0373960_0257344_227_577 102
527 3300035207 Ga0373942_0012462 Ga0373942_0012462_101_421 102
528 3300035241 Ga0373961_0285438 Ga0373961_0285438_176_529 102
529 3300042005 Ga0439448_0134438 Ga0439448_0134438_136_486 102
530 3300042012 Ga0439455_0199467 Ga0439455_0199467_134_484 102
531 3300042157 Ga0439458_0209334 Ga0439458_0209334_39_389 102
532 3300042876 Ga0451577_0097039 Ga0451577_0097039_1301_1645 102
533 3300042876 Ga0451577_0126210 Ga0451577_0126210_311_664 102
534 3300044656 Ga0466969_0211540 Ga0466969_0211540_22_339 102
535 3300044693 Ga0466961_0214584 Ga0466961_0214584_196_513 102
536 3300044694 Ga0466963_0311464 Ga0466963_0311464_80_421 102
537 3300044706 Ga0466964_0206973 Ga0466964_0206973_423_764 102
538 3300044712 Ga0453684_1020152 Ga0453684_1020152_173_526 102
539 3300044712 Ga0453684_1662365 Ga0453684_1662365_105_449 102
540 3300044765 Ga0466970_0598883 Ga0466970_0598883_84_401 102
541 3300044842 Ga0466957_0855852 Ga0466957_0855852_167_508 102
542 3300045051 Ga0451576_0836213 Ga0451576_0836213_426_770 102
543 3300045051 Ga0451576_1059929 Ga0451576_1059929_440_793 102
544 3300045976 Ga0466967_0078056 Ga0466967_0078056_292_633 102
545 3300046519 Ga0495632_0000003 Ga0495632_0000003_269151_269465 102
546 3300046616 Ga0495668_0015436 Ga0495668_0015436_3147_3461 102
547 3300046810 Ga0495660_0000009 Ga0495660_0000009_102011_102325 102
548 3300047469 Ga0495673_0000001 Ga0495673_0000001_918377_918691 102
549 3300048903 Ga0496100_0020465 Ga0496100_0020465_911_1225 102
550 3300048903 Ga0496100_0160018 Ga0496100_0160018_289_609 102
551 3300048904 Ga0496101_0001666 Ga0496101_0001666_4214_4528 102
552 3300048904 Ga0496101_0074238 Ga0496101_0074238_35_385 102
553 3300048904 Ga0496101_0194066 Ga0496101_0194066_1193_1510 102
554 3300048905 Ga0496102_0002744 Ga0496102_0002744_5808_6125 102
555 3300048905 Ga0496102_0011114 Ga0496102_0011114_3328_3678 102
556 3300048905 Ga0496102_0717489 Ga0496102_0717489_206_559 102
557 3300048906 Ga0496103_0078203 Ga0496103_0078203_381_698 102
558 3300048908 Ga0496105_0133554 Ga0496105_0133554_1266_1586 102
559 3300048909 Ga0496106_0002229 Ga0496106_0002229_11112_11462 102
560 3300048909 Ga0496106_0005702 Ga0496106_0005702_4035_4355 102
561 3300048909 Ga0496106_0195586 Ga0496106_0195586_523_840 102
562 3300048909 Ga0496106_1138456 Ga0496106_1138456_44_397 102
563 3300048910 Ga0496107_0002621 Ga0496107_0002621_10161_10481 102
564 3300048910 Ga0496107_0010881 Ga0496107_0010881_3537_3887 102
565 3300048910 Ga0496107_0106352 Ga0496107_0106352_64_378 102
566 3300048910 Ga0496107_0170373 Ga0496107_0170373_490_807 102
567 3300048911 Ga0496108_0009040 Ga0496108_0009040_5225_5545 102
568 3300048911 Ga0496108_0115156 Ga0496108_0115156_364_681 102
569 3300048912 Ga0496109_0001784 Ga0496109_0001784_3420_3740 102
570 3300048912 Ga0496109_0696808 Ga0496109_0696808_244_594 102
571 3300048912 Ga0496109_0920074 Ga0496109_0920074_469_786 102
572 3300048912 Ga0496109_1062092 Ga0496109_1062092_279_629 102
573 3300048913 Ga0496110_0034991 Ga0496110_0034991_1369_1689 102
574 3300048913 Ga0496110_0797142 Ga0496110_0797142_178_495 102
575 3300048913 Ga0496110_0974685 Ga0496110_0974685_285_635 102
