F485598
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 915 | 397 | 907 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0002196|Ga0395905_0002196_19433_19939 |
| Length | 168 |
| Sequence | MMDATFASMIFLQSGRTASTIQSGEINMKRTASAAWTGGLKDGKGNISTQSGVLSDTQYGFSSRFESGIGTNPEELIAAAHAGCFTMALSAQLGEAGITAEKLETTAAVTLDKVDGGFAITAIQLDLVAKIPGADQKVFEEAARKAKEGCPVSKLLNAEITLNSKLES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 2 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 3 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 4 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 5 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 6 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 7 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 8 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 9 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 189 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 209 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 210 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 229 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 232 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 305 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 309 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 340 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 341 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 342 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 345 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 347 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 348 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.17 |
| Metatranscriptomes | 15.96 |
| Isolates | 0.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.64 |
| Nodule | 0.11 |
| Rhizoplane | 4.81 |
| Rhizosphere | 91.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001069 | 3300000546 | Bacteria | 4287 |
| 2 | rootH1_10166822 | 3300003316 | Unclassified | 1649 |
| 3 | rootH2_10327266 | 3300003320 | Bacteria | 1371 |
| 4 | Ga0058863_10086366 | 3300004799 | Bacteria | 1170 |
| 5 | Ga0058863_10169191 | 3300004799 | Bacteria | 2133 |
| 6 | Ga0058861_10016523 | 3300004800 | Bacteria | 1012 |
| 7 | Ga0058861_10040453 | 3300004800 | Bacteria | 650 |
| 8 | Ga0058862_10279902 | 3300004803 | Bacteria | 827 |
| 9 | Ga0058862_12704330 | 3300004803 | Bacteria | 2853 |
| 10 | Ga0058862_12825811 | 3300004803 | Bacteria | 585 |
| 11 | Ga0070658_10034779 | 3300005327 | Bacteria | 4055 |
| 12 | Ga0070676_10027262 | 3300005328 | Bacteria | 3238 |
| 13 | Ga0070683_100182240 | 3300005329 | Bacteria | 1994 |
| 14 | Ga0070683_100289713 | 3300005329 | Bacteria | 1557 |
| 15 | Ga0070683_100703916 | 3300005329 | Bacteria | 967 |
| 16 | Ga0070683_101242974 | 3300005329 | Bacteria | 716 |
| 17 | Ga0070690_100144860 | 3300005330 | Bacteria | 1615 |
| 18 | Ga0070677_10056078 | 3300005333 | Bacteria | 1610 |
| 19 | Ga0068869_100031446 | 3300005334 | Bacteria | 3734 |
| 20 | Ga0068869_100042357 | 3300005334 | Bacteria | 3263 |
| 21 | Ga0068869_100091915 | 3300005334 | Bacteria | 2283 |
| 22 | Ga0070666_10299951 | 3300005335 | Bacteria | 1144 |
| 23 | Ga0070680_100053591 | 3300005336 | Bacteria | 3293 |
| 24 | Ga0070680_100114489 | 3300005336 | Bacteria | 2247 |
| 25 | Ga0070680_100365642 | 3300005336 | Bacteria | 1227 |
| 26 | Ga0070682_100559703 | 3300005337 | Bacteria | 896 |
| 27 | Ga0070682_101217062 | 3300005337 | Unclassified | 636 |
| 28 | Ga0068868_100083377 | 3300005338 | Bacteria | 2566 |
| 29 | Ga0068868_100259213 | 3300005338 | Bacteria | 1466 |
| 30 | Ga0068868_101282011 | 3300005338 | Bacteria | 680 |
| 31 | Ga0070660_100259930 | 3300005339 | Bacteria | 1417 |
| 32 | Ga0070660_100294666 | 3300005339 | Bacteria | 1329 |
| 33 | Ga0070660_101228166 | 3300005339 | Bacteria | 636 |
| 34 | Ga0070661_100029525 | 3300005344 | Bacteria | 3958 |
| 35 | Ga0070661_100514835 | 3300005344 | Bacteria | 959 |
| 36 | Ga0070661_101052665 | 3300005344 | Bacteria | 676 |
| 37 | Ga0070668_100035392 | 3300005347 | Bacteria | 3807 |
| 38 | Ga0070675_100172173 | 3300005354 | Bacteria | 1868 |
| 39 | Ga0070674_100145322 | 3300005356 | Bacteria | 1784 |
| 40 | Ga0070674_100874929 | 3300005356 | Bacteria | 781 |
| 41 | Ga0070674_101838990 | 3300005356 | Bacteria | 549 |
| 42 | Ga0070673_100124093 | 3300005364 | Bacteria | 2158 |
| 43 | Ga0070688_101739287 | 3300005365 | Bacteria | 511 |
| 44 | Ga0070659_100009699 | 3300005366 | Bacteria | 7074 |
| 45 | Ga0070659_100120996 | 3300005366 | Bacteria | 2120 |
| 46 | Ga0070659_100337811 | 3300005366 | Bacteria | 1261 |
| 47 | Ga0070667_100074620 | 3300005367 | Bacteria | 2894 |
| 48 | Ga0070667_100172287 | 3300005367 | Bacteria | 1911 |
| 49 | Ga0070667_100613076 | 3300005367 | Bacteria | 1003 |
| 50 | Ga0070667_101161140 | 3300005367 | Bacteria | 722 |
| 51 | Ga0070709_10065312 | 3300005434 | Bacteria | 2330 |
| 52 | Ga0070709_10096933 | 3300005434 | Bacteria | 1956 |
| 53 | Ga0070709_10130731 | 3300005434 | Bacteria | 1714 |
| 54 | Ga0070709_11430068 | 3300005434 | Unclassified | 560 |
| 55 | Ga0070714_100044401 | 3300005435 | Bacteria | 3762 |
| 56 | Ga0070714_100120267 | 3300005435 | Bacteria | 2335 |
| 57 | Ga0070714_100251061 | 3300005435 | Bacteria | 1636 |
| 58 | Ga0070714_100463996 | 3300005435 | Unclassified | 1204 |
| 59 | Ga0070714_100942820 | 3300005435 | Bacteria | 839 |
| 60 | Ga0070714_101517440 | 3300005435 | Bacteria | 655 |
| 61 | Ga0070714_101658704 | 3300005435 | Bacteria | 624 |
| 62 | Ga0070713_100099060 | 3300005436 | Bacteria | 2521 |
| 63 | Ga0070713_100128559 | 3300005436 | Bacteria | 2231 |
| 64 | Ga0070713_100232745 | 3300005436 | Bacteria | 1675 |
| 65 | Ga0070713_100251643 | 3300005436 | Bacteria | 1611 |
| 66 | Ga0070710_10094959 | 3300005437 | Bacteria | 1765 |
| 67 | Ga0070711_100003132 | 3300005439 | Bacteria | 9587 |
| 68 | Ga0070711_100056169 | 3300005439 | Bacteria | 2722 |
| 69 | Ga0070711_100160005 | 3300005439 | Bacteria | 1706 |
| 70 | Ga0070711_100964879 | 3300005439 | Bacteria | 730 |
| 71 | Ga0070705_100024135 | 3300005440 | Bacteria | 3278 |
| 72 | Ga0070705_100164580 | 3300005440 | Bacteria | 1486 |
| 73 | Ga0070705_100626880 | 3300005440 | Bacteria | 835 |
| 74 | Ga0070708_100027576 | 3300005445 | Bacteria | 4875 |
| 75 | Ga0070708_100039185 | 3300005445 | Bacteria | 4145 |
| 76 | Ga0070708_100228402 | 3300005445 | Bacteria | 1746 |
| 77 | Ga0070708_100460244 | 3300005445 | Unclassified | 1200 |
| 78 | Ga0070708_101415699 | 3300005445 | Bacteria | 648 |
| 79 | Ga0070663_100112126 | 3300005455 | Bacteria | 2051 |
| 80 | Ga0070663_100689596 | 3300005455 | Bacteria | 867 |
| 81 | Ga0070678_100003496 | 3300005456 | Bacteria | 8756 |
| 82 | Ga0070678_101131826 | 3300005456 | Bacteria | 724 |
| 83 | Ga0070662_100166573 | 3300005457 | Bacteria | 1727 |
| 84 | Ga0070662_100687240 | 3300005457 | Bacteria | 865 |
| 85 | Ga0070662_101429197 | 3300005457 | Bacteria | 596 |
| 86 | Ga0070681_10019745 | 3300005458 | Bacteria | 6749 |
| 87 | Ga0070681_10028870 | 3300005458 | Bacteria | 5573 |
| 88 | Ga0070681_10215999 | 3300005458 | Unclassified | 1833 |
| 89 | Ga0070681_10324364 | 3300005458 | Bacteria | 1449 |
| 90 | Ga0070681_10411539 | 3300005458 | Bacteria | 1264 |
| 91 | Ga0070681_10827502 | 3300005458 | Bacteria | 843 |
| 92 | Ga0068867_100078756 | 3300005459 | Bacteria | 2479 |
| 93 | Ga0068867_100313148 | 3300005459 | Bacteria | 1298 |
| 94 | Ga0068867_100764123 | 3300005459 | Bacteria | 859 |
| 95 | Ga0070685_10315238 | 3300005466 | Bacteria | 1058 |
| 96 | Ga0070706_100345862 | 3300005467 | Bacteria | 1386 |
| 97 | Ga0070707_100004850 | 3300005468 | Bacteria | 12603 |
| 98 | Ga0070707_100279293 | 3300005468 | Bacteria | 1623 |
| 99 | Ga0070707_100422840 | 3300005468 | Unclassified | 1293 |
| 100 | Ga0070707_100423774 | 3300005468 | Bacteria | 1291 |
| 101 | Ga0070698_100001375 | 3300005471 | Bacteria | 27052 |
| 102 | Ga0070698_100007655 | 3300005471 | Bacteria | 11687 |
| 103 | Ga0070698_100009642 | 3300005471 | Bacteria | 10329 |
| 104 | Ga0070698_100041339 | 3300005471 | Bacteria | 4732 |
| 105 | Ga0070699_100059421 | 3300005518 | Bacteria | 3311 |
| 106 | Ga0070699_100606773 | 3300005518 | Bacteria | 998 |
| 107 | Ga0070699_100760776 | 3300005518 | Bacteria | 886 |
| 108 | Ga0070699_100880319 | 3300005518 | Bacteria | 820 |
| 109 | Ga0070679_100000958 | 3300005530 | Bacteria | 25121 |
| 110 | Ga0070679_100008320 | 3300005530 | Bacteria | 9758 |
| 111 | Ga0070679_100082834 | 3300005530 | Bacteria | 3197 |
| 112 | Ga0070679_100118050 | 3300005530 | Bacteria | 2637 |
| 113 | Ga0070679_100241474 | 3300005530 | Bacteria | 1764 |
| 114 | Ga0070679_100310879 | 3300005530 | Bacteria | 1526 |
| 115 | Ga0070684_100006317 | 3300005535 | Bacteria | 9156 |
| 116 | Ga0070684_100308058 | 3300005535 | Bacteria | 1454 |
| 117 | Ga0070684_100798320 | 3300005535 | Bacteria | 882 |
| 118 | Ga0070697_100292145 | 3300005536 | Bacteria | 1400 |
| 119 | Ga0068853_100485837 | 3300005539 | Bacteria | 1165 |
| 120 | Ga0068853_100732461 | 3300005539 | Bacteria | 944 |
| 121 | Ga0068853_100879063 | 3300005539 | Bacteria | 860 |
| 122 | Ga0068853_100888716 | 3300005539 | Bacteria | 855 |
| 123 | Ga0070686_100057415 | 3300005544 | Bacteria | 2500 |
| 124 | Ga0070695_100061882 | 3300005545 | Unclassified | 2429 |
| 125 | Ga0070693_100013777 | 3300005547 | Bacteria | 4126 |
| 126 | Ga0070693_100021726 | 3300005547 | Bacteria | 3402 |
| 127 | Ga0070693_100761151 | 3300005547 | Bacteria | 714 |
| 128 | Ga0070665_100000391 | 3300005548 | Bacteria | 64820 |
| 129 | Ga0070665_100154533 | 3300005548 | Bacteria | 2296 |
| 130 | Ga0070665_101871498 | 3300005548 | Bacteria | 606 |
| 131 | Ga0070704_100558899 | 3300005549 | Bacteria | 1001 |
| 132 | Ga0068855_100100486 | 3300005563 | Bacteria | 3330 |
| 133 | Ga0068855_100111363 | 3300005563 | Bacteria | 3143 |
| 134 | Ga0068855_100129120 | 3300005563 | Bacteria | 2887 |
| 135 | Ga0068855_100131214 | 3300005563 | Bacteria | 2861 |
| 136 | Ga0070664_100401506 | 3300005564 | Bacteria | 1253 |
| 137 | Ga0068857_100040030 | 3300005577 | Bacteria | 4156 |
| 138 | Ga0068857_100227267 | 3300005577 | Bacteria | 1706 |
| 139 | Ga0068854_100092555 | 3300005578 | Bacteria | 2252 |
| 140 | Ga0068854_100192745 | 3300005578 | Bacteria | 1598 |
| 141 | Ga0068856_100315011 | 3300005614 | Bacteria | 1582 |
| 142 | Ga0068856_101000263 | 3300005614 | Bacteria | 854 |
| 143 | Ga0068856_101260083 | 3300005614 | Bacteria | 755 |
| 144 | Ga0068856_102650767 | 3300005614 | Bacteria | 507 |
| 145 | Ga0068852_100075097 | 3300005616 | Bacteria | 2980 |
| 146 | Ga0068852_100392618 | 3300005616 | Bacteria | 1363 |
| 147 | Ga0068852_100879737 | 3300005616 | Unclassified | 912 |
| 148 | Ga0068852_101417154 | 3300005616 | Bacteria | 717 |
| 149 | Ga0068852_102061475 | 3300005616 | Unclassified | 592 |
| 150 | Ga0068859_100018620 | 3300005617 | Bacteria | 6980 |
| 151 | Ga0068859_100052217 | 3300005617 | Unclassified | 4109 |
| 152 | Ga0068859_100092999 | 3300005617 | Bacteria | 3067 |
| 153 | Ga0068859_100178193 | 3300005617 | Bacteria | 2208 |
| 154 | Ga0068859_100298246 | 3300005617 | Bacteria | 1705 |
| 155 | Ga0068859_100506921 | 3300005617 | Bacteria | 1302 |
| 156 | Ga0068859_100923001 | 3300005617 | Bacteria | 957 |
| 157 | Ga0068859_101207982 | 3300005617 | Bacteria | 833 |
| 158 | Ga0068864_100068413 | 3300005618 | Bacteria | 3085 |
| 159 | Ga0068864_100823596 | 3300005618 | Bacteria | 913 |
| 160 | Ga0068864_101296838 | 3300005618 | Bacteria | 728 |
| 161 | Ga0068866_10080513 | 3300005718 | Bacteria | 1747 |
| 162 | Ga0068861_100091750 | 3300005719 | Bacteria | 2399 |
| 163 | Ga0068861_100214668 | 3300005719 | Bacteria | 1622 |
| 164 | Ga0068851_10125167 | 3300005834 | Bacteria | 1385 |
| 165 | Ga0068851_10502236 | 3300005834 | Bacteria | 727 |
| 166 | Ga0068870_10027185 | 3300005840 | Bacteria | 2859 |
| 167 | Ga0068863_100002412 | 3300005841 | Bacteria | 18565 |
| 168 | Ga0068863_100021310 | 3300005841 | Bacteria | 6185 |
| 169 | Ga0068863_100246439 | 3300005841 | Bacteria | 1725 |
| 170 | Ga0068863_101580882 | 3300005841 | Bacteria | 665 |
| 171 | Ga0068863_101660866 | 3300005841 | Bacteria | 648 |
| 172 | Ga0068858_100025426 | 3300005842 | Bacteria | 5509 |
| 173 | Ga0068858_100116326 | 3300005842 | Bacteria | 2499 |
| 174 | Ga0068858_100550516 | 3300005842 | Bacteria | 1117 |
| 175 | Ga0068858_101248359 | 3300005842 | Bacteria | 731 |
| 176 | Ga0068860_100020699 | 3300005843 | Bacteria | 6373 |
| 177 | Ga0068860_100027511 | 3300005843 | Bacteria | 5476 |
| 178 | Ga0068860_100056618 | 3300005843 | Bacteria | 3726 |
| 179 | Ga0068860_100159899 | 3300005843 | Bacteria | 2172 |
| 180 | Ga0068860_100269693 | 3300005843 | Bacteria | 1661 |
| 181 | Ga0068860_100969438 | 3300005843 | Bacteria | 868 |
| 182 | Ga0068860_101135247 | 3300005843 | Bacteria | 801 |
| 183 | Ga0068862_100278398 | 3300005844 | Bacteria | 1532 |
| 184 | Ga0068862_101838212 | 3300005844 | Bacteria | 615 |
| 185 | Ga0081540_1213712 | 3300005983 | Bacteria | 691 |
| 186 | Ga0070717_10398630 | 3300006028 | Unclassified | 1236 |
| 187 | Ga0070717_10474973 | 3300006028 | Bacteria | 1129 |
| 188 | Ga0070717_10569050 | 3300006028 | Bacteria | 1027 |
| 189 | Ga0070717_10635640 | 3300006028 | Bacteria | 969 |
| 190 | Ga0070717_11666994 | 3300006028 | Bacteria | 577 |
| 191 | Ga0070715_10081441 | 3300006163 | Bacteria | 1470 |
| 192 | Ga0070715_10117164 | 3300006163 | Bacteria | 1265 |
| 193 | Ga0070715_10425504 | 3300006163 | Bacteria | 744 |
| 194 | Ga0070715_10443497 | 3300006163 | Bacteria | 731 |
| 195 | Ga0070716_100038082 | 3300006173 | Bacteria | 2661 |
| 196 | Ga0070716_100111714 | 3300006173 | Bacteria | 1695 |
| 197 | Ga0070716_100517043 | 3300006173 | Bacteria | 884 |
| 198 | Ga0070712_100009764 | 3300006175 | Bacteria | 6048 |
| 199 | Ga0070712_100147025 | 3300006175 | Bacteria | 1805 |
| 200 | Ga0070712_100715313 | 3300006175 | Bacteria | 855 |
| 201 | Ga0070712_100738516 | 3300006175 | Bacteria | 842 |
| 202 | Ga0070712_101947838 | 3300006175 | Bacteria | 515 |
| 203 | Ga0075367_10585419 | 3300006178 | Bacteria | 709 |
| 204 | Ga0075366_10010141 | 3300006195 | Bacteria | 5282 |
| 205 | Ga0075366_10051605 | 3300006195 | Bacteria | 2444 |
| 206 | Ga0097621_100036118 | 3300006237 | Bacteria | 3952 |
| 207 | Ga0097621_100198944 | 3300006237 | Bacteria | 1739 |
| 208 | Ga0068871_100002381 | 3300006358 | Bacteria | 12820 |
| 209 | Ga0068871_100191938 | 3300006358 | Bacteria | 1760 |
| 210 | Ga0068871_100579516 | 3300006358 | Unclassified | 1018 |
| 211 | Ga0075428_100003175 | 3300006844 | Bacteria | 17960 |
| 212 | Ga0075431_101196053 | 3300006847 | Bacteria | 723 |
| 213 | Ga0075434_100004172 | 3300006871 | Bacteria | 12949 |
| 214 | Ga0075434_100010159 | 3300006871 | Bacteria | 8818 |
| 215 | Ga0075434_100521769 | 3300006871 | Bacteria | 1208 |
| 216 | Ga0075434_100553503 | 3300006871 | Bacteria | 1170 |
| 217 | Ga0068865_100099788 | 3300006881 | Unclassified | 2123 |
| 218 | Ga0068865_100344456 | 3300006881 | Bacteria | 1205 |
| 219 | Ga0068865_100657344 | 3300006881 | Bacteria | 891 |
| 220 | Ga0075436_100230686 | 3300006914 | Bacteria | 1315 |
| 221 | Ga0075436_101407922 | 3300006914 | Unclassified | 529 |
| 222 | Ga0097620_100018620 | 3300006931 | Bacteria | 6980 |
| 223 | Ga0097620_100052221 | 3300006931 | Unclassified | 4109 |
| 224 | Ga0097620_100093004 | 3300006931 | Bacteria | 3067 |
| 225 | Ga0097620_100178209 | 3300006931 | Bacteria | 2208 |
