F485598

General Info

Members Datasets Scaffolds Average Seq Length
915 397 907 141

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0002196|Ga0395905_0002196_19433_19939
Length 168
Sequence MMDATFASMIFLQSGRTASTIQSGEINMKRTASAAWTGGLKDGKGNISTQSGVLSDTQYGFSSRFESGIGTNPEELIAAAHAGCFTMALSAQLGEAGITAEKLETTAAVTLDKVDGGFAITAIQLDLVAKIPGADQKVFEEAARKAKEGCPVSKLLNAEITLNSKLES

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
3 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
4 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
5 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
6 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
7 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
8 2952252522 Salinicola sp. DM10 Isolate Unclassified
9 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
189 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
196 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
229 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
289 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
290 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
291 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
326 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
327 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
340 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
341 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
342 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
343 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
346 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
347 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
397 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.17
Metatranscriptomes 15.96
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0.11
Rhizoplane 4.81
Rhizosphere 91.8
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001069 3300000546 Bacteria 4287
2 rootH1_10166822 3300003316 Unclassified 1649
3 rootH2_10327266 3300003320 Bacteria 1371
4 Ga0058863_10086366 3300004799 Bacteria 1170
5 Ga0058863_10169191 3300004799 Bacteria 2133
6 Ga0058861_10016523 3300004800 Bacteria 1012
7 Ga0058861_10040453 3300004800 Bacteria 650
8 Ga0058862_10279902 3300004803 Bacteria 827
9 Ga0058862_12704330 3300004803 Bacteria 2853
10 Ga0058862_12825811 3300004803 Bacteria 585
11 Ga0070658_10034779 3300005327 Bacteria 4055
12 Ga0070676_10027262 3300005328 Bacteria 3238
13 Ga0070683_100182240 3300005329 Bacteria 1994
14 Ga0070683_100289713 3300005329 Bacteria 1557
15 Ga0070683_100703916 3300005329 Bacteria 967
16 Ga0070683_101242974 3300005329 Bacteria 716
17 Ga0070690_100144860 3300005330 Bacteria 1615
18 Ga0070677_10056078 3300005333 Bacteria 1610
19 Ga0068869_100031446 3300005334 Bacteria 3734
20 Ga0068869_100042357 3300005334 Bacteria 3263
21 Ga0068869_100091915 3300005334 Bacteria 2283
22 Ga0070666_10299951 3300005335 Bacteria 1144
23 Ga0070680_100053591 3300005336 Bacteria 3293
24 Ga0070680_100114489 3300005336 Bacteria 2247
25 Ga0070680_100365642 3300005336 Bacteria 1227
26 Ga0070682_100559703 3300005337 Bacteria 896
27 Ga0070682_101217062 3300005337 Unclassified 636
28 Ga0068868_100083377 3300005338 Bacteria 2566
29 Ga0068868_100259213 3300005338 Bacteria 1466
30 Ga0068868_101282011 3300005338 Bacteria 680
31 Ga0070660_100259930 3300005339 Bacteria 1417
32 Ga0070660_100294666 3300005339 Bacteria 1329
33 Ga0070660_101228166 3300005339 Bacteria 636
34 Ga0070661_100029525 3300005344 Bacteria 3958
35 Ga0070661_100514835 3300005344 Bacteria 959
36 Ga0070661_101052665 3300005344 Bacteria 676
37 Ga0070668_100035392 3300005347 Bacteria 3807
38 Ga0070675_100172173 3300005354 Bacteria 1868
39 Ga0070674_100145322 3300005356 Bacteria 1784
40 Ga0070674_100874929 3300005356 Bacteria 781
41 Ga0070674_101838990 3300005356 Bacteria 549
42 Ga0070673_100124093 3300005364 Bacteria 2158
43 Ga0070688_101739287 3300005365 Bacteria 511
44 Ga0070659_100009699 3300005366 Bacteria 7074
45 Ga0070659_100120996 3300005366 Bacteria 2120
46 Ga0070659_100337811 3300005366 Bacteria 1261
47 Ga0070667_100074620 3300005367 Bacteria 2894
48 Ga0070667_100172287 3300005367 Bacteria 1911
49 Ga0070667_100613076 3300005367 Bacteria 1003
50 Ga0070667_101161140 3300005367 Bacteria 722
51 Ga0070709_10065312 3300005434 Bacteria 2330
52 Ga0070709_10096933 3300005434 Bacteria 1956
53 Ga0070709_10130731 3300005434 Bacteria 1714
54 Ga0070709_11430068 3300005434 Unclassified 560
55 Ga0070714_100044401 3300005435 Bacteria 3762
56 Ga0070714_100120267 3300005435 Bacteria 2335
57 Ga0070714_100251061 3300005435 Bacteria 1636
58 Ga0070714_100463996 3300005435 Unclassified 1204
59 Ga0070714_100942820 3300005435 Bacteria 839
60 Ga0070714_101517440 3300005435 Bacteria 655
61 Ga0070714_101658704 3300005435 Bacteria 624
62 Ga0070713_100099060 3300005436 Bacteria 2521
63 Ga0070713_100128559 3300005436 Bacteria 2231
64 Ga0070713_100232745 3300005436 Bacteria 1675
65 Ga0070713_100251643 3300005436 Bacteria 1611
66 Ga0070710_10094959 3300005437 Bacteria 1765
67 Ga0070711_100003132 3300005439 Bacteria 9587
68 Ga0070711_100056169 3300005439 Bacteria 2722
69 Ga0070711_100160005 3300005439 Bacteria 1706
70 Ga0070711_100964879 3300005439 Bacteria 730
71 Ga0070705_100024135 3300005440 Bacteria 3278
72 Ga0070705_100164580 3300005440 Bacteria 1486
73 Ga0070705_100626880 3300005440 Bacteria 835
74 Ga0070708_100027576 3300005445 Bacteria 4875
75 Ga0070708_100039185 3300005445 Bacteria 4145
76 Ga0070708_100228402 3300005445 Bacteria 1746
77 Ga0070708_100460244 3300005445 Unclassified 1200
78 Ga0070708_101415699 3300005445 Bacteria 648
79 Ga0070663_100112126 3300005455 Bacteria 2051
80 Ga0070663_100689596 3300005455 Bacteria 867
81 Ga0070678_100003496 3300005456 Bacteria 8756
82 Ga0070678_101131826 3300005456 Bacteria 724
83 Ga0070662_100166573 3300005457 Bacteria 1727
84 Ga0070662_100687240 3300005457 Bacteria 865
85 Ga0070662_101429197 3300005457 Bacteria 596
86 Ga0070681_10019745 3300005458 Bacteria 6749
87 Ga0070681_10028870 3300005458 Bacteria 5573
88 Ga0070681_10215999 3300005458 Unclassified 1833
89 Ga0070681_10324364 3300005458 Bacteria 1449
90 Ga0070681_10411539 3300005458 Bacteria 1264
91 Ga0070681_10827502 3300005458 Bacteria 843
92 Ga0068867_100078756 3300005459 Bacteria 2479
93 Ga0068867_100313148 3300005459 Bacteria 1298
94 Ga0068867_100764123 3300005459 Bacteria 859
95 Ga0070685_10315238 3300005466 Bacteria 1058
96 Ga0070706_100345862 3300005467 Bacteria 1386
97 Ga0070707_100004850 3300005468 Bacteria 12603
98 Ga0070707_100279293 3300005468 Bacteria 1623
99 Ga0070707_100422840 3300005468 Unclassified 1293
100 Ga0070707_100423774 3300005468 Bacteria 1291
101 Ga0070698_100001375 3300005471 Bacteria 27052
102 Ga0070698_100007655 3300005471 Bacteria 11687
103 Ga0070698_100009642 3300005471 Bacteria 10329
104 Ga0070698_100041339 3300005471 Bacteria 4732
105 Ga0070699_100059421 3300005518 Bacteria 3311
106 Ga0070699_100606773 3300005518 Bacteria 998
107 Ga0070699_100760776 3300005518 Bacteria 886
108 Ga0070699_100880319 3300005518 Bacteria 820
109 Ga0070679_100000958 3300005530 Bacteria 25121
110 Ga0070679_100008320 3300005530 Bacteria 9758
111 Ga0070679_100082834 3300005530 Bacteria 3197
112 Ga0070679_100118050 3300005530 Bacteria 2637
113 Ga0070679_100241474 3300005530 Bacteria 1764
114 Ga0070679_100310879 3300005530 Bacteria 1526
115 Ga0070684_100006317 3300005535 Bacteria 9156
116 Ga0070684_100308058 3300005535 Bacteria 1454
117 Ga0070684_100798320 3300005535 Bacteria 882
118 Ga0070697_100292145 3300005536 Bacteria 1400
119 Ga0068853_100485837 3300005539 Bacteria 1165
120 Ga0068853_100732461 3300005539 Bacteria 944
121 Ga0068853_100879063 3300005539 Bacteria 860
122 Ga0068853_100888716 3300005539 Bacteria 855
123 Ga0070686_100057415 3300005544 Bacteria 2500
124 Ga0070695_100061882 3300005545 Unclassified 2429
125 Ga0070693_100013777 3300005547 Bacteria 4126
126 Ga0070693_100021726 3300005547 Bacteria 3402
127 Ga0070693_100761151 3300005547 Bacteria 714
128 Ga0070665_100000391 3300005548 Bacteria 64820
129 Ga0070665_100154533 3300005548 Bacteria 2296
130 Ga0070665_101871498 3300005548 Bacteria 606
131 Ga0070704_100558899 3300005549 Bacteria 1001
132 Ga0068855_100100486 3300005563 Bacteria 3330
133 Ga0068855_100111363 3300005563 Bacteria 3143
134 Ga0068855_100129120 3300005563 Bacteria 2887
135 Ga0068855_100131214 3300005563 Bacteria 2861
136 Ga0070664_100401506 3300005564 Bacteria 1253
137 Ga0068857_100040030 3300005577 Bacteria 4156
138 Ga0068857_100227267 3300005577 Bacteria 1706
139 Ga0068854_100092555 3300005578 Bacteria 2252
140 Ga0068854_100192745 3300005578 Bacteria 1598
141 Ga0068856_100315011 3300005614 Bacteria 1582
142 Ga0068856_101000263 3300005614 Bacteria 854
143 Ga0068856_101260083 3300005614 Bacteria 755
144 Ga0068856_102650767 3300005614 Bacteria 507
145 Ga0068852_100075097 3300005616 Bacteria 2980
146 Ga0068852_100392618 3300005616 Bacteria 1363
147 Ga0068852_100879737 3300005616 Unclassified 912
148 Ga0068852_101417154 3300005616 Bacteria 717
149 Ga0068852_102061475 3300005616 Unclassified 592
150 Ga0068859_100018620 3300005617 Bacteria 6980
151 Ga0068859_100052217 3300005617 Unclassified 4109
152 Ga0068859_100092999 3300005617 Bacteria 3067
153 Ga0068859_100178193 3300005617 Bacteria 2208
154 Ga0068859_100298246 3300005617 Bacteria 1705
155 Ga0068859_100506921 3300005617 Bacteria 1302
156 Ga0068859_100923001 3300005617 Bacteria 957
157 Ga0068859_101207982 3300005617 Bacteria 833
158 Ga0068864_100068413 3300005618 Bacteria 3085
159 Ga0068864_100823596 3300005618 Bacteria 913
160 Ga0068864_101296838 3300005618 Bacteria 728
161 Ga0068866_10080513 3300005718 Bacteria 1747
162 Ga0068861_100091750 3300005719 Bacteria 2399
163 Ga0068861_100214668 3300005719 Bacteria 1622
164 Ga0068851_10125167 3300005834 Bacteria 1385
165 Ga0068851_10502236 3300005834 Bacteria 727
166 Ga0068870_10027185 3300005840 Bacteria 2859
167 Ga0068863_100002412 3300005841 Bacteria 18565
168 Ga0068863_100021310 3300005841 Bacteria 6185
169 Ga0068863_100246439 3300005841 Bacteria 1725
170 Ga0068863_101580882 3300005841 Bacteria 665
171 Ga0068863_101660866 3300005841 Bacteria 648
172 Ga0068858_100025426 3300005842 Bacteria 5509
173 Ga0068858_100116326 3300005842 Bacteria 2499
174 Ga0068858_100550516 3300005842 Bacteria 1117
175 Ga0068858_101248359 3300005842 Bacteria 731
176 Ga0068860_100020699 3300005843 Bacteria 6373
177 Ga0068860_100027511 3300005843 Bacteria 5476
178 Ga0068860_100056618 3300005843 Bacteria 3726
179 Ga0068860_100159899 3300005843 Bacteria 2172
180 Ga0068860_100269693 3300005843 Bacteria 1661
181 Ga0068860_100969438 3300005843 Bacteria 868
182 Ga0068860_101135247 3300005843 Bacteria 801
183 Ga0068862_100278398 3300005844 Bacteria 1532
184 Ga0068862_101838212 3300005844 Bacteria 615
185 Ga0081540_1213712 3300005983 Bacteria 691
186 Ga0070717_10398630 3300006028 Unclassified 1236
187 Ga0070717_10474973 3300006028 Bacteria 1129
188 Ga0070717_10569050 3300006028 Bacteria 1027
189 Ga0070717_10635640 3300006028 Bacteria 969
190 Ga0070717_11666994 3300006028 Bacteria 577
191 Ga0070715_10081441 3300006163 Bacteria 1470
192 Ga0070715_10117164 3300006163 Bacteria 1265
193 Ga0070715_10425504 3300006163 Bacteria 744
194 Ga0070715_10443497 3300006163 Bacteria 731
195 Ga0070716_100038082 3300006173 Bacteria 2661
196 Ga0070716_100111714 3300006173 Bacteria 1695
197 Ga0070716_100517043 3300006173 Bacteria 884
198 Ga0070712_100009764 3300006175 Bacteria 6048
199 Ga0070712_100147025 3300006175 Bacteria 1805
200 Ga0070712_100715313 3300006175 Bacteria 855
201 Ga0070712_100738516 3300006175 Bacteria 842
202 Ga0070712_101947838 3300006175 Bacteria 515
203 Ga0075367_10585419 3300006178 Bacteria 709
204 Ga0075366_10010141 3300006195 Bacteria 5282
205 Ga0075366_10051605 3300006195 Bacteria 2444
206 Ga0097621_100036118 3300006237 Bacteria 3952
207 Ga0097621_100198944 3300006237 Bacteria 1739
208 Ga0068871_100002381 3300006358 Bacteria 12820
209 Ga0068871_100191938 3300006358 Bacteria 1760
210 Ga0068871_100579516 3300006358 Unclassified 1018
211 Ga0075428_100003175 3300006844 Bacteria 17960
212 Ga0075431_101196053 3300006847 Bacteria 723
213 Ga0075434_100004172 3300006871 Bacteria 12949
214 Ga0075434_100010159 3300006871 Bacteria 8818
215 Ga0075434_100521769 3300006871 Bacteria 1208
216 Ga0075434_100553503 3300006871 Bacteria 1170
217 Ga0068865_100099788 3300006881 Unclassified 2123
218 Ga0068865_100344456 3300006881 Bacteria 1205
219 Ga0068865_100657344 3300006881 Bacteria 891
220 Ga0075436_100230686 3300006914 Bacteria 1315
221 Ga0075436_101407922 3300006914 Unclassified 529
222 Ga0097620_100018620 3300006931 Bacteria 6980
223 Ga0097620_100052221 3300006931 Unclassified 4109
224 Ga0097620_100093004 3300006931 Bacteria 3067