576 3300048914 Ga0496111_0022218 Ga0496111_0022218_1953_2273 102
577 3300048915 Ga0496112_0051471 Ga0496112_0051471_693_1013 102
578 3300048916 Ga0496113_0091981 Ga0496113_0091981_834_1154 102
579 3300048917 Ga0496114_0265278 Ga0496114_0265278_1069_1389 102
580 3300048917 Ga0496114_0314183 Ga0496114_0314183_483_803 102
581 3300048917 Ga0496114_0712885 Ga0496114_0712885_193_543 102
582 3300048918 Ga0496115_0255087 Ga0496115_0255087_136_453 102
583 3300048918 Ga0496115_0278581 Ga0496115_0278581_93_413 102
584 3300048918 Ga0496115_0489199 Ga0496115_0489199_240_560 102
585 3300048921 Ga0496118_0111732 Ga0496118_0111732_693_1013 102
586 3300048921 Ga0496118_0138419 Ga0496118_0138419_671_988 102
587 3300048924 Ga0496121_0000368 Ga0496121_0000368_3239_3553 102
588 3300048924 Ga0496121_0338478 Ga0496121_0338478_303_623 102
589 3300048925 Ga0496122_0035640 Ga0496122_0035640_588_902 102
590 3300048926 Ga0496123_0020397 Ga0496123_0020397_1408_1722 102
591 3300048926 Ga0496123_0504644 Ga0496123_0504644_175_492 102
592 3300048927 Ga0496124_0064399 Ga0496124_0064399_131_448 102
593 3300048929 Ga0496126_0009926 Ga0496126_0009926_7279_7599 102
594 3300048929 Ga0496126_0061821 Ga0496126_0061821_1343_1663 102
595 3300048929 Ga0496126_0901836 Ga0496126_0901836_90_410 102
596 3300050490 nmdc:mga03n38_7495_c1 nmdc:mga03n38_7495_c1_1869_2189 102
597 3300050492 nmdc:mga0yw44_56564_c1 nmdc:mga0yw44_56564_c1_1275_1595 102
598 3300050494 nmdc:mga06z11_606569_c1 nmdc:mga06z11_606569_c1_62_382 102
599 3300050508 nmdc:mga09592_16816_c1 nmdc:mga09592_16816_c1_3468_3791 102
600 3300050508 nmdc:mga09592_793621_c1 nmdc:mga09592_793621_c1_355_705 102
601 3300050509 nmdc:mga0qj67_213444_c1 nmdc:mga0qj67_213444_c1_1107_1430 102
602 3300050510 nmdc:mga06r32_8403_c1 nmdc:mga06r32_8403_c1_6419_6742 102
603 3300050512 nmdc:mga0n895_933456_c1 nmdc:mga0n895_933456_c1_442_795 102
604 3300053139 Ga0500568_0029049 Ga0500568_0029049_1194_1514 102
605 3300002067 JGI24735J21928_10040768 JGI24735J21928_100407683 103
606 3300005327 Ga0070658_10041483 Ga0070658_100414833 103
607 3300005331 Ga0070670_100318908 Ga0070670_1003189082 103
608 3300005335 Ga0070666_10000001 Ga0070666_10000001346 103
609 3300005336 Ga0070680_100469087 Ga0070680_1004690872 103
610 3300005341 Ga0070691_10013229 Ga0070691_100132294 103
611 3300005344 Ga0070661_100027965 Ga0070661_1000279651 103
612 3300005344 Ga0070661_100114824 Ga0070661_1001148241 103
613 3300005345 Ga0070692_10042111 Ga0070692_100421111 103
614 3300005354 Ga0070675_100113062 Ga0070675_1001130623 103
615 3300005406 Ga0070703_10043198 Ga0070703_100431982 103
616 3300005438 Ga0070701_10140843 Ga0070701_101408432 103
617 3300005440 Ga0070705_100006334 Ga0070705_1000063348 103
618 3300005441 Ga0070700_100020679 Ga0070700_1000206792 103
619 3300005444 Ga0070694_100010520 Ga0070694_1000105208 103
620 3300005445 Ga0070708_100206472 Ga0070708_1002064721 103
621 3300005456 Ga0070678_100363726 Ga0070678_1003637262 103
622 3300005457 Ga0070662_100170044 Ga0070662_1001700443 103
623 3300005466 Ga0070685_10160212 Ga0070685_101602123 103
624 3300005518 Ga0070699_100403962 Ga0070699_1004039621 103
625 3300005518 Ga0070699_100416729 Ga0070699_1004167292 103