| 226 | Ga0097620_100298283 | 3300006931 | Bacteria | 1705 |
| 227 | Ga0097620_100922770 | 3300006931 | Bacteria | 957 |
| 228 | Ga0097620_101208025 | 3300006931 | Bacteria | 833 |
| 229 | Ga0075435_100097258 | 3300007076 | Bacteria | 2436 |
| 230 | Ga0075435_100288125 | 3300007076 | Bacteria | 1403 |
| 231 | Ga0075435_100513187 | 3300007076 | Bacteria | 1037 |
| 232 | Ga0075435_100693015 | 3300007076 | Bacteria | 885 |
| 233 | Ga0075435_100891819 | 3300007076 | Bacteria | 775 |
| 234 | Ga0099794_10000752 | 3300007265 | Bacteria | 10915 |
| 235 | Ga0099794_10004425 | 3300007265 | Bacteria | 5520 |
| 236 | Ga0099794_10025943 | 3300007265 | Bacteria | 2704 |
| 237 | Ga0099794_10116411 | 3300007265 | Unclassified | 1342 |
| 238 | Ga0099794_10184704 | 3300007265 | Bacteria | 1065 |
| 239 | Ga0099794_10224941 | 3300007265 | Bacteria | 964 |
| 240 | Ga0099794_10238461 | 3300007265 | Bacteria | 936 |
| 241 | Ga0099795_10220533 | 3300007788 | Bacteria | 807 |
| 242 | Ga0105251_10566001 | 3300009011 | Bacteria | 537 |
| 243 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 244 | Ga0105240_10008663 | 3300009093 | Bacteria | 14523 |
| 245 | Ga0105240_10015281 | 3300009093 | Bacteria | 10447 |
| 246 | Ga0105240_10267253 | 3300009093 | Bacteria | 1971 |
| 247 | Ga0105240_10507597 | 3300009093 | Bacteria | 1340 |
| 248 | Ga0105240_11741054 | 3300009093 | Bacteria | 650 |
| 249 | Ga0111539_10029445 | 3300009094 | Bacteria | 6687 |
| 250 | Ga0111539_10079181 | 3300009094 | Bacteria | 3865 |
| 251 | Ga0111539_12016933 | 3300009094 | Bacteria | 669 |
| 252 | Ga0105245_10067363 | 3300009098 | Bacteria | 3243 |
| 253 | Ga0105245_10067936 | 3300009098 | Bacteria | 3229 |
| 254 | Ga0105245_10772835 | 3300009098 | Bacteria | 997 |
| 255 | Ga0105247_10830701 | 3300009101 | Bacteria | 707 |
| 256 | Ga0105243_10505453 | 3300009148 | Bacteria | 1146 |
| 257 | Ga0105243_10941623 | 3300009148 | Bacteria | 862 |
| 258 | Ga0105241_10183200 | 3300009174 | Bacteria | 1739 |
| 259 | Ga0105241_10494279 | 3300009174 | Bacteria | 1090 |
| 260 | Ga0105241_12495273 | 3300009174 | Bacteria | 517 |
| 261 | Ga0105242_10158231 | 3300009176 | Bacteria | 1981 |
| 262 | Ga0105242_10480771 | 3300009176 | Bacteria | 1177 |
| 263 | Ga0105242_11464825 | 3300009176 | Bacteria | 712 |
| 264 | Ga0105248_10025404 | 3300009177 | Bacteria | 6586 |
| 265 | Ga0105248_11078314 | 3300009177 | Bacteria | 908 |
| 266 | Ga0105237_10026026 | 3300009545 | Bacteria | 5980 |
| 267 | Ga0105237_10183316 | 3300009545 | Bacteria | 2093 |
| 268 | Ga0105237_10198587 | 3300009545 | Bacteria | 2005 |
| 269 | Ga0105237_10304741 | 3300009545 | Bacteria | 1596 |
| 270 | Ga0105237_10559561 | 3300009545 | Bacteria | 1150 |
| 271 | Ga0105237_11270334 | 3300009545 | Bacteria | 743 |
| 272 | Ga0105238_10006718 | 3300009551 | Bacteria | 11481 |
| 273 | Ga0105238_10373450 | 3300009551 | Bacteria | 1416 |
| 274 | Ga0105238_10788970 | 3300009551 | Bacteria | 965 |
| 275 | Ga0105238_11438290 | 3300009551 | Bacteria | 717 |
| 276 | Ga0105238_12614215 | 3300009551 | Bacteria | 541 |
| 277 | Ga0105249_10125804 | 3300009553 | Bacteria | 2441 |
| 278 | Ga0105249_10135817 | 3300009553 | Bacteria | 2353 |
| 279 | Ga0105249_10625041 | 3300009553 | Bacteria | 1133 |
| 280 | Ga0105249_11056364 | 3300009553 | Bacteria | 882 |
| 281 | Ga0099796_10096753 | 3300010159 | Unclassified | 1105 |
| 282 | Ga0099796_10172579 | 3300010159 | Bacteria | 863 |
| 283 | Ga0105239_10027895 | 3300010375 | Bacteria | 6212 |
| 284 | Ga0105239_10281149 | 3300010375 | Bacteria | 1873 |
| 285 | Ga0105239_10781257 | 3300010375 | Bacteria | 1094 |
| 286 | Ga0105239_10912269 | 3300010375 | Bacteria | 1008 |
| 287 | Ga0105239_13243291 | 3300010375 | Bacteria | 530 |
| 288 | Ga0105246_10013082 | 3300011119 | Bacteria | 5193 |
| 289 | Ga0157370_10019224 | 3300013104 | Bacteria | 6861 |
| 290 | Ga0157370_10061081 | 3300013104 | Bacteria | 3576 |
| 291 | Ga0157370_10073414 | 3300013104 | Bacteria | 3228 |
| 292 | Ga0157370_10146320 | 3300013104 | Bacteria | 2200 |
| 293 | Ga0157369_10005530 | 3300013105 | Bacteria | 14670 |
| 294 | Ga0157369_10020894 | 3300013105 | Bacteria | 7320 |
| 295 | Ga0157369_10067463 | 3300013105 | Bacteria | 3846 |
| 296 | Ga0157369_10117643 | 3300013105 | Bacteria | 2821 |
| 297 | Ga0157369_10150759 | 3300013105 | Unclassified | 2457 |
| 298 | Ga0157369_10365937 | 3300013105 | Bacteria | 1497 |
| 299 | Ga0157369_10761942 | 3300013105 | Bacteria | 995 |
| 300 | Ga0157369_10975744 | 3300013105 | Bacteria | 868 |
| 301 | Ga0157374_10000046 | 3300013296 | Bacteria | 140823 |
| 302 | Ga0157374_10021854 | 3300013296 | Bacteria | 5701 |
| 303 | Ga0157374_10071311 | 3300013296 | Bacteria | 3275 |
| 304 | Ga0157374_10266416 | 3300013296 | Bacteria | 1689 |
| 305 | Ga0157374_10787913 | 3300013296 | Bacteria | 966 |
| 306 | Ga0157374_11107398 | 3300013296 | Bacteria | 812 |
| 307 | Ga0157378_10000683 | 3300013297 | Bacteria | 31888 |
| 308 | Ga0157378_10003013 | 3300013297 | Bacteria | 14969 |
| 309 | Ga0157378_10226518 | 3300013297 | Unclassified | 1779 |
| 310 | Ga0157378_10491317 | 3300013297 | Bacteria | 1225 |
| 311 | Ga0157378_10950556 | 3300013297 | Bacteria | 892 |
| 312 | Ga0163162_10133922 | 3300013306 | Bacteria | 2588 |
| 313 | Ga0163162_10325912 | 3300013306 | Bacteria | 1668 |
| 314 | Ga0163162_10505579 | 3300013306 | Bacteria | 1339 |
| 315 | Ga0163162_11031160 | 3300013306 | Bacteria | 931 |
| 316 | Ga0163162_13306928 | 3300013306 | Bacteria | 516 |
| 317 | Ga0157372_10064455 | 3300013307 | Bacteria | 4111 |
| 318 | Ga0157372_10077167 | 3300013307 | Unclassified | 3762 |
| 319 | Ga0157372_10250156 | 3300013307 | Bacteria | 2057 |
| 320 | Ga0157372_10273232 | 3300013307 | Bacteria | 1964 |
| 321 | Ga0157372_10396047 | 3300013307 | Bacteria | 1609 |
| 322 | Ga0157375_10139325 | 3300013308 | Bacteria | 2552 |
| 323 | Ga0157375_11354989 | 3300013308 | Bacteria | 837 |
| 324 | Ga0163163_10310653 | 3300014325 | Bacteria | 1629 |
| 325 | Ga0163163_10321046 | 3300014325 | Bacteria | 1602 |
| 326 | Ga0163163_10636787 | 3300014325 | Bacteria | 1130 |
| 327 | Ga0157377_10636980 | 3300014745 | Bacteria | 765 |
| 328 | Ga0157379_10050216 | 3300014968 | Bacteria | 3723 |
| 329 | Ga0157379_10121231 | 3300014968 | Bacteria | 2352 |
| 330 | Ga0157379_10329573 | 3300014968 | Bacteria | 1395 |
| 331 | Ga0157376_10000017 | 3300014969 | Bacteria | 268501 |
| 332 | Ga0157376_10000218 | 3300014969 | Bacteria | 39706 |
| 333 | Ga0157376_10007881 | 3300014969 | Bacteria | 7638 |
| 334 | Ga0157376_10781969 | 3300014969 | Bacteria | 966 |
| 335 | Ga0206356_11036649 | 3300020070 | Bacteria | 628 |
| 336 | Ga0206356_11258529 | 3300020070 | Bacteria | 1236 |
| 337 | Ga0206351_10037410 | 3300020077 | Bacteria | 529 |
| 338 | Ga0206351_10437456 | 3300020077 | Bacteria | 784 |
| 339 | Ga0206350_10111732 | 3300020080 | Bacteria | 1774 |
| 340 | Ga0206354_11605239 | 3300020081 | Bacteria | 594 |
| 341 | Ga0213876_10060491 | 3300021384 | Bacteria | 1998 |
| 342 | Ga0224712_10047143 | 3300022467 | Bacteria | 1657 |
| 343 | Ga0224712_10300915 | 3300022467 | Bacteria | 750 |
| 344 | Ga0224712_10632192 | 3300022467 | Bacteria | 524 |
| 345 | Ga0209233_1020262 | 3300025261 | Bacteria | 1748 |
| 346 | Ga0207697_10125290 | 3300025315 | Bacteria | 1108 |
| 347 | Ga0207656_10686951 | 3300025321 | Bacteria | 524 |
| 348 | Ga0207682_10090084 | 3300025893 | Bacteria | 1328 |
| 349 | Ga0207692_10146768 | 3300025898 | Bacteria | 1347 |
| 350 | Ga0207692_10249164 | 3300025898 | Bacteria | 1064 |
| 351 | Ga0207692_10399921 | 3300025898 | Bacteria | 856 |
| 352 | Ga0207642_10093179 | 3300025899 | Bacteria | 1493 |
| 353 | Ga0207642_10721659 | 3300025899 | Bacteria | 629 |
| 354 | Ga0207710_10428119 | 3300025900 | Bacteria | 681 |
| 355 | Ga0207680_10121307 | 3300025903 | Unclassified | 1710 |
| 356 | Ga0207685_10080505 | 3300025905 | Bacteria | 1346 |
| 357 | Ga0207685_10514558 | 3300025905 | Bacteria | 632 |
| 358 | Ga0207699_10006592 | 3300025906 | Bacteria | 5635 |
| 359 | Ga0207699_10292632 | 3300025906 | Bacteria | 1135 |
| 360 | Ga0207699_10701184 | 3300025906 | Unclassified | 741 |
| 361 | Ga0207699_10813639 | 3300025906 | Bacteria | 687 |
| 362 | Ga0207699_10831843 | 3300025906 | Unclassified | 679 |
| 363 | Ga0207699_11041166 | 3300025906 | Unclassified | 605 |
| 364 | Ga0207645_10003014 | 3300025907 | Bacteria | 13011 |
| 365 | Ga0207643_10046885 | 3300025908 | Bacteria | 2443 |
| 366 | Ga0207705_10004135 | 3300025909 | Bacteria | 11004 |
| 367 | Ga0207705_11422657 | 3300025909 | Bacteria | 527 |
| 368 | Ga0207684_10029497 | 3300025910 | Unclassified | 4671 |
| 369 | Ga0207654_10191743 | 3300025911 | Bacteria | 1340 |
| 370 | Ga0207707_10034581 | 3300025912 | Bacteria | 4421 |
| 371 | Ga0207707_10105532 | 3300025912 | Bacteria | 2463 |
| 372 | Ga0207707_10223446 | 3300025912 | Bacteria | 1639 |
| 373 | Ga0207707_10686578 | 3300025912 | Bacteria | 861 |
| 374 | Ga0207707_10711081 | 3300025912 | Bacteria | 843 |
| 375 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 376 | Ga0207695_10000249 | 3300025913 | Bacteria | 140258 |
| 377 | Ga0207695_10669431 | 3300025913 | Bacteria | 919 |
| 378 | Ga0207671_10010842 | 3300025914 | Bacteria | 7477 |
| 379 | Ga0207671_10053536 | 3300025914 | Bacteria | 2990 |
| 380 | Ga0207671_10105771 | 3300025914 | Unclassified | 2136 |
| 381 | Ga0207671_10318255 | 3300025914 | Bacteria | 1231 |
| 382 | Ga0207693_10020281 | 3300025915 | Bacteria | 5288 |
| 383 | Ga0207693_10075349 | 3300025915 | Bacteria | 2642 |
| 384 | Ga0207693_10321395 | 3300025915 | Bacteria | 1211 |
| 385 | Ga0207693_10337539 | 3300025915 | Bacteria | 1179 |
| 386 | Ga0207693_10415356 | 3300025915 | Bacteria | 1052 |
| 387 | Ga0207693_10442317 | 3300025915 | Unclassified | 1016 |
| 388 | Ga0207663_10000828 | 3300025916 | Bacteria | 13994 |
| 389 | Ga0207663_10150977 | 3300025916 | Unclassified | 1630 |
| 390 | Ga0207663_10441017 | 3300025916 | Bacteria | 1003 |
| 391 | Ga0207660_10002550 | 3300025917 | Bacteria | 11972 |
| 392 | Ga0207660_10217497 | 3300025917 | Unclassified | 1498 |
| 393 | Ga0207660_10664268 | 3300025917 | Bacteria | 850 |
| 394 | Ga0207657_10254847 | 3300025919 | Bacteria | 1398 |
| 395 | Ga0207649_10021003 | 3300025920 | Bacteria | 3751 |
| 396 | Ga0207649_11313209 | 3300025920 | Bacteria | 572 |
| 397 | Ga0207652_10066798 | 3300025921 | Bacteria | 3117 |
| 398 | Ga0207652_10173368 | 3300025921 | Bacteria | 1936 |
| 399 | Ga0207652_10233076 | 3300025921 | Bacteria | 1659 |
| 400 | Ga0207652_10300795 | 3300025921 | Bacteria | 1448 |
| 401 | Ga0207652_10550599 | 3300025921 | Bacteria | 1037 |
| 402 | Ga0207652_11777639 | 3300025921 | Bacteria | 521 |
| 403 | Ga0207646_10005962 | 3300025922 | Bacteria | 12710 |
| 404 | Ga0207646_10301825 | 3300025922 | Bacteria | 1447 |
| 405 | Ga0207681_10065693 | 3300025923 | Bacteria | 2509 |
| 406 | Ga0207694_10003813 | 3300025924 | Bacteria | 11925 |
| 407 | Ga0207694_10381162 | 3300025924 | Bacteria | 1170 |
| 408 | Ga0207694_10427023 | 3300025924 | Bacteria | 1104 |
| 409 | Ga0207694_10677440 | 3300025924 | Bacteria | 869 |
| 410 | Ga0207694_11494566 | 3300025924 | Bacteria | 570 |
| 411 | Ga0207659_10313493 | 3300025926 | Bacteria | 1292 |
| 412 | Ga0207687_10017316 | 3300025927 | Bacteria | 4742 |
| 413 | Ga0207687_10470960 | 3300025927 | Bacteria | 1044 |
| 414 | Ga0207687_11004731 | 3300025927 | Bacteria | 715 |
| 415 | Ga0207700_10034420 | 3300025928 | Bacteria | 3636 |
| 416 | Ga0207700_10040911 | 3300025928 | Bacteria | 3387 |
| 417 | Ga0207700_10205566 | 3300025928 | Bacteria | 1662 |
| 418 | Ga0207700_10338602 | 3300025928 | Bacteria | 1307 |
| 419 | Ga0207700_10445821 | 3300025928 | Bacteria | 1140 |
| 420 | Ga0207700_11019321 | 3300025928 | Bacteria | 741 |
| 421 | Ga0207700_11103805 | 3300025928 | Bacteria | 709 |
| 422 | Ga0207700_12040409 | 3300025928 | Bacteria | 500 |
| 423 | Ga0207664_10029757 | 3300025929 | Bacteria | 4163 |
| 424 | Ga0207664_10092082 | 3300025929 | Bacteria | 2487 |
| 425 | Ga0207664_10167600 | 3300025929 | Unclassified | 1878 |
| 426 | Ga0207664_10343008 | 3300025929 | Bacteria | 1321 |
| 427 | Ga0207664_10530628 | 3300025929 | Bacteria | 1055 |
| 428 | Ga0207664_10689258 | 3300025929 | Bacteria | 919 |
| 429 | Ga0207664_10749856 | 3300025929 | Bacteria | 878 |
| 430 | Ga0207664_10762459 | 3300025929 | Bacteria | 870 |
| 431 | Ga0207644_10942673 | 3300025931 | Bacteria | 724 |
| 432 | Ga0207690_10113879 | 3300025932 | Bacteria | 1952 |
| 433 | Ga0207690_10387938 | 3300025932 | Bacteria | 1111 |
| 434 | Ga0207706_10561007 | 3300025933 | Bacteria | 983 |
| 435 | Ga0207706_10706087 | 3300025933 | Bacteria | 861 |
| 436 | Ga0207686_10142110 | 3300025934 | Bacteria | 1660 |
| 437 | Ga0207686_10194272 | 3300025934 | Bacteria | 1449 |
| 438 | Ga0207686_11349415 | 3300025934 | Bacteria | 586 |
| 439 | Ga0207709_11058491 | 3300025935 | Bacteria | 665 |
| 440 | Ga0207670_10087012 | 3300025936 | Unclassified | 2200 |
| 441 | Ga0207670_10673057 | 3300025936 | Bacteria | 855 |
| 442 | Ga0207669_10042822 | 3300025937 | Bacteria | 2646 |
| 443 | Ga0207669_11504555 | 3300025937 | Bacteria | 574 |
| 444 | Ga0207704_10080679 | 3300025938 | Bacteria | 2101 |
| 445 | Ga0207704_10309529 | 3300025938 | Bacteria | 1214 |
| 446 | Ga0207704_10784033 | 3300025938 | Bacteria | 795 |
| 447 | Ga0207665_10006977 | 3300025939 | Bacteria | 7477 |
| 448 | Ga0207665_10022066 | 3300025939 | Bacteria | 4187 |
| 449 | Ga0207665_10054792 | 3300025939 | Bacteria | 2690 |
| 450 | Ga0207665_10278698 | 3300025939 | Bacteria | 1244 |
| 451 | Ga0207691_10013466 | 3300025940 | Bacteria | 7827 |
| 452 | Ga0207711_10071864 | 3300025941 | Bacteria | 3004 |
| 453 | Ga0207711_10166927 | 3300025941 | Bacteria | 1995 |
| 454 | Ga0207689_10006246 | 3300025942 | Bacteria | 10557 |
| 455 | Ga0207689_10007498 | 3300025942 | Bacteria | 9563 |
| 456 | Ga0207689_10052613 | 3300025942 | Bacteria | 3355 |
| 457 | Ga0207689_10110991 | 3300025942 | Bacteria | 2254 |
| 458 | Ga0207661_10391301 | 3300025944 | Bacteria | 1259 |
| 459 | Ga0207679_10947089 | 3300025945 | Bacteria | 789 |
| 460 | Ga0207667_10007844 | 3300025949 | Bacteria | 12748 |
| 461 | Ga0207667_10057520 | 3300025949 | Bacteria | 4081 |
| 462 | Ga0207667_10140868 | 3300025949 | Bacteria | 2483 |
| 463 | Ga0207667_10257751 | 3300025949 | Bacteria | 1784 |
| 464 | Ga0207667_10322818 | 3300025949 | Bacteria | 1577 |
| 465 | Ga0207651_10864099 | 3300025960 | Bacteria | 804 |
| 466 | Ga0207712_10047397 | 3300025961 | Bacteria | 2983 |
| 467 | Ga0207712_10652207 | 3300025961 | Bacteria | 915 |
| 468 | Ga0207712_10925499 | 3300025961 | Bacteria | 771 |
| 469 | Ga0207668_11684901 | 3300025972 | Bacteria | 572 |
| 470 | Ga0207668_11700825 | 3300025972 | Bacteria | 569 |
| 471 | Ga0207640_10077169 | 3300025981 | Bacteria | 2264 |
| 472 | Ga0207640_11041324 | 3300025981 | Bacteria | 722 |
| 473 | Ga0207640_11152740 | 3300025981 | Bacteria | 688 |
| 474 | Ga0207658_10141704 | 3300025986 | Bacteria | 1946 |
| 475 | Ga0207658_10346586 | 3300025986 | Unclassified | 1292 |
| 476 | Ga0207658_10584837 | 3300025986 | Bacteria | 1002 |
| 477 | Ga0207658_10601417 | 3300025986 | Bacteria | 988 |
| 478 | Ga0207658_10812859 | 3300025986 | Bacteria | 849 |
| 479 | Ga0207658_10993278 | 3300025986 | Bacteria | 766 |
| 480 | Ga0207677_10028242 | 3300026023 | Bacteria | 3544 |
| 481 | Ga0207677_10114399 | 3300026023 | Bacteria | 2016 |
| 482 | Ga0207703_10852570 | 3300026035 | Bacteria | 871 |