225 Ga0097620_100178209 3300006931 Bacteria 2208
226 Ga0097620_100298283 3300006931 Bacteria 1705
227 Ga0097620_100922770 3300006931 Bacteria 957
228 Ga0097620_101208025 3300006931 Bacteria 833
229 Ga0075435_100097258 3300007076 Bacteria 2436
230 Ga0075435_100288125 3300007076 Bacteria 1403
231 Ga0075435_100513187 3300007076 Bacteria 1037
232 Ga0075435_100693015 3300007076 Bacteria 885
233 Ga0075435_100891819 3300007076 Bacteria 775
234 Ga0099794_10000752 3300007265 Bacteria 10915
235 Ga0099794_10004425 3300007265 Bacteria 5520
236 Ga0099794_10025943 3300007265 Bacteria 2704
237 Ga0099794_10116411 3300007265 Unclassified 1342
238 Ga0099794_10184704 3300007265 Bacteria 1065
239 Ga0099794_10224941 3300007265 Bacteria 964
240 Ga0099794_10238461 3300007265 Bacteria 936
241 Ga0099795_10220533 3300007788 Bacteria 807
242 Ga0105251_10566001 3300009011 Bacteria 537
243 Ga0105240_10000001 3300009093 Bacteria 2887840
244 Ga0105240_10008663 3300009093 Bacteria 14523
245 Ga0105240_10015281 3300009093 Bacteria 10447
246 Ga0105240_10267253 3300009093 Bacteria 1971
247 Ga0105240_10507597 3300009093 Bacteria 1340
248 Ga0105240_11741054 3300009093 Bacteria 650
249 Ga0111539_10029445 3300009094 Bacteria 6687
250 Ga0111539_10079181 3300009094 Bacteria 3865
251 Ga0111539_12016933 3300009094 Bacteria 669
252 Ga0105245_10067363 3300009098 Bacteria 3243
253 Ga0105245_10067936 3300009098 Bacteria 3229
254 Ga0105245_10772835 3300009098 Bacteria 997
255 Ga0105247_10830701 3300009101 Bacteria 707
256 Ga0105243_10505453 3300009148 Bacteria 1146
257 Ga0105243_10941623 3300009148 Bacteria 862
258 Ga0105241_10183200 3300009174 Bacteria 1739
259 Ga0105241_10494279 3300009174 Bacteria 1090
260 Ga0105241_12495273 3300009174 Bacteria 517
261 Ga0105242_10158231 3300009176 Bacteria 1981
262 Ga0105242_10480771 3300009176 Bacteria 1177
263 Ga0105242_11464825 3300009176 Bacteria 712
264 Ga0105248_10025404 3300009177 Bacteria 6586
265 Ga0105248_11078314 3300009177 Bacteria 908
266 Ga0105237_10026026 3300009545 Bacteria 5980
267 Ga0105237_10183316 3300009545 Bacteria 2093
268 Ga0105237_10198587 3300009545 Bacteria 2005
269 Ga0105237_10304741 3300009545 Bacteria 1596
270 Ga0105237_10559561 3300009545 Bacteria 1150
271 Ga0105237_11270334 3300009545 Bacteria 743
272 Ga0105238_10006718 3300009551 Bacteria 11481
273 Ga0105238_10373450 3300009551 Bacteria 1416
274 Ga0105238_10788970 3300009551 Bacteria 965
275 Ga0105238_11438290 3300009551 Bacteria 717
276 Ga0105238_12614215 3300009551 Bacteria 541
277 Ga0105249_10125804 3300009553 Bacteria 2441
278 Ga0105249_10135817 3300009553 Bacteria 2353
279 Ga0105249_10625041 3300009553 Bacteria 1133
280 Ga0105249_11056364 3300009553 Bacteria 882
281 Ga0099796_10096753 3300010159 Unclassified 1105
282 Ga0099796_10172579 3300010159 Bacteria 863
283 Ga0105239_10027895 3300010375 Bacteria 6212
284 Ga0105239_10281149 3300010375 Bacteria 1873
285 Ga0105239_10781257 3300010375 Bacteria 1094
286 Ga0105239_10912269 3300010375 Bacteria 1008
287 Ga0105239_13243291 3300010375 Bacteria 530
288 Ga0105246_10013082 3300011119 Bacteria 5193
289 Ga0157370_10019224 3300013104 Bacteria 6861
290 Ga0157370_10061081 3300013104 Bacteria 3576
291 Ga0157370_10073414 3300013104 Bacteria 3228
292 Ga0157370_10146320 3300013104 Bacteria 2200
293 Ga0157369_10005530 3300013105 Bacteria 14670
294 Ga0157369_10020894 3300013105 Bacteria 7320
295 Ga0157369_10067463 3300013105 Bacteria 3846
296 Ga0157369_10117643 3300013105 Bacteria 2821
297 Ga0157369_10150759 3300013105 Unclassified 2457
298 Ga0157369_10365937 3300013105 Bacteria 1497
299 Ga0157369_10761942 3300013105 Bacteria 995
300 Ga0157369_10975744 3300013105 Bacteria 868
301 Ga0157374_10000046 3300013296 Bacteria 140823
302 Ga0157374_10021854 3300013296 Bacteria 5701
303 Ga0157374_10071311 3300013296 Bacteria 3275
304 Ga0157374_10266416 3300013296 Bacteria 1689
305 Ga0157374_10787913 3300013296 Bacteria 966
306 Ga0157374_11107398 3300013296 Bacteria 812
307 Ga0157378_10000683 3300013297 Bacteria 31888
308 Ga0157378_10003013 3300013297 Bacteria 14969
309 Ga0157378_10226518 3300013297 Unclassified 1779
310 Ga0157378_10491317 3300013297 Bacteria 1225
311 Ga0157378_10950556 3300013297 Bacteria 892
312 Ga0163162_10133922 3300013306 Bacteria 2588
313 Ga0163162_10325912 3300013306 Bacteria 1668
314 Ga0163162_10505579 3300013306 Bacteria 1339
315 Ga0163162_11031160 3300013306 Bacteria 931
316 Ga0163162_13306928 3300013306 Bacteria 516
317 Ga0157372_10064455 3300013307 Bacteria 4111
318 Ga0157372_10077167 3300013307 Unclassified 3762
319 Ga0157372_10250156 3300013307 Bacteria 2057
320 Ga0157372_10273232 3300013307 Bacteria 1964
321 Ga0157372_10396047 3300013307 Bacteria 1609
322 Ga0157375_10139325 3300013308 Bacteria 2552
323 Ga0157375_11354989 3300013308 Bacteria 837
324 Ga0163163_10310653 3300014325 Bacteria 1629
325 Ga0163163_10321046 3300014325 Bacteria 1602
326 Ga0163163_10636787 3300014325 Bacteria 1130
327 Ga0157377_10636980 3300014745 Bacteria 765
328 Ga0157379_10050216 3300014968 Bacteria 3723
329 Ga0157379_10121231 3300014968 Bacteria 2352
330 Ga0157379_10329573 3300014968 Bacteria 1395
331 Ga0157376_10000017 3300014969 Bacteria 268501
332 Ga0157376_10000218 3300014969 Bacteria 39706
333 Ga0157376_10007881 3300014969 Bacteria 7638
334 Ga0157376_10781969 3300014969 Bacteria 966
335 Ga0206356_11036649 3300020070 Bacteria 628
336 Ga0206356_11258529 3300020070 Bacteria 1236
337 Ga0206351_10037410 3300020077 Bacteria 529
338 Ga0206351_10437456 3300020077 Bacteria 784
339 Ga0206350_10111732 3300020080 Bacteria 1774
340 Ga0206354_11605239 3300020081 Bacteria 594
341 Ga0213876_10060491 3300021384 Bacteria 1998
342 Ga0224712_10047143 3300022467 Bacteria 1657
343 Ga0224712_10300915 3300022467 Bacteria 750
344 Ga0224712_10632192 3300022467 Bacteria 524
345 Ga0209233_1020262 3300025261 Bacteria 1748
346 Ga0207697_10125290 3300025315 Bacteria 1108
347 Ga0207656_10686951 3300025321 Bacteria 524
348 Ga0207682_10090084 3300025893 Bacteria 1328
349 Ga0207692_10146768 3300025898 Bacteria 1347
350 Ga0207692_10249164 3300025898 Bacteria 1064
351 Ga0207692_10399921 3300025898 Bacteria 856
352 Ga0207642_10093179 3300025899 Bacteria 1493
353 Ga0207642_10721659 3300025899 Bacteria 629
354 Ga0207710_10428119 3300025900 Bacteria 681
355 Ga0207680_10121307 3300025903 Unclassified 1710
356 Ga0207685_10080505 3300025905 Bacteria 1346
357 Ga0207685_10514558 3300025905 Bacteria 632
358 Ga0207699_10006592 3300025906 Bacteria 5635
359 Ga0207699_10292632 3300025906 Bacteria 1135
360 Ga0207699_10701184 3300025906 Unclassified 741
361 Ga0207699_10813639 3300025906 Bacteria 687
362 Ga0207699_10831843 3300025906 Unclassified 679
363 Ga0207699_11041166 3300025906 Unclassified 605
364 Ga0207645_10003014 3300025907 Bacteria 13011
365 Ga0207643_10046885 3300025908 Bacteria 2443
366 Ga0207705_10004135 3300025909 Bacteria 11004
367 Ga0207705_11422657 3300025909 Bacteria 527
368 Ga0207684_10029497 3300025910 Unclassified 4671
369 Ga0207654_10191743 3300025911 Bacteria 1340
370 Ga0207707_10034581 3300025912 Bacteria 4421
371 Ga0207707_10105532 3300025912 Bacteria 2463
372 Ga0207707_10223446 3300025912 Bacteria 1639
373 Ga0207707_10686578 3300025912 Bacteria 861
374 Ga0207707_10711081 3300025912 Bacteria 843
375 Ga0207695_10000001 3300025913 Bacteria 2888630
376 Ga0207695_10000249 3300025913 Bacteria 140258
377 Ga0207695_10669431 3300025913 Bacteria 919
378 Ga0207671_10010842 3300025914 Bacteria 7477
379 Ga0207671_10053536 3300025914 Bacteria 2990
380 Ga0207671_10105771 3300025914 Unclassified 2136
381 Ga0207671_10318255 3300025914 Bacteria 1231
382 Ga0207693_10020281 3300025915 Bacteria 5288
383 Ga0207693_10075349 3300025915 Bacteria 2642
384 Ga0207693_10321395 3300025915 Bacteria 1211
385 Ga0207693_10337539 3300025915 Bacteria 1179
386 Ga0207693_10415356 3300025915 Bacteria 1052
387 Ga0207693_10442317 3300025915 Unclassified 1016
388 Ga0207663_10000828 3300025916 Bacteria 13994
389 Ga0207663_10150977 3300025916 Unclassified 1630
390 Ga0207663_10441017 3300025916 Bacteria 1003
391 Ga0207660_10002550 3300025917 Bacteria 11972
392 Ga0207660_10217497 3300025917 Unclassified 1498
393 Ga0207660_10664268 3300025917 Bacteria 850
394 Ga0207657_10254847 3300025919 Bacteria 1398
395 Ga0207649_10021003 3300025920 Bacteria 3751
396 Ga0207649_11313209 3300025920 Bacteria 572
397 Ga0207652_10066798 3300025921 Bacteria 3117
398 Ga0207652_10173368 3300025921 Bacteria 1936
399 Ga0207652_10233076 3300025921 Bacteria 1659
400 Ga0207652_10300795 3300025921 Bacteria 1448
401 Ga0207652_10550599 3300025921 Bacteria 1037
402 Ga0207652_11777639 3300025921 Bacteria 521
403 Ga0207646_10005962 3300025922 Bacteria 12710
404 Ga0207646_10301825 3300025922 Bacteria 1447
405 Ga0207681_10065693 3300025923 Bacteria 2509
406 Ga0207694_10003813 3300025924 Bacteria 11925
407 Ga0207694_10381162 3300025924 Bacteria 1170
408 Ga0207694_10427023 3300025924 Bacteria 1104
409 Ga0207694_10677440 3300025924 Bacteria 869
410 Ga0207694_11494566 3300025924 Bacteria 570
411 Ga0207659_10313493 3300025926 Bacteria 1292
412 Ga0207687_10017316 3300025927 Bacteria 4742
413 Ga0207687_10470960 3300025927 Bacteria 1044
414 Ga0207687_11004731 3300025927 Bacteria 715
415 Ga0207700_10034420 3300025928 Bacteria 3636
416 Ga0207700_10040911 3300025928 Bacteria 3387
417 Ga0207700_10205566 3300025928 Bacteria 1662
418 Ga0207700_10338602 3300025928 Bacteria 1307
419 Ga0207700_10445821 3300025928 Bacteria 1140
420 Ga0207700_11019321 3300025928 Bacteria 741
421 Ga0207700_11103805 3300025928 Bacteria 709
422 Ga0207700_12040409 3300025928 Bacteria 500
423 Ga0207664_10029757 3300025929 Bacteria 4163
424 Ga0207664_10092082 3300025929 Bacteria 2487
425 Ga0207664_10167600 3300025929 Unclassified 1878
426 Ga0207664_10343008 3300025929 Bacteria 1321
427 Ga0207664_10530628 3300025929 Bacteria 1055
428 Ga0207664_10689258 3300025929 Bacteria 919
429 Ga0207664_10749856 3300025929 Bacteria 878
430 Ga0207664_10762459 3300025929 Bacteria 870
431 Ga0207644_10942673 3300025931 Bacteria 724
432 Ga0207690_10113879 3300025932 Bacteria 1952
433 Ga0207690_10387938 3300025932 Bacteria 1111
434 Ga0207706_10561007 3300025933 Bacteria 983
435 Ga0207706_10706087 3300025933 Bacteria 861
436 Ga0207686_10142110 3300025934 Bacteria 1660
437 Ga0207686_10194272 3300025934 Bacteria 1449
438 Ga0207686_11349415 3300025934 Bacteria 586
439 Ga0207709_11058491 3300025935 Bacteria 665
440 Ga0207670_10087012 3300025936 Unclassified 2200
441 Ga0207670_10673057 3300025936 Bacteria 855
442 Ga0207669_10042822 3300025937 Bacteria 2646
443 Ga0207669_11504555 3300025937 Bacteria 574
444 Ga0207704_10080679 3300025938 Bacteria 2101
445 Ga0207704_10309529 3300025938 Bacteria 1214
446 Ga0207704_10784033 3300025938 Bacteria 795
447 Ga0207665_10006977 3300025939 Bacteria 7477
448 Ga0207665_10022066 3300025939 Bacteria 4187
449 Ga0207665_10054792 3300025939 Bacteria 2690
450 Ga0207665_10278698 3300025939 Bacteria 1244
451 Ga0207691_10013466 3300025940 Bacteria 7827
452 Ga0207711_10071864 3300025941 Bacteria 3004
453 Ga0207711_10166927 3300025941 Bacteria 1995
454 Ga0207689_10006246 3300025942 Bacteria 10557
455 Ga0207689_10007498 3300025942 Bacteria 9563
456 Ga0207689_10052613 3300025942 Bacteria 3355
457 Ga0207689_10110991 3300025942 Bacteria 2254
458 Ga0207661_10391301 3300025944 Bacteria 1259
459 Ga0207679_10947089 3300025945 Bacteria 789
460 Ga0207667_10007844 3300025949 Bacteria 12748
461 Ga0207667_10057520 3300025949 Bacteria 4081
462 Ga0207667_10140868 3300025949 Bacteria 2483
463 Ga0207667_10257751 3300025949 Bacteria 1784
464 Ga0207667_10322818 3300025949 Bacteria 1577
465 Ga0207651_10864099 3300025960 Bacteria 804
466 Ga0207712_10047397 3300025961 Bacteria 2983
467 Ga0207712_10652207 3300025961 Bacteria 915
468 Ga0207712_10925499 3300025961 Bacteria 771
469 Ga0207668_11684901 3300025972 Bacteria 572
470 Ga0207668_11700825 3300025972 Bacteria 569
471 Ga0207640_10077169 3300025981 Bacteria 2264
472 Ga0207640_11041324 3300025981 Bacteria 722
473 Ga0207640_11152740 3300025981 Bacteria 688
474 Ga0207658_10141704 3300025986 Bacteria 1946
475 Ga0207658_10346586 3300025986 Unclassified 1292
476 Ga0207658_10584837 3300025986 Bacteria 1002
477 Ga0207658_10601417 3300025986 Bacteria 988
478 Ga0207658_10812859 3300025986 Bacteria 849
479 Ga0207658_10993278 3300025986 Bacteria 766
480 Ga0207677_10028242 3300026023 Bacteria 3544
481 Ga0207677_10114399 3300026023 Bacteria 2016
482 Ga0207703_10852570 3300026035 Bacteria 871
483 Ga0207703_11070389 3300026035 Bacteria 774
484 Ga0207703_11074635 3300026035 Bacteria 773
485 Ga0207703_11610481 3300026035 Bacteria 625
486 Ga0207639_10529266 3300026041 Bacteria 1080
487 Ga0207639_10539322 3300026041 Bacteria 1070
488 Ga0207639_10623244 3300026041 Bacteria 996