626 3300005530 Ga0070679_102043744 Ga0070679_1020437441 103
627 3300005536 Ga0070697_101503480 Ga0070697_1015034801 103
628 3300005545 Ga0070695_100009793 Ga0070695_1000097938 103
629 3300005546 Ga0070696_100005323 Ga0070696_1000053236 103
630 3300005549 Ga0070704_100065054 Ga0070704_1000650542 103
631 3300005577 Ga0068857_100070006 Ga0068857_1000700063 103
632 3300005615 Ga0070702_100250727 Ga0070702_1002507272 103
633 3300005617 Ga0068859_100031224 Ga0068859_1000312244 103
634 3300005618 Ga0068864_100856431 Ga0068864_1008564312 103
635 3300005841 Ga0068863_101486900 Ga0068863_1014869001 103
636 3300005842 Ga0068858_100045656 Ga0068858_1000456563 103
637 3300005843 Ga0068860_100388420 Ga0068860_1003884202 103
638 3300005843 Ga0068860_100502620 Ga0068860_1005026202 103
639 3300005844 Ga0068862_100345736 Ga0068862_1003457362 103
640 3300005844 Ga0068862_101919248 Ga0068862_1019192482 103
641 3300006852 Ga0075433_11128379 Ga0075433_111283792 103
642 3300006881 Ga0068865_101261367 Ga0068865_1012613672 103
643 3300006931 Ga0097620_100031226 Ga0097620_1000312265 103
644 3300009101 Ga0105247_10087908 Ga0105247_100879083 103
645 3300009148 Ga0105243_11829812 Ga0105243_118298122 103
646 3300009174 Ga0105241_10705170 Ga0105241_107051702 103
647 3300009551 Ga0105238_10000611 Ga0105238_1000061120 103
648 3300009553 Ga0105249_10010040 Ga0105249_100100404 103
649 3300010375 Ga0105239_10281619 Ga0105239_102816192 103
650 3300013306 Ga0163162_10000436 Ga0163162_1000043632 103
651 3300014326 Ga0157380_10159998 Ga0157380_101599982 103
652 3300014497 Ga0182008_10425803 Ga0182008_104258031 103
653 3300015261 Ga0182006_1000049 Ga0182006_100004940 103
654 3300015262 Ga0182007_10036195 Ga0182007_100361953 103
655 3300015265 Ga0182005_1030791 Ga0182005_10307912 103
656 3300015265 Ga0182005_1030792 Ga0182005_10307922 103
657 3300025885 Ga0207653_10005165 Ga0207653_100051652 103
658 3300025903 Ga0207680_10000003 Ga0207680_10000003391 103
659 3300025904 Ga0207647_10038770 Ga0207647_100387703 103
660 3300025909 Ga0207705_10007544 Ga0207705_100075442 103
661 3300025910 Ga0207684_10035743 Ga0207684_100357436 103
662 3300025911 Ga0207654_10177811 Ga0207654_101778112 103
663 3300025912 Ga0207707_10072162 Ga0207707_100721623 103
664 3300025920 Ga0207649_10625185 Ga0207649_106251852 103
665 3300025924 Ga0207694_10000068 Ga0207694_1000006854 103
666 3300025926 Ga0207659_10661458 Ga0207659_106614582 103
667 3300025933 Ga0207706_10065800 Ga0207706_100658003 103
668 3300025935 Ga0207709_10912297 Ga0207709_109122972 103
669 3300025938 Ga0207704_11227510 Ga0207704_112275102 103
670 3300025961 Ga0207712_10013035 Ga0207712_100130356 103
671 3300025972 Ga0207668_10538979 Ga0207668_105389792 103
672 3300026035 Ga0207703_10339289 Ga0207703_103392892 103
673 3300026075 Ga0207708_10019180 Ga0207708_100191806 103
674 3300026088 Ga0207641_10973840 Ga0207641_109738402 103
675 3300026095 Ga0207676_10701575 Ga0207676_107015752 103
676 3300026116 Ga0207674_10049854 Ga0207674_100498545 103
677 3300026121 Ga0207683_11393707 Ga0207683_113937072 103
678 3300028379 Ga0268266_10000011 Ga0268266_10000011336 103
679 3300028380 Ga0268265_10006006 Ga0268265_100060064 103
680 3300028380 Ga0268265_11879733 Ga0268265_118797332 103