| 483 | Ga0207703_11070389 | 3300026035 | Bacteria | 774 |
| 484 | Ga0207703_11074635 | 3300026035 | Bacteria | 773 |
| 485 | Ga0207703_11610481 | 3300026035 | Bacteria | 625 |
| 486 | Ga0207639_10529266 | 3300026041 | Bacteria | 1080 |
| 487 | Ga0207639_10539322 | 3300026041 | Bacteria | 1070 |
| 488 | Ga0207639_10623244 | 3300026041 | Bacteria | 996 |
| 489 | Ga0207639_10804400 | 3300026041 | Bacteria | 876 |
| 490 | Ga0207639_12270582 | 3300026041 | Bacteria | 504 |
| 491 | Ga0207702_10129039 | 3300026078 | Bacteria | 2273 |
| 492 | Ga0207702_10303407 | 3300026078 | Bacteria | 1516 |
| 493 | Ga0207702_11029662 | 3300026078 | Bacteria | 817 |
| 494 | Ga0207702_11107763 | 3300026078 | Bacteria | 786 |
| 495 | Ga0207641_10002695 | 3300026088 | Bacteria | 16208 |
| 496 | Ga0207641_10164826 | 3300026088 | Bacteria | 2017 |
| 497 | Ga0207641_10277514 | 3300026088 | Bacteria | 1575 |
| 498 | Ga0207641_12085419 | 3300026088 | Bacteria | 568 |
| 499 | Ga0207648_10012083 | 3300026089 | Bacteria | 8099 |
| 500 | Ga0207648_10252902 | 3300026089 | Bacteria | 1571 |
| 501 | Ga0207648_10488097 | 3300026089 | Bacteria | 1126 |
| 502 | Ga0207676_10036301 | 3300026095 | Bacteria | 3748 |
| 503 | Ga0207676_10973350 | 3300026095 | Bacteria | 835 |
| 504 | Ga0207674_10035632 | 3300026116 | Bacteria | 5193 |
| 505 | Ga0207674_10139137 | 3300026116 | Bacteria | 2388 |
| 506 | Ga0207674_10187098 | 3300026116 | Bacteria | 2021 |
| 507 | Ga0207674_10220768 | 3300026116 | Bacteria | 1843 |
| 508 | Ga0207675_100019140 | 3300026118 | Bacteria | 6390 |
| 509 | Ga0207675_100087826 | 3300026118 | Bacteria | 2921 |
| 510 | Ga0207683_10011591 | 3300026121 | Bacteria | 7527 |
| 511 | Ga0207698_10247195 | 3300026142 | Bacteria | 1630 |
| 512 | Ga0207698_10377199 | 3300026142 | Unclassified | 1348 |
| 513 | Ga0207698_11664858 | 3300026142 | Bacteria | 653 |
| 514 | Ga0207698_11790985 | 3300026142 | Bacteria | 629 |
| 515 | Ga0209281_1000108 | 3300027111 | Bacteria | 217582 |
| 516 | Ga0209179_1098678 | 3300027512 | Bacteria | 650 |
| 517 | Ga0209588_1027354 | 3300027671 | Bacteria | 1815 |
| 518 | Ga0209588_1044791 | 3300027671 | Unclassified | 1431 |
| 519 | Ga0209588_1045876 | 3300027671 | Unclassified | 1414 |
| 520 | Ga0209588_1073764 | 3300027671 | Bacteria | 1102 |
| 521 | Ga0209588_1255594 | 3300027671 | Bacteria | 534 |
| 522 | Ga0207428_10133711 | 3300027907 | Unclassified | 1897 |
| 523 | Ga0207428_10175270 | 3300027907 | Unclassified | 1622 |
| 524 | Ga0268266_10000721 | 3300028379 | Bacteria | 44545 |
| 525 | Ga0268266_10078727 | 3300028379 | Bacteria | 2869 |
| 526 | Ga0268266_10273778 | 3300028379 | Bacteria | 1568 |
| 527 | Ga0268266_10474876 | 3300028379 | Bacteria | 1191 |
| 528 | Ga0268265_10974736 | 3300028380 | Bacteria | 836 |
| 529 | Ga0268264_10046600 | 3300028381 | Bacteria | 3601 |
| 530 | Ga0268264_10050795 | 3300028381 | Bacteria | 3454 |
| 531 | Ga0268264_10184336 | 3300028381 | Unclassified | 1898 |
| 532 | Ga0268264_10208396 | 3300028381 | Bacteria | 1793 |
| 533 | Ga0268264_10427667 | 3300028381 | Bacteria | 1278 |
| 534 | Ga0268264_10861856 | 3300028381 | Bacteria | 908 |
| 535 | Ga0265319_1000302 | 3300028563 | Bacteria | 36694 |
| 536 | Ga0265318_10000913 | 3300028577 | Bacteria | 19264 |
| 537 | Ga0265318_10008761 | 3300028577 | Bacteria | 4483 |
| 538 | Ga0265338_10248469 | 3300028800 | Bacteria | 1313 |
| 539 | Ga0265760_10210636 | 3300031090 | Bacteria | 660 |
| 540 | Ga0265320_10017814 | 3300031240 | Bacteria | 3931 |
| 541 | Ga0265325_10512973 | 3300031241 | Bacteria | 519 |
| 542 | Ga0265340_10055634 | 3300031247 | Bacteria | 1905 |
| 543 | Ga0265331_10079010 | 3300031250 | Bacteria | 1531 |
| 544 | Ga0265327_10000214 | 3300031251 | Bacteria | 120181 |
| 545 | Ga0265316_10434863 | 3300031344 | Bacteria | 942 |
| 546 | Ga0307508_10155047 | 3300031616 | Bacteria | 1894 |
| 547 | Ga0307405_10220405 | 3300031731 | Bacteria | 1391 |
| 548 | Ga0307414_10973765 | 3300032004 | Unclassified | 780 |
| 549 | Ga0316212_1008679 | 3300033547 | Unclassified | 1460 |
| 550 | Ga0373926_0006361 | 3300035083 | Bacteria | 3922 |
| 551 | Ga0373940_0045942 | 3300035088 | Bacteria | 1214 |
| 552 | Ga0373945_0341982 | 3300035116 | Bacteria | 647 |
| 553 | Ga0373943_0044149 | 3300035170 | Bacteria | 2168 |
| 554 | Ga0373946_0034777 | 3300035171 | Bacteria | 2036 |
| 555 | Ga0373955_0026695 | 3300035172 | Bacteria | 2978 |
| 556 | Ga0373924_0001655 | 3300035410 | Bacteria | 7315 |
| 557 | Ga0373924_0071453 | 3300035410 | Bacteria | 1465 |
| 558 | Ga0373931_0104054 | 3300035691 | Bacteria | 1601 |
| 559 | Ga0373931_0540727 | 3300035691 | Bacteria | 756 |
| 560 | Ga0373931_0638824 | 3300035691 | Bacteria | 699 |
| 561 | Ga0373935_0088367 | 3300035692 | Unclassified | 2025 |
| 562 | Ga0373935_0781767 | 3300035692 | Bacteria | 704 |
| 563 | Ga0373927_0012762 | 3300035695 | Bacteria | 5589 |
| 564 | Ga0373933_0107967 | 3300035724 | Bacteria | 1733 |
| 565 | Ga0373933_0436477 | 3300035724 | Bacteria | 856 |
| 566 | Ga0373947_0834066 | 3300035725 | Bacteria | 629 |
| 567 | Ga0373937_0000225 | 3300036401 | Bacteria | 54909 |
| 568 | Ga0373937_0107398 | 3300036401 | Bacteria | 2595 |
| 569 | Ga0373937_0578241 | 3300036401 | Bacteria | 1067 |
| 570 | Ga0373937_1431817 | 3300036401 | Bacteria | 639 |
| 571 | Ga0395899_0051052 | 3300037312 | Bacteria | 3070 |
| 572 | Ga0395899_0838258 | 3300037312 | Bacteria | 565 |
| 573 | Ga0395900_0008973 | 3300037418 | Bacteria | 10254 |
| 574 | Ga0395898_0010182 | 3300037466 | Bacteria | 9843 |
| 575 | Ga0395898_0505768 | 3300037466 | Bacteria | 1149 |
| 576 | Ga0395905_0002196 | 3300037471 | Bacteria | 22050 |
| 577 | Ga0395905_0003889 | 3300037471 | Bacteria | 15759 |
| 578 | Ga0395905_0162732 | 3300037471 | Unclassified | 2097 |
| 579 | Ga0395905_0204403 | 3300037471 | Bacteria | 1851 |
| 580 | Ga0436365_0581532 | 3300039437 | Bacteria | 2911 |
| 581 | Ga0436361_0069880 | 3300039447 | Bacteria | 969 |
| 582 | Ga0451841_0284456 | 3300041498 | Bacteria | 1954 |
| 583 | Ga0451855_0031514 | 3300041511 | Bacteria | 616 |
| 584 | Ga0451577_0756303 | 3300042876 | Bacteria | 879 |
| 585 | Ga0453683_0842328 | 3300044673 | Bacteria | 605 |
| 586 | Ga0466965_0160215 | 3300044683 | Bacteria | 1180 |
| 587 | Ga0466966_0001835 | 3300044684 | Bacteria | 13773 |
| 588 | Ga0466966_0055498 | 3300044684 | Bacteria | 2507 |
| 589 | Ga0466963_0021566 | 3300044694 | Bacteria | 4066 |
| 590 | Ga0466963_0418021 | 3300044694 | Bacteria | 946 |
| 591 | Ga0453684_0598252 | 3300044712 | Bacteria | 1209 |
| 592 | Ga0453684_1622024 | 3300044712 | Unclassified | 663 |
| 593 | Ga0466970_0372896 | 3300044765 | Bacteria | 812 |
| 594 | Ga0466957_0016647 | 3300044842 | Bacteria | 4301 |
| 595 | Ga0466957_0096678 | 3300044842 | Bacteria | 1856 |
| 596 | Ga0466959_0427822 | 3300045049 | Bacteria | 898 |
| 597 | Ga0466959_1054190 | 3300045049 | Bacteria | 541 |
| 598 | Ga0466959_1128004 | 3300045049 | Bacteria | 521 |
| 599 | Ga0466967_1323485 | 3300045976 | Bacteria | 717 |
| 600 | Ga0495603_0131963 | 3300046455 | Bacteria | 1454 |
| 601 | Ga0495603_0539911 | 3300046455 | Bacteria | 668 |
| 602 | Ga0495638_0234560 | 3300046460 | Bacteria | 1019 |
| 603 | Ga0495651_0600920 | 3300046462 | Bacteria | 694 |
| 604 | Ga0495580_0039295 | 3300046472 | Bacteria | 3385 |
| 605 | Ga0495582_0004066 | 3300046473 | Bacteria | 8219 |
| 606 | Ga0495664_0570676 | 3300046477 | Bacteria | 673 |
| 607 | Ga0495664_0697865 | 3300046477 | Bacteria | 600 |
| 608 | Ga0495584_0046724 | 3300046491 | Bacteria | 2184 |
| 609 | Ga0495584_0077069 | 3300046491 | Bacteria | 1676 |
| 610 | Ga0495585_0000148 | 3300046492 | Bacteria | 76376 |
| 611 | Ga0495596_0015142 | 3300046500 | Bacteria | 3236 |
| 612 | Ga0495583_0190298 | 3300046506 | Bacteria | 837 |
| 613 | Ga0495583_0448014 | 3300046506 | Bacteria | 506 |
| 614 | Ga0495616_0169166 | 3300046513 | Bacteria | 978 |
| 615 | Ga0495628_0495082 | 3300046516 | Bacteria | 883 |
| 616 | Ga0495628_0712914 | 3300046516 | Bacteria | 708 |
| 617 | Ga0495630_0070531 | 3300046517 | Bacteria | 2629 |
| 618 | Ga0495630_0126744 | 3300046517 | Bacteria | 1938 |
| 619 | Ga0495631_0063919 | 3300046518 | Bacteria | 1594 |
| 620 | Ga0495643_0009289 | 3300046522 | Bacteria | 6123 |
| 621 | Ga0495644_0022045 | 3300046523 | Bacteria | 2428 |
| 622 | Ga0495663_0004095 | 3300046525 | Bacteria | 4129 |
| 623 | Ga0495666_0015085 | 3300046526 | Bacteria | 3845 |
| 624 | Ga0495666_0136191 | 3300046526 | Bacteria | 1146 |
| 625 | Ga0495666_0326192 | 3300046526 | Bacteria | 693 |
| 626 | Ga0495642_0072640 | 3300046528 | Bacteria | 1440 |
| 627 | Ga0495652_0081018 | 3300046529 | Bacteria | 2679 |
| 628 | Ga0495665_0070728 | 3300046531 | Bacteria | 1838 |
| 629 | Ga0495665_0169596 | 3300046531 | Bacteria | 1136 |
| 630 | Ga0495665_0249240 | 3300046531 | Bacteria | 914 |
| 631 | Ga0495586_0263149 | 3300046535 | Bacteria | 985 |
| 632 | Ga0495587_0018167 | 3300046536 | Bacteria | 4362 |
| 633 | Ga0495609_0001458 | 3300046538 | Bacteria | 15690 |
| 634 | Ga0495609_0044747 | 3300046538 | Bacteria | 1985 |
| 635 | Ga0495621_0133533 | 3300046539 | Bacteria | 967 |
| 636 | Ga0495597_0009662 | 3300046542 | Bacteria | 4753 |
| 637 | Ga0495645_0016723 | 3300046543 | Bacteria | 5246 |
| 638 | Ga0495645_0098475 | 3300046543 | Bacteria | 2081 |
| 639 | Ga0495645_0329839 | 3300046543 | Bacteria | 988 |
| 640 | Ga0495622_0001973 | 3300046557 | Bacteria | 10055 |
| 641 | Ga0495622_0006367 | 3300046557 | Bacteria | 5479 |
| 642 | Ga0495622_0209788 | 3300046557 | Bacteria | 866 |
| 643 | Ga0495656_0035523 | 3300046615 | Bacteria | 2048 |
| 644 | Ga0495656_0110959 | 3300046615 | Bacteria | 1283 |
| 645 | Ga0495668_0040218 | 3300046616 | Bacteria | 2608 |
| 646 | Ga0495668_0226080 | 3300046616 | Bacteria | 1025 |
| 647 | Ga0495634_0369184 | 3300046642 | Bacteria | 857 |
| 648 | Ga0495611_0090206 | 3300046648 | Bacteria | 1416 |
| 649 | Ga0495625_0028107 | 3300046660 | Bacteria | 4221 |
| 650 | Ga0495625_0314266 | 3300046660 | Bacteria | 999 |
| 651 | Ga0495625_0450051 | 3300046660 | Bacteria | 796 |
| 652 | Ga0495635_0054129 | 3300046663 | Bacteria | 2764 |
| 653 | Ga0495635_0096049 | 3300046663 | Bacteria | 2026 |
| 654 | Ga0495661_0024256 | 3300046665 | Bacteria | 3928 |
| 655 | Ga0495588_0003529 | 3300046674 | Bacteria | 6822 |
| 656 | Ga0495588_0012161 | 3300046674 | Bacteria | 4058 |
| 657 | Ga0495588_0037676 | 3300046674 | Bacteria | 2457 |
| 658 | Ga0495588_0088169 | 3300046674 | Bacteria | 1623 |
| 659 | Ga0495646_0083017 | 3300046680 | Bacteria | 1863 |
| 660 | Ga0495613_0198177 | 3300046689 | Bacteria | 1417 |
| 661 | Ga0495613_0671068 | 3300046689 | Bacteria | 684 |
| 662 | Ga0495624_0002163 | 3300046690 | Bacteria | 14985 |
| 663 | Ga0495589_0101993 | 3300046794 | Bacteria | 1388 |
| 664 | Ga0495581_0016671 | 3300047315 | Bacteria | 4271 |
| 665 | Ga0495581_0164671 | 3300047315 | Bacteria | 1296 |
| 666 | Ga0495604_0033035 | 3300047317 | Bacteria | 4097 |
| 667 | Ga0495636_0030641 | 3300047318 | Bacteria | 2201 |
| 668 | Ga0495636_0190296 | 3300047318 | Bacteria | 934 |
| 669 | Ga0495674_0153215 | 3300047319 | Bacteria | 1932 |
| 670 | Ga0495674_0393378 | 3300047319 | Bacteria | 1120 |
| 671 | Ga0495672_0023003 | 3300047320 | Bacteria | 4040 |
| 672 | Ga0495672_0210973 | 3300047320 | Bacteria | 964 |
| 673 | Ga0495676_0080007 | 3300047321 | Bacteria | 2483 |
| 674 | Ga0495683_0300219 | 3300047323 | Bacteria | 690 |
| 675 | Ga0495675_0225987 | 3300047444 | Bacteria | 1131 |
| 676 | Ga0495677_0013840 | 3300047445 | Bacteria | 2937 |
| 677 | Ga0495685_041485 | 3300047447 | Bacteria | 1573 |
| 678 | Ga0495673_0018181 | 3300047469 | Bacteria | 3551 |
| 679 | Ga0495681_0013143 | 3300047470 | Bacteria | 4825 |
| 680 | Ga0495681_0205002 | 3300047470 | Bacteria | 798 |
| 681 | Ga0495686_0067514 | 3300047472 | Bacteria | 2207 |
| 682 | Ga0495602_0283926 | 3300048088 | Bacteria | 1218 |
| 683 | Ga0495614_0034013 | 3300048089 | Bacteria | 2192 |
| 684 | Ga0496101_0177535 | 3300048904 | Bacteria | 1639 |
| 685 | Ga0496102_0001461 | 3300048905 | Bacteria | 20885 |
| 686 | Ga0496102_0042961 | 3300048905 | Bacteria | 4097 |
| 687 | Ga0496102_0555771 | 3300048905 | Bacteria | 1071 |
| 688 | Ga0496102_1605542 | 3300048905 | Bacteria | 569 |
| 689 | Ga0496103_0016154 | 3300048906 | Bacteria | 4455 |
| 690 | Ga0496103_0821141 | 3300048906 | Bacteria | 586 |
| 691 | Ga0496104_0002008 | 3300048907 | Bacteria | 17659 |
| 692 | Ga0496104_0047745 | 3300048907 | Bacteria | 4036 |
| 693 | Ga0496104_0064166 | 3300048907 | Bacteria | 3485 |
| 694 | Ga0496105_0014169 | 3300048908 | Bacteria | 6345 |
| 695 | Ga0496105_0020489 | 3300048908 | Bacteria | 5344 |
| 696 | Ga0496105_0054680 | 3300048908 | Bacteria | 3296 |
| 697 | Ga0496106_0053142 | 3300048909 | Bacteria | 3059 |
| 698 | Ga0496106_0527143 | 3300048909 | Unclassified | 948 |
| 699 | Ga0496107_0870148 | 3300048910 | Bacteria | 658 |
| 700 | Ga0496108_0017503 | 3300048911 | Bacteria | 5863 |
| 701 | Ga0496108_0060056 | 3300048911 | Bacteria | 3198 |
| 702 | Ga0496108_0521908 | 3300048911 | Bacteria | 1037 |
| 703 | Ga0496109_0134847 | 3300048912 | Bacteria | 2306 |
| 704 | Ga0496109_0202502 | 3300048912 | Bacteria | 1866 |
| 705 | Ga0496109_1212604 | 3300048912 | Bacteria | 691 |
| 706 | Ga0496110_0010298 | 3300048913 | Bacteria | 7599 |
| 707 | Ga0496110_1192164 | 3300048913 | Bacteria | 670 |
| 708 | Ga0496110_1256933 | 3300048913 | Bacteria | 649 |
| 709 | Ga0496111_0009322 | 3300048914 | Bacteria | 6546 |
| 710 | Ga0496111_0151783 | 3300048914 | Bacteria | 1718 |
| 711 | Ga0496112_0009847 | 3300048915 | Bacteria | 8635 |
| 712 | Ga0496112_0024683 | 3300048915 | Bacteria | 5763 |
| 713 | Ga0496112_0029744 | 3300048915 | Bacteria | 5284 |
| 714 | Ga0496112_0081126 | 3300048915 | Bacteria | 3208 |
| 715 | Ga0496112_0310245 | 3300048915 | Bacteria | 1523 |
| 716 | Ga0496112_1083550 | 3300048915 | Bacteria | 719 |
| 717 | Ga0496113_0002200 | 3300048916 | Bacteria | 11247 |
| 718 | Ga0496113_0030749 | 3300048916 | Bacteria | 3889 |
| 719 | Ga0496113_0063277 | 3300048916 | Bacteria | 2796 |
| 720 | Ga0496113_0990967 | 3300048916 | Bacteria | 662 |
| 721 | Ga0496114_0015547 | 3300048917 | Bacteria | 6118 |
| 722 | Ga0496114_0520016 | 3300048917 | Bacteria | 1052 |
| 723 | Ga0496115_0004423 | 3300048918 | Bacteria | 10184 |
| 724 | Ga0496115_0017316 | 3300048918 | Bacteria | 5506 |
| 725 | Ga0496115_0493795 | 3300048918 | Unclassified | 984 |
| 726 | Ga0496115_0656843 | 3300048918 | Bacteria | 828 |
| 727 | Ga0496115_0760877 | 3300048918 | Bacteria | 757 |
| 728 | Ga0496124_0194661 | 3300048927 | Unclassified | 1548 |
| 729 | Ga0496126_0689903 | 3300048929 | Unclassified | 795 |
| 730 | Ga0495682_0176312 | 3300049460 | Bacteria | 760 |
| 731 | Ga0501031_0083621 | 3300049568 | Bacteria | 2080 |
| 732 | Ga0501033_0175827 | 3300049570 | Bacteria | 1536 |
| 733 | Ga0501034_0339962 | 3300049571 | Bacteria | 1431 |
| 734 | Ga0501036_0343038 | 3300049572 | Bacteria | 1247 |
| 735 | Ga0501037_0590279 | 3300049573 | Bacteria | 747 |
| 736 | Ga0501039_0051616 | 3300049575 | Bacteria | 3182 |
| 737 | Ga0501040_0036438 | 3300049576 | Bacteria | 3339 |
| 738 | Ga0501042_0221080 | 3300049578 | Bacteria | 1366 |
| 739 | Ga0501046_0195395 | 3300049580 | Bacteria | 1507 |
| 740 | Ga0501048_0033564 | 3300049582 | Bacteria | 3707 |
| 741 | Ga0501074_0288821 | 3300049590 | Bacteria | 1166 |
| 742 | Ga0501075_0203191 | 3300049591 | Bacteria | 1511 |
| 743 | Ga0501077_0485429 | 3300049593 | Bacteria | 792 |