489 Ga0207639_10804400 3300026041 Bacteria 876
490 Ga0207639_12270582 3300026041 Bacteria 504
491 Ga0207702_10129039 3300026078 Bacteria 2273
492 Ga0207702_10303407 3300026078 Bacteria 1516
493 Ga0207702_11029662 3300026078 Bacteria 817
494 Ga0207702_11107763 3300026078 Bacteria 786
495 Ga0207641_10002695 3300026088 Bacteria 16208
496 Ga0207641_10164826 3300026088 Bacteria 2017
497 Ga0207641_10277514 3300026088 Bacteria 1575
498 Ga0207641_12085419 3300026088 Bacteria 568
499 Ga0207648_10012083 3300026089 Bacteria 8099
500 Ga0207648_10252902 3300026089 Bacteria 1571
501 Ga0207648_10488097 3300026089 Bacteria 1126
502 Ga0207676_10036301 3300026095 Bacteria 3748
503 Ga0207676_10973350 3300026095 Bacteria 835
504 Ga0207674_10035632 3300026116 Bacteria 5193
505 Ga0207674_10139137 3300026116 Bacteria 2388
506 Ga0207674_10187098 3300026116 Bacteria 2021
507 Ga0207674_10220768 3300026116 Bacteria 1843
508 Ga0207675_100019140 3300026118 Bacteria 6390
509 Ga0207675_100087826 3300026118 Bacteria 2921
510 Ga0207683_10011591 3300026121 Bacteria 7527
511 Ga0207698_10247195 3300026142 Bacteria 1630
512 Ga0207698_10377199 3300026142 Unclassified 1348
513 Ga0207698_11664858 3300026142 Bacteria 653
514 Ga0207698_11790985 3300026142 Bacteria 629
515 Ga0209281_1000108 3300027111 Bacteria 217582
516 Ga0209179_1098678 3300027512 Bacteria 650
517 Ga0209588_1027354 3300027671 Bacteria 1815
518 Ga0209588_1044791 3300027671 Unclassified 1431
519 Ga0209588_1045876 3300027671 Unclassified 1414
520 Ga0209588_1073764 3300027671 Bacteria 1102
521 Ga0209588_1255594 3300027671 Bacteria 534
522 Ga0207428_10133711 3300027907 Unclassified 1897
523 Ga0207428_10175270 3300027907 Unclassified 1622
524 Ga0268266_10000721 3300028379 Bacteria 44545
525 Ga0268266_10078727 3300028379 Bacteria 2869
526 Ga0268266_10273778 3300028379 Bacteria 1568
527 Ga0268266_10474876 3300028379 Bacteria 1191
528 Ga0268265_10974736 3300028380 Bacteria 836
529 Ga0268264_10046600 3300028381 Bacteria 3601
530 Ga0268264_10050795 3300028381 Bacteria 3454
531 Ga0268264_10184336 3300028381 Unclassified 1898
532 Ga0268264_10208396 3300028381 Bacteria 1793
533 Ga0268264_10427667 3300028381 Bacteria 1278
534 Ga0268264_10861856 3300028381 Bacteria 908
535 Ga0265319_1000302 3300028563 Bacteria 36694
536 Ga0265318_10000913 3300028577 Bacteria 19264
537 Ga0265318_10008761 3300028577 Bacteria 4483
538 Ga0265338_10248469 3300028800 Bacteria 1313
539 Ga0265760_10210636 3300031090 Bacteria 660
540 Ga0265320_10017814 3300031240 Bacteria 3931
541 Ga0265325_10512973 3300031241 Bacteria 519
542 Ga0265340_10055634 3300031247 Bacteria 1905
543 Ga0265331_10079010 3300031250 Bacteria 1531
544 Ga0265327_10000214 3300031251 Bacteria 120181
545 Ga0265316_10434863 3300031344 Bacteria 942
546 Ga0307508_10155047 3300031616 Bacteria 1894
547 Ga0307405_10220405 3300031731 Bacteria 1391
548 Ga0307414_10973765 3300032004 Unclassified 780
549 Ga0316212_1008679 3300033547 Unclassified 1460
550 Ga0373926_0006361 3300035083 Bacteria 3922
551 Ga0373940_0045942 3300035088 Bacteria 1214
552 Ga0373945_0341982 3300035116 Bacteria 647
553 Ga0373943_0044149 3300035170 Bacteria 2168
554 Ga0373946_0034777 3300035171 Bacteria 2036
555 Ga0373955_0026695 3300035172 Bacteria 2978
556 Ga0373924_0001655 3300035410 Bacteria 7315
557 Ga0373924_0071453 3300035410 Bacteria 1465
558 Ga0373931_0104054 3300035691 Bacteria 1601
559 Ga0373931_0540727 3300035691 Bacteria 756
560 Ga0373931_0638824 3300035691 Bacteria 699
561 Ga0373935_0088367 3300035692 Unclassified 2025
562 Ga0373935_0781767 3300035692 Bacteria 704
563 Ga0373927_0012762 3300035695 Bacteria 5589
564 Ga0373933_0107967 3300035724 Bacteria 1733
565 Ga0373933_0436477 3300035724 Bacteria 856
566 Ga0373947_0834066 3300035725 Bacteria 629
567 Ga0373937_0000225 3300036401 Bacteria 54909
568 Ga0373937_0107398 3300036401 Bacteria 2595
569 Ga0373937_0578241 3300036401 Bacteria 1067
570 Ga0373937_1431817 3300036401 Bacteria 639
571 Ga0395899_0051052 3300037312 Bacteria 3070
572 Ga0395899_0838258 3300037312 Bacteria 565
573 Ga0395900_0008973 3300037418 Bacteria 10254
574 Ga0395898_0010182 3300037466 Bacteria 9843
575 Ga0395898_0505768 3300037466 Bacteria 1149
576 Ga0395905_0002196 3300037471 Bacteria 22050
577 Ga0395905_0003889 3300037471 Bacteria 15759
578 Ga0395905_0162732 3300037471 Unclassified 2097
579 Ga0395905_0204403 3300037471 Bacteria 1851
580 Ga0436365_0581532 3300039437 Bacteria 2911
581 Ga0436361_0069880 3300039447 Bacteria 969
582 Ga0451841_0284456 3300041498 Bacteria 1954
583 Ga0451855_0031514 3300041511 Bacteria 616
584 Ga0451577_0756303 3300042876 Bacteria 879
585 Ga0453683_0842328 3300044673 Bacteria 605
586 Ga0466965_0160215 3300044683 Bacteria 1180
587 Ga0466966_0001835 3300044684 Bacteria 13773
588 Ga0466966_0055498 3300044684 Bacteria 2507
589 Ga0466963_0021566 3300044694 Bacteria 4066
590 Ga0466963_0418021 3300044694 Bacteria 946
591 Ga0453684_0598252 3300044712 Bacteria 1209
592 Ga0453684_1622024 3300044712 Unclassified 663
593 Ga0466970_0372896 3300044765 Bacteria 812
594 Ga0466957_0016647 3300044842 Bacteria 4301
595 Ga0466957_0096678 3300044842 Bacteria 1856
596 Ga0466959_0427822 3300045049 Bacteria 898
597 Ga0466959_1054190 3300045049 Bacteria 541
598 Ga0466959_1128004 3300045049 Bacteria 521
599 Ga0466967_1323485 3300045976 Bacteria 717
600 Ga0495603_0131963 3300046455 Bacteria 1454
601 Ga0495603_0539911 3300046455 Bacteria 668
602 Ga0495638_0234560 3300046460 Bacteria 1019
603 Ga0495651_0600920 3300046462 Bacteria 694
604 Ga0495580_0039295 3300046472 Bacteria 3385
605 Ga0495582_0004066 3300046473 Bacteria 8219
606 Ga0495664_0570676 3300046477 Bacteria 673
607 Ga0495664_0697865 3300046477 Bacteria 600
608 Ga0495584_0046724 3300046491 Bacteria 2184
609 Ga0495584_0077069 3300046491 Bacteria 1676
610 Ga0495585_0000148 3300046492 Bacteria 76376
611 Ga0495596_0015142 3300046500 Bacteria 3236
612 Ga0495583_0190298 3300046506 Bacteria 837
613 Ga0495583_0448014 3300046506 Bacteria 506
614 Ga0495616_0169166 3300046513 Bacteria 978
615 Ga0495628_0495082 3300046516 Bacteria 883
616 Ga0495628_0712914 3300046516 Bacteria 708
617 Ga0495630_0070531 3300046517 Bacteria 2629
618 Ga0495630_0126744 3300046517 Bacteria 1938
619 Ga0495631_0063919 3300046518 Bacteria 1594
620 Ga0495643_0009289 3300046522 Bacteria 6123
621 Ga0495644_0022045 3300046523 Bacteria 2428
622 Ga0495663_0004095 3300046525 Bacteria 4129
623 Ga0495666_0015085 3300046526 Bacteria 3845
624 Ga0495666_0136191 3300046526 Bacteria 1146
625 Ga0495666_0326192 3300046526 Bacteria 693
626 Ga0495642_0072640 3300046528 Bacteria 1440
627 Ga0495652_0081018 3300046529 Bacteria 2679
628 Ga0495665_0070728 3300046531 Bacteria 1838
629 Ga0495665_0169596 3300046531 Bacteria 1136
630 Ga0495665_0249240 3300046531 Bacteria 914
631 Ga0495586_0263149 3300046535 Bacteria 985
632 Ga0495587_0018167 3300046536 Bacteria 4362
633 Ga0495609_0001458 3300046538 Bacteria 15690
634 Ga0495609_0044747 3300046538 Bacteria 1985
635 Ga0495621_0133533 3300046539 Bacteria 967
636 Ga0495597_0009662 3300046542 Bacteria 4753
637 Ga0495645_0016723 3300046543 Bacteria 5246
638 Ga0495645_0098475 3300046543 Bacteria 2081
639 Ga0495645_0329839 3300046543 Bacteria 988
640 Ga0495622_0001973 3300046557 Bacteria 10055
641 Ga0495622_0006367 3300046557 Bacteria 5479
642 Ga0495622_0209788 3300046557 Bacteria 866
643 Ga0495656_0035523 3300046615 Bacteria 2048
644 Ga0495656_0110959 3300046615 Bacteria 1283
645 Ga0495668_0040218 3300046616 Bacteria 2608
646 Ga0495668_0226080 3300046616 Bacteria 1025
647 Ga0495634_0369184 3300046642 Bacteria 857
648 Ga0495611_0090206 3300046648 Bacteria 1416
649 Ga0495625_0028107 3300046660 Bacteria 4221
650 Ga0495625_0314266 3300046660 Bacteria 999
651 Ga0495625_0450051 3300046660 Bacteria 796
652 Ga0495635_0054129 3300046663 Bacteria 2764
653 Ga0495635_0096049 3300046663 Bacteria 2026
654 Ga0495661_0024256 3300046665 Bacteria 3928
655 Ga0495588_0003529 3300046674 Bacteria 6822
656 Ga0495588_0012161 3300046674 Bacteria 4058
657 Ga0495588_0037676 3300046674 Bacteria 2457
658 Ga0495588_0088169 3300046674 Bacteria 1623
659 Ga0495646_0083017 3300046680 Bacteria 1863
660 Ga0495613_0198177 3300046689 Bacteria 1417
661 Ga0495613_0671068 3300046689 Bacteria 684
662 Ga0495624_0002163 3300046690 Bacteria 14985
663 Ga0495589_0101993 3300046794 Bacteria 1388
664 Ga0495581_0016671 3300047315 Bacteria 4271
665 Ga0495581_0164671 3300047315 Bacteria 1296
666 Ga0495604_0033035 3300047317 Bacteria 4097
667 Ga0495636_0030641 3300047318 Bacteria 2201
668 Ga0495636_0190296 3300047318 Bacteria 934
669 Ga0495674_0153215 3300047319 Bacteria 1932
670 Ga0495674_0393378 3300047319 Bacteria 1120
671 Ga0495672_0023003 3300047320 Bacteria 4040
672 Ga0495672_0210973 3300047320 Bacteria 964
673 Ga0495676_0080007 3300047321 Bacteria 2483
674 Ga0495683_0300219 3300047323 Bacteria 690
675 Ga0495675_0225987 3300047444 Bacteria 1131
676 Ga0495677_0013840 3300047445 Bacteria 2937
677 Ga0495685_041485 3300047447 Bacteria 1573
678 Ga0495673_0018181 3300047469 Bacteria 3551
679 Ga0495681_0013143 3300047470 Bacteria 4825
680 Ga0495681_0205002 3300047470 Bacteria 798
681 Ga0495686_0067514 3300047472 Bacteria 2207
682 Ga0495602_0283926 3300048088 Bacteria 1218
683 Ga0495614_0034013 3300048089 Bacteria 2192
684 Ga0496101_0177535 3300048904 Bacteria 1639
685 Ga0496102_0001461 3300048905 Bacteria 20885
686 Ga0496102_0042961 3300048905 Bacteria 4097
687 Ga0496102_0555771 3300048905 Bacteria 1071
688 Ga0496102_1605542 3300048905 Bacteria 569
689 Ga0496103_0016154 3300048906 Bacteria 4455
690 Ga0496103_0821141 3300048906 Bacteria 586
691 Ga0496104_0002008 3300048907 Bacteria 17659
692 Ga0496104_0047745 3300048907 Bacteria 4036
693 Ga0496104_0064166 3300048907 Bacteria 3485
694 Ga0496105_0014169 3300048908 Bacteria 6345
695 Ga0496105_0020489 3300048908 Bacteria 5344
696 Ga0496105_0054680 3300048908 Bacteria 3296
697 Ga0496106_0053142 3300048909 Bacteria 3059
698 Ga0496106_0527143 3300048909 Unclassified 948
699 Ga0496107_0870148 3300048910 Bacteria 658
700 Ga0496108_0017503 3300048911 Bacteria 5863
701 Ga0496108_0060056 3300048911 Bacteria 3198
702 Ga0496108_0521908 3300048911 Bacteria 1037
703 Ga0496109_0134847 3300048912 Bacteria 2306
704 Ga0496109_0202502 3300048912 Bacteria 1866
705 Ga0496109_1212604 3300048912 Bacteria 691
706 Ga0496110_0010298 3300048913 Bacteria 7599
707 Ga0496110_1192164 3300048913 Bacteria 670
708 Ga0496110_1256933 3300048913 Bacteria 649
709 Ga0496111_0009322 3300048914 Bacteria 6546
710 Ga0496111_0151783 3300048914 Bacteria 1718
711 Ga0496112_0009847 3300048915 Bacteria 8635
712 Ga0496112_0024683 3300048915 Bacteria 5763
713 Ga0496112_0029744 3300048915 Bacteria 5284
714 Ga0496112_0081126 3300048915 Bacteria 3208
715 Ga0496112_0310245 3300048915 Bacteria 1523
716 Ga0496112_1083550 3300048915 Bacteria 719
717 Ga0496113_0002200 3300048916 Bacteria 11247
718 Ga0496113_0030749 3300048916 Bacteria 3889
719 Ga0496113_0063277 3300048916 Bacteria 2796
720 Ga0496113_0990967 3300048916 Bacteria 662
721 Ga0496114_0015547 3300048917 Bacteria 6118
722 Ga0496114_0520016 3300048917 Bacteria 1052
723 Ga0496115_0004423 3300048918 Bacteria 10184
724 Ga0496115_0017316 3300048918 Bacteria 5506
725 Ga0496115_0493795 3300048918 Unclassified 984
726 Ga0496115_0656843 3300048918 Bacteria 828
727 Ga0496115_0760877 3300048918 Bacteria 757
728 Ga0496124_0194661 3300048927 Unclassified 1548
729 Ga0496126_0689903 3300048929 Unclassified 795
730 Ga0495682_0176312 3300049460 Bacteria 760
731 Ga0501031_0083621 3300049568 Bacteria 2080
732 Ga0501033_0175827 3300049570 Bacteria 1536
733 Ga0501034_0339962 3300049571 Bacteria 1431
734 Ga0501036_0343038 3300049572 Bacteria 1247
735 Ga0501037_0590279 3300049573 Bacteria 747
736 Ga0501039_0051616 3300049575 Bacteria 3182
737 Ga0501040_0036438 3300049576 Bacteria 3339
738 Ga0501042_0221080 3300049578 Bacteria 1366
739 Ga0501046_0195395 3300049580 Bacteria 1507
740 Ga0501048_0033564 3300049582 Bacteria 3707
741 Ga0501074_0288821 3300049590 Bacteria 1166
742 Ga0501075_0203191 3300049591 Bacteria 1511
743 Ga0501077_0485429 3300049593 Bacteria 792
744 Ga0501223_003701 3300049663 Unclassified 3305
745 Ga0501081_0388208 3300049743 Bacteria 1032
746 Ga0501083_0163388 3300049744 Bacteria 1456
747 Ga0501035_0342545 3300049822 Bacteria 1252
748 Ga0501045_0015341 3300049824 Bacteria 5440
749 nmdc:mga0k408_206848_c1 3300050493 Bacteria 1172
750 nmdc:mga06r32_134538_c1 3300050510 Bacteria 2446
751 nmdc:mga06r32_823324_c1 3300050510 Bacteria 888
752 nmdc:mga08y16_199106_c1 3300050511 Bacteria 2076
753 nmdc:mga08y16_70299_c1 3300050511 Bacteria 3649
754 nmdc:mga0n895_107001_c1 3300050512 Bacteria 2810
755 nmdc:mga0n895_233160_c1 3300050512 Bacteria 1868
756 nmdc:mga0n895_535402_c1 3300050512 Bacteria 1178