681 3300028381 Ga0268264_10070313 Ga0268264_100703132 103
682 3300028381 Ga0268264_10464210 Ga0268264_104642102 103
683 3300032126 Ga0307415_102235173 Ga0307415_1022351732 103
684 3300033180 Ga0307510_10005162 Ga0307510_100051624 103
685 3300033180 Ga0307510_10039726 Ga0307510_100397263 103
686 3300035088 Ga0373940_0296423 Ga0373940_0296423_109_435 103
687 3300041456 Ga0451795_0174589 Ga0451795_0174589_609_929 103
688 3300041512 Ga0451853_1856925 Ga0451853_1856925_189_545 103
689 3300041512 Ga0451853_2507703 Ga0451853_2507703_211_561 103
690 3300046460 Ga0495638_0123666 Ga0495638_0123666_783_1103 103
691 3300046471 Ga0495650_0000724 Ga0495650_0000724_12854_13174 103
692 3300046471 Ga0495650_0000912 Ga0495650_0000912_20724_21044 103
693 3300046501 Ga0495607_0000002 Ga0495607_0000002_320131_320451 103
694 3300046507 Ga0495606_0009282 Ga0495606_0009282_6580_6900 103
695 3300046512 Ga0495610_0120007 Ga0495610_0120007_680_1000 103
696 3300046515 Ga0495620_0000401 Ga0495620_0000401_14084_14404 103
697 3300046518 Ga0495631_0000410 Ga0495631_0000410_5268_5588 103
698 3300046519 Ga0495632_0004605 Ga0495632_0004605_7999_8319 103
699 3300046524 Ga0495648_0009496 Ga0495648_0009496_6140_6460 103
700 3300046648 Ga0495611_0000008 Ga0495611_0000008_47895_48215 103
701 3300046660 Ga0495625_0003154 Ga0495625_0003154_4703_5023 103
702 3300046660 Ga0495625_0304637 Ga0495625_0304637_216_536 103
703 3300047469 Ga0495673_0000030 Ga0495673_0000030_286098_286418 103
704 3300047472 Ga0495686_0000077 Ga0495686_0000077_185704_186024 103
705 3300047472 Ga0495686_0017160 Ga0495686_0017160_2431_2751 103
706 3300048903 Ga0496100_0026869 Ga0496100_0026869_1568_1894 103
707 3300048905 Ga0496102_0012607 Ga0496102_0012607_193_519 103
708 3300048906 Ga0496103_0127038 Ga0496103_0127038_211_537 103
709 3300048909 Ga0496106_0029054 Ga0496106_0029054_3274_3600 103
710 3300048910 Ga0496107_0185159 Ga0496107_0185159_186_512 103
711 3300048911 Ga0496108_1333691 Ga0496108_1333691_104_430 103
712 3300048918 Ga0496115_0082573 Ga0496115_0082573_684_1010 103
713 3300048924 Ga0496121_0078690 Ga0496121_0078690_1501_1821 103
714 3300048928 Ga0496125_0026949 Ga0496125_0026949_1695_2015 103
715 3300048929 Ga0496126_0026115 Ga0496126_0026115_4707_5027 103
716 3300049824 Ga0501045_1417356 Ga0501045_1417356_85_429 103
717 3300050515 nmdc:mga0a205_821288_c1 nmdc:mga0a205_821288_c1_175_516 103
718 3300053090 Ga0500646_0015830 Ga0500646_0015830_1115_1435 103
719 3300053160 Ga0500633_0039139 Ga0500633_0039139_1122_1442 103
720 3300005328 Ga0070676_10083564 Ga0070676_100835642 104
721 3300005340 Ga0070689_100348203 Ga0070689_1003482032 104
722 3300005340 Ga0070689_101090685 Ga0070689_1010906852 104
723 3300005343 Ga0070687_100104306 Ga0070687_1001043061 104
724 3300005347 Ga0070668_100516231 Ga0070668_1005162312 104
725 3300005353 Ga0070669_100022973 Ga0070669_1000229733 104
726 3300005354 Ga0070675_100021556 Ga0070675_1000215563 104
727 3300005365 Ga0070688_100996666 Ga0070688_1009966661 104
728 3300005441 Ga0070700_101130486 Ga0070700_1011304862 104
729 3300005455 Ga0070663_101072245 Ga0070663_1010722451 104
730 3300005456 Ga0070678_100076595 Ga0070678_1000765952 104