| 744 | Ga0501223_003701 | 3300049663 | Unclassified | 3305 |
| 745 | Ga0501081_0388208 | 3300049743 | Bacteria | 1032 |
| 746 | Ga0501083_0163388 | 3300049744 | Bacteria | 1456 |
| 747 | Ga0501035_0342545 | 3300049822 | Bacteria | 1252 |
| 748 | Ga0501045_0015341 | 3300049824 | Bacteria | 5440 |
| 749 | nmdc:mga0k408_206848_c1 | 3300050493 | Bacteria | 1172 |
| 750 | nmdc:mga06r32_134538_c1 | 3300050510 | Bacteria | 2446 |
| 751 | nmdc:mga06r32_823324_c1 | 3300050510 | Bacteria | 888 |
| 752 | nmdc:mga08y16_199106_c1 | 3300050511 | Bacteria | 2076 |
| 753 | nmdc:mga08y16_70299_c1 | 3300050511 | Bacteria | 3649 |
| 754 | nmdc:mga0n895_107001_c1 | 3300050512 | Bacteria | 2810 |
| 755 | nmdc:mga0n895_233160_c1 | 3300050512 | Bacteria | 1868 |
| 756 | nmdc:mga0n895_535402_c1 | 3300050512 | Bacteria | 1178 |
| 757 | nmdc:mga0rr50_65151_c1 | 3300050513 | Bacteria | 2759 |
| 758 | nmdc:mga0rr50_773087_c1 | 3300050513 | Bacteria | 820 |
| 759 | nmdc:mga0rr50_837547_c1 | 3300050513 | Bacteria | 785 |
| 760 | nmdc:mga0rr50_86907_c1 | 3300050513 | Bacteria | 2426 |
| 761 | nmdc:mga08x19_311100_c1 | 3300050514 | Bacteria | 1095 |
| 762 | nmdc:mga08x19_332951_c1 | 3300050514 | Bacteria | 1058 |
| 763 | nmdc:mga08x19_952749_c1 | 3300050514 | Bacteria | 610 |
| 764 | Ga0495601_0029001 | 3300053077 | Bacteria | 3430 |
| 765 | Ga0495595_0644363 | 3300053084 | Bacteria | 542 |
| 766 | Ga0500646_0005101 | 3300053090 | Bacteria | 3327 |
| 767 | Ga0500646_0348967 | 3300053090 | Bacteria | 539 |
| 768 | Ga0500583_0029030 | 3300053092 | Bacteria | 2406 |
| 769 | Ga0500641_0017669 | 3300053096 | Bacteria | 2672 |
| 770 | Ga0500654_076893 | 3300053099 | Bacteria | 1585 |
| 771 | Ga0500618_027643 | 3300053125 | Bacteria | 1348 |
| 772 | Ga0500559_0077594 | 3300053136 | Unclassified | 1505 |
| 773 | Ga0500564_012813 | 3300053138 | Bacteria | 3737 |
| 774 | Ga0500588_0004579 | 3300053146 | Bacteria | 3007 |
| 775 | Ga0500633_0018606 | 3300053160 | Bacteria | 2063 |
| 776 | Ga0501084_0126434 | 3300054114 | Bacteria | 2151 |
| 777 | Ga0587084_002272 | 3300059477 | Bacteria | 1967 |
| 778 | Ga0587084_010044 | 3300059477 | Bacteria | 1234 |
| 779 | Ga0587084_029059 | 3300059477 | Bacteria | 879 |
| 780 | Ga0587093_001567 | 3300059478 | Bacteria | 1966 |
| 781 | Ga0587093_020765 | 3300059478 | Bacteria | 877 |
| 782 | Ga0587093_030018 | 3300059478 | Bacteria | 778 |
| 783 | Ga0587066_002509 | 3300059490 | Bacteria | 2033 |
| 784 | Ga0587066_042734 | 3300059490 | Bacteria | 861 |
| 785 | Ga0587066_049770 | 3300059490 | Bacteria | 821 |
| 786 | Ga0587066_051600 | 3300059490 | Bacteria | 812 |
| 787 | Ga0587066_095841 | 3300059490 | Bacteria | 666 |
| 788 | Ga0587070_003045 | 3300059491 | Bacteria | 1971 |
| 789 | Ga0587070_003105 | 3300059491 | Bacteria | 1959 |
| 790 | Ga0587070_041500 | 3300059491 | Bacteria | 882 |
| 791 | Ga0587070_045646 | 3300059491 | Bacteria | 856 |
| 792 | Ga0587070_084209 | 3300059491 | Bacteria | 703 |
| 793 | Ga0587073_0035746 | 3300059492 | Bacteria | 1055 |
| 794 | Ga0587073_0043842 | 3300059492 | Bacteria | 987 |
| 795 | Ga0587073_0054585 | 3300059492 | Bacteria | 917 |
| 796 | Ga0587077_023550 | 3300059493 | Bacteria | 1113 |
| 797 | Ga0587077_031757 | 3300059493 | Bacteria | 1010 |
| 798 | Ga0587077_033708 | 3300059493 | Bacteria | 991 |
| 799 | Ga0587080_020235 | 3300059503 | Bacteria | 1085 |
| 800 | Ga0587080_048150 | 3300059503 | Bacteria | 797 |
| 801 | Ga0587082_003050 | 3300059504 | Bacteria | 1971 |
| 802 | Ga0587082_006045 | 3300059504 | Bacteria | 1600 |
| 803 | Ga0587082_035498 | 3300059504 | Bacteria | 890 |
| 804 | Ga0587082_040728 | 3300059504 | Bacteria | 851 |
| 805 | Ga0587082_136810 | 3300059504 | Bacteria | 568 |
| 806 | Ga0587083_0004263 | 3300059505 | Bacteria | 1974 |
| 807 | Ga0587083_0024103 | 3300059505 | Bacteria | 1155 |
| 808 | Ga0587083_0066264 | 3300059505 | Bacteria | 827 |
| 809 | Ga0587083_0115189 | 3300059505 | Bacteria | 688 |
| 810 | Ga0587085_002190 | 3300059506 | Bacteria | 1959 |
| 811 | Ga0587085_002655 | 3300059506 | Bacteria | 1848 |
| 812 | Ga0587085_026541 | 3300059506 | Bacteria | 923 |
| 813 | Ga0587086_001672 | 3300059507 | Bacteria | 1966 |
| 814 | Ga0587086_010814 | 3300059507 | Bacteria | 1111 |
| 815 | Ga0587086_023258 | 3300059507 | Bacteria | 863 |
| 816 | Ga0587086_027455 | 3300059507 | Bacteria | 817 |
| 817 | Ga0587088_003158 | 3300059508 | Bacteria | 1964 |
| 818 | Ga0587088_023406 | 3300059508 | Bacteria | 1050 |
| 819 | Ga0587088_061796 | 3300059508 | Bacteria | 761 |
| 820 | Ga0587089_032198 | 3300059509 | Bacteria | 779 |
| 821 | Ga0587090_000825 | 3300059510 | Bacteria | 2845 |
| 822 | Ga0587090_002764 | 3300059510 | Bacteria | 1966 |
| 823 | Ga0587090_032726 | 3300059510 | Bacteria | 878 |
| 824 | Ga0587091_002851 | 3300059511 | Bacteria | 2107 |
| 825 | Ga0587091_044895 | 3300059511 | Bacteria | 886 |
| 826 | Ga0587091_045492 | 3300059511 | Bacteria | 882 |
| 827 | Ga0587092_028719 | 3300059512 | Bacteria | 908 |
| 828 | Ga0587092_041190 | 3300059512 | Bacteria | 804 |
| 829 | Ga0587092_053479 | 3300059512 | Bacteria | 737 |
| 830 | Ga0587094_002275 | 3300059513 | Bacteria | 1971 |
| 831 | Ga0587094_018240 | 3300059513 | Bacteria | 996 |
| 832 | Ga0587094_032732 | 3300059513 | Bacteria | 814 |
| 833 | Ga0587094_135218 | 3300059513 | Bacteria | 505 |
| 834 | Ga0587095_009873 | 3300059514 | Bacteria | 796 |
| 835 | Ga0587106_001867 | 3300059605 | Bacteria | 1967 |
| 836 | Ga0587106_027054 | 3300059605 | Bacteria | 895 |
| 837 | Ga0587125_003852 | 3300059607 | Bacteria | 1303 |
| 838 | Ga0587129_007963 | 3300059608 | Bacteria | 777 |
| 839 | Ga0587101_001659 | 3300059623 | Bacteria | 1968 |
| 840 | Ga0587101_006335 | 3300059623 | Bacteria | 1353 |
| 841 | Ga0587101_031764 | 3300059623 | Bacteria | 828 |
| 842 | Ga0587101_105263 | 3300059623 | Bacteria | 566 |
| 843 | Ga0587109_013386 | 3300059624 | Bacteria | 1361 |
| 844 | Ga0587109_015244 | 3300059624 | Bacteria | 1302 |
| 845 | Ga0587109_044495 | 3300059624 | Bacteria | 891 |
| 846 | Ga0587109_049854 | 3300059624 | Bacteria | 855 |
| 847 | Ga0587109_061211 | 3300059624 | Bacteria | 793 |
| 848 | Ga0587115_002909 | 3300059626 | Bacteria | 1752 |
| 849 | Ga0587115_008128 | 3300059626 | Bacteria | 1254 |
| 850 | Ga0587117_028084 | 3300059627 | Bacteria | 831 |
| 851 | Ga0587117_037797 | 3300059627 | Bacteria | 757 |
| 852 | Ga0587117_116866 | 3300059627 | Bacteria | 524 |
| 853 | Ga0587127_002315 | 3300059629 | Bacteria | 1145 |
| 854 | Ga0587127_009405 | 3300059629 | Bacteria | 744 |
| 855 | Ga0587128_002336 | 3300059630 | Bacteria | 1964 |
| 856 | Ga0587130_017147 | 3300059631 | Bacteria | 759 |
| 857 | Ga0587062_001677 | 3300059639 | Bacteria | 1971 |
| 858 | Ga0587062_001799 | 3300059639 | Bacteria | 1935 |
| 859 | Ga0587062_002771 | 3300059639 | Bacteria | 1708 |
| 860 | Ga0587062_030416 | 3300059639 | Bacteria | 824 |
| 861 | Ga0587067_003113 | 3300059640 | Bacteria | 2045 |
| 862 | Ga0587067_021829 | 3300059640 | Bacteria | 1108 |
| 863 | Ga0587067_034498 | 3300059640 | Bacteria | 952 |
| 864 | Ga0587067_060343 | 3300059640 | Bacteria | 793 |
| 865 | Ga0587068_003462 | 3300059641 | Bacteria | 2016 |
| 866 | Ga0587068_003890 | 3300059641 | Bacteria | 1943 |
| 867 | Ga0587068_035618 | 3300059641 | Bacteria | 882 |
| 868 | Ga0587068_047761 | 3300059641 | Bacteria | 793 |
| 869 | Ga0587069_001242 | 3300059642 | Bacteria | 2275 |
| 870 | Ga0587069_035088 | 3300059642 | Bacteria | 831 |
| 871 | Ga0587069_072090 | 3300059642 | Bacteria | 658 |
| 872 | Ga0587069_104578 | 3300059642 | Bacteria | 583 |
| 873 | Ga0587072_004015 | 3300059643 | Bacteria | 2107 |
| 874 | Ga0587072_004818 | 3300059643 | Bacteria | 1985 |
| 875 | Ga0587072_080587 | 3300059643 | Bacteria | 703 |
| 876 | Ga0587075_013836 | 3300059644 | Bacteria | 1115 |
| 877 | Ga0587075_014523 | 3300059644 | Bacteria | 1097 |
| 878 | Ga0587075_033528 | 3300059644 | Bacteria | 829 |
| 879 | Ga0587076_002921 | 3300059645 | Bacteria | 1978 |
| 880 | Ga0587076_005570 | 3300059645 | Bacteria | 1636 |
| 881 | Ga0587076_051722 | 3300059645 | Bacteria | 803 |
| 882 | Ga0587076_057481 | 3300059645 | Bacteria | 776 |
| 883 | Ga0587078_001575 | 3300059646 | Bacteria | 2070 |
| 884 | Ga0587078_019093 | 3300059646 | Bacteria | 853 |
| 885 | Ga0587079_058464 | 3300059647 | Bacteria | 829 |
| 886 | Ga0587100_012758 | 3300059648 | Bacteria | 739 |
| 887 | Ga0587102_005348 | 3300059649 | Bacteria | 1131 |
| 888 | Ga0587102_019865 | 3300059649 | Bacteria | 750 |
| 889 | Ga0587105_011909 | 3300059651 | Bacteria | 676 |
| 890 | Ga0587107_034509 | 3300059652 | Bacteria | 788 |
| 891 | Ga0587107_048558 | 3300059652 | Bacteria | 712 |
| 892 | Ga0587107_053554 | 3300059652 | Bacteria | 691 |
| 893 | Ga0587110_008867 | 3300059654 | Bacteria | 977 |
| 894 | Ga0587119_025728 | 3300059658 | Bacteria | 778 |
| 895 | Ga0587124_000691 | 3300059660 | Bacteria | 1956 |
| 896 | Ga0587060_008795 | 3300060243 | Bacteria | 839 |
| 897 | Ga0587071_005270 | 3300060344 | Bacteria | 1970 |
| 898 | Ga0587071_050556 | 3300060344 | Bacteria | 859 |
| 899 | Ga0587071_063793 | 3300060344 | Unclassified | 788 |
| 900 | Ga0587071_128913 | 3300060344 | Bacteria | 611 |
| 901 | Ga0587111_0002424 | 3300060346 | Bacteria | 2483 |
| 902 | Ga0587111_0003136 | 3300060346 | Bacteria | 2312 |
| 903 | Ga0587111_0033382 | 3300060346 | Bacteria | 1063 |
| 904 | Ga0587111_0057353 | 3300060346 | Bacteria | 876 |
| 905 | Ga0587111_0218447 | 3300060346 | Bacteria | 549 |
| 906 | Ga0501082_0089278 | 3300060353 | Bacteria | 2661 |
| 907 | Ga0466962_0192145 | 3300061719 | Unclassified | 996 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005337 | Ga0070682_101217062 | Ga0070682_1012170621 | 113 |
| 2 | 3300005616 | Ga0068852_102061475 | Ga0068852_1020614752 | 118 |
| 3 | 3300005616 | Ga0068852_100879737 | Ga0068852_1008797372 | 120 |
| 4 | 3300026142 | Ga0207698_10377199 | Ga0207698_103771991 | 120 |
| 5 | 3300047320 | Ga0495672_0023003 | Ga0495672_0023003_2287_2706 | 120 |
| 6 | iso_pu_bacteria | 2866065130 | 2866069130 | 127 |
| 7 | 3300035088 | Ga0373940_0045942 | Ga0373940_0045942_759_1190 | 133 |
| 8 | 3300005328 | Ga0070676_10027262 | Ga0070676_100272622 | 136 |
| 9 | 3300005333 | Ga0070677_10056078 | Ga0070677_100560781 | 136 |
| 10 | 3300005334 | Ga0068869_100042357 | Ga0068869_1000423573 | 136 |
| 11 | 3300005334 | Ga0068869_100091915 | Ga0068869_1000919152 | 136 |
| 12 | 3300005335 | Ga0070666_10299951 | Ga0070666_102999512 | 136 |
| 13 | 3300005338 | Ga0068868_100083377 | Ga0068868_1000833773 | 136 |
| 14 | 3300005347 | Ga0070668_100035392 | Ga0070668_1000353923 | 136 |
| 15 | 3300005354 | Ga0070675_100172173 | Ga0070675_1001721731 | 136 |
| 16 | 3300005356 | Ga0070674_100145322 | Ga0070674_1001453223 | 136 |
| 17 | 3300005356 | Ga0070674_101838990 | Ga0070674_1018389901 | 136 |
| 18 | 3300005364 | Ga0070673_100124093 | Ga0070673_1001240933 | 136 |
| 19 | 3300005367 | Ga0070667_100074620 | Ga0070667_1000746203 | 136 |
| 20 | 3300005367 | Ga0070667_101161140 | Ga0070667_1011611401 | 136 |
| 21 | 3300005455 | Ga0070663_100112126 | Ga0070663_1001121262 | 136 |
| 22 | 3300005456 | Ga0070678_100003496 | Ga0070678_1000034961 | 136 |
| 23 | 3300005459 | Ga0068867_100078756 | Ga0068867_1000787562 | 136 |
| 24 | 3300005459 | Ga0068867_100764123 | Ga0068867_1007641231 | 136 |
| 25 | 3300005539 | Ga0068853_100879063 | Ga0068853_1008790631 | 136 |
| 26 | 3300005548 | Ga0070665_100154533 | Ga0070665_1001545333 | 136 |
| 27 | 3300005617 | Ga0068859_100018620 | Ga0068859_1000186206 | 136 |
| 28 | 3300005617 | Ga0068859_100052217 | Ga0068859_1000522173 | 136 |
| 29 | 3300005617 | Ga0068859_100298246 | Ga0068859_1002982463 | 136 |
| 30 | 3300005719 | Ga0068861_100091750 | Ga0068861_1000917502 | 136 |
| 31 | 3300005719 | Ga0068861_100214668 | Ga0068861_1002146681 | 136 |
| 32 | 3300005840 | Ga0068870_10027185 | Ga0068870_100271851 | 136 |
| 33 | 3300005841 | Ga0068863_101580882 | Ga0068863_1015808821 | 136 |
| 34 | 3300005841 | Ga0068863_101660866 | Ga0068863_1016608662 | 136 |
| 35 | 3300005843 | Ga0068860_100020699 | Ga0068860_1000206997 | 136 |
| 36 | 3300005843 | Ga0068860_100159899 | Ga0068860_1001598992 | 136 |
| 37 | 3300005843 | Ga0068860_100269693 | Ga0068860_1002696933 | 136 |
| 38 | 3300005844 | Ga0068862_100278398 | Ga0068862_1002783981 | 136 |
| 39 | 3300006237 | Ga0097621_100198944 | Ga0097621_1001989441 | 136 |
| 40 | 3300006358 | Ga0068871_100579516 | Ga0068871_1005795162 | 136 |
| 41 | 3300006881 | Ga0068865_100099788 | Ga0068865_1000997882 | 136 |
| 42 | 3300006881 | Ga0068865_100344456 | Ga0068865_1003444562 | 136 |
| 43 | 3300006931 | Ga0097620_100018620 | Ga0097620_1000186203 | 136 |
| 44 | 3300006931 | Ga0097620_100052221 | Ga0097620_1000522213 | 136 |
| 45 | 3300006931 | Ga0097620_100298283 | Ga0097620_1002982833 | 136 |
| 46 | 3300009148 | Ga0105243_10505453 | Ga0105243_105054532 | 136 |
| 47 | 3300009174 | Ga0105241_10183200 | Ga0105241_101832003 | 136 |
| 48 | 3300009176 | Ga0105242_11464825 | Ga0105242_114648252 | 136 |
| 49 | 3300009553 | Ga0105249_10125804 | Ga0105249_101258044 | 136 |
| 50 | 3300009553 | Ga0105249_10135817 | Ga0105249_101358171 | 136 |
| 51 | 3300009553 | Ga0105249_11056364 | Ga0105249_110563642 | 136 |
| 52 | 3300011119 | Ga0105246_10013082 | Ga0105246_100130821 | 136 |
| 53 | 3300013297 | Ga0157378_10226518 | Ga0157378_102265183 | 136 |
| 54 | 3300013297 | Ga0157378_10950556 | Ga0157378_109505562 | 136 |
| 55 | 3300013306 | Ga0163162_13306928 | Ga0163162_133069281 | 136 |
| 56 | 3300013308 | Ga0157375_11354989 | Ga0157375_113549891 | 136 |
| 57 | 3300014745 | Ga0157377_10636980 | Ga0157377_106369801 | 136 |
| 58 | 3300014968 | Ga0157379_10329573 | Ga0157379_103295732 | 136 |
| 59 | 3300025315 | Ga0207697_10125290 | Ga0207697_101252902 | 136 |
| 60 | 3300025893 | Ga0207682_10090084 | Ga0207682_100900842 | 136 |
| 61 | 3300025899 | Ga0207642_10721659 | Ga0207642_107216591 | 136 |
| 62 | 3300025903 | Ga0207680_10121307 | Ga0207680_101213072 | 136 |
| 63 | 3300025907 | Ga0207645_10003014 | Ga0207645_1000301412 | 136 |
| 64 | 3300025908 | Ga0207643_10046885 | Ga0207643_100468853 | 136 |
| 65 | 3300025911 | Ga0207654_10191743 | Ga0207654_101917432 | 136 |
| 66 | 3300025923 | Ga0207681_10065693 | Ga0207681_100656932 | 136 |
| 67 | 3300025926 | Ga0207659_10313493 | Ga0207659_103134932 | 136 |
| 68 | 3300025931 | Ga0207644_10942673 | Ga0207644_109426732 | 136 |
| 69 | 3300025933 | Ga0207706_10706087 | Ga0207706_107060871 | 136 |
| 70 | 3300025934 | Ga0207686_10142110 | Ga0207686_101421102 | 136 |
| 71 | 3300025934 | Ga0207686_11349415 | Ga0207686_113494152 | 136 |
| 72 | 3300025937 | Ga0207669_10042822 | Ga0207669_100428222 | 136 |
| 73 | 3300025937 | Ga0207669_11504555 | Ga0207669_115045551 | 136 |
| 74 | 3300025938 | Ga0207704_10080679 | Ga0207704_100806791 | 136 |
| 75 | 3300025938 | Ga0207704_10309529 | Ga0207704_103095292 | 136 |
| 76 | 3300025940 | Ga0207691_10013466 | Ga0207691_100134667 | 136 |
| 77 | 3300025942 | Ga0207689_10006246 | Ga0207689_100062463 | 136 |
| 78 | 3300025942 | Ga0207689_10007498 | Ga0207689_1000749812 | 136 |
| 79 | 3300025942 | Ga0207689_10052613 | Ga0207689_100526131 | 136 |
| 80 | 3300025960 | Ga0207651_10864099 | Ga0207651_108640991 | 136 |
| 81 | 3300025961 | Ga0207712_10047397 | Ga0207712_100473972 | 136 |
| 82 | 3300025961 | Ga0207712_10652207 | Ga0207712_106522071 | 136 |
| 83 | 3300025972 | Ga0207668_11700825 | Ga0207668_117008251 | 136 |