757 nmdc:mga0rr50_65151_c1 3300050513 Bacteria 2759
758 nmdc:mga0rr50_773087_c1 3300050513 Bacteria 820
759 nmdc:mga0rr50_837547_c1 3300050513 Bacteria 785
760 nmdc:mga0rr50_86907_c1 3300050513 Bacteria 2426
761 nmdc:mga08x19_311100_c1 3300050514 Bacteria 1095
762 nmdc:mga08x19_332951_c1 3300050514 Bacteria 1058
763 nmdc:mga08x19_952749_c1 3300050514 Bacteria 610
764 Ga0495601_0029001 3300053077 Bacteria 3430
765 Ga0495595_0644363 3300053084 Bacteria 542
766 Ga0500646_0005101 3300053090 Bacteria 3327
767 Ga0500646_0348967 3300053090 Bacteria 539
768 Ga0500583_0029030 3300053092 Bacteria 2406
769 Ga0500641_0017669 3300053096 Bacteria 2672
770 Ga0500654_076893 3300053099 Bacteria 1585
771 Ga0500618_027643 3300053125 Bacteria 1348
772 Ga0500559_0077594 3300053136 Unclassified 1505
773 Ga0500564_012813 3300053138 Bacteria 3737
774 Ga0500588_0004579 3300053146 Bacteria 3007
775 Ga0500633_0018606 3300053160 Bacteria 2063
776 Ga0501084_0126434 3300054114 Bacteria 2151
777 Ga0587084_002272 3300059477 Bacteria 1967
778 Ga0587084_010044 3300059477 Bacteria 1234
779 Ga0587084_029059 3300059477 Bacteria 879
780 Ga0587093_001567 3300059478 Bacteria 1966
781 Ga0587093_020765 3300059478 Bacteria 877
782 Ga0587093_030018 3300059478 Bacteria 778
783 Ga0587066_002509 3300059490 Bacteria 2033
784 Ga0587066_042734 3300059490 Bacteria 861
785 Ga0587066_049770 3300059490 Bacteria 821
786 Ga0587066_051600 3300059490 Bacteria 812
787 Ga0587066_095841 3300059490 Bacteria 666
788 Ga0587070_003045 3300059491 Bacteria 1971
789 Ga0587070_003105 3300059491 Bacteria 1959
790 Ga0587070_041500 3300059491 Bacteria 882
791 Ga0587070_045646 3300059491 Bacteria 856
792 Ga0587070_084209 3300059491 Bacteria 703
793 Ga0587073_0035746 3300059492 Bacteria 1055
794 Ga0587073_0043842 3300059492 Bacteria 987
795 Ga0587073_0054585 3300059492 Bacteria 917
796 Ga0587077_023550 3300059493 Bacteria 1113
797 Ga0587077_031757 3300059493 Bacteria 1010
798 Ga0587077_033708 3300059493 Bacteria 991
799 Ga0587080_020235 3300059503 Bacteria 1085
800 Ga0587080_048150 3300059503 Bacteria 797
801 Ga0587082_003050 3300059504 Bacteria 1971
802 Ga0587082_006045 3300059504 Bacteria 1600
803 Ga0587082_035498 3300059504 Bacteria 890
804 Ga0587082_040728 3300059504 Bacteria 851
805 Ga0587082_136810 3300059504 Bacteria 568
806 Ga0587083_0004263 3300059505 Bacteria 1974
807 Ga0587083_0024103 3300059505 Bacteria 1155
808 Ga0587083_0066264 3300059505 Bacteria 827
809 Ga0587083_0115189 3300059505 Bacteria 688
810 Ga0587085_002190 3300059506 Bacteria 1959
811 Ga0587085_002655 3300059506 Bacteria 1848
812 Ga0587085_026541 3300059506 Bacteria 923
813 Ga0587086_001672 3300059507 Bacteria 1966
814 Ga0587086_010814 3300059507 Bacteria 1111
815 Ga0587086_023258 3300059507 Bacteria 863
816 Ga0587086_027455 3300059507 Bacteria 817
817 Ga0587088_003158 3300059508 Bacteria 1964
818 Ga0587088_023406 3300059508 Bacteria 1050
819 Ga0587088_061796 3300059508 Bacteria 761
820 Ga0587089_032198 3300059509 Bacteria 779
821 Ga0587090_000825 3300059510 Bacteria 2845
822 Ga0587090_002764 3300059510 Bacteria 1966
823 Ga0587090_032726 3300059510 Bacteria 878
824 Ga0587091_002851 3300059511 Bacteria 2107
825 Ga0587091_044895 3300059511 Bacteria 886
826 Ga0587091_045492 3300059511 Bacteria 882
827 Ga0587092_028719 3300059512 Bacteria 908
828 Ga0587092_041190 3300059512 Bacteria 804
829 Ga0587092_053479 3300059512 Bacteria 737
830 Ga0587094_002275 3300059513 Bacteria 1971
831 Ga0587094_018240 3300059513 Bacteria 996
832 Ga0587094_032732 3300059513 Bacteria 814
833 Ga0587094_135218 3300059513 Bacteria 505
834 Ga0587095_009873 3300059514 Bacteria 796
835 Ga0587106_001867 3300059605 Bacteria 1967
836 Ga0587106_027054 3300059605 Bacteria 895
837 Ga0587125_003852 3300059607 Bacteria 1303
838 Ga0587129_007963 3300059608 Bacteria 777
839 Ga0587101_001659 3300059623 Bacteria 1968
840 Ga0587101_006335 3300059623 Bacteria 1353
841 Ga0587101_031764 3300059623 Bacteria 828
842 Ga0587101_105263 3300059623 Bacteria 566
843 Ga0587109_013386 3300059624 Bacteria 1361
844 Ga0587109_015244 3300059624 Bacteria 1302
845 Ga0587109_044495 3300059624 Bacteria 891
846 Ga0587109_049854 3300059624 Bacteria 855
847 Ga0587109_061211 3300059624 Bacteria 793
848 Ga0587115_002909 3300059626 Bacteria 1752
849 Ga0587115_008128 3300059626 Bacteria 1254
850 Ga0587117_028084 3300059627 Bacteria 831
851 Ga0587117_037797 3300059627 Bacteria 757
852 Ga0587117_116866 3300059627 Bacteria 524
853 Ga0587127_002315 3300059629 Bacteria 1145
854 Ga0587127_009405 3300059629 Bacteria 744
855 Ga0587128_002336 3300059630 Bacteria 1964
856 Ga0587130_017147 3300059631 Bacteria 759
857 Ga0587062_001677 3300059639 Bacteria 1971
858 Ga0587062_001799 3300059639 Bacteria 1935
859 Ga0587062_002771 3300059639 Bacteria 1708
860 Ga0587062_030416 3300059639 Bacteria 824
861 Ga0587067_003113 3300059640 Bacteria 2045
862 Ga0587067_021829 3300059640 Bacteria 1108
863 Ga0587067_034498 3300059640 Bacteria 952
864 Ga0587067_060343 3300059640 Bacteria 793
865 Ga0587068_003462 3300059641 Bacteria 2016
866 Ga0587068_003890 3300059641 Bacteria 1943
867 Ga0587068_035618 3300059641 Bacteria 882
868 Ga0587068_047761 3300059641 Bacteria 793
869 Ga0587069_001242 3300059642 Bacteria 2275
870 Ga0587069_035088 3300059642 Bacteria 831
871 Ga0587069_072090 3300059642 Bacteria 658
872 Ga0587069_104578 3300059642 Bacteria 583
873 Ga0587072_004015 3300059643 Bacteria 2107
874 Ga0587072_004818 3300059643 Bacteria 1985
875 Ga0587072_080587 3300059643 Bacteria 703
876 Ga0587075_013836 3300059644 Bacteria 1115
877 Ga0587075_014523 3300059644 Bacteria 1097
878 Ga0587075_033528 3300059644 Bacteria 829
879 Ga0587076_002921 3300059645 Bacteria 1978
880 Ga0587076_005570 3300059645 Bacteria 1636
881 Ga0587076_051722 3300059645 Bacteria 803
882 Ga0587076_057481 3300059645 Bacteria 776
883 Ga0587078_001575 3300059646 Bacteria 2070
884 Ga0587078_019093 3300059646 Bacteria 853
885 Ga0587079_058464 3300059647 Bacteria 829
886 Ga0587100_012758 3300059648 Bacteria 739
887 Ga0587102_005348 3300059649 Bacteria 1131
888 Ga0587102_019865 3300059649 Bacteria 750
889 Ga0587105_011909 3300059651 Bacteria 676
890 Ga0587107_034509 3300059652 Bacteria 788
891 Ga0587107_048558 3300059652 Bacteria 712
892 Ga0587107_053554 3300059652 Bacteria 691
893 Ga0587110_008867 3300059654 Bacteria 977
894 Ga0587119_025728 3300059658 Bacteria 778
895 Ga0587124_000691 3300059660 Bacteria 1956
896 Ga0587060_008795 3300060243 Bacteria 839
897 Ga0587071_005270 3300060344 Bacteria 1970
898 Ga0587071_050556 3300060344 Bacteria 859
899 Ga0587071_063793 3300060344 Unclassified 788
900 Ga0587071_128913 3300060344 Bacteria 611
901 Ga0587111_0002424 3300060346 Bacteria 2483
902 Ga0587111_0003136 3300060346 Bacteria 2312
903 Ga0587111_0033382 3300060346 Bacteria 1063
904 Ga0587111_0057353 3300060346 Bacteria 876
905 Ga0587111_0218447 3300060346 Bacteria 549
906 Ga0501082_0089278 3300060353 Bacteria 2661
907 Ga0466962_0192145 3300061719 Unclassified 996

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_101217062 Ga0070682_1012170621 113
2 3300005616 Ga0068852_102061475 Ga0068852_1020614752 118
3 3300005616 Ga0068852_100879737 Ga0068852_1008797372 120
4 3300026142 Ga0207698_10377199 Ga0207698_103771991 120
5 3300047320 Ga0495672_0023003 Ga0495672_0023003_2287_2706 120
6 iso_pu_bacteria 2866065130 2866069130 127
7 3300035088 Ga0373940_0045942 Ga0373940_0045942_759_1190 133
8 3300005328 Ga0070676_10027262 Ga0070676_100272622 136
9 3300005333 Ga0070677_10056078 Ga0070677_100560781 136
10 3300005334 Ga0068869_100042357 Ga0068869_1000423573 136
11 3300005334 Ga0068869_100091915 Ga0068869_1000919152 136
12 3300005335 Ga0070666_10299951 Ga0070666_102999512 136
13 3300005338 Ga0068868_100083377 Ga0068868_1000833773 136
14 3300005347 Ga0070668_100035392 Ga0070668_1000353923 136
15 3300005354 Ga0070675_100172173 Ga0070675_1001721731 136
16 3300005356 Ga0070674_100145322 Ga0070674_1001453223 136
17 3300005356 Ga0070674_101838990 Ga0070674_1018389901 136
18 3300005364 Ga0070673_100124093 Ga0070673_1001240933 136
19 3300005367 Ga0070667_100074620 Ga0070667_1000746203 136
20 3300005367 Ga0070667_101161140 Ga0070667_1011611401 136
21 3300005455 Ga0070663_100112126 Ga0070663_1001121262 136
22 3300005456 Ga0070678_100003496 Ga0070678_1000034961 136
23 3300005459 Ga0068867_100078756 Ga0068867_1000787562 136
24 3300005459 Ga0068867_100764123 Ga0068867_1007641231 136
25 3300005539 Ga0068853_100879063 Ga0068853_1008790631 136
26 3300005548 Ga0070665_100154533 Ga0070665_1001545333 136
27 3300005617 Ga0068859_100018620 Ga0068859_1000186206 136
28 3300005617 Ga0068859_100052217 Ga0068859_1000522173 136
29 3300005617 Ga0068859_100298246 Ga0068859_1002982463 136
30 3300005719 Ga0068861_100091750 Ga0068861_1000917502 136
31 3300005719 Ga0068861_100214668 Ga0068861_1002146681 136
32 3300005840 Ga0068870_10027185 Ga0068870_100271851 136
33 3300005841 Ga0068863_101580882 Ga0068863_1015808821 136
34 3300005841 Ga0068863_101660866 Ga0068863_1016608662 136
35 3300005843 Ga0068860_100020699 Ga0068860_1000206997 136
36 3300005843 Ga0068860_100159899 Ga0068860_1001598992 136
37 3300005843 Ga0068860_100269693 Ga0068860_1002696933 136
38 3300005844 Ga0068862_100278398 Ga0068862_1002783981 136
39 3300006237 Ga0097621_100198944 Ga0097621_1001989441 136
40 3300006358 Ga0068871_100579516 Ga0068871_1005795162 136
41 3300006881 Ga0068865_100099788 Ga0068865_1000997882 136
42 3300006881 Ga0068865_100344456 Ga0068865_1003444562 136
43 3300006931 Ga0097620_100018620 Ga0097620_1000186203 136
44 3300006931 Ga0097620_100052221 Ga0097620_1000522213 136
45 3300006931 Ga0097620_100298283 Ga0097620_1002982833 136
46 3300009148 Ga0105243_10505453 Ga0105243_105054532 136
47 3300009174 Ga0105241_10183200 Ga0105241_101832003 136
48 3300009176 Ga0105242_11464825 Ga0105242_114648252 136
49 3300009553 Ga0105249_10125804 Ga0105249_101258044 136
50 3300009553 Ga0105249_10135817 Ga0105249_101358171 136
51 3300009553 Ga0105249_11056364 Ga0105249_110563642 136
52 3300011119 Ga0105246_10013082 Ga0105246_100130821 136
53 3300013297 Ga0157378_10226518 Ga0157378_102265183 136
54 3300013297 Ga0157378_10950556 Ga0157378_109505562 136
55 3300013306 Ga0163162_13306928 Ga0163162_133069281 136
56 3300013308 Ga0157375_11354989 Ga0157375_113549891 136
57 3300014745 Ga0157377_10636980 Ga0157377_106369801 136
58 3300014968 Ga0157379_10329573 Ga0157379_103295732 136
59 3300025315 Ga0207697_10125290 Ga0207697_101252902 136
60 3300025893 Ga0207682_10090084 Ga0207682_100900842 136
61 3300025899 Ga0207642_10721659 Ga0207642_107216591 136
62 3300025903 Ga0207680_10121307 Ga0207680_101213072 136
63 3300025907 Ga0207645_10003014 Ga0207645_1000301412 136
64 3300025908 Ga0207643_10046885 Ga0207643_100468853 136
65 3300025911 Ga0207654_10191743 Ga0207654_101917432 136
66 3300025923 Ga0207681_10065693 Ga0207681_100656932 136
67 3300025926 Ga0207659_10313493 Ga0207659_103134932 136
68 3300025931 Ga0207644_10942673 Ga0207644_109426732 136
69 3300025933 Ga0207706_10706087 Ga0207706_107060871 136
70 3300025934 Ga0207686_10142110 Ga0207686_101421102 136
71 3300025934 Ga0207686_11349415 Ga0207686_113494152 136
72 3300025937 Ga0207669_10042822 Ga0207669_100428222 136
73 3300025937 Ga0207669_11504555 Ga0207669_115045551 136
74 3300025938 Ga0207704_10080679 Ga0207704_100806791 136
75 3300025938 Ga0207704_10309529 Ga0207704_103095292 136
76 3300025940 Ga0207691_10013466 Ga0207691_100134667 136
77 3300025942 Ga0207689_10006246 Ga0207689_100062463 136
78 3300025942 Ga0207689_10007498 Ga0207689_1000749812 136
79 3300025942 Ga0207689_10052613 Ga0207689_100526131 136
80 3300025960 Ga0207651_10864099 Ga0207651_108640991 136
81 3300025961 Ga0207712_10047397 Ga0207712_100473972 136
82 3300025961 Ga0207712_10652207 Ga0207712_106522071 136
83 3300025972 Ga0207668_11700825 Ga0207668_117008251 136
84 3300025981 Ga0207640_11041324 Ga0207640_110413241 136
85 3300025986 Ga0207658_10141704 Ga0207658_101417044 136
86 3300025986 Ga0207658_10346586 Ga0207658_103465862 136
87 3300025986 Ga0207658_10993278 Ga0207658_109932781 136
88 3300026023 Ga0207677_10028242 Ga0207677_100282424 136
89 3300026035 Ga0207703_11610481 Ga0207703_116104811 136
90 3300026088 Ga0207641_10164826 Ga0207641_101648261 136
91 3300026088 Ga0207641_12085419 Ga0207641_120854191 136
92 3300026089 Ga0207648_10012083 Ga0207648_100120833 136
93 3300026089 Ga0207648_10488097 Ga0207648_104880973 136
94 3300026118 Ga0207675_100019140 Ga0207675_1000191406 136
95 3300026118 Ga0207675_100087826 Ga0207675_1000878263 136
96 3300026121 Ga0207683_10011591 Ga0207683_100115916 136
97 3300028379 Ga0268266_10078727 Ga0268266_100787272 136
98 3300028380 Ga0268265_10974736 Ga0268265_109747361 136