731 3300005459 Ga0068867_100026985 Ga0068867_1000269854 104
732 3300005466 Ga0070685_10263322 Ga0070685_102633222 104
733 3300005471 Ga0070698_101096892 Ga0070698_1010968921 104
734 3300005543 Ga0070672_100004186 Ga0070672_1000041867 104
735 3300005577 Ga0068857_101613937 Ga0068857_1016139371 104
736 3300005617 Ga0068859_100652009 Ga0068859_1006520091 104
737 3300005618 Ga0068864_100829063 Ga0068864_1008290632 104
738 3300005618 Ga0068864_101340479 Ga0068864_1013404792 104
739 3300005719 Ga0068861_102178783 Ga0068861_1021787832 104
740 3300005841 Ga0068863_100087748 Ga0068863_1000877483 104
741 3300005841 Ga0068863_101123835 Ga0068863_1011238352 104
742 3300005843 Ga0068860_100216171 Ga0068860_1002161713 104
743 3300005844 Ga0068862_100032236 Ga0068862_1000322363 104
744 3300006237 Ga0097621_100278357 Ga0097621_1002783572 104
745 3300006844 Ga0075428_100130833 Ga0075428_1001308332 104
746 3300006844 Ga0075428_100262592 Ga0075428_1002625922 104
747 3300006846 Ga0075430_100024687 Ga0075430_1000246874 104
748 3300006847 Ga0075431_100871651 Ga0075431_1008716512 104
749 3300006871 Ga0075434_100504932 Ga0075434_1005049322 104
750 3300006931 Ga0097620_100651994 Ga0097620_1006519941 104
751 3300007788 Ga0099795_10526707 Ga0099795_105267072 104
752 3300009147 Ga0114129_10319521 Ga0114129_103195212 104
753 3300009551 Ga0105238_12070853 Ga0105238_120708531 104
754 3300013306 Ga0163162_10131391 Ga0163162_101313912 104
755 3300013308 Ga0157375_10068289 Ga0157375_100682893 104
756 3300014326 Ga0157380_11206854 Ga0157380_112068541 104
757 3300014497 Ga0182008_10386642 Ga0182008_103866422 104
758 3300025918 Ga0207662_10108991 Ga0207662_101089913 104
759 3300025926 Ga0207659_10079709 Ga0207659_100797092 104
760 3300025926 Ga0207659_11486313 Ga0207659_114863131 104
761 3300025937 Ga0207669_10383878 Ga0207669_103838781 104
762 3300025940 Ga0207691_10005503 Ga0207691_100055039 104
763 3300025961 Ga0207712_10938756 Ga0207712_109387562 104
764 3300025972 Ga0207668_10213493 Ga0207668_102134933 104
765 3300026075 Ga0207708_10412434 Ga0207708_104124342 104
766 3300026088 Ga0207641_10324202 Ga0207641_103242022 104
767 3300026088 Ga0207641_11104943 Ga0207641_111049432 104
768 3300026089 Ga0207648_10011132 Ga0207648_100111327 104
769 3300026095 Ga0207676_12317861 Ga0207676_123178611 104
770 3300026121 Ga0207683_10100572 Ga0207683_101005723 104
771 3300028380 Ga0268265_10779522 Ga0268265_107795222 104
772 3300028381 Ga0268264_10175839 Ga0268264_101758392 104
773 3300035088 Ga0373940_0183855 Ga0373940_0183855_97_420 104
774 3300035115 Ga0373941_0393208 Ga0373941_0393208_125_463 104
775 3300035691 Ga0373931_0094161 Ga0373931_0094161_443_766 104
776 3300037853 Ga0436364_0341842 Ga0436364_0341842_129_470 104
777 3300042001 Ga0439441_101259 Ga0439441_101259_249_578 104
778 3300046528 Ga0495642_0229807 Ga0495642_0229807_70_405 104
779 3300050507 nmdc:mga05p37_264431_c1 nmdc:mga05p37_264431_c1_416_760 104
780 3300050510 nmdc:mga06r32_65621_c1 nmdc:mga06r32_65621_c1_2848_3189 104
781 3300050511 nmdc:mga08y16_513385_c1 nmdc:mga08y16_513385_c1_825_1145 104
782 3300050512 nmdc:mga0n895_956145_c1 nmdc:mga0n895_956145_c1_31_354 104
783 3300005328 Ga0070676_10264388 Ga0070676_102643882 105