| 84 | 3300025981 | Ga0207640_11041324 | Ga0207640_110413241 | 136 |
| 85 | 3300025986 | Ga0207658_10141704 | Ga0207658_101417044 | 136 |
| 86 | 3300025986 | Ga0207658_10346586 | Ga0207658_103465862 | 136 |
| 87 | 3300025986 | Ga0207658_10993278 | Ga0207658_109932781 | 136 |
| 88 | 3300026023 | Ga0207677_10028242 | Ga0207677_100282424 | 136 |
| 89 | 3300026035 | Ga0207703_11610481 | Ga0207703_116104811 | 136 |
| 90 | 3300026088 | Ga0207641_10164826 | Ga0207641_101648261 | 136 |
| 91 | 3300026088 | Ga0207641_12085419 | Ga0207641_120854191 | 136 |
| 92 | 3300026089 | Ga0207648_10012083 | Ga0207648_100120833 | 136 |
| 93 | 3300026089 | Ga0207648_10488097 | Ga0207648_104880973 | 136 |
| 94 | 3300026118 | Ga0207675_100019140 | Ga0207675_1000191406 | 136 |
| 95 | 3300026118 | Ga0207675_100087826 | Ga0207675_1000878263 | 136 |
| 96 | 3300026121 | Ga0207683_10011591 | Ga0207683_100115916 | 136 |
| 97 | 3300028379 | Ga0268266_10078727 | Ga0268266_100787272 | 136 |
| 98 | 3300028380 | Ga0268265_10974736 | Ga0268265_109747361 | 136 |
| 99 | 3300028381 | Ga0268264_10184336 | Ga0268264_101843363 | 136 |
| 100 | 3300028381 | Ga0268264_10208396 | Ga0268264_102083962 | 136 |
| 101 | 3300028381 | Ga0268264_10427667 | Ga0268264_104276672 | 136 |
| 102 | 3300031616 | Ga0307508_10155047 | Ga0307508_101550472 | 136 |
| 103 | 3300049744 | Ga0501083_0163388 | Ga0501083_0163388_488_898 | 136 |
| 104 | iso_pu_bacteria | 2511231026 | 2511387160 | 136 |
| 105 | 3300003316 | rootH1_10166822 | rootH1_101668222 | 138 |
| 106 | 3300005367 | Ga0070667_100613076 | Ga0070667_1006130762 | 138 |
| 107 | 3300005578 | Ga0068854_100092555 | Ga0068854_1000925553 | 138 |
| 108 | 3300006195 | Ga0075366_10010141 | Ga0075366_100101416 | 138 |
| 109 | 3300006195 | Ga0075366_10051605 | Ga0075366_100516053 | 138 |
| 110 | 3300009093 | Ga0105240_10015281 | Ga0105240_100152812 | 138 |
| 111 | 3300010375 | Ga0105239_10027895 | Ga0105239_100278953 | 138 |
| 112 | 3300025913 | Ga0207695_10669431 | Ga0207695_106694311 | 138 |
| 113 | 3300025914 | Ga0207671_10010842 | Ga0207671_100108422 | 138 |
| 114 | 3300025914 | Ga0207671_10053536 | Ga0207671_100535363 | 138 |
| 115 | 3300025981 | Ga0207640_10077169 | Ga0207640_100771691 | 138 |
| 116 | 3300025986 | Ga0207658_10601417 | Ga0207658_106014172 | 138 |
| 117 | 3300046460 | Ga0495638_0234560 | Ga0495638_0234560_280_696 | 138 |
| 118 | 3300047472 | Ga0495686_0067514 | Ga0495686_0067514_652_1068 | 138 |
| 119 | 3300050493 | nmdc:mga0k408_206848_c1 | nmdc:mga0k408_206848_c1_401_817 | 138 |
| 120 | 3300053136 | Ga0500559_0077594 | Ga0500559_0077594_859_1278 | 138 |
| 121 | iso_pu_bacteria | 2916178963 | 2916180313 | 138 |
| 122 | 3300009545 | Ga0105237_11270334 | Ga0105237_112703342 | 139 |
| 123 | 3300025912 | Ga0207707_10686578 | Ga0207707_106865782 | 139 |
| 124 | 3300035172 | Ga0373955_0026695 | Ga0373955_0026695_2096_2518 | 139 |
| 125 | iso_pu_bacteria | 2818991461 | 2819687623 | 139 |
| 126 | iso_pu_bacteria | 2867507094 | 2867509819 | 139 |
| 127 | iso_pu_bacteria | 2896253425 | 2896255996 | 139 |
| 128 | iso_pu_bacteria | 2899803654 | 2899805925 | 139 |
| 129 | iso_pu_bacteria | 2952252522 | 2952254628 | 139 |
| 130 | 3300005327 | Ga0070658_10034779 | Ga0070658_100347791 | 140 |
| 131 | 3300005329 | Ga0070683_100289713 | Ga0070683_1002897132 | 140 |
| 132 | 3300005337 | Ga0070682_100559703 | Ga0070682_1005597031 | 140 |
| 133 | 3300005339 | Ga0070660_101228166 | Ga0070660_1012281661 | 140 |
| 134 | 3300005344 | Ga0070661_100029525 | Ga0070661_1000295252 | 140 |
| 135 | 3300005344 | Ga0070661_100514835 | Ga0070661_1005148351 | 140 |
| 136 | 3300005366 | Ga0070659_100009699 | Ga0070659_1000096998 | 140 |
| 137 | 3300005435 | Ga0070714_101658704 | Ga0070714_1016587042 | 140 |
| 138 | 3300005455 | Ga0070663_100689596 | Ga0070663_1006895961 | 140 |
| 139 | 3300005458 | Ga0070681_10827502 | Ga0070681_108275022 | 140 |
| 140 | 3300005530 | Ga0070679_100310879 | Ga0070679_1003108792 | 140 |
| 141 | 3300005535 | Ga0070684_100798320 | Ga0070684_1007983201 | 140 |
| 142 | 3300005563 | Ga0068855_100100486 | Ga0068855_1001004863 | 140 |
| 143 | 3300005563 | Ga0068855_100131214 | Ga0068855_1001312143 | 140 |
| 144 | 3300005616 | Ga0068852_101417154 | Ga0068852_1014171541 | 140 |
| 145 | 3300005617 | Ga0068859_101207982 | Ga0068859_1012079821 | 140 |
| 146 | 3300005834 | Ga0068851_10502236 | Ga0068851_105022362 | 140 |
| 147 | 3300006178 | Ga0075367_10585419 | Ga0075367_105854192 | 140 |
| 148 | 3300006931 | Ga0097620_101208025 | Ga0097620_1012080251 | 140 |
| 149 | 3300009093 | Ga0105240_10008663 | Ga0105240_1000866312 | 140 |
| 150 | 3300009094 | Ga0111539_10029445 | Ga0111539_100294457 | 140 |
| 151 | 3300009098 | Ga0105245_10067936 | Ga0105245_100679363 | 140 |
| 152 | 3300009174 | Ga0105241_12495273 | Ga0105241_124952731 | 140 |
| 153 | 3300009551 | Ga0105238_10006718 | Ga0105238_100067182 | 140 |
| 154 | 3300009551 | Ga0105238_10373450 | Ga0105238_103734501 | 140 |
| 155 | 3300010375 | Ga0105239_10912269 | Ga0105239_109122691 | 140 |
| 156 | 3300013104 | Ga0157370_10146320 | Ga0157370_101463202 | 140 |
| 157 | 3300013105 | Ga0157369_10005530 | Ga0157369_1000553014 | 140 |
| 158 | 3300013105 | Ga0157369_10117643 | Ga0157369_101176431 | 140 |
| 159 | 3300013105 | Ga0157369_10761942 | Ga0157369_107619422 | 140 |
| 160 | 3300013296 | Ga0157374_10000046 | Ga0157374_1000004630 | 140 |
| 161 | 3300013296 | Ga0157374_11107398 | Ga0157374_111073982 | 140 |
| 162 | 3300013297 | Ga0157378_10491317 | Ga0157378_104913171 | 140 |
| 163 | 3300013307 | Ga0157372_10273232 | Ga0157372_102732322 | 140 |
| 164 | 3300013307 | Ga0157372_10396047 | Ga0157372_103960472 | 140 |
| 165 | 3300014968 | Ga0157379_10121231 | Ga0157379_101212312 | 140 |
| 166 | 3300014969 | Ga0157376_10000218 | Ga0157376_1000021816 | 140 |
| 167 | 3300025321 | Ga0207656_10686951 | Ga0207656_106869511 | 140 |
| 168 | 3300025900 | Ga0207710_10428119 | Ga0207710_104281191 | 140 |
| 169 | 3300025909 | Ga0207705_10004135 | Ga0207705_1000413512 | 140 |
| 170 | 3300025909 | Ga0207705_11422657 | Ga0207705_114226571 | 140 |
| 171 | 3300025912 | Ga0207707_10711081 | Ga0207707_107110812 | 140 |
| 172 | 3300025913 | Ga0207695_10000249 | Ga0207695_1000024913 | 140 |
| 173 | 3300025920 | Ga0207649_10021003 | Ga0207649_100210033 | 140 |
| 174 | 3300025920 | Ga0207649_11313209 | Ga0207649_113132091 | 140 |
| 175 | 3300025921 | Ga0207652_10300795 | Ga0207652_103007952 | 140 |
| 176 | 3300025924 | Ga0207694_10003813 | Ga0207694_1000381312 | 140 |
| 177 | 3300025924 | Ga0207694_10381162 | Ga0207694_103811622 | 140 |
| 178 | 3300025927 | Ga0207687_10470960 | Ga0207687_104709602 | 140 |
| 179 | 3300025928 | Ga0207700_12040409 | Ga0207700_120404091 | 140 |
| 180 | 3300025929 | Ga0207664_10530628 | Ga0207664_105306282 | 140 |
| 181 | 3300025929 | Ga0207664_10689258 | Ga0207664_106892582 | 140 |
| 182 | 3300025932 | Ga0207690_10387938 | Ga0207690_103879382 | 140 |
| 183 | 3300025944 | Ga0207661_10391301 | Ga0207661_103913011 | 140 |
| 184 | 3300025949 | Ga0207667_10007844 | Ga0207667_100078447 | 140 |
| 185 | 3300025949 | Ga0207667_10057520 | Ga0207667_100575204 | 140 |
| 186 | 3300025949 | Ga0207667_10140868 | Ga0207667_101408683 | 140 |
| 187 | 3300026078 | Ga0207702_10129039 | Ga0207702_101290392 | 140 |
| 188 | 3300026078 | Ga0207702_11107763 | Ga0207702_111077631 | 140 |
| 189 | 3300026116 | Ga0207674_10187098 | Ga0207674_101870982 | 140 |
| 190 | 3300026142 | Ga0207698_11664858 | Ga0207698_116648582 | 140 |
| 191 | 3300027907 | Ga0207428_10133711 | Ga0207428_101337112 | 140 |
| 192 | 3300028563 | Ga0265319_1000302 | Ga0265319_10003028 | 140 |
| 193 | 3300028577 | Ga0265318_10000913 | Ga0265318_100009133 | 140 |
| 194 | 3300031090 | Ga0265760_10210636 | Ga0265760_102106361 | 140 |
| 195 | 3300031240 | Ga0265320_10017814 | Ga0265320_100178143 | 140 |
| 196 | 3300031731 | Ga0307405_10220405 | Ga0307405_102204051 | 140 |
| 197 | 3300032004 | Ga0307414_10973765 | Ga0307414_109737651 | 140 |
| 198 | 3300037312 | Ga0395899_0051052 | Ga0395899_0051052_803_1225 | 140 |
| 199 | 3300037312 | Ga0395899_0838258 | Ga0395899_0838258_24_446 | 140 |
| 200 | 3300037418 | Ga0395900_0008973 | Ga0395900_0008973_5313_5735 | 140 |
| 201 | 3300037471 | Ga0395905_0003889 | Ga0395905_0003889_10060_10482 | 140 |
| 202 | 3300044683 | Ga0466965_0160215 | Ga0466965_0160215_209_631 | 140 |
| 203 | 3300044684 | Ga0466966_0001835 | Ga0466966_0001835_6821_7243 | 140 |
| 204 | 3300044684 | Ga0466966_0055498 | Ga0466966_0055498_1683_2105 | 140 |
| 205 | 3300044694 | Ga0466963_0418021 | Ga0466963_0418021_235_657 | 140 |
| 206 | 3300044765 | Ga0466970_0372896 | Ga0466970_0372896_80_502 | 140 |
| 207 | 3300045049 | Ga0466959_0427822 | Ga0466959_0427822_186_608 | 140 |
| 208 | 3300045049 | Ga0466959_1054190 | Ga0466959_1054190_57_479 | 140 |
| 209 | 3300045976 | Ga0466967_1323485 | Ga0466967_1323485_34_456 | 140 |
| 210 | 3300049568 | Ga0501031_0083621 | Ga0501031_0083621_1434_1856 | 140 |
| 211 | 3300049570 | Ga0501033_0175827 | Ga0501033_0175827_769_1191 | 140 |
| 212 | 3300049571 | Ga0501034_0339962 | Ga0501034_0339962_31_453 | 140 |
| 213 | 3300049572 | Ga0501036_0343038 | Ga0501036_0343038_52_474 | 140 |
| 214 | 3300049573 | Ga0501037_0590279 | Ga0501037_0590279_109_531 | 140 |
| 215 | 3300049575 | Ga0501039_0051616 | Ga0501039_0051616_1649_2071 | 140 |
| 216 | 3300049576 | Ga0501040_0036438 | Ga0501040_0036438_1043_1465 | 140 |
| 217 | 3300049578 | Ga0501042_0221080 | Ga0501042_0221080_207_629 | 140 |
| 218 | 3300049580 | Ga0501046_0195395 | Ga0501046_0195395_557_979 | 140 |
| 219 | 3300049582 | Ga0501048_0033564 | Ga0501048_0033564_712_1134 | 140 |
| 220 | 3300049590 | Ga0501074_0288821 | Ga0501074_0288821_478_900 | 140 |
| 221 | 3300049591 | Ga0501075_0203191 | Ga0501075_0203191_109_531 | 140 |
| 222 | 3300049593 | Ga0501077_0485429 | Ga0501077_0485429_22_444 | 140 |
| 223 | 3300049663 | Ga0501223_003701 | Ga0501223_003701_2154_2588 | 140 |
| 224 | 3300049743 | Ga0501081_0388208 | Ga0501081_0388208_343_765 | 140 |
| 225 | 3300049822 | Ga0501035_0342545 | Ga0501035_0342545_685_1107 | 140 |
| 226 | 3300049824 | Ga0501045_0015341 | Ga0501045_0015341_299_721 | 140 |
| 227 | 3300050511 | nmdc:mga08y16_70299_c1 | nmdc:mga08y16_70299_c1_1430_1855 | 140 |
| 228 | 3300054114 | Ga0501084_0126434 | Ga0501084_0126434_1644_2066 | 140 |
| 229 | 3300059477 | Ga0587084_002272 | Ga0587084_002272_1284_1706 | 140 |
| 230 | 3300059477 | Ga0587084_010044 | Ga0587084_010044_214_636 | 140 |
| 231 | 3300059478 | Ga0587093_001567 | Ga0587093_001567_1286_1708 | 140 |
| 232 | 3300059478 | Ga0587093_020765 | Ga0587093_020765_215_637 | 140 |
| 233 | 3300059478 | Ga0587093_030018 | Ga0587093_030018_197_619 | 140 |
| 234 | 3300059490 | Ga0587066_002509 | Ga0587066_002509_263_685 | 140 |
| 235 | 3300059490 | Ga0587066_049770 | Ga0587066_049770_241_663 | 140 |
| 236 | 3300059490 | Ga0587066_051600 | Ga0587066_051600_249_671 | 140 |
| 237 | 3300059490 | Ga0587066_095841 | Ga0587066_095841_38_496 | 140 |
| 238 | 3300059491 | Ga0587070_003045 | Ga0587070_003045_266_688 | 140 |
| 239 | 3300059491 | Ga0587070_003105 | Ga0587070_003105_1267_1725 | 140 |
| 240 | 3300059491 | Ga0587070_041500 | Ga0587070_041500_247_669 | 140 |
| 241 | 3300059491 | Ga0587070_045646 | Ga0587070_045646_221_643 | 140 |
| 242 | 3300059492 | Ga0587073_0035746 | Ga0587073_0035746_375_797 | 140 |
| 243 | 3300059492 | Ga0587073_0043842 | Ga0587073_0043842_320_742 | 140 |
| 244 | 3300059493 | Ga0587077_023550 | Ga0587077_023550_234_692 | 140 |
| 245 | 3300059493 | Ga0587077_031757 | Ga0587077_031757_326_748 | 140 |
| 246 | 3300059493 | Ga0587077_033708 | Ga0587077_033708_257_679 | 140 |
| 247 | 3300059503 | Ga0587080_020235 | Ga0587080_020235_266_688 | 140 |
| 248 | 3300059503 | Ga0587080_048150 | Ga0587080_048150_126_548 | 140 |
| 249 | 3300059504 | Ga0587082_003050 | Ga0587082_003050_236_694 | 140 |
| 250 | 3300059504 | Ga0587082_006045 | Ga0587082_006045_789_1211 | 140 |
| 251 | 3300059504 | Ga0587082_035498 | Ga0587082_035498_206_628 | 140 |
| 252 | 3300059504 | Ga0587082_040728 | Ga0587082_040728_256_678 | 140 |
| 253 | 3300059505 | Ga0587083_0004263 | Ga0587083_0004263_1278_1736 | 140 |
| 254 | 3300059505 | Ga0587083_0024103 | Ga0587083_0024103_256_678 | 140 |
| 255 | 3300059505 | Ga0587083_0066264 | Ga0587083_0066264_146_568 | 140 |
| 256 | 3300059506 | Ga0587085_002190 | Ga0587085_002190_1267_1725 | 140 |
| 257 | 3300059506 | Ga0587085_002655 | Ga0587085_002655_168_590 | 140 |
| 258 | 3300059506 | Ga0587085_026541 | Ga0587085_026541_360_782 | 140 |
| 259 | 3300059507 | Ga0587086_001672 | Ga0587086_001672_1284_1706 | 140 |
| 260 | 3300059507 | Ga0587086_010814 | Ga0587086_010814_247_669 | 140 |
| 261 | 3300059507 | Ga0587086_023258 | Ga0587086_023258_267_725 | 140 |
| 262 | 3300059507 | Ga0587086_027455 | Ga0587086_027455_251_673 | 140 |
| 263 | 3300059508 | Ga0587088_003158 | Ga0587088_003158_1284_1706 | 140 |
| 264 | 3300059508 | Ga0587088_023406 | Ga0587088_023406_386_808 | 140 |
| 265 | 3300059508 | Ga0587088_061796 | Ga0587088_061796_160_618 | 140 |
| 266 | 3300059509 | Ga0587089_032198 | Ga0587089_032198_219_641 | 140 |
| 267 | 3300059510 | Ga0587090_000825 | Ga0587090_000825_1521_1979 | 140 |
| 268 | 3300059510 | Ga0587090_002764 | Ga0587090_002764_1283_1705 | 140 |
| 269 | 3300059510 | Ga0587090_032726 | Ga0587090_032726_243_665 | 140 |
| 270 | 3300059511 | Ga0587091_002851 | Ga0587091_002851_1425_1883 | 140 |
| 271 | 3300059511 | Ga0587091_044895 | Ga0587091_044895_251_673 | 140 |
| 272 | 3300059511 | Ga0587091_045492 | Ga0587091_045492_247_669 | 140 |
| 273 | 3300059512 | Ga0587092_028719 | Ga0587092_028719_240_662 | 140 |
| 274 | 3300059512 | Ga0587092_041190 | Ga0587092_041190_264_686 | 140 |
| 275 | 3300059512 | Ga0587092_053479 | Ga0587092_053479_248_670 | 140 |
| 276 | 3300059513 | Ga0587094_002275 | Ga0587094_002275_1287_1709 | 140 |
| 277 | 3300059513 | Ga0587094_018240 | Ga0587094_018240_325_747 | 140 |
| 278 | 3300059513 | Ga0587094_032732 | Ga0587094_032732_193_651 | 140 |
| 279 | 3300059514 | Ga0587095_009873 | Ga0587095_009873_116_538 | 140 |
| 280 | 3300059605 | Ga0587106_001867 | Ga0587106_001867_1283_1705 | 140 |
| 281 | 3300059607 | Ga0587125_003852 | Ga0587125_003852_260_682 | 140 |
| 282 | 3300059608 | Ga0587129_007963 | Ga0587129_007963_116_538 | 140 |
| 283 | 3300059623 | Ga0587101_001659 | Ga0587101_001659_262_684 | 140 |
| 284 | 3300059623 | Ga0587101_006335 | Ga0587101_006335_235_693 | 140 |
| 285 | 3300059623 | Ga0587101_031764 | Ga0587101_031764_241_663 | 140 |
| 286 | 3300059623 | Ga0587101_105263 | Ga0587101_105263_130_552 | 140 |
| 287 | 3300059624 | Ga0587109_013386 | Ga0587109_013386_665_1123 | 140 |
| 288 | 3300059624 | Ga0587109_015244 | Ga0587109_015244_502_924 | 140 |
| 289 | 3300059624 | Ga0587109_044495 | Ga0587109_044495_262_684 | 140 |
| 290 | 3300059624 | Ga0587109_061211 | Ga0587109_061211_228_650 | 140 |
| 291 | 3300059626 | Ga0587115_002909 | Ga0587115_002909_1069_1491 | 140 |
| 292 | 3300059627 | Ga0587117_028084 | Ga0587117_028084_230_652 | 140 |
| 293 | 3300059627 | Ga0587117_037797 | Ga0587117_037797_139_561 | 140 |
| 294 | 3300059629 | Ga0587127_002315 | Ga0587127_002315_459_881 | 140 |
| 295 | 3300059629 | Ga0587127_009405 | Ga0587127_009405_180_602 | 140 |
| 296 | 3300059630 | Ga0587128_002336 | Ga0587128_002336_260_682 | 140 |
| 297 | 3300059631 | Ga0587130_017147 | Ga0587130_017147_260_682 | 140 |
| 298 | 3300059639 | Ga0587062_001677 | Ga0587062_001677_236_694 | 140 |