99 3300028381 Ga0268264_10184336 Ga0268264_101843363 136
100 3300028381 Ga0268264_10208396 Ga0268264_102083962 136
101 3300028381 Ga0268264_10427667 Ga0268264_104276672 136
102 3300031616 Ga0307508_10155047 Ga0307508_101550472 136
103 3300049744 Ga0501083_0163388 Ga0501083_0163388_488_898 136
104 iso_pu_bacteria 2511231026 2511387160 136
105 3300003316 rootH1_10166822 rootH1_101668222 138
106 3300005367 Ga0070667_100613076 Ga0070667_1006130762 138
107 3300005578 Ga0068854_100092555 Ga0068854_1000925553 138
108 3300006195 Ga0075366_10010141 Ga0075366_100101416 138
109 3300006195 Ga0075366_10051605 Ga0075366_100516053 138
110 3300009093 Ga0105240_10015281 Ga0105240_100152812 138
111 3300010375 Ga0105239_10027895 Ga0105239_100278953 138
112 3300025913 Ga0207695_10669431 Ga0207695_106694311 138
113 3300025914 Ga0207671_10010842 Ga0207671_100108422 138
114 3300025914 Ga0207671_10053536 Ga0207671_100535363 138
115 3300025981 Ga0207640_10077169 Ga0207640_100771691 138
116 3300025986 Ga0207658_10601417 Ga0207658_106014172 138
117 3300046460 Ga0495638_0234560 Ga0495638_0234560_280_696 138
118 3300047472 Ga0495686_0067514 Ga0495686_0067514_652_1068 138
119 3300050493 nmdc:mga0k408_206848_c1 nmdc:mga0k408_206848_c1_401_817 138
120 3300053136 Ga0500559_0077594 Ga0500559_0077594_859_1278 138
121 iso_pu_bacteria 2916178963 2916180313 138
122 3300009545 Ga0105237_11270334 Ga0105237_112703342 139
123 3300025912 Ga0207707_10686578 Ga0207707_106865782 139
124 3300035172 Ga0373955_0026695 Ga0373955_0026695_2096_2518 139
125 iso_pu_bacteria 2818991461 2819687623 139
126 iso_pu_bacteria 2867507094 2867509819 139
127 iso_pu_bacteria 2896253425 2896255996 139
128 iso_pu_bacteria 2899803654 2899805925 139
129 iso_pu_bacteria 2952252522 2952254628 139
130 3300005327 Ga0070658_10034779 Ga0070658_100347791 140
131 3300005329 Ga0070683_100289713 Ga0070683_1002897132 140
132 3300005337 Ga0070682_100559703 Ga0070682_1005597031 140
133 3300005339 Ga0070660_101228166 Ga0070660_1012281661 140
134 3300005344 Ga0070661_100029525 Ga0070661_1000295252 140
135 3300005344 Ga0070661_100514835 Ga0070661_1005148351 140
136 3300005366 Ga0070659_100009699 Ga0070659_1000096998 140
137 3300005435 Ga0070714_101658704 Ga0070714_1016587042 140
138 3300005455 Ga0070663_100689596 Ga0070663_1006895961 140
139 3300005458 Ga0070681_10827502 Ga0070681_108275022 140
140 3300005530 Ga0070679_100310879 Ga0070679_1003108792 140
141 3300005535 Ga0070684_100798320 Ga0070684_1007983201 140
142 3300005563 Ga0068855_100100486 Ga0068855_1001004863 140
143 3300005563 Ga0068855_100131214 Ga0068855_1001312143 140
144 3300005616 Ga0068852_101417154 Ga0068852_1014171541 140
145 3300005617 Ga0068859_101207982 Ga0068859_1012079821 140
146 3300005834 Ga0068851_10502236 Ga0068851_105022362 140
147 3300006178 Ga0075367_10585419 Ga0075367_105854192 140
148 3300006931 Ga0097620_101208025 Ga0097620_1012080251 140
149 3300009093 Ga0105240_10008663 Ga0105240_1000866312 140
150 3300009094 Ga0111539_10029445 Ga0111539_100294457 140
151 3300009098 Ga0105245_10067936 Ga0105245_100679363 140
152 3300009174 Ga0105241_12495273 Ga0105241_124952731 140
153 3300009551 Ga0105238_10006718 Ga0105238_100067182 140
154 3300009551 Ga0105238_10373450 Ga0105238_103734501 140
155 3300010375 Ga0105239_10912269 Ga0105239_109122691 140
156 3300013104 Ga0157370_10146320 Ga0157370_101463202 140
157 3300013105 Ga0157369_10005530 Ga0157369_1000553014 140
158 3300013105 Ga0157369_10117643 Ga0157369_101176431 140
159 3300013105 Ga0157369_10761942 Ga0157369_107619422 140
160 3300013296 Ga0157374_10000046 Ga0157374_1000004630 140
161 3300013296 Ga0157374_11107398 Ga0157374_111073982 140
162 3300013297 Ga0157378_10491317 Ga0157378_104913171 140
163 3300013307 Ga0157372_10273232 Ga0157372_102732322 140
164 3300013307 Ga0157372_10396047 Ga0157372_103960472 140
165 3300014968 Ga0157379_10121231 Ga0157379_101212312 140
166 3300014969 Ga0157376_10000218 Ga0157376_1000021816 140
167 3300025321 Ga0207656_10686951 Ga0207656_106869511 140
168 3300025900 Ga0207710_10428119 Ga0207710_104281191 140
169 3300025909 Ga0207705_10004135 Ga0207705_1000413512 140
170 3300025909 Ga0207705_11422657 Ga0207705_114226571 140
171 3300025912 Ga0207707_10711081 Ga0207707_107110812 140
172 3300025913 Ga0207695_10000249 Ga0207695_1000024913 140
173 3300025920 Ga0207649_10021003 Ga0207649_100210033 140
174 3300025920 Ga0207649_11313209 Ga0207649_113132091 140
175 3300025921 Ga0207652_10300795 Ga0207652_103007952 140
176 3300025924 Ga0207694_10003813 Ga0207694_1000381312 140
177 3300025924 Ga0207694_10381162 Ga0207694_103811622 140
178 3300025927 Ga0207687_10470960 Ga0207687_104709602 140
179 3300025928 Ga0207700_12040409 Ga0207700_120404091 140
180 3300025929 Ga0207664_10530628 Ga0207664_105306282 140
181 3300025929 Ga0207664_10689258 Ga0207664_106892582 140
182 3300025932 Ga0207690_10387938 Ga0207690_103879382 140
183 3300025944 Ga0207661_10391301 Ga0207661_103913011 140
184 3300025949 Ga0207667_10007844 Ga0207667_100078447 140
185 3300025949 Ga0207667_10057520 Ga0207667_100575204 140
186 3300025949 Ga0207667_10140868 Ga0207667_101408683 140
187 3300026078 Ga0207702_10129039 Ga0207702_101290392 140
188 3300026078 Ga0207702_11107763 Ga0207702_111077631 140
189 3300026116 Ga0207674_10187098 Ga0207674_101870982 140
190 3300026142 Ga0207698_11664858 Ga0207698_116648582 140
191 3300027907 Ga0207428_10133711 Ga0207428_101337112 140
192 3300028563 Ga0265319_1000302 Ga0265319_10003028 140
193 3300028577 Ga0265318_10000913 Ga0265318_100009133 140
194 3300031090 Ga0265760_10210636 Ga0265760_102106361 140
195 3300031240 Ga0265320_10017814 Ga0265320_100178143 140
196 3300031731 Ga0307405_10220405 Ga0307405_102204051 140
197 3300032004 Ga0307414_10973765 Ga0307414_109737651 140
198 3300037312 Ga0395899_0051052 Ga0395899_0051052_803_1225 140
199 3300037312 Ga0395899_0838258 Ga0395899_0838258_24_446 140
200 3300037418 Ga0395900_0008973 Ga0395900_0008973_5313_5735 140
201 3300037471 Ga0395905_0003889 Ga0395905_0003889_10060_10482 140
202 3300044683 Ga0466965_0160215 Ga0466965_0160215_209_631 140
203 3300044684 Ga0466966_0001835 Ga0466966_0001835_6821_7243 140
204 3300044684 Ga0466966_0055498 Ga0466966_0055498_1683_2105 140
205 3300044694 Ga0466963_0418021 Ga0466963_0418021_235_657 140
206 3300044765 Ga0466970_0372896 Ga0466970_0372896_80_502 140
207 3300045049 Ga0466959_0427822 Ga0466959_0427822_186_608 140
208 3300045049 Ga0466959_1054190 Ga0466959_1054190_57_479 140
209 3300045976 Ga0466967_1323485 Ga0466967_1323485_34_456 140
210 3300049568 Ga0501031_0083621 Ga0501031_0083621_1434_1856 140
211 3300049570 Ga0501033_0175827 Ga0501033_0175827_769_1191 140
212 3300049571 Ga0501034_0339962 Ga0501034_0339962_31_453 140
213 3300049572 Ga0501036_0343038 Ga0501036_0343038_52_474 140
214 3300049573 Ga0501037_0590279 Ga0501037_0590279_109_531 140
215 3300049575 Ga0501039_0051616 Ga0501039_0051616_1649_2071 140
216 3300049576 Ga0501040_0036438 Ga0501040_0036438_1043_1465 140
217 3300049578 Ga0501042_0221080 Ga0501042_0221080_207_629 140
218 3300049580 Ga0501046_0195395 Ga0501046_0195395_557_979 140
219 3300049582 Ga0501048_0033564 Ga0501048_0033564_712_1134 140
220 3300049590 Ga0501074_0288821 Ga0501074_0288821_478_900 140
221 3300049591 Ga0501075_0203191 Ga0501075_0203191_109_531 140
222 3300049593 Ga0501077_0485429 Ga0501077_0485429_22_444 140
223 3300049663 Ga0501223_003701 Ga0501223_003701_2154_2588 140
224 3300049743 Ga0501081_0388208 Ga0501081_0388208_343_765 140
225 3300049822 Ga0501035_0342545 Ga0501035_0342545_685_1107 140
226 3300049824 Ga0501045_0015341 Ga0501045_0015341_299_721 140
227 3300050511 nmdc:mga08y16_70299_c1 nmdc:mga08y16_70299_c1_1430_1855 140
228 3300054114 Ga0501084_0126434 Ga0501084_0126434_1644_2066 140
229 3300059477 Ga0587084_002272 Ga0587084_002272_1284_1706 140
230 3300059477 Ga0587084_010044 Ga0587084_010044_214_636 140
231 3300059478 Ga0587093_001567 Ga0587093_001567_1286_1708 140
232 3300059478 Ga0587093_020765 Ga0587093_020765_215_637 140
233 3300059478 Ga0587093_030018 Ga0587093_030018_197_619 140
234 3300059490 Ga0587066_002509 Ga0587066_002509_263_685 140
235 3300059490 Ga0587066_049770 Ga0587066_049770_241_663 140
236 3300059490 Ga0587066_051600 Ga0587066_051600_249_671 140
237 3300059490 Ga0587066_095841 Ga0587066_095841_38_496 140
238 3300059491 Ga0587070_003045 Ga0587070_003045_266_688 140
239 3300059491 Ga0587070_003105 Ga0587070_003105_1267_1725 140
240 3300059491 Ga0587070_041500 Ga0587070_041500_247_669 140
241 3300059491 Ga0587070_045646 Ga0587070_045646_221_643 140
242 3300059492 Ga0587073_0035746 Ga0587073_0035746_375_797 140
243 3300059492 Ga0587073_0043842 Ga0587073_0043842_320_742 140
244 3300059493 Ga0587077_023550 Ga0587077_023550_234_692 140
245 3300059493 Ga0587077_031757 Ga0587077_031757_326_748 140
246 3300059493 Ga0587077_033708 Ga0587077_033708_257_679 140
247 3300059503 Ga0587080_020235 Ga0587080_020235_266_688 140
248 3300059503 Ga0587080_048150 Ga0587080_048150_126_548 140
249 3300059504 Ga0587082_003050 Ga0587082_003050_236_694 140
250 3300059504 Ga0587082_006045 Ga0587082_006045_789_1211 140
251 3300059504 Ga0587082_035498 Ga0587082_035498_206_628 140
252 3300059504 Ga0587082_040728 Ga0587082_040728_256_678 140
253 3300059505 Ga0587083_0004263 Ga0587083_0004263_1278_1736 140
254 3300059505 Ga0587083_0024103 Ga0587083_0024103_256_678 140
255 3300059505 Ga0587083_0066264 Ga0587083_0066264_146_568 140
256 3300059506 Ga0587085_002190 Ga0587085_002190_1267_1725 140
257 3300059506 Ga0587085_002655 Ga0587085_002655_168_590 140
258 3300059506 Ga0587085_026541 Ga0587085_026541_360_782 140
259 3300059507 Ga0587086_001672 Ga0587086_001672_1284_1706 140
260 3300059507 Ga0587086_010814 Ga0587086_010814_247_669 140
261 3300059507 Ga0587086_023258 Ga0587086_023258_267_725 140
262 3300059507 Ga0587086_027455 Ga0587086_027455_251_673 140
263 3300059508 Ga0587088_003158 Ga0587088_003158_1284_1706 140
264 3300059508 Ga0587088_023406 Ga0587088_023406_386_808 140
265 3300059508 Ga0587088_061796 Ga0587088_061796_160_618 140
266 3300059509 Ga0587089_032198 Ga0587089_032198_219_641 140
267 3300059510 Ga0587090_000825 Ga0587090_000825_1521_1979 140
268 3300059510 Ga0587090_002764 Ga0587090_002764_1283_1705 140
269 3300059510 Ga0587090_032726 Ga0587090_032726_243_665 140
270 3300059511 Ga0587091_002851 Ga0587091_002851_1425_1883 140
271 3300059511 Ga0587091_044895 Ga0587091_044895_251_673 140
272 3300059511 Ga0587091_045492 Ga0587091_045492_247_669 140
273 3300059512 Ga0587092_028719 Ga0587092_028719_240_662 140
274 3300059512 Ga0587092_041190 Ga0587092_041190_264_686 140
275 3300059512 Ga0587092_053479 Ga0587092_053479_248_670 140
276 3300059513 Ga0587094_002275 Ga0587094_002275_1287_1709 140
277 3300059513 Ga0587094_018240 Ga0587094_018240_325_747 140
278 3300059513 Ga0587094_032732 Ga0587094_032732_193_651 140
279 3300059514 Ga0587095_009873 Ga0587095_009873_116_538 140
280 3300059605 Ga0587106_001867 Ga0587106_001867_1283_1705 140
281 3300059607 Ga0587125_003852 Ga0587125_003852_260_682 140
282 3300059608 Ga0587129_007963 Ga0587129_007963_116_538 140
283 3300059623 Ga0587101_001659 Ga0587101_001659_262_684 140
284 3300059623 Ga0587101_006335 Ga0587101_006335_235_693 140
285 3300059623 Ga0587101_031764 Ga0587101_031764_241_663 140
286 3300059623 Ga0587101_105263 Ga0587101_105263_130_552 140
287 3300059624 Ga0587109_013386 Ga0587109_013386_665_1123 140
288 3300059624 Ga0587109_015244 Ga0587109_015244_502_924 140
289 3300059624 Ga0587109_044495 Ga0587109_044495_262_684 140
290 3300059624 Ga0587109_061211 Ga0587109_061211_228_650 140
291 3300059626 Ga0587115_002909 Ga0587115_002909_1069_1491 140
292 3300059627 Ga0587117_028084 Ga0587117_028084_230_652 140
293 3300059627 Ga0587117_037797 Ga0587117_037797_139_561 140
294 3300059629 Ga0587127_002315 Ga0587127_002315_459_881 140
295 3300059629 Ga0587127_009405 Ga0587127_009405_180_602 140
296 3300059630 Ga0587128_002336 Ga0587128_002336_260_682 140
297 3300059631 Ga0587130_017147 Ga0587130_017147_260_682 140
298 3300059639 Ga0587062_001677 Ga0587062_001677_236_694 140
299 3300059639 Ga0587062_001799 Ga0587062_001799_1259_1681 140
300 3300059639 Ga0587062_002771 Ga0587062_002771_1025_1447 140
301 3300059639 Ga0587062_030416 Ga0587062_030416_247_669 140
302 3300059640 Ga0587067_003113 Ga0587067_003113_273_731 140
303 3300059640 Ga0587067_021829 Ga0587067_021829_287_709 140
304 3300059640 Ga0587067_060343 Ga0587067_060343_263_685 140
305 3300059641 Ga0587068_003462 Ga0587068_003462_1330_1788 140
306 3300059641 Ga0587068_003890 Ga0587068_003890_1266_1688 140
307 3300059641 Ga0587068_035618 Ga0587068_035618_247_669 140
308 3300059641 Ga0587068_047761 Ga0587068_047761_121_543 140
309 3300059642 Ga0587069_001242 Ga0587069_001242_1456_1878 140