784 3300005329 Ga0070683_102198067 Ga0070683_1021980671 105
785 3300005330 Ga0070690_100228768 Ga0070690_1002287682 105
786 3300005335 Ga0070666_10013113 Ga0070666_100131132 105
787 3300005337 Ga0070682_100065685 Ga0070682_1000656852 105
788 3300005340 Ga0070689_100276266 Ga0070689_1002762662 105
789 3300005343 Ga0070687_100052184 Ga0070687_1000521841 105
790 3300005343 Ga0070687_100138672 Ga0070687_1001386722 105
791 3300005344 Ga0070661_100108408 Ga0070661_1001084082 105
792 3300005347 Ga0070668_100249357 Ga0070668_1002493572 105
793 3300005353 Ga0070669_100286896 Ga0070669_1002868962 105
794 3300005353 Ga0070669_100574183 Ga0070669_1005741832 105
795 3300005354 Ga0070675_100000103 Ga0070675_10000010327 105
796 3300005354 Ga0070675_100035421 Ga0070675_1000354213 105
797 3300005354 Ga0070675_101134324 Ga0070675_1011343242 105
798 3300005355 Ga0070671_100033557 Ga0070671_1000335573 105
799 3300005356 Ga0070674_100177643 Ga0070674_1001776433 105
800 3300005364 Ga0070673_100016190 Ga0070673_1000161903 105
801 3300005365 Ga0070688_100071497 Ga0070688_1000714973 105
802 3300005367 Ga0070667_100011691 Ga0070667_1000116913 105
803 3300005440 Ga0070705_100293846 Ga0070705_1002938462 105
804 3300005455 Ga0070663_100915219 Ga0070663_1009152191 105
805 3300005456 Ga0070678_100358808 Ga0070678_1003588082 105
806 3300005466 Ga0070685_10011073 Ga0070685_100110734 105
807 3300005466 Ga0070685_10500382 Ga0070685_105003822 105
808 3300005543 Ga0070672_100004426 Ga0070672_1000044268 105
809 3300005543 Ga0070672_100511775 Ga0070672_1005117753 105
810 3300005543 Ga0070672_100752606 Ga0070672_1007526062 105
811 3300005544 Ga0070686_100144907 Ga0070686_1001449072 105
812 3300005548 Ga0070665_100183776 Ga0070665_1001837762 105
813 3300005564 Ga0070664_101132411 Ga0070664_1011324112 105
814 3300005577 Ga0068857_100623749 Ga0068857_1006237492 105
815 3300005617 Ga0068859_100001040 Ga0068859_1000010408 105
816 3300005617 Ga0068859_100001955 Ga0068859_1000019559 105
817 3300005618 Ga0068864_100407726 Ga0068864_1004077262 105
818 3300005719 Ga0068861_101068890 Ga0068861_1010688902 105
819 3300005840 Ga0068870_10470937 Ga0068870_104709372 105
820 3300005841 Ga0068863_100000572 Ga0068863_10000057214 105
821 3300005842 Ga0068858_100001626 Ga0068858_10000162611 105
822 3300005843 Ga0068860_100010500 Ga0068860_1000105007 105
823 3300005844 Ga0068862_100098913 Ga0068862_1000989132 105
824 3300005844 Ga0068862_100136327 Ga0068862_1001363273 105
825 3300006237 Ga0097621_100041838 Ga0097621_1000418384 105
826 3300006358 Ga0068871_100510972 Ga0068871_1005109722 105
827 3300006931 Ga0097620_100001040 Ga0097620_10000104016 105
828 3300006931 Ga0097620_100001955 Ga0097620_1000019559 105
829 3300009098 Ga0105245_10051311 Ga0105245_100513114 105
830 3300009148 Ga0105243_10880546 Ga0105243_108805462 105
831 3300009176 Ga0105242_10505620 Ga0105242_105056203 105
832 3300009177 Ga0105248_10000527 Ga0105248_1000052721 105
833 3300009553 Ga0105249_11661127 Ga0105249_116611272 105
834 3300013296 Ga0157374_11093973 Ga0157374_110939732 105
835 3300013306 Ga0163162_10006107 Ga0163162_100061079 105
836 3300013308 Ga0157375_10000420 Ga0157375_1000042015 105