| 299 | 3300059639 | Ga0587062_001799 | Ga0587062_001799_1259_1681 | 140 |
| 300 | 3300059639 | Ga0587062_002771 | Ga0587062_002771_1025_1447 | 140 |
| 301 | 3300059639 | Ga0587062_030416 | Ga0587062_030416_247_669 | 140 |
| 302 | 3300059640 | Ga0587067_003113 | Ga0587067_003113_273_731 | 140 |
| 303 | 3300059640 | Ga0587067_021829 | Ga0587067_021829_287_709 | 140 |
| 304 | 3300059640 | Ga0587067_060343 | Ga0587067_060343_263_685 | 140 |
| 305 | 3300059641 | Ga0587068_003462 | Ga0587068_003462_1330_1788 | 140 |
| 306 | 3300059641 | Ga0587068_003890 | Ga0587068_003890_1266_1688 | 140 |
| 307 | 3300059641 | Ga0587068_035618 | Ga0587068_035618_247_669 | 140 |
| 308 | 3300059641 | Ga0587068_047761 | Ga0587068_047761_121_543 | 140 |
| 309 | 3300059642 | Ga0587069_001242 | Ga0587069_001242_1456_1878 | 140 |
| 310 | 3300059642 | Ga0587069_035088 | Ga0587069_035088_241_663 | 140 |
| 311 | 3300059642 | Ga0587069_072090 | Ga0587069_072090_68_490 | 140 |
| 312 | 3300059643 | Ga0587072_004015 | Ga0587072_004015_863_1321 | 140 |
| 313 | 3300059643 | Ga0587072_004818 | Ga0587072_004818_262_684 | 140 |
| 314 | 3300059644 | Ga0587075_014523 | Ga0587075_014523_262_684 | 140 |
| 315 | 3300059644 | Ga0587075_033528 | Ga0587075_033528_254_676 | 140 |
| 316 | 3300059645 | Ga0587076_002921 | Ga0587076_002921_1281_1739 | 140 |
| 317 | 3300059645 | Ga0587076_005570 | Ga0587076_005570_945_1367 | 140 |
| 318 | 3300059645 | Ga0587076_051722 | Ga0587076_051722_120_542 | 140 |
| 319 | 3300059645 | Ga0587076_057481 | Ga0587076_057481_150_572 | 140 |
| 320 | 3300059646 | Ga0587078_001575 | Ga0587078_001575_1304_1726 | 140 |
| 321 | 3300059646 | Ga0587078_019093 | Ga0587078_019093_180_602 | 140 |
| 322 | 3300059647 | Ga0587079_058464 | Ga0587079_058464_264_686 | 140 |
| 323 | 3300059648 | Ga0587100_012758 | Ga0587100_012758_174_596 | 140 |
| 324 | 3300059649 | Ga0587102_005348 | Ga0587102_005348_339_761 | 140 |
| 325 | 3300059649 | Ga0587102_019865 | Ga0587102_019865_189_611 | 140 |
| 326 | 3300059651 | Ga0587105_011909 | Ga0587105_011909_83_505 | 140 |
| 327 | 3300059652 | Ga0587107_034509 | Ga0587107_034509_252_674 | 140 |
| 328 | 3300059652 | Ga0587107_053554 | Ga0587107_053554_139_561 | 140 |
| 329 | 3300059654 | Ga0587110_008867 | Ga0587110_008867_296_760 | 140 |
| 330 | 3300059658 | Ga0587119_025728 | Ga0587119_025728_265_687 | 140 |
| 331 | 3300059660 | Ga0587124_000691 | Ga0587124_000691_1284_1706 | 140 |
| 332 | 3300060243 | Ga0587060_008795 | Ga0587060_008795_193_615 | 140 |
| 333 | 3300060344 | Ga0587071_005270 | Ga0587071_005270_263_685 | 140 |
| 334 | 3300060344 | Ga0587071_050556 | Ga0587071_050556_230_652 | 140 |
| 335 | 3300060344 | Ga0587071_128913 | Ga0587071_128913_93_515 | 140 |
| 336 | 3300060346 | Ga0587111_0002424 | Ga0587111_0002424_713_1171 | 140 |
| 337 | 3300060346 | Ga0587111_0003136 | Ga0587111_0003136_1533_1955 | 140 |
| 338 | 3300060346 | Ga0587111_0033382 | Ga0587111_0033382_428_850 | 140 |
| 339 | 3300060346 | Ga0587111_0057353 | Ga0587111_0057353_241_663 | 140 |
| 340 | 3300060353 | Ga0501082_0089278 | Ga0501082_0089278_713_1135 | 140 |
| 341 | 3300003320 | rootH2_10327266 | rootH2_103272661 | 141 |
| 342 | 3300004799 | Ga0058863_10086366 | Ga0058863_100863661 | 141 |
| 343 | 3300004799 | Ga0058863_10169191 | Ga0058863_101691911 | 141 |
| 344 | 3300004800 | Ga0058861_10016523 | Ga0058861_100165231 | 141 |
| 345 | 3300004800 | Ga0058861_10040453 | Ga0058861_100404531 | 141 |
| 346 | 3300004803 | Ga0058862_10279902 | Ga0058862_102799022 | 141 |
| 347 | 3300004803 | Ga0058862_12704330 | Ga0058862_127043303 | 141 |
| 348 | 3300004803 | Ga0058862_12825811 | Ga0058862_128258111 | 141 |
| 349 | 3300005329 | Ga0070683_100703916 | Ga0070683_1007039162 | 141 |
| 350 | 3300005329 | Ga0070683_101242974 | Ga0070683_1012429741 | 141 |
| 351 | 3300005330 | Ga0070690_100144860 | Ga0070690_1001448602 | 141 |
| 352 | 3300005334 | Ga0068869_100031446 | Ga0068869_1000314464 | 141 |
| 353 | 3300005336 | Ga0070680_100053591 | Ga0070680_1000535913 | 141 |
| 354 | 3300005336 | Ga0070680_100114489 | Ga0070680_1001144892 | 141 |
| 355 | 3300005338 | Ga0068868_100259213 | Ga0068868_1002592132 | 141 |
| 356 | 3300005338 | Ga0068868_101282011 | Ga0068868_1012820111 | 141 |
| 357 | 3300005339 | Ga0070660_100259930 | Ga0070660_1002599301 | 141 |
| 358 | 3300005344 | Ga0070661_101052665 | Ga0070661_1010526651 | 141 |
| 359 | 3300005356 | Ga0070674_100874929 | Ga0070674_1008749292 | 141 |
| 360 | 3300005365 | Ga0070688_101739287 | Ga0070688_1017392871 | 141 |
| 361 | 3300005366 | Ga0070659_100120996 | Ga0070659_1001209962 | 141 |
| 362 | 3300005366 | Ga0070659_100337811 | Ga0070659_1003378112 | 141 |
| 363 | 3300005367 | Ga0070667_100172287 | Ga0070667_1001722871 | 141 |
| 364 | 3300005434 | Ga0070709_10065312 | Ga0070709_100653123 | 141 |
| 365 | 3300005434 | Ga0070709_10096933 | Ga0070709_100969332 | 141 |
| 366 | 3300005434 | Ga0070709_10130731 | Ga0070709_101307312 | 141 |
| 367 | 3300005434 | Ga0070709_11430068 | Ga0070709_114300681 | 141 |
| 368 | 3300005435 | Ga0070714_100044401 | Ga0070714_1000444012 | 141 |
| 369 | 3300005435 | Ga0070714_100120267 | Ga0070714_1001202671 | 141 |
| 370 | 3300005435 | Ga0070714_100251061 | Ga0070714_1002510612 | 141 |
| 371 | 3300005435 | Ga0070714_100463996 | Ga0070714_1004639962 | 141 |
| 372 | 3300005435 | Ga0070714_100942820 | Ga0070714_1009428202 | 141 |
| 373 | 3300005435 | Ga0070714_101517440 | Ga0070714_1015174401 | 141 |
| 374 | 3300005436 | Ga0070713_100099060 | Ga0070713_1000990604 | 141 |
| 375 | 3300005436 | Ga0070713_100128559 | Ga0070713_1001285593 | 141 |
| 376 | 3300005436 | Ga0070713_100232745 | Ga0070713_1002327452 | 141 |
| 377 | 3300005436 | Ga0070713_100251643 | Ga0070713_1002516432 | 141 |
| 378 | 3300005437 | Ga0070710_10094959 | Ga0070710_100949592 | 141 |
| 379 | 3300005439 | Ga0070711_100003132 | Ga0070711_1000031325 | 141 |
| 380 | 3300005439 | Ga0070711_100056169 | Ga0070711_1000561692 | 141 |
| 381 | 3300005439 | Ga0070711_100160005 | Ga0070711_1001600051 | 141 |
| 382 | 3300005439 | Ga0070711_100964879 | Ga0070711_1009648791 | 141 |
| 383 | 3300005440 | Ga0070705_100024135 | Ga0070705_1000241354 | 141 |
| 384 | 3300005440 | Ga0070705_100164580 | Ga0070705_1001645802 | 141 |
| 385 | 3300005440 | Ga0070705_100626880 | Ga0070705_1006268802 | 141 |
| 386 | 3300005445 | Ga0070708_100027576 | Ga0070708_1000275766 | 141 |
| 387 | 3300005445 | Ga0070708_100039185 | Ga0070708_1000391856 | 141 |
| 388 | 3300005445 | Ga0070708_100228402 | Ga0070708_1002284022 | 141 |
| 389 | 3300005445 | Ga0070708_100460244 | Ga0070708_1004602441 | 141 |
| 390 | 3300005445 | Ga0070708_101415699 | Ga0070708_1014156991 | 141 |
| 391 | 3300005456 | Ga0070678_101131826 | Ga0070678_1011318261 | 141 |
| 392 | 3300005457 | Ga0070662_100166573 | Ga0070662_1001665732 | 141 |
| 393 | 3300005457 | Ga0070662_100687240 | Ga0070662_1006872402 | 141 |
| 394 | 3300005457 | Ga0070662_101429197 | Ga0070662_1014291971 | 141 |
| 395 | 3300005458 | Ga0070681_10019745 | Ga0070681_100197454 | 141 |
| 396 | 3300005458 | Ga0070681_10028870 | Ga0070681_100288705 | 141 |
| 397 | 3300005458 | Ga0070681_10215999 | Ga0070681_102159993 | 141 |
| 398 | 3300005458 | Ga0070681_10324364 | Ga0070681_103243642 | 141 |
| 399 | 3300005459 | Ga0068867_100313148 | Ga0068867_1003131482 | 141 |
| 400 | 3300005466 | Ga0070685_10315238 | Ga0070685_103152382 | 141 |
| 401 | 3300005467 | Ga0070706_100345862 | Ga0070706_1003458621 | 141 |
| 402 | 3300005468 | Ga0070707_100004850 | Ga0070707_10000485012 | 141 |
| 403 | 3300005468 | Ga0070707_100279293 | Ga0070707_1002792932 | 141 |
| 404 | 3300005468 | Ga0070707_100422840 | Ga0070707_1004228402 | 141 |
| 405 | 3300005468 | Ga0070707_100423774 | Ga0070707_1004237742 | 141 |
| 406 | 3300005471 | Ga0070698_100001375 | Ga0070698_10000137517 | 141 |
| 407 | 3300005471 | Ga0070698_100007655 | Ga0070698_10000765510 | 141 |
| 408 | 3300005471 | Ga0070698_100009642 | Ga0070698_1000096427 | 141 |
| 409 | 3300005471 | Ga0070698_100041339 | Ga0070698_1000413395 | 141 |
| 410 | 3300005518 | Ga0070699_100059421 | Ga0070699_1000594216 | 141 |
| 411 | 3300005518 | Ga0070699_100606773 | Ga0070699_1006067732 | 141 |
| 412 | 3300005518 | Ga0070699_100760776 | Ga0070699_1007607762 | 141 |
| 413 | 3300005518 | Ga0070699_100880319 | Ga0070699_1008803192 | 141 |
| 414 | 3300005530 | Ga0070679_100000958 | Ga0070679_10000095820 | 141 |
| 415 | 3300005530 | Ga0070679_100008320 | Ga0070679_1000083206 | 141 |
| 416 | 3300005530 | Ga0070679_100082834 | Ga0070679_1000828344 | 141 |
| 417 | 3300005530 | Ga0070679_100118050 | Ga0070679_1001180502 | 141 |
| 418 | 3300005530 | Ga0070679_100241474 | Ga0070679_1002414742 | 141 |
| 419 | 3300005535 | Ga0070684_100006317 | Ga0070684_1000063174 | 141 |
| 420 | 3300005536 | Ga0070697_100292145 | Ga0070697_1002921452 | 141 |
| 421 | 3300005539 | Ga0068853_100485837 | Ga0068853_1004858371 | 141 |
| 422 | 3300005539 | Ga0068853_100732461 | Ga0068853_1007324612 | 141 |
| 423 | 3300005539 | Ga0068853_100888716 | Ga0068853_1008887162 | 141 |
| 424 | 3300005544 | Ga0070686_100057415 | Ga0070686_1000574153 | 141 |
| 425 | 3300005545 | Ga0070695_100061882 | Ga0070695_1000618822 | 141 |
| 426 | 3300005547 | Ga0070693_100013777 | Ga0070693_1000137773 | 141 |
| 427 | 3300005547 | Ga0070693_100021726 | Ga0070693_1000217264 | 141 |
| 428 | 3300005547 | Ga0070693_100761151 | Ga0070693_1007611511 | 141 |
| 429 | 3300005548 | Ga0070665_100000391 | Ga0070665_10000039132 | 141 |
| 430 | 3300005548 | Ga0070665_101871498 | Ga0070665_1018714982 | 141 |
| 431 | 3300005549 | Ga0070704_100558899 | Ga0070704_1005588991 | 141 |
| 432 | 3300005563 | Ga0068855_100111363 | Ga0068855_1001113633 | 141 |
| 433 | 3300005563 | Ga0068855_100129120 | Ga0068855_1001291205 | 141 |
| 434 | 3300005564 | Ga0070664_100401506 | Ga0070664_1004015062 | 141 |
| 435 | 3300005577 | Ga0068857_100227267 | Ga0068857_1002272672 | 141 |
| 436 | 3300005578 | Ga0068854_100192745 | Ga0068854_1001927452 | 141 |
| 437 | 3300005614 | Ga0068856_100315011 | Ga0068856_1003150112 | 141 |
| 438 | 3300005614 | Ga0068856_101000263 | Ga0068856_1010002632 | 141 |
| 439 | 3300005614 | Ga0068856_101260083 | Ga0068856_1012600831 | 141 |
| 440 | 3300005614 | Ga0068856_102650767 | Ga0068856_1026507671 | 141 |
| 441 | 3300005616 | Ga0068852_100075097 | Ga0068852_1000750972 | 141 |
| 442 | 3300005616 | Ga0068852_100392618 | Ga0068852_1003926182 | 141 |
| 443 | 3300005617 | Ga0068859_100092999 | Ga0068859_1000929993 | 141 |
| 444 | 3300005617 | Ga0068859_100178193 | Ga0068859_1001781932 | 141 |
| 445 | 3300005617 | Ga0068859_100506921 | Ga0068859_1005069211 | 141 |
| 446 | 3300005617 | Ga0068859_100923001 | Ga0068859_1009230012 | 141 |
| 447 | 3300005618 | Ga0068864_100823596 | Ga0068864_1008235962 | 141 |
| 448 | 3300005618 | Ga0068864_101296838 | Ga0068864_1012968381 | 141 |
| 449 | 3300005718 | Ga0068866_10080513 | Ga0068866_100805132 | 141 |
| 450 | 3300005834 | Ga0068851_10125167 | Ga0068851_101251672 | 141 |
| 451 | 3300005841 | Ga0068863_100002412 | Ga0068863_10000241222 | 141 |
| 452 | 3300005841 | Ga0068863_100246439 | Ga0068863_1002464392 | 141 |
| 453 | 3300005842 | Ga0068858_100025426 | Ga0068858_1000254265 | 141 |
| 454 | 3300005842 | Ga0068858_100116326 | Ga0068858_1001163262 | 141 |
| 455 | 3300005842 | Ga0068858_101248359 | Ga0068858_1012483591 | 141 |
| 456 | 3300005843 | Ga0068860_100027511 | Ga0068860_1000275119 | 141 |
| 457 | 3300005843 | Ga0068860_100056618 | Ga0068860_1000566182 | 141 |
| 458 | 3300005843 | Ga0068860_100969438 | Ga0068860_1009694382 | 141 |
| 459 | 3300005843 | Ga0068860_101135247 | Ga0068860_1011352472 | 141 |
| 460 | 3300005844 | Ga0068862_101838212 | Ga0068862_1018382121 | 141 |
| 461 | 3300005983 | Ga0081540_1213712 | Ga0081540_12137121 | 141 |
| 462 | 3300006028 | Ga0070717_10398630 | Ga0070717_103986302 | 141 |
| 463 | 3300006028 | Ga0070717_10474973 | Ga0070717_104749732 | 141 |
| 464 | 3300006028 | Ga0070717_10569050 | Ga0070717_105690501 | 141 |
| 465 | 3300006028 | Ga0070717_10635640 | Ga0070717_106356402 | 141 |
| 466 | 3300006163 | Ga0070715_10081441 | Ga0070715_100814412 | 141 |
| 467 | 3300006163 | Ga0070715_10117164 | Ga0070715_101171642 | 141 |
| 468 | 3300006163 | Ga0070715_10425504 | Ga0070715_104255041 | 141 |
| 469 | 3300006163 | Ga0070715_10443497 | Ga0070715_104434972 | 141 |
| 470 | 3300006173 | Ga0070716_100038082 | Ga0070716_1000380824 | 141 |
| 471 | 3300006173 | Ga0070716_100111714 | Ga0070716_1001117143 | 141 |
| 472 | 3300006173 | Ga0070716_100517043 | Ga0070716_1005170432 | 141 |
| 473 | 3300006175 | Ga0070712_100009764 | Ga0070712_1000097642 | 141 |
| 474 | 3300006175 | Ga0070712_100147025 | Ga0070712_1001470252 | 141 |
| 475 | 3300006175 | Ga0070712_100738516 | Ga0070712_1007385161 | 141 |
| 476 | 3300006175 | Ga0070712_101947838 | Ga0070712_1019478381 | 141 |
| 477 | 3300006237 | Ga0097621_100036118 | Ga0097621_1000361184 | 141 |
| 478 | 3300006358 | Ga0068871_100002381 | Ga0068871_1000023812 | 141 |
| 479 | 3300006844 | Ga0075428_100003175 | Ga0075428_1000031759 | 141 |
| 480 | 3300006871 | Ga0075434_100004172 | Ga0075434_1000041723 | 141 |
| 481 | 3300006871 | Ga0075434_100010159 | Ga0075434_10001015911 | 141 |
| 482 | 3300006871 | Ga0075434_100521769 | Ga0075434_1005217692 | 141 |
| 483 | 3300006871 | Ga0075434_100553503 | Ga0075434_1005535032 | 141 |
| 484 | 3300006881 | Ga0068865_100657344 | Ga0068865_1006573442 | 141 |
| 485 | 3300006914 | Ga0075436_100230686 | Ga0075436_1002306862 | 141 |
| 486 | 3300006914 | Ga0075436_101407922 | Ga0075436_1014079221 | 141 |
| 487 | 3300006931 | Ga0097620_100093004 | Ga0097620_1000930042 | 141 |
| 488 | 3300006931 | Ga0097620_100178209 | Ga0097620_1001782093 | 141 |
| 489 | 3300006931 | Ga0097620_100922770 | Ga0097620_1009227702 | 141 |
| 490 | 3300007076 | Ga0075435_100097258 | Ga0075435_1000972582 | 141 |
| 491 | 3300007076 | Ga0075435_100288125 | Ga0075435_1002881252 | 141 |
| 492 | 3300007076 | Ga0075435_100513187 | Ga0075435_1005131871 | 141 |
| 493 | 3300007076 | Ga0075435_100891819 | Ga0075435_1008918191 | 141 |
| 494 | 3300007265 | Ga0099794_10000752 | Ga0099794_100007525 | 141 |
| 495 | 3300007265 | Ga0099794_10004425 | Ga0099794_100044254 | 141 |
| 496 | 3300007265 | Ga0099794_10025943 | Ga0099794_100259432 | 141 |
| 497 | 3300007265 | Ga0099794_10116411 | Ga0099794_101164112 | 141 |
| 498 | 3300007265 | Ga0099794_10184704 | Ga0099794_101847042 | 141 |
| 499 | 3300007265 | Ga0099794_10224941 | Ga0099794_102249412 | 141 |
| 500 | 3300007265 | Ga0099794_10238461 | Ga0099794_102384611 | 141 |
| 501 | 3300007788 | Ga0099795_10220533 | Ga0099795_102205332 | 141 |
| 502 | 3300009011 | Ga0105251_10566001 | Ga0105251_105660011 | 141 |
| 503 | 3300009093 | Ga0105240_10000001 | Ga0105240_100000011396 | 141 |
| 504 | 3300009093 | Ga0105240_10267253 | Ga0105240_102672532 | 141 |
| 505 | 3300009093 | Ga0105240_10507597 | Ga0105240_105075972 | 141 |
| 506 | 3300009093 | Ga0105240_11741054 | Ga0105240_117410541 | 141 |
| 507 | 3300009094 | Ga0111539_10079181 | Ga0111539_100791812 | 141 |
| 508 | 3300009098 | Ga0105245_10067363 | Ga0105245_100673633 | 141 |
| 509 | 3300009098 | Ga0105245_10772835 | Ga0105245_107728352 | 141 |
| 510 | 3300009101 | Ga0105247_10830701 | Ga0105247_108307011 | 141 |
| 511 | 3300009148 | Ga0105243_10941623 | Ga0105243_109416232 | 141 |
| 512 | 3300009176 | Ga0105242_10158231 | Ga0105242_101582312 | 141 |