310 3300059642 Ga0587069_035088 Ga0587069_035088_241_663 140
311 3300059642 Ga0587069_072090 Ga0587069_072090_68_490 140
312 3300059643 Ga0587072_004015 Ga0587072_004015_863_1321 140
313 3300059643 Ga0587072_004818 Ga0587072_004818_262_684 140
314 3300059644 Ga0587075_014523 Ga0587075_014523_262_684 140
315 3300059644 Ga0587075_033528 Ga0587075_033528_254_676 140
316 3300059645 Ga0587076_002921 Ga0587076_002921_1281_1739 140
317 3300059645 Ga0587076_005570 Ga0587076_005570_945_1367 140
318 3300059645 Ga0587076_051722 Ga0587076_051722_120_542 140
319 3300059645 Ga0587076_057481 Ga0587076_057481_150_572 140
320 3300059646 Ga0587078_001575 Ga0587078_001575_1304_1726 140
321 3300059646 Ga0587078_019093 Ga0587078_019093_180_602 140
322 3300059647 Ga0587079_058464 Ga0587079_058464_264_686 140
323 3300059648 Ga0587100_012758 Ga0587100_012758_174_596 140
324 3300059649 Ga0587102_005348 Ga0587102_005348_339_761 140
325 3300059649 Ga0587102_019865 Ga0587102_019865_189_611 140
326 3300059651 Ga0587105_011909 Ga0587105_011909_83_505 140
327 3300059652 Ga0587107_034509 Ga0587107_034509_252_674 140
328 3300059652 Ga0587107_053554 Ga0587107_053554_139_561 140
329 3300059654 Ga0587110_008867 Ga0587110_008867_296_760 140
330 3300059658 Ga0587119_025728 Ga0587119_025728_265_687 140
331 3300059660 Ga0587124_000691 Ga0587124_000691_1284_1706 140
332 3300060243 Ga0587060_008795 Ga0587060_008795_193_615 140
333 3300060344 Ga0587071_005270 Ga0587071_005270_263_685 140
334 3300060344 Ga0587071_050556 Ga0587071_050556_230_652 140
335 3300060344 Ga0587071_128913 Ga0587071_128913_93_515 140
336 3300060346 Ga0587111_0002424 Ga0587111_0002424_713_1171 140
337 3300060346 Ga0587111_0003136 Ga0587111_0003136_1533_1955 140
338 3300060346 Ga0587111_0033382 Ga0587111_0033382_428_850 140
339 3300060346 Ga0587111_0057353 Ga0587111_0057353_241_663 140
340 3300060353 Ga0501082_0089278 Ga0501082_0089278_713_1135 140
341 3300003320 rootH2_10327266 rootH2_103272661 141
342 3300004799 Ga0058863_10086366 Ga0058863_100863661 141
343 3300004799 Ga0058863_10169191 Ga0058863_101691911 141
344 3300004800 Ga0058861_10016523 Ga0058861_100165231 141
345 3300004800 Ga0058861_10040453 Ga0058861_100404531 141
346 3300004803 Ga0058862_10279902 Ga0058862_102799022 141
347 3300004803 Ga0058862_12704330 Ga0058862_127043303 141
348 3300004803 Ga0058862_12825811 Ga0058862_128258111 141
349 3300005329 Ga0070683_100703916 Ga0070683_1007039162 141
350 3300005329 Ga0070683_101242974 Ga0070683_1012429741 141
351 3300005330 Ga0070690_100144860 Ga0070690_1001448602 141
352 3300005334 Ga0068869_100031446 Ga0068869_1000314464 141
353 3300005336 Ga0070680_100053591 Ga0070680_1000535913 141
354 3300005336 Ga0070680_100114489 Ga0070680_1001144892 141
355 3300005338 Ga0068868_100259213 Ga0068868_1002592132 141
356 3300005338 Ga0068868_101282011 Ga0068868_1012820111 141
357 3300005339 Ga0070660_100259930 Ga0070660_1002599301 141
358 3300005344 Ga0070661_101052665 Ga0070661_1010526651 141
359 3300005356 Ga0070674_100874929 Ga0070674_1008749292 141
360 3300005365 Ga0070688_101739287 Ga0070688_1017392871 141
361 3300005366 Ga0070659_100120996 Ga0070659_1001209962 141
362 3300005366 Ga0070659_100337811 Ga0070659_1003378112 141
363 3300005367 Ga0070667_100172287 Ga0070667_1001722871 141
364 3300005434 Ga0070709_10065312 Ga0070709_100653123 141
365 3300005434 Ga0070709_10096933 Ga0070709_100969332 141
366 3300005434 Ga0070709_10130731 Ga0070709_101307312 141
367 3300005434 Ga0070709_11430068 Ga0070709_114300681 141
368 3300005435 Ga0070714_100044401 Ga0070714_1000444012 141
369 3300005435 Ga0070714_100120267 Ga0070714_1001202671 141
370 3300005435 Ga0070714_100251061 Ga0070714_1002510612 141
371 3300005435 Ga0070714_100463996 Ga0070714_1004639962 141
372 3300005435 Ga0070714_100942820 Ga0070714_1009428202 141
373 3300005435 Ga0070714_101517440 Ga0070714_1015174401 141
374 3300005436 Ga0070713_100099060 Ga0070713_1000990604 141
375 3300005436 Ga0070713_100128559 Ga0070713_1001285593 141
376 3300005436 Ga0070713_100232745 Ga0070713_1002327452 141
377 3300005436 Ga0070713_100251643 Ga0070713_1002516432 141
378 3300005437 Ga0070710_10094959 Ga0070710_100949592 141
379 3300005439 Ga0070711_100003132 Ga0070711_1000031325 141
380 3300005439 Ga0070711_100056169 Ga0070711_1000561692 141
381 3300005439 Ga0070711_100160005 Ga0070711_1001600051 141
382 3300005439 Ga0070711_100964879 Ga0070711_1009648791 141
383 3300005440 Ga0070705_100024135 Ga0070705_1000241354 141
384 3300005440 Ga0070705_100164580 Ga0070705_1001645802 141
385 3300005440 Ga0070705_100626880 Ga0070705_1006268802 141
386 3300005445 Ga0070708_100027576 Ga0070708_1000275766 141
387 3300005445 Ga0070708_100039185 Ga0070708_1000391856 141
388 3300005445 Ga0070708_100228402 Ga0070708_1002284022 141
389 3300005445 Ga0070708_100460244 Ga0070708_1004602441 141
390 3300005445 Ga0070708_101415699 Ga0070708_1014156991 141
391 3300005456 Ga0070678_101131826 Ga0070678_1011318261 141
392 3300005457 Ga0070662_100166573 Ga0070662_1001665732 141
393 3300005457 Ga0070662_100687240 Ga0070662_1006872402 141
394 3300005457 Ga0070662_101429197 Ga0070662_1014291971 141
395 3300005458 Ga0070681_10019745 Ga0070681_100197454 141
396 3300005458 Ga0070681_10028870 Ga0070681_100288705 141
397 3300005458 Ga0070681_10215999 Ga0070681_102159993 141
398 3300005458 Ga0070681_10324364 Ga0070681_103243642 141
399 3300005459 Ga0068867_100313148 Ga0068867_1003131482 141
400 3300005466 Ga0070685_10315238 Ga0070685_103152382 141
401 3300005467 Ga0070706_100345862 Ga0070706_1003458621 141
402 3300005468 Ga0070707_100004850 Ga0070707_10000485012 141
403 3300005468 Ga0070707_100279293 Ga0070707_1002792932 141
404 3300005468 Ga0070707_100422840 Ga0070707_1004228402 141
405 3300005468 Ga0070707_100423774 Ga0070707_1004237742 141
406 3300005471 Ga0070698_100001375 Ga0070698_10000137517 141
407 3300005471 Ga0070698_100007655 Ga0070698_10000765510 141
408 3300005471 Ga0070698_100009642 Ga0070698_1000096427 141
409 3300005471 Ga0070698_100041339 Ga0070698_1000413395 141
410 3300005518 Ga0070699_100059421 Ga0070699_1000594216 141
411 3300005518 Ga0070699_100606773 Ga0070699_1006067732 141
412 3300005518 Ga0070699_100760776 Ga0070699_1007607762 141
413 3300005518 Ga0070699_100880319 Ga0070699_1008803192 141
414 3300005530 Ga0070679_100000958 Ga0070679_10000095820 141
415 3300005530 Ga0070679_100008320 Ga0070679_1000083206 141
416 3300005530 Ga0070679_100082834 Ga0070679_1000828344 141
417 3300005530 Ga0070679_100118050 Ga0070679_1001180502 141
418 3300005530 Ga0070679_100241474 Ga0070679_1002414742 141
419 3300005535 Ga0070684_100006317 Ga0070684_1000063174 141
420 3300005536 Ga0070697_100292145 Ga0070697_1002921452 141
421 3300005539 Ga0068853_100485837 Ga0068853_1004858371 141
422 3300005539 Ga0068853_100732461 Ga0068853_1007324612 141
423 3300005539 Ga0068853_100888716 Ga0068853_1008887162 141
424 3300005544 Ga0070686_100057415 Ga0070686_1000574153 141
425 3300005545 Ga0070695_100061882 Ga0070695_1000618822 141
426 3300005547 Ga0070693_100013777 Ga0070693_1000137773 141
427 3300005547 Ga0070693_100021726 Ga0070693_1000217264 141
428 3300005547 Ga0070693_100761151 Ga0070693_1007611511 141
429 3300005548 Ga0070665_100000391 Ga0070665_10000039132 141
430 3300005548 Ga0070665_101871498 Ga0070665_1018714982 141
431 3300005549 Ga0070704_100558899 Ga0070704_1005588991 141
432 3300005563 Ga0068855_100111363 Ga0068855_1001113633 141
433 3300005563 Ga0068855_100129120 Ga0068855_1001291205 141
434 3300005564 Ga0070664_100401506 Ga0070664_1004015062 141
435 3300005577 Ga0068857_100227267 Ga0068857_1002272672 141
436 3300005578 Ga0068854_100192745 Ga0068854_1001927452 141
437 3300005614 Ga0068856_100315011 Ga0068856_1003150112 141
438 3300005614 Ga0068856_101000263 Ga0068856_1010002632 141
439 3300005614 Ga0068856_101260083 Ga0068856_1012600831 141
440 3300005614 Ga0068856_102650767 Ga0068856_1026507671 141
441 3300005616 Ga0068852_100075097 Ga0068852_1000750972 141
442 3300005616 Ga0068852_100392618 Ga0068852_1003926182 141
443 3300005617 Ga0068859_100092999 Ga0068859_1000929993 141
444 3300005617 Ga0068859_100178193 Ga0068859_1001781932 141
445 3300005617 Ga0068859_100506921 Ga0068859_1005069211 141
446 3300005617 Ga0068859_100923001 Ga0068859_1009230012 141
447 3300005618 Ga0068864_100823596 Ga0068864_1008235962 141
448 3300005618 Ga0068864_101296838 Ga0068864_1012968381 141
449 3300005718 Ga0068866_10080513 Ga0068866_100805132 141
450 3300005834 Ga0068851_10125167 Ga0068851_101251672 141
451 3300005841 Ga0068863_100002412 Ga0068863_10000241222 141
452 3300005841 Ga0068863_100246439 Ga0068863_1002464392 141
453 3300005842 Ga0068858_100025426 Ga0068858_1000254265 141
454 3300005842 Ga0068858_100116326 Ga0068858_1001163262 141
455 3300005842 Ga0068858_101248359 Ga0068858_1012483591 141
456 3300005843 Ga0068860_100027511 Ga0068860_1000275119 141
457 3300005843 Ga0068860_100056618 Ga0068860_1000566182 141
458 3300005843 Ga0068860_100969438 Ga0068860_1009694382 141
459 3300005843 Ga0068860_101135247 Ga0068860_1011352472 141
460 3300005844 Ga0068862_101838212 Ga0068862_1018382121 141
461 3300005983 Ga0081540_1213712 Ga0081540_12137121 141
462 3300006028 Ga0070717_10398630 Ga0070717_103986302 141
463 3300006028 Ga0070717_10474973 Ga0070717_104749732 141
464 3300006028 Ga0070717_10569050 Ga0070717_105690501 141
465 3300006028 Ga0070717_10635640 Ga0070717_106356402 141
466 3300006163 Ga0070715_10081441 Ga0070715_100814412 141
467 3300006163 Ga0070715_10117164 Ga0070715_101171642 141
468 3300006163 Ga0070715_10425504 Ga0070715_104255041 141
469 3300006163 Ga0070715_10443497 Ga0070715_104434972 141
470 3300006173 Ga0070716_100038082 Ga0070716_1000380824 141
471 3300006173 Ga0070716_100111714 Ga0070716_1001117143 141
472 3300006173 Ga0070716_100517043 Ga0070716_1005170432 141
473 3300006175 Ga0070712_100009764 Ga0070712_1000097642 141
474 3300006175 Ga0070712_100147025 Ga0070712_1001470252 141
475 3300006175 Ga0070712_100738516 Ga0070712_1007385161 141
476 3300006175 Ga0070712_101947838 Ga0070712_1019478381 141
477 3300006237 Ga0097621_100036118 Ga0097621_1000361184 141
478 3300006358 Ga0068871_100002381 Ga0068871_1000023812 141
479 3300006844 Ga0075428_100003175 Ga0075428_1000031759 141
480 3300006871 Ga0075434_100004172 Ga0075434_1000041723 141
481 3300006871 Ga0075434_100010159 Ga0075434_10001015911 141
482 3300006871 Ga0075434_100521769 Ga0075434_1005217692 141
483 3300006871 Ga0075434_100553503 Ga0075434_1005535032 141
484 3300006881 Ga0068865_100657344 Ga0068865_1006573442 141
485 3300006914 Ga0075436_100230686 Ga0075436_1002306862 141
486 3300006914 Ga0075436_101407922 Ga0075436_1014079221 141
487 3300006931 Ga0097620_100093004 Ga0097620_1000930042 141
488 3300006931 Ga0097620_100178209 Ga0097620_1001782093 141
489 3300006931 Ga0097620_100922770 Ga0097620_1009227702 141
490 3300007076 Ga0075435_100097258 Ga0075435_1000972582 141
491 3300007076 Ga0075435_100288125 Ga0075435_1002881252 141
492 3300007076 Ga0075435_100513187 Ga0075435_1005131871 141
493 3300007076 Ga0075435_100891819 Ga0075435_1008918191 141
494 3300007265 Ga0099794_10000752 Ga0099794_100007525 141
495 3300007265 Ga0099794_10004425 Ga0099794_100044254 141
496 3300007265 Ga0099794_10025943 Ga0099794_100259432 141
497 3300007265 Ga0099794_10116411 Ga0099794_101164112 141
498 3300007265 Ga0099794_10184704 Ga0099794_101847042 141
499 3300007265 Ga0099794_10224941 Ga0099794_102249412 141
500 3300007265 Ga0099794_10238461 Ga0099794_102384611 141
501 3300007788 Ga0099795_10220533 Ga0099795_102205332 141
502 3300009011 Ga0105251_10566001 Ga0105251_105660011 141
503 3300009093 Ga0105240_10000001 Ga0105240_100000011396 141
504 3300009093 Ga0105240_10267253 Ga0105240_102672532 141
505 3300009093 Ga0105240_10507597 Ga0105240_105075972 141
506 3300009093 Ga0105240_11741054 Ga0105240_117410541 141
507 3300009094 Ga0111539_10079181 Ga0111539_100791812 141
508 3300009098 Ga0105245_10067363 Ga0105245_100673633 141
509 3300009098 Ga0105245_10772835 Ga0105245_107728352 141
510 3300009101 Ga0105247_10830701 Ga0105247_108307011 141
511 3300009148 Ga0105243_10941623 Ga0105243_109416232 141
512 3300009176 Ga0105242_10158231 Ga0105242_101582312 141
513 3300009176 Ga0105242_10480771 Ga0105242_104807712 141
514 3300009177 Ga0105248_10025404 Ga0105248_100254045 141
515 3300009177 Ga0105248_11078314 Ga0105248_110783141 141
516 3300009545 Ga0105237_10026026 Ga0105237_100260265 141
517 3300009545 Ga0105237_10183316 Ga0105237_101833162 141
518 3300009545 Ga0105237_10198587 Ga0105237_101985872 141
519 3300009545 Ga0105237_10304741 Ga0105237_103047412 141
520 3300009545 Ga0105237_10559561 Ga0105237_105595612 141
521 3300009551 Ga0105238_11438290 Ga0105238_114382902 141
522 3300009551 Ga0105238_12614215 Ga0105238_126142151 141
523 3300009553 Ga0105249_10625041 Ga0105249_106250412 141
524 3300010159 Ga0099796_10096753 Ga0099796_100967532 141
525 3300010159 Ga0099796_10172579 Ga0099796_101725792 141
526 3300010375 Ga0105239_10281149 Ga0105239_102811492 141
527 3300010375 Ga0105239_10781257 Ga0105239_107812572 141
528 3300010375 Ga0105239_13243291 Ga0105239_132432911 141
529 3300013104 Ga0157370_10019224 Ga0157370_100192242 141
530 3300013104 Ga0157370_10061081 Ga0157370_100610813 141
531 3300013104 Ga0157370_10073414 Ga0157370_100734144 141
532 3300013105 Ga0157369_10020894 Ga0157369_100208942 141
533 3300013105 Ga0157369_10067463 Ga0157369_100674632 141
534 3300013105 Ga0157369_10150759 Ga0157369_101507592 141
535 3300013105 Ga0157369_10365937 Ga0157369_103659372 141
536 3300013296 Ga0157374_10021854 Ga0157374_100218543 141
537 3300013296 Ga0157374_10266416 Ga0157374_102664162 141
538 3300013296 Ga0157374_10787913 Ga0157374_107879131 141
539 3300013297 Ga0157378_10000683 Ga0157378_100006833 141
540 3300013297 Ga0157378_10003013 Ga0157378_100030138 141
541 3300013306 Ga0163162_10133922 Ga0163162_101339222 141
542 3300013306 Ga0163162_10505579 Ga0163162_105055791 141
543 3300013306 Ga0163162_11031160 Ga0163162_110311602 141
544 3300013307 Ga0157372_10064455 Ga0157372_100644554 141
545 3300013307 Ga0157372_10077167 Ga0157372_100771674 141
546 3300013307 Ga0157372_10250156 Ga0157372_102501562 141
547 3300013308 Ga0157375_10139325 Ga0157375_101393252 141
548 3300014325 Ga0163163_10321046 Ga0163163_103210461 141
549 3300014325 Ga0163163_10636787 Ga0163163_106367872 141
550 3300014969 Ga0157376_10000017 Ga0157376_10000017166 141
551 3300020070 Ga0206356_11036649 Ga0206356_110366491 141
552 3300020070 Ga0206356_11258529 Ga0206356_112585292 141
553 3300020077 Ga0206351_10037410 Ga0206351_100374101 141
554 3300020077 Ga0206351_10437456 Ga0206351_104374561 141
555 3300020080 Ga0206350_10111732 Ga0206350_101117321 141
556 3300020081 Ga0206354_11605239 Ga0206354_116052391 141
557 3300021384 Ga0213876_10060491 Ga0213876_100604913 141
558 3300022467 Ga0224712_10047143 Ga0224712_100471431 141
559 3300022467 Ga0224712_10300915 Ga0224712_103009151 141
560 3300022467 Ga0224712_10632192 Ga0224712_106321921 141
561 3300025261 Ga0209233_1020262 Ga0209233_10202622 141
562 3300025898 Ga0207692_10146768 Ga0207692_101467682 141
563 3300025898 Ga0207692_10249164 Ga0207692_102491642 141
564 3300025898 Ga0207692_10399921 Ga0207692_103999212 141
565 3300025899 Ga0207642_10093179 Ga0207642_100931793 141
566 3300025905 Ga0207685_10080505 Ga0207685_100805052 141
567 3300025905 Ga0207685_10514558 Ga0207685_105145581 141
568 3300025906 Ga0207699_10006592 Ga0207699_100065925 141
569 3300025906 Ga0207699_10701184 Ga0207699_107011842 141
570 3300025906 Ga0207699_10813639 Ga0207699_108136391 141
571 3300025906 Ga0207699_10831843 Ga0207699_108318431 141
572 3300025906 Ga0207699_11041166 Ga0207699_110411662 141
573 3300025910 Ga0207684_10029497 Ga0207684_100294973 141
574 3300025912 Ga0207707_10034581 Ga0207707_100345812 141
575 3300025912 Ga0207707_10105532 Ga0207707_101055322 141
576 3300025912 Ga0207707_10223446 Ga0207707_102234462 141
577 3300025913 Ga0207695_10000001 Ga0207695_100000011400 141
578 3300025914 Ga0207671_10105771 Ga0207671_101057713 141
579 3300025914 Ga0207671_10318255 Ga0207671_103182552 141
580 3300025915 Ga0207693_10020281 Ga0207693_100202814 141
581 3300025915 Ga0207693_10075349 Ga0207693_100753493 141
582 3300025915 Ga0207693_10321395 Ga0207693_103213952 141
583 3300025915 Ga0207693_10415356 Ga0207693_104153562 141
584 3300025915 Ga0207693_10442317 Ga0207693_104423171 141
585 3300025916 Ga0207663_10000828 Ga0207663_100008284 141
586 3300025916 Ga0207663_10150977 Ga0207663_101509772 141
587 3300025916 Ga0207663_10441017 Ga0207663_104410172 141
588 3300025917 Ga0207660_10002550 Ga0207660_100025502 141
589 3300025917 Ga0207660_10217497 Ga0207660_102174972 141
590 3300025917 Ga0207660_10664268 Ga0207660_106642682 141
591 3300025919 Ga0207657_10254847 Ga0207657_102548474 141
592 3300025921 Ga0207652_10066798 Ga0207652_100667983 141
593 3300025921 Ga0207652_10173368 Ga0207652_101733682 141
594 3300025921 Ga0207652_10233076 Ga0207652_102330762 141
595 3300025921 Ga0207652_10550599 Ga0207652_105505991 141
596 3300025921 Ga0207652_11777639 Ga0207652_117776391 141
597 3300025922 Ga0207646_10005962 Ga0207646_1000596215 141
598 3300025922 Ga0207646_10301825 Ga0207646_103018252 141
599 3300025924 Ga0207694_10427023 Ga0207694_104270231 141
600 3300025924 Ga0207694_11494566 Ga0207694_114945661 141
601 3300025927 Ga0207687_10017316 Ga0207687_100173162 141
602 3300025927 Ga0207687_11004731 Ga0207687_110047311 141
603 3300025928 Ga0207700_10034420 Ga0207700_100344204 141
604 3300025928 Ga0207700_10040911 Ga0207700_100409114 141
605 3300025928 Ga0207700_10205566 Ga0207700_102055661 141
606 3300025928 Ga0207700_10338602 Ga0207700_103386022 141
607 3300025928 Ga0207700_10445821 Ga0207700_104458212 141
608 3300025928 Ga0207700_11019321 Ga0207700_110193211 141
609 3300025928 Ga0207700_11103805 Ga0207700_111038051 141
610 3300025929 Ga0207664_10029757 Ga0207664_100297574 141
611 3300025929 Ga0207664_10092082 Ga0207664_100920821 141
612 3300025929 Ga0207664_10167600 Ga0207664_101676001 141
613 3300025929 Ga0207664_10343008 Ga0207664_103430081 141
614 3300025929 Ga0207664_10749856 Ga0207664_107498561 141
615 3300025929 Ga0207664_10762459 Ga0207664_107624592 141
616 3300025932 Ga0207690_10113879 Ga0207690_101138792 141
617 3300025933 Ga0207706_10561007 Ga0207706_105610072 141
618 3300025934 Ga0207686_10194272 Ga0207686_101942722 141
619 3300025935 Ga0207709_11058491 Ga0207709_110584911 141
620 3300025936 Ga0207670_10087012 Ga0207670_100870123 141
621 3300025936 Ga0207670_10673057 Ga0207670_106730571 141
622 3300025938 Ga0207704_10784033 Ga0207704_107840332 141
623 3300025939 Ga0207665_10006977 Ga0207665_100069772 141
624 3300025939 Ga0207665_10022066 Ga0207665_100220663 141
625 3300025939 Ga0207665_10054792 Ga0207665_100547921 141
626 3300025939 Ga0207665_10278698 Ga0207665_102786982 141
627 3300025941 Ga0207711_10071864 Ga0207711_100718643 141
628 3300025942 Ga0207689_10110991 Ga0207689_101109912 141
629 3300025949 Ga0207667_10257751 Ga0207667_102577512 141
630 3300025949 Ga0207667_10322818 Ga0207667_103228183 141
631 3300025961 Ga0207712_10925499 Ga0207712_109254991 141
632 3300025972 Ga0207668_11684901 Ga0207668_116849011 141
633 3300025981 Ga0207640_11152740 Ga0207640_111527401 141
634 3300025986 Ga0207658_10584837 Ga0207658_105848371 141
635 3300025986 Ga0207658_10812859 Ga0207658_108128592 141
636 3300026023 Ga0207677_10114399 Ga0207677_101143992 141
637 3300026035 Ga0207703_10852570 Ga0207703_108525701 141
638 3300026035 Ga0207703_11074635 Ga0207703_110746351 141
639 3300026041 Ga0207639_10529266 Ga0207639_105292661 141
640 3300026041 Ga0207639_10539322 Ga0207639_105393222 141
641 3300026041 Ga0207639_10623244 Ga0207639_106232441 141
642 3300026041 Ga0207639_10804400 Ga0207639_108044002 141
643 3300026041 Ga0207639_12270582 Ga0207639_122705821 141
644 3300026078 Ga0207702_10303407 Ga0207702_103034072 141
645 3300026078 Ga0207702_11029662 Ga0207702_110296622 141
646 3300026088 Ga0207641_10002695 Ga0207641_1000269516 141
647 3300026088 Ga0207641_10277514 Ga0207641_102775141 141
648 3300026089 Ga0207648_10252902 Ga0207648_102529022 141
649 3300026095 Ga0207676_10973350 Ga0207676_109733501 141
650 3300026116 Ga0207674_10139137 Ga0207674_101391372 141
651 3300026116 Ga0207674_10220768 Ga0207674_102207682 141
652 3300026142 Ga0207698_10247195 Ga0207698_102471952 141
653 3300026142 Ga0207698_11790985 Ga0207698_117909851 141
654 3300027111 Ga0209281_1000108 Ga0209281_100010865 141
655 3300027512 Ga0209179_1098678 Ga0209179_10986781 141
656 3300027671 Ga0209588_1027354 Ga0209588_10273543 141
657 3300027671 Ga0209588_1044791 Ga0209588_10447911 141
658 3300027671 Ga0209588_1045876 Ga0209588_10458762 141
659 3300027671 Ga0209588_1073764 Ga0209588_10737642 141
660 3300027671 Ga0209588_1255594 Ga0209588_12555941 141
661 3300027907 Ga0207428_10175270 Ga0207428_101752702 141
662 3300028379 Ga0268266_10000721 Ga0268266_1000072110 141
663 3300028379 Ga0268266_10273778 Ga0268266_102737782 141
664 3300028379 Ga0268266_10474876 Ga0268266_104748761 141
665 3300028381 Ga0268264_10046600 Ga0268264_100466002 141
666 3300028381 Ga0268264_10050795 Ga0268264_100507952 141
667 3300028381 Ga0268264_10861856 Ga0268264_108618562 141
668 3300028577 Ga0265318_10008761 Ga0265318_100087616 141
669 3300028800 Ga0265338_10248469 Ga0265338_102484691 141
670 3300031241 Ga0265325_10512973 Ga0265325_105129731 141
671 3300031247 Ga0265340_10055634 Ga0265340_100556343 141
672 3300031250 Ga0265331_10079010 Ga0265331_100790101 141
673 3300031251 Ga0265327_10000214 Ga0265327_1000021411 141
674 3300031344 Ga0265316_10434863 Ga0265316_104348632 141
675 3300033547 Ga0316212_1008679 Ga0316212_10086792 141
676 3300035083 Ga0373926_0006361 Ga0373926_0006361_313_738 141
677 3300035116 Ga0373945_0341982 Ga0373945_0341982_106_531 141
678 3300035170 Ga0373943_0044149 Ga0373943_0044149_318_743 141
679 3300035171 Ga0373946_0034777 Ga0373946_0034777_196_621 141
680 3300035410 Ga0373924_0001655 Ga0373924_0001655_6282_6707 141
681 3300035410 Ga0373924_0071453 Ga0373924_0071453_222_647 141
682 3300035691 Ga0373931_0104054 Ga0373931_0104054_686_1111 141
683 3300035691 Ga0373931_0540727 Ga0373931_0540727_231_656 141
684 3300035691 Ga0373931_0638824 Ga0373931_0638824_261_686 141
685 3300035692 Ga0373935_0088367 Ga0373935_0088367_1490_1915 141
686 3300035695 Ga0373927_0012762 Ga0373927_0012762_3279_3704 141
687 3300035724 Ga0373933_0107967 Ga0373933_0107967_1143_1568 141
688 3300035724 Ga0373933_0436477 Ga0373933_0436477_405_830 141
689 3300035725 Ga0373947_0834066 Ga0373947_0834066_158_583 141
690 3300036401 Ga0373937_0000225 Ga0373937_0000225_12886_13311 141
691 3300036401 Ga0373937_0107398 Ga0373937_0107398_361_786 141
692 3300036401 Ga0373937_0578241 Ga0373937_0578241_240_665 141
693 3300036401 Ga0373937_1431817 Ga0373937_1431817_151_576 141
694 3300037466 Ga0395898_0010182 Ga0395898_0010182_8717_9142 141
695 3300037466 Ga0395898_0505768 Ga0395898_0505768_531_956 141
696 3300037471 Ga0395905_0002196 Ga0395905_0002196_19433_19939 141
697 3300037471 Ga0395905_0162732 Ga0395905_0162732_664_1089 141
698 3300037471 Ga0395905_0204403 Ga0395905_0204403_1308_1733 141
699 3300039437 Ga0436365_0581532 Ga0436365_0581532_1613_2038 141
700 3300039447 Ga0436361_0069880 Ga0436361_0069880_372_797 141
701 3300041498 Ga0451841_0284456 Ga0451841_0284456_277_702 141
702 3300041511 Ga0451855_0031514 Ga0451855_0031514_19_444 141
703 3300042876 Ga0451577_0756303 Ga0451577_0756303_389_814 141
704 3300044673 Ga0453683_0842328 Ga0453683_0842328_161_586 141
705 3300044694 Ga0466963_0021566 Ga0466963_0021566_3047_3472 141
706 3300044712 Ga0453684_0598252 Ga0453684_0598252_624_1076 141
707 3300044712 Ga0453684_1622024 Ga0453684_1622024_111_536 141
708 3300044842 Ga0466957_0016647 Ga0466957_0016647_445_888 141
709 3300044842 Ga0466957_0096678 Ga0466957_0096678_1215_1643 141
710 3300045049 Ga0466959_1128004 Ga0466959_1128004_21_446 141
711 3300046455 Ga0495603_0131963 Ga0495603_0131963_769_1194 141
712 3300046455 Ga0495603_0539911 Ga0495603_0539911_17_445 141
713 3300046462 Ga0495651_0600920 Ga0495651_0600920_197_622 141
714 3300046472 Ga0495580_0039295 Ga0495580_0039295_2924_3349 141
715 3300046473 Ga0495582_0004066 Ga0495582_0004066_457_882 141
716 3300046477 Ga0495664_0570676 Ga0495664_0570676_234_659 141
717 3300046477 Ga0495664_0697865 Ga0495664_0697865_137_562 141
718 3300046491 Ga0495584_0046724 Ga0495584_0046724_1142_1570 141
719 3300046491 Ga0495584_0077069 Ga0495584_0077069_1233_1661 141
720 3300046492 Ga0495585_0000148 Ga0495585_0000148_8682_9110 141
721 3300046500 Ga0495596_0015142 Ga0495596_0015142_2793_3221 141
722 3300046506 Ga0495583_0190298 Ga0495583_0190298_63_491 141
723 3300046506 Ga0495583_0448014 Ga0495583_0448014_58_489 141
724 3300046513 Ga0495616_0169166 Ga0495616_0169166_526_960 141
725 3300046516 Ga0495628_0495082 Ga0495628_0495082_251_676 141
726 3300046516 Ga0495628_0712914 Ga0495628_0712914_124_549 141
727 3300046517 Ga0495630_0070531 Ga0495630_0070531_1656_2084 141
728 3300046518 Ga0495631_0063919 Ga0495631_0063919_1127_1555 141
729 3300046522 Ga0495643_0009289 Ga0495643_0009289_867_1295 141
730 3300046523 Ga0495644_0022045 Ga0495644_0022045_709_1137 141
731 3300046525 Ga0495663_0004095 Ga0495663_0004095_1431_1865 141
732 3300046526 Ga0495666_0015085 Ga0495666_0015085_2462_2890 141
733 3300046526 Ga0495666_0136191 Ga0495666_0136191_480_908 141
734 3300046526 Ga0495666_0326192 Ga0495666_0326192_157_582 141