837 3300014325 Ga0163163_10002143 Ga0163163_1000214312 105
838 3300014968 Ga0157379_10000292 Ga0157379_1000029216 105
839 3300014969 Ga0157376_10146042 Ga0157376_101460422 105
840 3300017792 Ga0163161_10028408 Ga0163161_100284083 105
841 3300025903 Ga0207680_10269032 Ga0207680_102690322 105
842 3300025918 Ga0207662_10898614 Ga0207662_108986142 105
843 3300025923 Ga0207681_10420889 Ga0207681_104208892 105
844 3300025923 Ga0207681_10754757 Ga0207681_107547572 105
845 3300025925 Ga0207650_10090014 Ga0207650_100900142 105
846 3300025926 Ga0207659_10006200 Ga0207659_100062002 105
847 3300025926 Ga0207659_10015205 Ga0207659_100152053 105
848 3300025926 Ga0207659_10023985 Ga0207659_100239853 105
849 3300025926 Ga0207659_10039841 Ga0207659_100398412 105
850 3300025927 Ga0207687_10730789 Ga0207687_107307892 105
851 3300025931 Ga0207644_10125951 Ga0207644_101259513 105
852 3300025934 Ga0207686_11105453 Ga0207686_111054532 105
853 3300025936 Ga0207670_10270063 Ga0207670_102700633 105
854 3300025937 Ga0207669_10685964 Ga0207669_106859642 105
855 3300025937 Ga0207669_11019009 Ga0207669_110190092 105
856 3300025940 Ga0207691_10009766 Ga0207691_100097662 105
857 3300025940 Ga0207691_10362045 Ga0207691_103620451 105
858 3300025940 Ga0207691_10708905 Ga0207691_107089052 105
859 3300025941 Ga0207711_10003479 Ga0207711_100034793 105
860 3300025941 Ga0207711_10133561 Ga0207711_101335613 105
861 3300025942 Ga0207689_10870802 Ga0207689_108708021 105
862 3300025945 Ga0207679_10090961 Ga0207679_100909613 105
863 3300025960 Ga0207651_10004091 Ga0207651_100040915 105
864 3300025960 Ga0207651_10323955 Ga0207651_103239552 105
865 3300025972 Ga0207668_10130222 Ga0207668_101302222 105
866 3300025986 Ga0207658_10014896 Ga0207658_100148963 105
867 3300026035 Ga0207703_10037133 Ga0207703_100371333 105
868 3300026075 Ga0207708_10469516 Ga0207708_104695162 105
869 3300026075 Ga0207708_10983287 Ga0207708_109832871 105
870 3300026088 Ga0207641_10001943 Ga0207641_100019434 105
871 3300026095 Ga0207676_10436550 Ga0207676_104365502 105
872 3300026116 Ga0207674_10498547 Ga0207674_104985473 105
873 3300027907 Ga0207428_10031609 Ga0207428_100316091 105
874 3300028379 Ga0268266_10183825 Ga0268266_101838253 105
875 3300028380 Ga0268265_10726508 Ga0268265_107265081 105
876 3300028381 Ga0268264_10005822 Ga0268264_100058223 105
877 3300032002 Ga0307416_103265362 Ga0307416_1032653621 105
878 3300047318 Ga0495636_0117749 Ga0495636_0117749_194_538 105
879 3300048911 Ga0496108_0332096 Ga0496108_0332096_418_765 105
880 3300049575 Ga0501039_1588599 Ga0501039_1588599_31_381 105
881 3300005336 Ga0070680_100159476 Ga0070680_1001594762 106
882 3300005458 Ga0070681_10031164 Ga0070681_100311645 106
883 3300005530 Ga0070679_100031410 Ga0070679_1000314105 106
884 3300014968 Ga0157379_11329916 Ga0157379_113299161 106
885 3300025912 Ga0207707_10023231 Ga0207707_100232314 106
886 3300025917 Ga0207660_10129400 Ga0207660_101294002 106
887 3300025921 Ga0207652_10056235 Ga0207652_100562353 106
888 3300025986 Ga0207658_11670726 Ga0207658_116707261 106
889 3300026035 Ga0207703_11474475 Ga0207703_114744752 106
890 3300026095 Ga0207676_12334943 Ga0207676_123349431 106
891 3300053153 Ga0500616_0109048 Ga0500616_0109048_426_758 107