| 513 | 3300009176 | Ga0105242_10480771 | Ga0105242_104807712 | 141 |
| 514 | 3300009177 | Ga0105248_10025404 | Ga0105248_100254045 | 141 |
| 515 | 3300009177 | Ga0105248_11078314 | Ga0105248_110783141 | 141 |
| 516 | 3300009545 | Ga0105237_10026026 | Ga0105237_100260265 | 141 |
| 517 | 3300009545 | Ga0105237_10183316 | Ga0105237_101833162 | 141 |
| 518 | 3300009545 | Ga0105237_10198587 | Ga0105237_101985872 | 141 |
| 519 | 3300009545 | Ga0105237_10304741 | Ga0105237_103047412 | 141 |
| 520 | 3300009545 | Ga0105237_10559561 | Ga0105237_105595612 | 141 |
| 521 | 3300009551 | Ga0105238_11438290 | Ga0105238_114382902 | 141 |
| 522 | 3300009551 | Ga0105238_12614215 | Ga0105238_126142151 | 141 |
| 523 | 3300009553 | Ga0105249_10625041 | Ga0105249_106250412 | 141 |
| 524 | 3300010159 | Ga0099796_10096753 | Ga0099796_100967532 | 141 |
| 525 | 3300010159 | Ga0099796_10172579 | Ga0099796_101725792 | 141 |
| 526 | 3300010375 | Ga0105239_10281149 | Ga0105239_102811492 | 141 |
| 527 | 3300010375 | Ga0105239_10781257 | Ga0105239_107812572 | 141 |
| 528 | 3300010375 | Ga0105239_13243291 | Ga0105239_132432911 | 141 |
| 529 | 3300013104 | Ga0157370_10019224 | Ga0157370_100192242 | 141 |
| 530 | 3300013104 | Ga0157370_10061081 | Ga0157370_100610813 | 141 |
| 531 | 3300013104 | Ga0157370_10073414 | Ga0157370_100734144 | 141 |
| 532 | 3300013105 | Ga0157369_10020894 | Ga0157369_100208942 | 141 |
| 533 | 3300013105 | Ga0157369_10067463 | Ga0157369_100674632 | 141 |
| 534 | 3300013105 | Ga0157369_10150759 | Ga0157369_101507592 | 141 |
| 535 | 3300013105 | Ga0157369_10365937 | Ga0157369_103659372 | 141 |
| 536 | 3300013296 | Ga0157374_10021854 | Ga0157374_100218543 | 141 |
| 537 | 3300013296 | Ga0157374_10266416 | Ga0157374_102664162 | 141 |
| 538 | 3300013296 | Ga0157374_10787913 | Ga0157374_107879131 | 141 |
| 539 | 3300013297 | Ga0157378_10000683 | Ga0157378_100006833 | 141 |
| 540 | 3300013297 | Ga0157378_10003013 | Ga0157378_100030138 | 141 |
| 541 | 3300013306 | Ga0163162_10133922 | Ga0163162_101339222 | 141 |
| 542 | 3300013306 | Ga0163162_10505579 | Ga0163162_105055791 | 141 |
| 543 | 3300013306 | Ga0163162_11031160 | Ga0163162_110311602 | 141 |
| 544 | 3300013307 | Ga0157372_10064455 | Ga0157372_100644554 | 141 |
| 545 | 3300013307 | Ga0157372_10077167 | Ga0157372_100771674 | 141 |
| 546 | 3300013307 | Ga0157372_10250156 | Ga0157372_102501562 | 141 |
| 547 | 3300013308 | Ga0157375_10139325 | Ga0157375_101393252 | 141 |
| 548 | 3300014325 | Ga0163163_10321046 | Ga0163163_103210461 | 141 |
| 549 | 3300014325 | Ga0163163_10636787 | Ga0163163_106367872 | 141 |
| 550 | 3300014969 | Ga0157376_10000017 | Ga0157376_10000017166 | 141 |
| 551 | 3300020070 | Ga0206356_11036649 | Ga0206356_110366491 | 141 |
| 552 | 3300020070 | Ga0206356_11258529 | Ga0206356_112585292 | 141 |
| 553 | 3300020077 | Ga0206351_10037410 | Ga0206351_100374101 | 141 |
| 554 | 3300020077 | Ga0206351_10437456 | Ga0206351_104374561 | 141 |
| 555 | 3300020080 | Ga0206350_10111732 | Ga0206350_101117321 | 141 |
| 556 | 3300020081 | Ga0206354_11605239 | Ga0206354_116052391 | 141 |
| 557 | 3300021384 | Ga0213876_10060491 | Ga0213876_100604913 | 141 |
| 558 | 3300022467 | Ga0224712_10047143 | Ga0224712_100471431 | 141 |
| 559 | 3300022467 | Ga0224712_10300915 | Ga0224712_103009151 | 141 |
| 560 | 3300022467 | Ga0224712_10632192 | Ga0224712_106321921 | 141 |
| 561 | 3300025261 | Ga0209233_1020262 | Ga0209233_10202622 | 141 |
| 562 | 3300025898 | Ga0207692_10146768 | Ga0207692_101467682 | 141 |
| 563 | 3300025898 | Ga0207692_10249164 | Ga0207692_102491642 | 141 |
| 564 | 3300025898 | Ga0207692_10399921 | Ga0207692_103999212 | 141 |
| 565 | 3300025899 | Ga0207642_10093179 | Ga0207642_100931793 | 141 |
| 566 | 3300025905 | Ga0207685_10080505 | Ga0207685_100805052 | 141 |
| 567 | 3300025905 | Ga0207685_10514558 | Ga0207685_105145581 | 141 |
| 568 | 3300025906 | Ga0207699_10006592 | Ga0207699_100065925 | 141 |
| 569 | 3300025906 | Ga0207699_10701184 | Ga0207699_107011842 | 141 |
| 570 | 3300025906 | Ga0207699_10813639 | Ga0207699_108136391 | 141 |
| 571 | 3300025906 | Ga0207699_10831843 | Ga0207699_108318431 | 141 |
| 572 | 3300025906 | Ga0207699_11041166 | Ga0207699_110411662 | 141 |
| 573 | 3300025910 | Ga0207684_10029497 | Ga0207684_100294973 | 141 |
| 574 | 3300025912 | Ga0207707_10034581 | Ga0207707_100345812 | 141 |
| 575 | 3300025912 | Ga0207707_10105532 | Ga0207707_101055322 | 141 |
| 576 | 3300025912 | Ga0207707_10223446 | Ga0207707_102234462 | 141 |
| 577 | 3300025913 | Ga0207695_10000001 | Ga0207695_100000011400 | 141 |
| 578 | 3300025914 | Ga0207671_10105771 | Ga0207671_101057713 | 141 |
| 579 | 3300025914 | Ga0207671_10318255 | Ga0207671_103182552 | 141 |
| 580 | 3300025915 | Ga0207693_10020281 | Ga0207693_100202814 | 141 |
| 581 | 3300025915 | Ga0207693_10075349 | Ga0207693_100753493 | 141 |
| 582 | 3300025915 | Ga0207693_10321395 | Ga0207693_103213952 | 141 |
| 583 | 3300025915 | Ga0207693_10415356 | Ga0207693_104153562 | 141 |
| 584 | 3300025915 | Ga0207693_10442317 | Ga0207693_104423171 | 141 |
| 585 | 3300025916 | Ga0207663_10000828 | Ga0207663_100008284 | 141 |
| 586 | 3300025916 | Ga0207663_10150977 | Ga0207663_101509772 | 141 |
| 587 | 3300025916 | Ga0207663_10441017 | Ga0207663_104410172 | 141 |
| 588 | 3300025917 | Ga0207660_10002550 | Ga0207660_100025502 | 141 |
| 589 | 3300025917 | Ga0207660_10217497 | Ga0207660_102174972 | 141 |
| 590 | 3300025917 | Ga0207660_10664268 | Ga0207660_106642682 | 141 |
| 591 | 3300025919 | Ga0207657_10254847 | Ga0207657_102548474 | 141 |
| 592 | 3300025921 | Ga0207652_10066798 | Ga0207652_100667983 | 141 |
| 593 | 3300025921 | Ga0207652_10173368 | Ga0207652_101733682 | 141 |
| 594 | 3300025921 | Ga0207652_10233076 | Ga0207652_102330762 | 141 |
| 595 | 3300025921 | Ga0207652_10550599 | Ga0207652_105505991 | 141 |
| 596 | 3300025921 | Ga0207652_11777639 | Ga0207652_117776391 | 141 |
| 597 | 3300025922 | Ga0207646_10005962 | Ga0207646_1000596215 | 141 |
| 598 | 3300025922 | Ga0207646_10301825 | Ga0207646_103018252 | 141 |
| 599 | 3300025924 | Ga0207694_10427023 | Ga0207694_104270231 | 141 |
| 600 | 3300025924 | Ga0207694_11494566 | Ga0207694_114945661 | 141 |
| 601 | 3300025927 | Ga0207687_10017316 | Ga0207687_100173162 | 141 |
| 602 | 3300025927 | Ga0207687_11004731 | Ga0207687_110047311 | 141 |
| 603 | 3300025928 | Ga0207700_10034420 | Ga0207700_100344204 | 141 |
| 604 | 3300025928 | Ga0207700_10040911 | Ga0207700_100409114 | 141 |
| 605 | 3300025928 | Ga0207700_10205566 | Ga0207700_102055661 | 141 |
| 606 | 3300025928 | Ga0207700_10338602 | Ga0207700_103386022 | 141 |
| 607 | 3300025928 | Ga0207700_10445821 | Ga0207700_104458212 | 141 |
| 608 | 3300025928 | Ga0207700_11019321 | Ga0207700_110193211 | 141 |
| 609 | 3300025928 | Ga0207700_11103805 | Ga0207700_111038051 | 141 |
| 610 | 3300025929 | Ga0207664_10029757 | Ga0207664_100297574 | 141 |
| 611 | 3300025929 | Ga0207664_10092082 | Ga0207664_100920821 | 141 |
| 612 | 3300025929 | Ga0207664_10167600 | Ga0207664_101676001 | 141 |
| 613 | 3300025929 | Ga0207664_10343008 | Ga0207664_103430081 | 141 |
| 614 | 3300025929 | Ga0207664_10749856 | Ga0207664_107498561 | 141 |
| 615 | 3300025929 | Ga0207664_10762459 | Ga0207664_107624592 | 141 |
| 616 | 3300025932 | Ga0207690_10113879 | Ga0207690_101138792 | 141 |
| 617 | 3300025933 | Ga0207706_10561007 | Ga0207706_105610072 | 141 |
| 618 | 3300025934 | Ga0207686_10194272 | Ga0207686_101942722 | 141 |
| 619 | 3300025935 | Ga0207709_11058491 | Ga0207709_110584911 | 141 |
| 620 | 3300025936 | Ga0207670_10087012 | Ga0207670_100870123 | 141 |
| 621 | 3300025936 | Ga0207670_10673057 | Ga0207670_106730571 | 141 |
| 622 | 3300025938 | Ga0207704_10784033 | Ga0207704_107840332 | 141 |
| 623 | 3300025939 | Ga0207665_10006977 | Ga0207665_100069772 | 141 |
| 624 | 3300025939 | Ga0207665_10022066 | Ga0207665_100220663 | 141 |
| 625 | 3300025939 | Ga0207665_10054792 | Ga0207665_100547921 | 141 |
| 626 | 3300025939 | Ga0207665_10278698 | Ga0207665_102786982 | 141 |
| 627 | 3300025941 | Ga0207711_10071864 | Ga0207711_100718643 | 141 |
| 628 | 3300025942 | Ga0207689_10110991 | Ga0207689_101109912 | 141 |
| 629 | 3300025949 | Ga0207667_10257751 | Ga0207667_102577512 | 141 |
| 630 | 3300025949 | Ga0207667_10322818 | Ga0207667_103228183 | 141 |
| 631 | 3300025961 | Ga0207712_10925499 | Ga0207712_109254991 | 141 |
| 632 | 3300025972 | Ga0207668_11684901 | Ga0207668_116849011 | 141 |
| 633 | 3300025981 | Ga0207640_11152740 | Ga0207640_111527401 | 141 |
| 634 | 3300025986 | Ga0207658_10584837 | Ga0207658_105848371 | 141 |
| 635 | 3300025986 | Ga0207658_10812859 | Ga0207658_108128592 | 141 |
| 636 | 3300026023 | Ga0207677_10114399 | Ga0207677_101143992 | 141 |
| 637 | 3300026035 | Ga0207703_10852570 | Ga0207703_108525701 | 141 |
| 638 | 3300026035 | Ga0207703_11074635 | Ga0207703_110746351 | 141 |
| 639 | 3300026041 | Ga0207639_10529266 | Ga0207639_105292661 | 141 |
| 640 | 3300026041 | Ga0207639_10539322 | Ga0207639_105393222 | 141 |
| 641 | 3300026041 | Ga0207639_10623244 | Ga0207639_106232441 | 141 |
| 642 | 3300026041 | Ga0207639_10804400 | Ga0207639_108044002 | 141 |
| 643 | 3300026041 | Ga0207639_12270582 | Ga0207639_122705821 | 141 |
| 644 | 3300026078 | Ga0207702_10303407 | Ga0207702_103034072 | 141 |
| 645 | 3300026078 | Ga0207702_11029662 | Ga0207702_110296622 | 141 |
| 646 | 3300026088 | Ga0207641_10002695 | Ga0207641_1000269516 | 141 |
| 647 | 3300026088 | Ga0207641_10277514 | Ga0207641_102775141 | 141 |
| 648 | 3300026089 | Ga0207648_10252902 | Ga0207648_102529022 | 141 |
| 649 | 3300026095 | Ga0207676_10973350 | Ga0207676_109733501 | 141 |
| 650 | 3300026116 | Ga0207674_10139137 | Ga0207674_101391372 | 141 |
| 651 | 3300026116 | Ga0207674_10220768 | Ga0207674_102207682 | 141 |
| 652 | 3300026142 | Ga0207698_10247195 | Ga0207698_102471952 | 141 |
| 653 | 3300026142 | Ga0207698_11790985 | Ga0207698_117909851 | 141 |
| 654 | 3300027111 | Ga0209281_1000108 | Ga0209281_100010865 | 141 |
| 655 | 3300027512 | Ga0209179_1098678 | Ga0209179_10986781 | 141 |
| 656 | 3300027671 | Ga0209588_1027354 | Ga0209588_10273543 | 141 |
| 657 | 3300027671 | Ga0209588_1044791 | Ga0209588_10447911 | 141 |
| 658 | 3300027671 | Ga0209588_1045876 | Ga0209588_10458762 | 141 |
| 659 | 3300027671 | Ga0209588_1073764 | Ga0209588_10737642 | 141 |
| 660 | 3300027671 | Ga0209588_1255594 | Ga0209588_12555941 | 141 |
| 661 | 3300027907 | Ga0207428_10175270 | Ga0207428_101752702 | 141 |
| 662 | 3300028379 | Ga0268266_10000721 | Ga0268266_1000072110 | 141 |
| 663 | 3300028379 | Ga0268266_10273778 | Ga0268266_102737782 | 141 |
| 664 | 3300028379 | Ga0268266_10474876 | Ga0268266_104748761 | 141 |
| 665 | 3300028381 | Ga0268264_10046600 | Ga0268264_100466002 | 141 |
| 666 | 3300028381 | Ga0268264_10050795 | Ga0268264_100507952 | 141 |
| 667 | 3300028381 | Ga0268264_10861856 | Ga0268264_108618562 | 141 |
| 668 | 3300028577 | Ga0265318_10008761 | Ga0265318_100087616 | 141 |
| 669 | 3300028800 | Ga0265338_10248469 | Ga0265338_102484691 | 141 |
| 670 | 3300031241 | Ga0265325_10512973 | Ga0265325_105129731 | 141 |
| 671 | 3300031247 | Ga0265340_10055634 | Ga0265340_100556343 | 141 |
| 672 | 3300031250 | Ga0265331_10079010 | Ga0265331_100790101 | 141 |
| 673 | 3300031251 | Ga0265327_10000214 | Ga0265327_1000021411 | 141 |
| 674 | 3300031344 | Ga0265316_10434863 | Ga0265316_104348632 | 141 |
| 675 | 3300033547 | Ga0316212_1008679 | Ga0316212_10086792 | 141 |
| 676 | 3300035083 | Ga0373926_0006361 | Ga0373926_0006361_313_738 | 141 |
| 677 | 3300035116 | Ga0373945_0341982 | Ga0373945_0341982_106_531 | 141 |
| 678 | 3300035170 | Ga0373943_0044149 | Ga0373943_0044149_318_743 | 141 |
| 679 | 3300035171 | Ga0373946_0034777 | Ga0373946_0034777_196_621 | 141 |
| 680 | 3300035410 | Ga0373924_0001655 | Ga0373924_0001655_6282_6707 | 141 |
| 681 | 3300035410 | Ga0373924_0071453 | Ga0373924_0071453_222_647 | 141 |
| 682 | 3300035691 | Ga0373931_0104054 | Ga0373931_0104054_686_1111 | 141 |
| 683 | 3300035691 | Ga0373931_0540727 | Ga0373931_0540727_231_656 | 141 |
| 684 | 3300035691 | Ga0373931_0638824 | Ga0373931_0638824_261_686 | 141 |
| 685 | 3300035692 | Ga0373935_0088367 | Ga0373935_0088367_1490_1915 | 141 |
| 686 | 3300035695 | Ga0373927_0012762 | Ga0373927_0012762_3279_3704 | 141 |
| 687 | 3300035724 | Ga0373933_0107967 | Ga0373933_0107967_1143_1568 | 141 |
| 688 | 3300035724 | Ga0373933_0436477 | Ga0373933_0436477_405_830 | 141 |
| 689 | 3300035725 | Ga0373947_0834066 | Ga0373947_0834066_158_583 | 141 |
| 690 | 3300036401 | Ga0373937_0000225 | Ga0373937_0000225_12886_13311 | 141 |
| 691 | 3300036401 | Ga0373937_0107398 | Ga0373937_0107398_361_786 | 141 |
| 692 | 3300036401 | Ga0373937_0578241 | Ga0373937_0578241_240_665 | 141 |
| 693 | 3300036401 | Ga0373937_1431817 | Ga0373937_1431817_151_576 | 141 |
| 694 | 3300037466 | Ga0395898_0010182 | Ga0395898_0010182_8717_9142 | 141 |
| 695 | 3300037466 | Ga0395898_0505768 | Ga0395898_0505768_531_956 | 141 |
| 696 | 3300037471 | Ga0395905_0002196 | Ga0395905_0002196_19433_19939 | 141 |
| 697 | 3300037471 | Ga0395905_0162732 | Ga0395905_0162732_664_1089 | 141 |
| 698 | 3300037471 | Ga0395905_0204403 | Ga0395905_0204403_1308_1733 | 141 |
| 699 | 3300039437 | Ga0436365_0581532 | Ga0436365_0581532_1613_2038 | 141 |
| 700 | 3300039447 | Ga0436361_0069880 | Ga0436361_0069880_372_797 | 141 |
| 701 | 3300041498 | Ga0451841_0284456 | Ga0451841_0284456_277_702 | 141 |
| 702 | 3300041511 | Ga0451855_0031514 | Ga0451855_0031514_19_444 | 141 |
| 703 | 3300042876 | Ga0451577_0756303 | Ga0451577_0756303_389_814 | 141 |
| 704 | 3300044673 | Ga0453683_0842328 | Ga0453683_0842328_161_586 | 141 |
| 705 | 3300044694 | Ga0466963_0021566 | Ga0466963_0021566_3047_3472 | 141 |
| 706 | 3300044712 | Ga0453684_0598252 | Ga0453684_0598252_624_1076 | 141 |
| 707 | 3300044712 | Ga0453684_1622024 | Ga0453684_1622024_111_536 | 141 |
| 708 | 3300044842 | Ga0466957_0016647 | Ga0466957_0016647_445_888 | 141 |
| 709 | 3300044842 | Ga0466957_0096678 | Ga0466957_0096678_1215_1643 | 141 |
| 710 | 3300045049 | Ga0466959_1128004 | Ga0466959_1128004_21_446 | 141 |
| 711 | 3300046455 | Ga0495603_0131963 | Ga0495603_0131963_769_1194 | 141 |
| 712 | 3300046455 | Ga0495603_0539911 | Ga0495603_0539911_17_445 | 141 |
| 713 | 3300046462 | Ga0495651_0600920 | Ga0495651_0600920_197_622 | 141 |
| 714 | 3300046472 | Ga0495580_0039295 | Ga0495580_0039295_2924_3349 | 141 |
| 715 | 3300046473 | Ga0495582_0004066 | Ga0495582_0004066_457_882 | 141 |
| 716 | 3300046477 | Ga0495664_0570676 | Ga0495664_0570676_234_659 | 141 |
| 717 | 3300046477 | Ga0495664_0697865 | Ga0495664_0697865_137_562 | 141 |
| 718 | 3300046491 | Ga0495584_0046724 | Ga0495584_0046724_1142_1570 | 141 |
| 719 | 3300046491 | Ga0495584_0077069 | Ga0495584_0077069_1233_1661 | 141 |
| 720 | 3300046492 | Ga0495585_0000148 | Ga0495585_0000148_8682_9110 | 141 |
| 721 | 3300046500 | Ga0495596_0015142 | Ga0495596_0015142_2793_3221 | 141 |
| 722 | 3300046506 | Ga0495583_0190298 | Ga0495583_0190298_63_491 | 141 |
| 723 | 3300046506 | Ga0495583_0448014 | Ga0495583_0448014_58_489 | 141 |
| 724 | 3300046513 | Ga0495616_0169166 | Ga0495616_0169166_526_960 | 141 |
| 725 | 3300046516 | Ga0495628_0495082 | Ga0495628_0495082_251_676 | 141 |
| 726 | 3300046516 | Ga0495628_0712914 | Ga0495628_0712914_124_549 | 141 |
| 727 | 3300046517 | Ga0495630_0070531 | Ga0495630_0070531_1656_2084 | 141 |
| 728 | 3300046518 | Ga0495631_0063919 | Ga0495631_0063919_1127_1555 | 141 |