735 3300046529 Ga0495652_0081018 Ga0495652_0081018_1357_1782 141
736 3300046531 Ga0495665_0070728 Ga0495665_0070728_956_1384 141
737 3300046531 Ga0495665_0169596 Ga0495665_0169596_684_1112 141
738 3300046531 Ga0495665_0249240 Ga0495665_0249240_281_709 141
739 3300046535 Ga0495586_0263149 Ga0495586_0263149_181_609 141
740 3300046536 Ga0495587_0018167 Ga0495587_0018167_772_1197 141
741 3300046538 Ga0495609_0001458 Ga0495609_0001458_8643_9071 141
742 3300046538 Ga0495609_0044747 Ga0495609_0044747_1111_1545 141
743 3300046539 Ga0495621_0133533 Ga0495621_0133533_298_732 141
744 3300046542 Ga0495597_0009662 Ga0495597_0009662_3626_4060 141
745 3300046543 Ga0495645_0016723 Ga0495645_0016723_2255_2680 141
746 3300046543 Ga0495645_0098475 Ga0495645_0098475_383_808 141
747 3300046543 Ga0495645_0329839 Ga0495645_0329839_212_637 141
748 3300046557 Ga0495622_0001973 Ga0495622_0001973_5176_5604 141
749 3300046557 Ga0495622_0006367 Ga0495622_0006367_1665_2093 141
750 3300046557 Ga0495622_0209788 Ga0495622_0209788_154_579 141
751 3300046615 Ga0495656_0035523 Ga0495656_0035523_184_618 141
752 3300046615 Ga0495656_0110959 Ga0495656_0110959_17_442 141
753 3300046616 Ga0495668_0040218 Ga0495668_0040218_1854_2282 141
754 3300046616 Ga0495668_0226080 Ga0495668_0226080_158_592 141
755 3300046642 Ga0495634_0369184 Ga0495634_0369184_386_814 141
756 3300046648 Ga0495611_0090206 Ga0495611_0090206_849_1277 141
757 3300046660 Ga0495625_0028107 Ga0495625_0028107_1532_1960 141
758 3300046660 Ga0495625_0314266 Ga0495625_0314266_119_553 141
759 3300046660 Ga0495625_0450051 Ga0495625_0450051_341_775 141
760 3300046663 Ga0495635_0054129 Ga0495635_0054129_1121_1546 141
761 3300046663 Ga0495635_0096049 Ga0495635_0096049_266_694 141
762 3300046665 Ga0495661_0024256 Ga0495661_0024256_3401_3835 141
763 3300046674 Ga0495588_0003529 Ga0495588_0003529_3537_3965 141
764 3300046674 Ga0495588_0012161 Ga0495588_0012161_2033_2464 141
765 3300046674 Ga0495588_0037676 Ga0495588_0037676_1010_1438 141
766 3300046674 Ga0495588_0088169 Ga0495588_0088169_268_696 141
767 3300046680 Ga0495646_0083017 Ga0495646_0083017_848_1273 141
768 3300046689 Ga0495613_0198177 Ga0495613_0198177_772_1197 141
769 3300046689 Ga0495613_0671068 Ga0495613_0671068_216_641 141
770 3300046690 Ga0495624_0002163 Ga0495624_0002163_1988_2416 141
771 3300046794 Ga0495589_0101993 Ga0495589_0101993_274_702 141
772 3300047315 Ga0495581_0016671 Ga0495581_0016671_3174_3602 141
773 3300047315 Ga0495581_0164671 Ga0495581_0164671_689_1117 141
774 3300047317 Ga0495604_0033035 Ga0495604_0033035_2176_2601 141
775 3300047318 Ga0495636_0030641 Ga0495636_0030641_1212_1640 141
776 3300047318 Ga0495636_0190296 Ga0495636_0190296_120_545 141
777 3300047319 Ga0495674_0153215 Ga0495674_0153215_630_1055 141
778 3300047319 Ga0495674_0393378 Ga0495674_0393378_420_845 141
779 3300047320 Ga0495672_0210973 Ga0495672_0210973_16_444 141
780 3300047321 Ga0495676_0080007 Ga0495676_0080007_1377_1805 141
781 3300047323 Ga0495683_0300219 Ga0495683_0300219_251_679 141
782 3300047444 Ga0495675_0225987 Ga0495675_0225987_652_1080 141
783 3300047445 Ga0495677_0013840 Ga0495677_0013840_848_1276 141
784 3300047447 Ga0495685_041485 Ga0495685_041485_710_1144 141
785 3300047469 Ga0495673_0018181 Ga0495673_0018181_2130_2558 141
786 3300047470 Ga0495681_0013143 Ga0495681_0013143_4337_4771 141
787 3300047470 Ga0495681_0205002 Ga0495681_0205002_73_507 141
788 3300048088 Ga0495602_0283926 Ga0495602_0283926_283_708 141
789 3300048089 Ga0495614_0034013 Ga0495614_0034013_1458_1886 141
790 3300048904 Ga0496101_0177535 Ga0496101_0177535_167_592 141
791 3300048905 Ga0496102_0001461 Ga0496102_0001461_11886_12311 141
792 3300048905 Ga0496102_0042961 Ga0496102_0042961_2491_2916 141
793 3300048905 Ga0496102_1605542 Ga0496102_1605542_58_492 141
794 3300048906 Ga0496103_0016154 Ga0496103_0016154_3277_3702 141
795 3300048906 Ga0496103_0821141 Ga0496103_0821141_19_444 141
796 3300048907 Ga0496104_0047745 Ga0496104_0047745_1744_2169 141
797 3300048907 Ga0496104_0064166 Ga0496104_0064166_613_1038 141
798 3300048908 Ga0496105_0020489 Ga0496105_0020489_1238_1663 141
799 3300048908 Ga0496105_0054680 Ga0496105_0054680_826_1251 141
800 3300048909 Ga0496106_0053142 Ga0496106_0053142_2425_2850 141
801 3300048909 Ga0496106_0527143 Ga0496106_0527143_211_663 141
802 3300048910 Ga0496107_0870148 Ga0496107_0870148_54_479 141
803 3300048911 Ga0496108_0060056 Ga0496108_0060056_542_1012 141
804 3300048911 Ga0496108_0521908 Ga0496108_0521908_335_760 141
805 3300048912 Ga0496109_0202502 Ga0496109_0202502_1163_1633 141
806 3300048912 Ga0496109_1212604 Ga0496109_1212604_74_499 141
807 3300048913 Ga0496110_0010298 Ga0496110_0010298_5398_5823 141
808 3300048913 Ga0496110_1192164 Ga0496110_1192164_137_562 141
809 3300048914 Ga0496111_0009322 Ga0496111_0009322_257_682 141
810 3300048915 Ga0496112_0009847 Ga0496112_0009847_721_1146 141
811 3300048915 Ga0496112_0024683 Ga0496112_0024683_4626_5051 141
812 3300048915 Ga0496112_0081126 Ga0496112_0081126_2755_3180 141
813 3300048915 Ga0496112_0310245 Ga0496112_0310245_828_1253 141
814 3300048915 Ga0496112_1083550 Ga0496112_1083550_20_445 141
815 3300048916 Ga0496113_0002200 Ga0496113_0002200_5673_6098 141
816 3300048916 Ga0496113_0063277 Ga0496113_0063277_537_962 141
817 3300048916 Ga0496113_0990967 Ga0496113_0990967_116_544 141
818 3300048917 Ga0496114_0015547 Ga0496114_0015547_5409_5879 141
819 3300048917 Ga0496114_0520016 Ga0496114_0520016_225_650 141
820 3300048918 Ga0496115_0004423 Ga0496115_0004423_1337_1762 141
821 3300048918 Ga0496115_0017316 Ga0496115_0017316_3445_3876 141
822 3300048918 Ga0496115_0493795 Ga0496115_0493795_90_542 141
823 3300048918 Ga0496115_0656843 Ga0496115_0656843_83_508 141
824 3300048918 Ga0496115_0760877 Ga0496115_0760877_10_480 141
825 3300048927 Ga0496124_0194661 Ga0496124_0194661_602_1027 141
826 3300048929 Ga0496126_0689903 Ga0496126_0689903_338_763 141
827 3300049460 Ga0495682_0176312 Ga0495682_0176312_222_647 141
828 3300050510 nmdc:mga06r32_134538_c1 nmdc:mga06r32_134538_c1_1513_1938 141
829 3300050511 nmdc:mga08y16_199106_c1 nmdc:mga08y16_199106_c1_727_1155 141
830 3300050512 nmdc:mga0n895_107001_c1 nmdc:mga0n895_107001_c1_988_1413 141
831 3300050512 nmdc:mga0n895_233160_c1 nmdc:mga0n895_233160_c1_141_566 141
832 3300050512 nmdc:mga0n895_535402_c1 nmdc:mga0n895_535402_c1_336_761 141
833 3300050513 nmdc:mga0rr50_65151_c1 nmdc:mga0rr50_65151_c1_1339_1764 141
834 3300050513 nmdc:mga0rr50_773087_c1 nmdc:mga0rr50_773087_c1_88_513 141
835 3300050513 nmdc:mga0rr50_837547_c1 nmdc:mga0rr50_837547_c1_45_470 141
836 3300050513 nmdc:mga0rr50_86907_c1 nmdc:mga0rr50_86907_c1_898_1323 141
837 3300050514 nmdc:mga08x19_311100_c1 nmdc:mga08x19_311100_c1_626_1051 141
838 3300050514 nmdc:mga08x19_332951_c1 nmdc:mga08x19_332951_c1_535_960 141
839 3300050514 nmdc:mga08x19_952749_c1 nmdc:mga08x19_952749_c1_138_563 141
840 3300053077 Ga0495601_0029001 Ga0495601_0029001_1415_1840 141
841 3300053084 Ga0495595_0644363 Ga0495595_0644363_27_452 141
842 3300053090 Ga0500646_0348967 Ga0500646_0348967_70_498 141
843 3300053125 Ga0500618_027643 Ga0500618_027643_34_465 141
844 3300053138 Ga0500564_012813 Ga0500564_012813_2438_2863 141
845 3300059477 Ga0587084_029059 Ga0587084_029059_441_866 141
846 3300059490 Ga0587066_042734 Ga0587066_042734_424_849 141
847 3300059491 Ga0587070_084209 Ga0587070_084209_268_693 141
848 3300059492 Ga0587073_0054585 Ga0587073_0054585_27_452 141
849 3300059504 Ga0587082_136810 Ga0587082_136810_27_452 141
850 3300059505 Ga0587083_0115189 Ga0587083_0115189_251_676 141
851 3300059513 Ga0587094_135218 Ga0587094_135218_68_493 141
852 3300059605 Ga0587106_027054 Ga0587106_027054_145_570 141
853 3300059624 Ga0587109_049854 Ga0587109_049854_418_843 141
854 3300059626 Ga0587115_008128 Ga0587115_008128_802_1227 141
855 3300059627 Ga0587117_116866 Ga0587117_116866_10_435 141
856 3300059640 Ga0587067_034498 Ga0587067_034498_515_940 141
857 3300059642 Ga0587069_104578 Ga0587069_104578_31_456 141
858 3300059643 Ga0587072_080587 Ga0587072_080587_268_693 141
859 3300059644 Ga0587075_013836 Ga0587075_013836_31_456 141
860 3300059652 Ga0587107_048558 Ga0587107_048558_275_700 141
861 3300060344 Ga0587071_063793 Ga0587071_063793_45_470 141
862 3300060346 Ga0587111_0218447 Ga0587111_0218447_109_534 141
863 3300061719 Ga0466962_0192145 Ga0466962_0192145_76_501 141
864 3300005329 Ga0070683_100182240 Ga0070683_1001822401 142
865 3300005336 Ga0070680_100365642 Ga0070680_1003656422 142
866 3300005339 Ga0070660_100294666 Ga0070660_1002946662 142
867 3300005458 Ga0070681_10411539 Ga0070681_104115392 142
868 3300005535 Ga0070684_100308058 Ga0070684_1003080583 142
869 3300005577 Ga0068857_100040030 Ga0068857_1000400302 142
870 3300005618 Ga0068864_100068413 Ga0068864_1000684133 142
871 3300005841 Ga0068863_100021310 Ga0068863_1000213105 142
872 3300005842 Ga0068858_100550516 Ga0068858_1005505162 142
873 3300006028 Ga0070717_11666994 Ga0070717_116669941 142
874 3300006175 Ga0070712_100715313 Ga0070712_1007153132 142
875 3300006358 Ga0068871_100191938 Ga0068871_1001919383 142
876 3300006847 Ga0075431_101196053 Ga0075431_1011960531 142
877 3300007076 Ga0075435_100693015 Ga0075435_1006930152 142
878 3300009094 Ga0111539_12016933 Ga0111539_120169332 142
879 3300009174 Ga0105241_10494279 Ga0105241_104942792 142
880 3300009551 Ga0105238_10788970 Ga0105238_107889702 142
881 3300013105 Ga0157369_10975744 Ga0157369_109757442 142
882 3300014968 Ga0157379_10050216 Ga0157379_100502163 142
883 3300014969 Ga0157376_10781969 Ga0157376_107819692 142
884 3300025906 Ga0207699_10292632 Ga0207699_102926322 142
885 3300025915 Ga0207693_10337539 Ga0207693_103375391 142
886 3300025924 Ga0207694_10677440 Ga0207694_106774402 142
887 3300025941 Ga0207711_10166927 Ga0207711_101669271 142
888 3300025945 Ga0207679_10947089 Ga0207679_109470891 142
889 3300026035 Ga0207703_11070389 Ga0207703_110703892 142
890 3300026095 Ga0207676_10036301 Ga0207676_100363011 142
891 3300026116 Ga0207674_10035632 Ga0207674_100356323 142
892 3300035692 Ga0373935_0781767 Ga0373935_0781767_203_634 142
893 3300046517 Ga0495630_0126744 Ga0495630_0126744_166_597 142
894 3300046528 Ga0495642_0072640 Ga0495642_0072640_410_841 142
895 3300048905 Ga0496102_0555771 Ga0496102_0555771_560_991 142
896 3300048907 Ga0496104_0002008 Ga0496104_0002008_447_878 142
897 3300048908 Ga0496105_0014169 Ga0496105_0014169_4120_4551 142
898 3300048911 Ga0496108_0017503 Ga0496108_0017503_2155_2586 142
899 3300048912 Ga0496109_0134847 Ga0496109_0134847_375_806 142
900 3300048913 Ga0496110_1256933 Ga0496110_1256933_39_470 142
901 3300048914 Ga0496111_0151783 Ga0496111_0151783_212_643 142
902 3300048915 Ga0496112_0029744 Ga0496112_0029744_1163_1594 142
903 3300048916 Ga0496113_0030749 Ga0496113_0030749_2906_3337 142
904 3300050510 nmdc:mga06r32_823324_c1 nmdc:mga06r32_823324_c1_414_845 142
905 3300053090 Ga0500646_0005101 Ga0500646_0005101_83_514 142
906 3300053092 Ga0500583_0029030 Ga0500583_0029030_1469_1900 142
907 3300053096 Ga0500641_0017669 Ga0500641_0017669_484_915 142
908 3300053099 Ga0500654_076893 Ga0500654_076893_889_1320 142
909 3300053146 Ga0500588_0004579 Ga0500588_0004579_1848_2279 142
910 3300053160 Ga0500633_0018606 Ga0500633_0018606_404_835 142
911 3300000546 LJNas_1001069 LJNas_10010692 143
912 3300013296 Ga0157374_10071311 Ga0157374_100713111 143
913 3300013306 Ga0163162_10325912 Ga0163162_103259124 143
914 3300014325 Ga0163163_10310653 Ga0163163_103106532 143
915 3300014969 Ga0157376_10007881 Ga0157376_100078818 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

66

165

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.9733 1 143
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9697 1 143
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9678 1 143
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9675 1 143
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9608 1 143
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9736 1 143 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9537 1 143 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9334 1 142 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.927 1 142 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9202 45 142 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A537D4C0-F1-model_v4 OsmC family peroxiredoxin 0.9907 1 83 GO:0004601
GO:0006979
AF-A0A6L5G3Q2-F1-model_v4 OsmC family peroxiredoxin 0.9881 47 142 GO:0004601
GO:0006979
AF-B4VT13-F1-model_v4 OsmC-like protein 0.9863 1 79 GO:0004601
GO:0006979
AF-A0A1N6JDU6-F1-model_v4 Osmotically inducible protein OsmC 0.9851 1 142 GO:0004601
GO:0006979
AF-A0A358RW30-F1-model_v4 deleted 0.9846 1 77

Feature Viewer

pLDDT pTM Quality
95.31 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map