892 3300005354 Ga0070675_100143053 Ga0070675_1001430532 108
893 3300005364 Ga0070673_100235410 Ga0070673_1002354103 108
894 3300005365 Ga0070688_100581292 Ga0070688_1005812922 108
895 3300005564 Ga0070664_100272367 Ga0070664_1002723672 108
896 3300009177 Ga0105248_10839989 Ga0105248_108399892 108
897 3300025945 Ga0207679_10340459 Ga0207679_103404592 108
898 2162886012 MBSR1b_contig_11158489 MBSR1b_0986.00003590 109
899 3300005288 Ga0065714_10250901 Ga0065714_102509012 109
900 3300005330 Ga0070690_100048099 Ga0070690_1000480993 109
901 3300005331 Ga0070670_100043037 Ga0070670_1000430372 109
902 3300005340 Ga0070689_100036377 Ga0070689_1000363773 109
903 3300005354 Ga0070675_100027006 Ga0070675_1000270063 109
904 3300005364 Ga0070673_102262967 Ga0070673_1022629671 109
905 3300005365 Ga0070688_100015100 Ga0070688_1000151002 109
906 3300005441 Ga0070700_101672916 Ga0070700_1016729162 109
907 3300005457 Ga0070662_100469769 Ga0070662_1004697692 109
908 3300005544 Ga0070686_100085706 Ga0070686_1000857062 109
909 3300005577 Ga0068857_100324107 Ga0068857_1003241072 109
910 3300009094 Ga0111539_10108841 Ga0111539_101088412 109
911 3300009094 Ga0111539_10155806 Ga0111539_101558063 109
912 3300009094 Ga0111539_11417318 Ga0111539_114173182 109
913 3300009177 Ga0105248_10100182 Ga0105248_101001823 109
914 3300013306 Ga0163162_12011677 Ga0163162_120116772 109
915 3300013308 Ga0157375_13176851 Ga0157375_131768512 109
916 3300014326 Ga0157380_10219948 Ga0157380_102199482 109
917 3300050511 nmdc:mga08y16_43202_c1 nmdc:mga08y16_43202_c1_3964_4308 109
918 3300050511 nmdc:mga08y16_85745_c1 nmdc:mga08y16_85745_c1_1572_1901 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07689

KaiB

KaiB domain

38

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n8y-assembly1.cif.gz_G kaicba circadian clock backbone model based on a cryo-em density 0.819 20 66
4kun-assembly1.cif.gz_B crystal structure of legionella pneumophila lpp1115 / kaib 0.7656 17 71
6iev-assembly1.cif.gz_C crystal structure of a designed protein 0.761 16 58
6iev-assembly1.cif.gz_A crystal structure of a designed protein 0.7594 16 63
5jwr-assembly1.cif.gz_B crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus 0.7552 17 71
ID Description Score Start End Superfamily
1t4zA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7664 18 71 3.40.30.10
4kunB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7656 17 71 3.40.30.10
af_P82890_1_152_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7383 19 57 3.40.50.2300
5jwoB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7351 17 71 3.40.30.10
1urgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.735 19 62 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1V1PC86-F1-model_v4 Circadian clock protein KaiB 0.9482 18 66 GO:0048511
AF-A0A1F9PH16-F1-model_v4 KaiB domain-containing protein 0.9408 18 66 GO:0048511
AF-A0A657Q190-F1-model_v4 Circadian clock protein KaiB 0.9286 13 66 GO:0048511
AF-A0A7V9KD35-F1-model_v4 Circadian clock protein KaiB 0.9268 13 66 GO:0048511
AF-A0A7X6AH67-F1-model_v4 deleted 0.9205 17 66

Feature Viewer

pLDDT pTM Quality
69.42 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map