| 729 | 3300046522 | Ga0495643_0009289 | Ga0495643_0009289_867_1295 | 141 |
| 730 | 3300046523 | Ga0495644_0022045 | Ga0495644_0022045_709_1137 | 141 |
| 731 | 3300046525 | Ga0495663_0004095 | Ga0495663_0004095_1431_1865 | 141 |
| 732 | 3300046526 | Ga0495666_0015085 | Ga0495666_0015085_2462_2890 | 141 |
| 733 | 3300046526 | Ga0495666_0136191 | Ga0495666_0136191_480_908 | 141 |
| 734 | 3300046526 | Ga0495666_0326192 | Ga0495666_0326192_157_582 | 141 |
| 735 | 3300046529 | Ga0495652_0081018 | Ga0495652_0081018_1357_1782 | 141 |
| 736 | 3300046531 | Ga0495665_0070728 | Ga0495665_0070728_956_1384 | 141 |
| 737 | 3300046531 | Ga0495665_0169596 | Ga0495665_0169596_684_1112 | 141 |
| 738 | 3300046531 | Ga0495665_0249240 | Ga0495665_0249240_281_709 | 141 |
| 739 | 3300046535 | Ga0495586_0263149 | Ga0495586_0263149_181_609 | 141 |
| 740 | 3300046536 | Ga0495587_0018167 | Ga0495587_0018167_772_1197 | 141 |
| 741 | 3300046538 | Ga0495609_0001458 | Ga0495609_0001458_8643_9071 | 141 |
| 742 | 3300046538 | Ga0495609_0044747 | Ga0495609_0044747_1111_1545 | 141 |
| 743 | 3300046539 | Ga0495621_0133533 | Ga0495621_0133533_298_732 | 141 |
| 744 | 3300046542 | Ga0495597_0009662 | Ga0495597_0009662_3626_4060 | 141 |
| 745 | 3300046543 | Ga0495645_0016723 | Ga0495645_0016723_2255_2680 | 141 |
| 746 | 3300046543 | Ga0495645_0098475 | Ga0495645_0098475_383_808 | 141 |
| 747 | 3300046543 | Ga0495645_0329839 | Ga0495645_0329839_212_637 | 141 |
| 748 | 3300046557 | Ga0495622_0001973 | Ga0495622_0001973_5176_5604 | 141 |
| 749 | 3300046557 | Ga0495622_0006367 | Ga0495622_0006367_1665_2093 | 141 |
| 750 | 3300046557 | Ga0495622_0209788 | Ga0495622_0209788_154_579 | 141 |
| 751 | 3300046615 | Ga0495656_0035523 | Ga0495656_0035523_184_618 | 141 |
| 752 | 3300046615 | Ga0495656_0110959 | Ga0495656_0110959_17_442 | 141 |
| 753 | 3300046616 | Ga0495668_0040218 | Ga0495668_0040218_1854_2282 | 141 |
| 754 | 3300046616 | Ga0495668_0226080 | Ga0495668_0226080_158_592 | 141 |
| 755 | 3300046642 | Ga0495634_0369184 | Ga0495634_0369184_386_814 | 141 |
| 756 | 3300046648 | Ga0495611_0090206 | Ga0495611_0090206_849_1277 | 141 |
| 757 | 3300046660 | Ga0495625_0028107 | Ga0495625_0028107_1532_1960 | 141 |
| 758 | 3300046660 | Ga0495625_0314266 | Ga0495625_0314266_119_553 | 141 |
| 759 | 3300046660 | Ga0495625_0450051 | Ga0495625_0450051_341_775 | 141 |
| 760 | 3300046663 | Ga0495635_0054129 | Ga0495635_0054129_1121_1546 | 141 |
| 761 | 3300046663 | Ga0495635_0096049 | Ga0495635_0096049_266_694 | 141 |
| 762 | 3300046665 | Ga0495661_0024256 | Ga0495661_0024256_3401_3835 | 141 |
| 763 | 3300046674 | Ga0495588_0003529 | Ga0495588_0003529_3537_3965 | 141 |
| 764 | 3300046674 | Ga0495588_0012161 | Ga0495588_0012161_2033_2464 | 141 |
| 765 | 3300046674 | Ga0495588_0037676 | Ga0495588_0037676_1010_1438 | 141 |
| 766 | 3300046674 | Ga0495588_0088169 | Ga0495588_0088169_268_696 | 141 |
| 767 | 3300046680 | Ga0495646_0083017 | Ga0495646_0083017_848_1273 | 141 |
| 768 | 3300046689 | Ga0495613_0198177 | Ga0495613_0198177_772_1197 | 141 |
| 769 | 3300046689 | Ga0495613_0671068 | Ga0495613_0671068_216_641 | 141 |
| 770 | 3300046690 | Ga0495624_0002163 | Ga0495624_0002163_1988_2416 | 141 |
| 771 | 3300046794 | Ga0495589_0101993 | Ga0495589_0101993_274_702 | 141 |
| 772 | 3300047315 | Ga0495581_0016671 | Ga0495581_0016671_3174_3602 | 141 |
| 773 | 3300047315 | Ga0495581_0164671 | Ga0495581_0164671_689_1117 | 141 |
| 774 | 3300047317 | Ga0495604_0033035 | Ga0495604_0033035_2176_2601 | 141 |
| 775 | 3300047318 | Ga0495636_0030641 | Ga0495636_0030641_1212_1640 | 141 |
| 776 | 3300047318 | Ga0495636_0190296 | Ga0495636_0190296_120_545 | 141 |
| 777 | 3300047319 | Ga0495674_0153215 | Ga0495674_0153215_630_1055 | 141 |
| 778 | 3300047319 | Ga0495674_0393378 | Ga0495674_0393378_420_845 | 141 |
| 779 | 3300047320 | Ga0495672_0210973 | Ga0495672_0210973_16_444 | 141 |
| 780 | 3300047321 | Ga0495676_0080007 | Ga0495676_0080007_1377_1805 | 141 |
| 781 | 3300047323 | Ga0495683_0300219 | Ga0495683_0300219_251_679 | 141 |
| 782 | 3300047444 | Ga0495675_0225987 | Ga0495675_0225987_652_1080 | 141 |
| 783 | 3300047445 | Ga0495677_0013840 | Ga0495677_0013840_848_1276 | 141 |
| 784 | 3300047447 | Ga0495685_041485 | Ga0495685_041485_710_1144 | 141 |
| 785 | 3300047469 | Ga0495673_0018181 | Ga0495673_0018181_2130_2558 | 141 |
| 786 | 3300047470 | Ga0495681_0013143 | Ga0495681_0013143_4337_4771 | 141 |
| 787 | 3300047470 | Ga0495681_0205002 | Ga0495681_0205002_73_507 | 141 |
| 788 | 3300048088 | Ga0495602_0283926 | Ga0495602_0283926_283_708 | 141 |
| 789 | 3300048089 | Ga0495614_0034013 | Ga0495614_0034013_1458_1886 | 141 |
| 790 | 3300048904 | Ga0496101_0177535 | Ga0496101_0177535_167_592 | 141 |
| 791 | 3300048905 | Ga0496102_0001461 | Ga0496102_0001461_11886_12311 | 141 |
| 792 | 3300048905 | Ga0496102_0042961 | Ga0496102_0042961_2491_2916 | 141 |
| 793 | 3300048905 | Ga0496102_1605542 | Ga0496102_1605542_58_492 | 141 |
| 794 | 3300048906 | Ga0496103_0016154 | Ga0496103_0016154_3277_3702 | 141 |
| 795 | 3300048906 | Ga0496103_0821141 | Ga0496103_0821141_19_444 | 141 |
| 796 | 3300048907 | Ga0496104_0047745 | Ga0496104_0047745_1744_2169 | 141 |
| 797 | 3300048907 | Ga0496104_0064166 | Ga0496104_0064166_613_1038 | 141 |
| 798 | 3300048908 | Ga0496105_0020489 | Ga0496105_0020489_1238_1663 | 141 |
| 799 | 3300048908 | Ga0496105_0054680 | Ga0496105_0054680_826_1251 | 141 |
| 800 | 3300048909 | Ga0496106_0053142 | Ga0496106_0053142_2425_2850 | 141 |
| 801 | 3300048909 | Ga0496106_0527143 | Ga0496106_0527143_211_663 | 141 |
| 802 | 3300048910 | Ga0496107_0870148 | Ga0496107_0870148_54_479 | 141 |
| 803 | 3300048911 | Ga0496108_0060056 | Ga0496108_0060056_542_1012 | 141 |
| 804 | 3300048911 | Ga0496108_0521908 | Ga0496108_0521908_335_760 | 141 |
| 805 | 3300048912 | Ga0496109_0202502 | Ga0496109_0202502_1163_1633 | 141 |
| 806 | 3300048912 | Ga0496109_1212604 | Ga0496109_1212604_74_499 | 141 |
| 807 | 3300048913 | Ga0496110_0010298 | Ga0496110_0010298_5398_5823 | 141 |
| 808 | 3300048913 | Ga0496110_1192164 | Ga0496110_1192164_137_562 | 141 |
| 809 | 3300048914 | Ga0496111_0009322 | Ga0496111_0009322_257_682 | 141 |
| 810 | 3300048915 | Ga0496112_0009847 | Ga0496112_0009847_721_1146 | 141 |
| 811 | 3300048915 | Ga0496112_0024683 | Ga0496112_0024683_4626_5051 | 141 |
| 812 | 3300048915 | Ga0496112_0081126 | Ga0496112_0081126_2755_3180 | 141 |
| 813 | 3300048915 | Ga0496112_0310245 | Ga0496112_0310245_828_1253 | 141 |
| 814 | 3300048915 | Ga0496112_1083550 | Ga0496112_1083550_20_445 | 141 |
| 815 | 3300048916 | Ga0496113_0002200 | Ga0496113_0002200_5673_6098 | 141 |
| 816 | 3300048916 | Ga0496113_0063277 | Ga0496113_0063277_537_962 | 141 |
| 817 | 3300048916 | Ga0496113_0990967 | Ga0496113_0990967_116_544 | 141 |
| 818 | 3300048917 | Ga0496114_0015547 | Ga0496114_0015547_5409_5879 | 141 |
| 819 | 3300048917 | Ga0496114_0520016 | Ga0496114_0520016_225_650 | 141 |
| 820 | 3300048918 | Ga0496115_0004423 | Ga0496115_0004423_1337_1762 | 141 |
| 821 | 3300048918 | Ga0496115_0017316 | Ga0496115_0017316_3445_3876 | 141 |
| 822 | 3300048918 | Ga0496115_0493795 | Ga0496115_0493795_90_542 | 141 |
| 823 | 3300048918 | Ga0496115_0656843 | Ga0496115_0656843_83_508 | 141 |
| 824 | 3300048918 | Ga0496115_0760877 | Ga0496115_0760877_10_480 | 141 |
| 825 | 3300048927 | Ga0496124_0194661 | Ga0496124_0194661_602_1027 | 141 |
| 826 | 3300048929 | Ga0496126_0689903 | Ga0496126_0689903_338_763 | 141 |
| 827 | 3300049460 | Ga0495682_0176312 | Ga0495682_0176312_222_647 | 141 |
| 828 | 3300050510 | nmdc:mga06r32_134538_c1 | nmdc:mga06r32_134538_c1_1513_1938 | 141 |
| 829 | 3300050511 | nmdc:mga08y16_199106_c1 | nmdc:mga08y16_199106_c1_727_1155 | 141 |
| 830 | 3300050512 | nmdc:mga0n895_107001_c1 | nmdc:mga0n895_107001_c1_988_1413 | 141 |
| 831 | 3300050512 | nmdc:mga0n895_233160_c1 | nmdc:mga0n895_233160_c1_141_566 | 141 |
| 832 | 3300050512 | nmdc:mga0n895_535402_c1 | nmdc:mga0n895_535402_c1_336_761 | 141 |
| 833 | 3300050513 | nmdc:mga0rr50_65151_c1 | nmdc:mga0rr50_65151_c1_1339_1764 | 141 |
| 834 | 3300050513 | nmdc:mga0rr50_773087_c1 | nmdc:mga0rr50_773087_c1_88_513 | 141 |
| 835 | 3300050513 | nmdc:mga0rr50_837547_c1 | nmdc:mga0rr50_837547_c1_45_470 | 141 |
| 836 | 3300050513 | nmdc:mga0rr50_86907_c1 | nmdc:mga0rr50_86907_c1_898_1323 | 141 |
| 837 | 3300050514 | nmdc:mga08x19_311100_c1 | nmdc:mga08x19_311100_c1_626_1051 | 141 |
| 838 | 3300050514 | nmdc:mga08x19_332951_c1 | nmdc:mga08x19_332951_c1_535_960 | 141 |
| 839 | 3300050514 | nmdc:mga08x19_952749_c1 | nmdc:mga08x19_952749_c1_138_563 | 141 |
| 840 | 3300053077 | Ga0495601_0029001 | Ga0495601_0029001_1415_1840 | 141 |
| 841 | 3300053084 | Ga0495595_0644363 | Ga0495595_0644363_27_452 | 141 |
| 842 | 3300053090 | Ga0500646_0348967 | Ga0500646_0348967_70_498 | 141 |
| 843 | 3300053125 | Ga0500618_027643 | Ga0500618_027643_34_465 | 141 |
| 844 | 3300053138 | Ga0500564_012813 | Ga0500564_012813_2438_2863 | 141 |
| 845 | 3300059477 | Ga0587084_029059 | Ga0587084_029059_441_866 | 141 |
| 846 | 3300059490 | Ga0587066_042734 | Ga0587066_042734_424_849 | 141 |
| 847 | 3300059491 | Ga0587070_084209 | Ga0587070_084209_268_693 | 141 |
| 848 | 3300059492 | Ga0587073_0054585 | Ga0587073_0054585_27_452 | 141 |
| 849 | 3300059504 | Ga0587082_136810 | Ga0587082_136810_27_452 | 141 |
| 850 | 3300059505 | Ga0587083_0115189 | Ga0587083_0115189_251_676 | 141 |
| 851 | 3300059513 | Ga0587094_135218 | Ga0587094_135218_68_493 | 141 |
| 852 | 3300059605 | Ga0587106_027054 | Ga0587106_027054_145_570 | 141 |
| 853 | 3300059624 | Ga0587109_049854 | Ga0587109_049854_418_843 | 141 |
| 854 | 3300059626 | Ga0587115_008128 | Ga0587115_008128_802_1227 | 141 |
| 855 | 3300059627 | Ga0587117_116866 | Ga0587117_116866_10_435 | 141 |
| 856 | 3300059640 | Ga0587067_034498 | Ga0587067_034498_515_940 | 141 |
| 857 | 3300059642 | Ga0587069_104578 | Ga0587069_104578_31_456 | 141 |
| 858 | 3300059643 | Ga0587072_080587 | Ga0587072_080587_268_693 | 141 |
| 859 | 3300059644 | Ga0587075_013836 | Ga0587075_013836_31_456 | 141 |
| 860 | 3300059652 | Ga0587107_048558 | Ga0587107_048558_275_700 | 141 |
| 861 | 3300060344 | Ga0587071_063793 | Ga0587071_063793_45_470 | 141 |
| 862 | 3300060346 | Ga0587111_0218447 | Ga0587111_0218447_109_534 | 141 |
| 863 | 3300061719 | Ga0466962_0192145 | Ga0466962_0192145_76_501 | 141 |
| 864 | 3300005329 | Ga0070683_100182240 | Ga0070683_1001822401 | 142 |
| 865 | 3300005336 | Ga0070680_100365642 | Ga0070680_1003656422 | 142 |
| 866 | 3300005339 | Ga0070660_100294666 | Ga0070660_1002946662 | 142 |
| 867 | 3300005458 | Ga0070681_10411539 | Ga0070681_104115392 | 142 |
| 868 | 3300005535 | Ga0070684_100308058 | Ga0070684_1003080583 | 142 |
| 869 | 3300005577 | Ga0068857_100040030 | Ga0068857_1000400302 | 142 |
| 870 | 3300005618 | Ga0068864_100068413 | Ga0068864_1000684133 | 142 |
| 871 | 3300005841 | Ga0068863_100021310 | Ga0068863_1000213105 | 142 |
| 872 | 3300005842 | Ga0068858_100550516 | Ga0068858_1005505162 | 142 |
| 873 | 3300006028 | Ga0070717_11666994 | Ga0070717_116669941 | 142 |
| 874 | 3300006175 | Ga0070712_100715313 | Ga0070712_1007153132 | 142 |
| 875 | 3300006358 | Ga0068871_100191938 | Ga0068871_1001919383 | 142 |
| 876 | 3300006847 | Ga0075431_101196053 | Ga0075431_1011960531 | 142 |
| 877 | 3300007076 | Ga0075435_100693015 | Ga0075435_1006930152 | 142 |
| 878 | 3300009094 | Ga0111539_12016933 | Ga0111539_120169332 | 142 |
| 879 | 3300009174 | Ga0105241_10494279 | Ga0105241_104942792 | 142 |
| 880 | 3300009551 | Ga0105238_10788970 | Ga0105238_107889702 | 142 |
| 881 | 3300013105 | Ga0157369_10975744 | Ga0157369_109757442 | 142 |
| 882 | 3300014968 | Ga0157379_10050216 | Ga0157379_100502163 | 142 |
| 883 | 3300014969 | Ga0157376_10781969 | Ga0157376_107819692 | 142 |
| 884 | 3300025906 | Ga0207699_10292632 | Ga0207699_102926322 | 142 |
| 885 | 3300025915 | Ga0207693_10337539 | Ga0207693_103375391 | 142 |
| 886 | 3300025924 | Ga0207694_10677440 | Ga0207694_106774402 | 142 |
| 887 | 3300025941 | Ga0207711_10166927 | Ga0207711_101669271 | 142 |
| 888 | 3300025945 | Ga0207679_10947089 | Ga0207679_109470891 | 142 |
| 889 | 3300026035 | Ga0207703_11070389 | Ga0207703_110703892 | 142 |
| 890 | 3300026095 | Ga0207676_10036301 | Ga0207676_100363011 | 142 |
| 891 | 3300026116 | Ga0207674_10035632 | Ga0207674_100356323 | 142 |
| 892 | 3300035692 | Ga0373935_0781767 | Ga0373935_0781767_203_634 | 142 |
| 893 | 3300046517 | Ga0495630_0126744 | Ga0495630_0126744_166_597 | 142 |
| 894 | 3300046528 | Ga0495642_0072640 | Ga0495642_0072640_410_841 | 142 |
| 895 | 3300048905 | Ga0496102_0555771 | Ga0496102_0555771_560_991 | 142 |
| 896 | 3300048907 | Ga0496104_0002008 | Ga0496104_0002008_447_878 | 142 |
| 897 | 3300048908 | Ga0496105_0014169 | Ga0496105_0014169_4120_4551 | 142 |
| 898 | 3300048911 | Ga0496108_0017503 | Ga0496108_0017503_2155_2586 | 142 |
| 899 | 3300048912 | Ga0496109_0134847 | Ga0496109_0134847_375_806 | 142 |
| 900 | 3300048913 | Ga0496110_1256933 | Ga0496110_1256933_39_470 | 142 |
| 901 | 3300048914 | Ga0496111_0151783 | Ga0496111_0151783_212_643 | 142 |
| 902 | 3300048915 | Ga0496112_0029744 | Ga0496112_0029744_1163_1594 | 142 |
| 903 | 3300048916 | Ga0496113_0030749 | Ga0496113_0030749_2906_3337 | 142 |
| 904 | 3300050510 | nmdc:mga06r32_823324_c1 | nmdc:mga06r32_823324_c1_414_845 | 142 |
| 905 | 3300053090 | Ga0500646_0005101 | Ga0500646_0005101_83_514 | 142 |
| 906 | 3300053092 | Ga0500583_0029030 | Ga0500583_0029030_1469_1900 | 142 |
| 907 | 3300053096 | Ga0500641_0017669 | Ga0500641_0017669_484_915 | 142 |
| 908 | 3300053099 | Ga0500654_076893 | Ga0500654_076893_889_1320 | 142 |
| 909 | 3300053146 | Ga0500588_0004579 | Ga0500588_0004579_1848_2279 | 142 |
| 910 | 3300053160 | Ga0500633_0018606 | Ga0500633_0018606_404_835 | 142 |
| 911 | 3300000546 | LJNas_1001069 | LJNas_10010692 | 143 |
| 912 | 3300013296 | Ga0157374_10071311 | Ga0157374_100713111 | 143 |
| 913 | 3300013306 | Ga0163162_10325912 | Ga0163162_103259124 | 143 |
| 914 | 3300014325 | Ga0163163_10310653 | Ga0163163_103106532 | 143 |
| 915 | 3300014969 | Ga0157376_10007881 | Ga0157376_100078818 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nye-assembly3.cif.gz_F | crystal structure of osmc from e. coli | 0.9733 | 1 | 143 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9697 | 1 | 143 |
| 1nye-assembly2.cif.gz_D | crystal structure of osmc from e. coli | 0.9678 | 1 | 143 |
| 1nye-assembly2.cif.gz_C | crystal structure of osmc from e. coli | 0.9675 | 1 | 143 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.9608 | 1 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9736 | 1 | 143 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9537 | 1 | 143 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9334 | 1 | 142 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.927 | 1 | 142 | 3.30.300.20 |
| 6mjnB02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9202 | 45 | 142 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537D4C0-F1-model_v4 | OsmC family peroxiredoxin | 0.9907 | 1 | 83 |
GO:0004601
GO:0006979 |
| AF-A0A6L5G3Q2-F1-model_v4 | OsmC family peroxiredoxin | 0.9881 | 47 | 142 |
GO:0004601
GO:0006979 |
| AF-B4VT13-F1-model_v4 | OsmC-like protein | 0.9863 | 1 | 79 |
GO:0004601
GO:0006979 |
| AF-A0A1N6JDU6-F1-model_v4 | Osmotically inducible protein OsmC | 0.9851 | 1 | 142 |
GO:0004601
GO:0006979 |
| AF-A0A358RW30-F1-model_v4 | deleted | 0.9846 | 1 | 77 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar