F485453
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 910 | 423 | 829 | 120 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2939657138|2939657773 |
| Length | 118 |
| Sequence | TLTSPETAAAHGVGLSDAAAQKVRSLMTQEGRDDLRLRVAVQPGGCSGLIYQLYFDERFLDGDASVDFGDGVEVVVDKMSVPYLMGASIDFEDTIQKQGFTIDNPNAAGSCACGDSFH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 2 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 3 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 4 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 5 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 6 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 7 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 8 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 9 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 10 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 11 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 12 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 13 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 14 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 15 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 16 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 17 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 18 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 19 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 20 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 21 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 22 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 23 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 24 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 25 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 26 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 27 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 28 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 29 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 30 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 31 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 32 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 33 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 34 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 35 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 36 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 37 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 38 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 39 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 40 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 41 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 42 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 43 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 44 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 45 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 46 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 47 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 48 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 49 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 50 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 51 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 52 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 53 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 54 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 55 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 56 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 57 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 58 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 59 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 60 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 61 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 62 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 63 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 64 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 65 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 66 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 67 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 68 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 69 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 70 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 71 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 72 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 73 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 74 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 75 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 76 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 77 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 78 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 79 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 80 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 81 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 82 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 84 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 85 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 86 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 87 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 88 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 89 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 90 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 91 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 92 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 93 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 94 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 96 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 97 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 98 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 99 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 100 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 104 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 106 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 119 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 120 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 123 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 124 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 125 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 126 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 127 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 128 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 129 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 130 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 131 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 132 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 133 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 134 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 135 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 136 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 137 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 139 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 140 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 142 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 143 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 144 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 145 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 177 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 181 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 192 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 246 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 247 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 250 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 258 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 259 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 267 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 275 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 276 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 277 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 278 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 279 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 280 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 286 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 287 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 290 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 291 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 292 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 293 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 379 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 380 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 381 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 383 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 384 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 385 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 386 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 387 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 388 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 389 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 415 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 416 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 417 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 418 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 419 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 420 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 421 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 422 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 423 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.75 |
| Metatranscriptomes | 8.46 |
| Isolates | 8.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 10.44 |
| Nodule | 0 |
| Rhizoplane | 3.74 |
| Rhizosphere | 70.88 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 14.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10016630 | 3300001979 | Bacteria | 2653 |
| 2 | JGI24740J21852_10032850 | 3300001979 | Bacteria | 1655 |
| 3 | JGI24740J21852_10083933 | 3300001979 | Bacteria | 830 |
| 4 | JGI24739J22299_10005914 | 3300001989 | Bacteria | 4633 |
| 5 | JGI24739J22299_10036697 | 3300001989 | Bacteria | 1655 |
| 6 | JGI24737J22298_10026723 | 3300001990 | Bacteria | 1822 |
| 7 | JGI24737J22298_10262116 | 3300001990 | Bacteria | 511 |
| 8 | JGI24735J21928_10000431 | 3300002067 | Bacteria | 14659 |
| 9 | JGI24735J21928_10046826 | 3300002067 | Bacteria | 1254 |
| 10 | JGI25162J39368_1006402 | 3300002737 | Bacteria | 2042 |
| 11 | JGI25154J39366_1001125 | 3300002738 | Bacteria | 10388 |
| 12 | JGI25164J39214_1000402 | 3300002772 | Bacteria | 24889 |
| 13 | Ga0006778J45830_1009243 | 3300003162 | Bacteria | 511 |
| 14 | Ga0006759J45824_1032353 | 3300003163 | Bacteria | 519 |
| 15 | JGI25406J46586_10013791 | 3300003203 | Bacteria | 3456 |
| 16 | JGI25165J46597_1000004 | 3300003214 | Bacteria | 667510 |
| 17 | Ga0006777J48905_1027580 | 3300003308 | Bacteria | 503 |
| 18 | rootH2_10099343 | 3300003320 | Bacteria | 2691 |
| 19 | Ga0007427J51700_105914 | 3300003559 | Bacteria | 3546 |
| 20 | Ga0006781J51513_1010598 | 3300003568 | Bacteria | 1801 |
| 21 | Ga0006562J51391_1006898 | 3300003578 | Bacteria | 6416 |
| 22 | Ga0006562J51391_1014808 | 3300003578 | Bacteria | 10498 |
| 23 | Ga0006562J51391_1014811 | 3300003578 | Bacteria | 7630 |
| 24 | Ga0007411J51799_112608 | 3300003611 | Bacteria | 678 |
| 25 | Ga0006780_1007103 | 3300003735 | Bacteria | 3547 |
| 26 | Ga0055539_1000008 | 3300003752 | Bacteria | 537665 |
| 27 | Ga0055539_1012101 | 3300003752 | Bacteria | 1061 |
| 28 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 29 | Ga0055532_1006376 | 3300003758 | Bacteria | 1580 |
| 30 | Ga0055525_1000787 | 3300003759 | Bacteria | 10179 |
| 31 | Ga0055525_1007188 | 3300003759 | Bacteria | 941 |
| 32 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 33 | Ga0055529_1000019 | 3300003763 | Bacteria | 332786 |
| 34 | Ga0055529_1006166 | 3300003763 | Bacteria | 1690 |
| 35 | Ga0055541_1002268 | 3300003841 | Bacteria | 3879 |
| 36 | Ga0058860_10117912 | 3300004801 | Bacteria | 812 |
| 37 | Ga0058860_12007059 | 3300004801 | Bacteria | 551 |
| 38 | Ga0065714_10003468 | 3300005288 | Bacteria | 13259 |
| 39 | Ga0065714_10175973 | 3300005288 | Bacteria | 983 |
| 40 | Ga0065714_10437834 | 3300005288 | Bacteria | 562 |
| 41 | Ga0070658_10002538 | 3300005327 | Bacteria | 15231 |
| 42 | Ga0070658_10011276 | 3300005327 | Bacteria | 7164 |
| 43 | Ga0070658_10018446 | 3300005327 | Bacteria | 5586 |
| 44 | Ga0070658_10024386 | 3300005327 | Bacteria | 4852 |
| 45 | Ga0070658_10119339 | 3300005327 | Bacteria | 2191 |
| 46 | Ga0070658_10287880 | 3300005327 | Bacteria | 1400 |
| 47 | Ga0070676_10170303 | 3300005328 | Bacteria | 1408 |
| 48 | Ga0070677_10428159 | 3300005333 | Bacteria | 703 |
| 49 | Ga0068869_100030634 | 3300005334 | Bacteria | 3778 |
| 50 | Ga0068869_100334916 | 3300005334 | Bacteria | 1230 |
| 51 | Ga0070682_100108313 | 3300005337 | Bacteria | 1847 |
| 52 | Ga0070682_100205196 | 3300005337 | Bacteria | 1393 |
| 53 | Ga0070682_100685039 | 3300005337 | Bacteria | 820 |
| 54 | Ga0070682_101320142 | 3300005337 | Bacteria | 614 |
| 55 | Ga0068868_100136422 | 3300005338 | Bacteria | 2012 |
| 56 | Ga0068868_100668258 | 3300005338 | Bacteria | 927 |
| 57 | Ga0068868_100844645 | 3300005338 | Bacteria | 829 |
| 58 | Ga0070660_100153791 | 3300005339 | Bacteria | 1851 |
| 59 | Ga0070660_100218590 | 3300005339 | Bacteria | 1548 |
| 60 | Ga0070660_100637225 | 3300005339 | Bacteria | 892 |
| 61 | Ga0070691_10431478 | 3300005341 | Bacteria | 749 |
| 62 | Ga0070661_100121708 | 3300005344 | Bacteria | 1955 |
| 63 | Ga0070668_100019550 | 3300005347 | Bacteria | 5098 |
| 64 | Ga0070675_100373423 | 3300005354 | Bacteria | 1268 |
| 65 | Ga0070671_100114768 | 3300005355 | Bacteria | 2264 |
| 66 | Ga0070671_100296052 | 3300005355 | Bacteria | 1377 |
| 67 | Ga0070659_100000366 | 3300005366 | Bacteria | 34220 |
| 68 | Ga0070659_100076747 | 3300005366 | Bacteria | 2664 |
| 69 | Ga0070667_100003912 | 3300005367 | Bacteria | 12649 |
| 70 | Ga0070714_100211744 | 3300005435 | Bacteria | 1777 |
| 71 | Ga0070714_100445987 | 3300005435 | Bacteria | 1229 |
| 72 | Ga0070714_101325681 | 3300005435 | Bacteria | 703 |
| 73 | Ga0070701_11350260 | 3300005438 | Bacteria | 511 |
| 74 | Ga0070663_100592288 | 3300005455 | Bacteria | 932 |
| 75 | Ga0070663_101109728 | 3300005455 | Bacteria | 692 |
| 76 | Ga0070685_10142121 | 3300005466 | Bacteria | 1512 |
| 77 | Ga0070679_101445306 | 3300005530 | Bacteria | 634 |
| 78 | Ga0068853_100052456 | 3300005539 | Bacteria | 3513 |
| 79 | Ga0068853_100072924 | 3300005539 | Bacteria | 2993 |
| 80 | Ga0068853_100545653 | 3300005539 | Bacteria | 1098 |
| 81 | Ga0070672_101314305 | 3300005543 | Bacteria | 646 |
| 82 | Ga0070686_101424364 | 3300005544 | Bacteria | 582 |
| 83 | Ga0068855_100004431 | 3300005563 | Bacteria | 17153 |
| 84 | Ga0068855_100025012 | 3300005563 | Bacteria | 7146 |
| 85 | Ga0068855_100167746 | 3300005563 | Bacteria | 2488 |
| 86 | Ga0068855_100209693 | 3300005563 | Bacteria | 2190 |
| 87 | Ga0068855_100984625 | 3300005563 | Bacteria | 887 |
| 88 | Ga0068855_101114295 | 3300005563 | Bacteria | 824 |
| 89 | Ga0068855_101650102 | 3300005563 | Bacteria | 655 |
| 90 | Ga0068857_100002984 | 3300005577 | Bacteria | 13950 |
| 91 | Ga0068857_100275842 | 3300005577 | Bacteria | 1546 |
| 92 | Ga0068857_100494645 | 3300005577 | Bacteria | 1147 |
| 93 | Ga0068854_101373225 | 3300005578 | Bacteria | 638 |
| 94 | Ga0068856_100040400 | 3300005614 | Bacteria | 4582 |
| 95 | Ga0068856_100056191 | 3300005614 | Bacteria | 3883 |
| 96 | Ga0068856_100065521 | 3300005614 | Bacteria | 3591 |
| 97 | Ga0068856_100201556 | 3300005614 | Bacteria | 2004 |
| 98 | Ga0068856_100296655 | 3300005614 | Bacteria | 1634 |
| 99 | Ga0068856_100533508 | 3300005614 | Bacteria | 1195 |
| 100 | Ga0068856_101073892 | 3300005614 | Bacteria | 823 |
| 101 | Ga0068852_100069820 | 3300005616 | Bacteria | 3080 |
| 102 | Ga0068852_100793296 | 3300005616 | Bacteria | 961 |
| 103 | Ga0068852_100886767 | 3300005616 | Bacteria | 909 |
| 104 | Ga0068859_100462788 | 3300005617 | Bacteria | 1364 |
| 105 | Ga0068864_100080524 | 3300005618 | Bacteria | 2853 |
| 106 | Ga0068864_100118513 | 3300005618 | Bacteria | 2364 |
| 107 | Ga0068861_100166387 | 3300005719 | Bacteria | 1823 |
| 108 | Ga0068851_10000020 | 3300005834 | Bacteria | 133551 |
| 109 | Ga0068870_10134526 | 3300005840 | Bacteria | 1440 |
| 110 | Ga0068863_100058611 | 3300005841 | Bacteria | 3643 |
| 111 | Ga0068858_100000233 | 3300005842 | Bacteria | 60097 |
| 112 | Ga0068862_100389872 | 3300005844 | Bacteria | 1301 |
| 113 | Ga0068862_101252275 | 3300005844 | Bacteria | 742 |
| 114 | Ga0081540_1008305 | 3300005983 | Bacteria | 7264 |
| 115 | Ga0081539_10000432 | 3300005985 | Bacteria | 89138 |
| 116 | Ga0081539_10061848 | 3300005985 | Bacteria | 2049 |
| 117 | Ga0081539_10135194 | 3300005985 | Bacteria | 1206 |
| 118 | Ga0070717_11589490 | 3300006028 | Bacteria | 593 |
| 119 | Ga0075365_10014081 | 3300006038 | Bacteria | 4804 |
| 120 | Ga0075365_10016040 | 3300006038 | Bacteria | 4545 |
| 121 | Ga0075365_10151737 | 3300006038 | Bacteria | 1612 |
| 122 | Ga0075365_10487849 | 3300006038 | Bacteria | 871 |
| 123 | Ga0075365_10509142 | 3300006038 | Bacteria | 851 |
| 124 | Ga0075364_10000664 | 3300006051 | Bacteria | 17846 |
| 125 | Ga0075364_10006010 | 3300006051 | Bacteria | 7096 |
| 126 | Ga0075364_10072297 | 3300006051 | Bacteria | 2273 |
| 127 | Ga0075364_10094417 | 3300006051 | Bacteria | 1987 |
| 128 | Ga0075364_10244267 | 3300006051 | Bacteria | 1220 |
| 129 | Ga0075364_10354878 | 3300006051 | Bacteria | 1000 |
| 130 | Ga0070712_100500165 | 3300006175 | Bacteria | 1019 |
| 131 | Ga0075369_10007782 | 3300006186 | Bacteria | 4098 |
| 132 | Ga0075369_10039734 | 3300006186 | Bacteria | 2010 |
| 133 | Ga0075369_10048476 | 3300006186 | Bacteria | 1833 |
| 134 | Ga0075369_10222376 | 3300006186 | Bacteria | 874 |
| 135 | Ga0075369_10538361 | 3300006186 | Bacteria | 557 |
| 136 | Ga0075366_10431814 | 3300006195 | Bacteria | 812 |
| 137 | Ga0075370_10771516 | 3300006353 | Bacteria | 586 |
| 138 | Ga0075428_101876510 | 3300006844 | Bacteria | 623 |
| 139 | Ga0097620_100462766 | 3300006931 | Bacteria | 1364 |
| 140 | Ga0105244_10035710 | 3300009036 | Bacteria | 2610 |
| 141 | Ga0105240_10002356 | 3300009093 | Bacteria | 30453 |
| 142 | Ga0105240_10122729 | 3300009093 | Bacteria | 3126 |
| 143 | Ga0111539_10455066 | 3300009094 | Bacteria | 1490 |
| 144 | Ga0111539_10499896 | 3300009094 | Bacteria | 1416 |
| 145 | Ga0105245_10051261 | 3300009098 | Bacteria | 3700 |
| 146 | Ga0105245_10082967 | 3300009098 | Bacteria | 2933 |
| 147 | Ga0105247_10091905 | 3300009101 | Bacteria | 1928 |
| 148 | Ga0105247_11016577 | 3300009101 | Bacteria | 648 |
| 149 | Ga0105243_10436524 | 3300009148 | Bacteria | 1225 |
| 150 | Ga0105243_10717885 | 3300009148 | Bacteria | 976 |
| 151 | Ga0105243_11195879 | 3300009148 | Bacteria | 773 |
| 152 | Ga0105243_11745416 | 3300009148 | Bacteria | 652 |
| 153 | Ga0105241_10000260 | 3300009174 | Bacteria | 39516 |
| 154 | Ga0105241_10223011 | 3300009174 | Bacteria | 1586 |
| 155 | Ga0105241_10317717 | 3300009174 | Bacteria | 1342 |
| 156 | Ga0105248_10000714 | 3300009177 | Bacteria | 37567 |
| 157 | Ga0105248_10162370 | 3300009177 | Bacteria | 2519 |
| 158 | Ga0105237_10006375 | 3300009545 | Bacteria | 13100 |
| 159 | Ga0105237_10505764 | 3300009545 | Bacteria | 1215 |
| 160 | Ga0105237_10552930 | 3300009545 | Bacteria | 1158 |
| 161 | Ga0105237_11779993 | 3300009545 | Bacteria | 624 |
| 162 | Ga0105238_10023651 | 3300009551 | Bacteria | 6260 |
| 163 | Ga0105238_10088136 | 3300009551 | Bacteria | 3090 |
| 164 | Ga0105238_10702738 | 3300009551 | Bacteria | 1023 |
| 165 | Ga0105238_11551022 | 3300009551 | Bacteria | 692 |
| 166 | Ga0105238_12054234 | 3300009551 | Bacteria | 605 |
| 167 | Ga0105249_11645121 | 3300009553 | Bacteria | 715 |
| 168 | Ga0105239_10388730 | 3300010375 | Bacteria | 1578 |
| 169 | Ga0105239_11618225 | 3300010375 | Bacteria | 749 |
| 170 | Ga0105246_10046591 | 3300011119 | Bacteria | 2958 |
| 171 | Ga0157373_10584333 | 3300013100 | Bacteria | 812 |
| 172 | Ga0157371_10001714 | 3300013102 | Bacteria | 22297 |
| 173 | Ga0157371_10890684 | 3300013102 | Bacteria | 674 |
| 174 | Ga0157370_10040958 | 3300013104 | Bacteria | 4471 |
| 175 | Ga0157370_10723688 | 3300013104 | Bacteria | 907 |
| 176 | Ga0157370_11194763 | 3300013104 | Bacteria | 686 |
| 177 | Ga0157370_11325577 | 3300013104 | Bacteria | 648 |
| 178 | Ga0157370_11398024 | 3300013104 | Bacteria | 630 |
| 179 | Ga0157369_10003460 | 3300013105 | Bacteria | 18728 |
| 180 | Ga0157369_10065475 | 3300013105 | Bacteria | 3911 |
| 181 | Ga0157369_10202739 | 3300013105 | Bacteria | 2082 |
| 182 | Ga0157369_10304610 | 3300013105 | Bacteria | 1657 |
| 183 | Ga0157369_10428088 | 3300013105 | Bacteria | 1372 |
| 184 | Ga0157369_12346345 | 3300013105 | Bacteria | 541 |
| 185 | Ga0157374_10196136 | 3300013296 | Bacteria | 1976 |
| 186 | Ga0157374_10302225 | 3300013296 | Bacteria | 1583 |
| 187 | Ga0157374_11711662 | 3300013296 | Bacteria | 654 |
| 188 | Ga0163162_11222628 | 3300013306 | Bacteria | 853 |
| 189 | Ga0157372_10050676 | 3300013307 | Bacteria | 4617 |
| 190 | Ga0157372_10090442 | 3300013307 | Bacteria | 3480 |
| 191 | Ga0157372_10497005 | 3300013307 | Bacteria | 1422 |
| 192 | Ga0157372_10679855 | 3300013307 | Bacteria | 1198 |
| 193 | Ga0157375_10089812 | 3300013308 | Bacteria | 3129 |
| 194 | Ga0157375_10682888 | 3300013308 | Bacteria | 1181 |
| 195 | Ga0157375_11164253 | 3300013308 | Bacteria | 904 |
| 196 | Ga0157375_12954239 | 3300013308 | Bacteria | 568 |
| 197 | Ga0163163_10048647 | 3300014325 | Bacteria | 4170 |
| 198 | Ga0163163_13104411 | 3300014325 | Bacteria | 518 |
| 199 | Ga0157380_10068168 | 3300014326 | Bacteria | 2867 |
| 200 | Ga0157380_10935531 | 3300014326 | Bacteria | 896 |
| 201 | Ga0157380_11498048 | 3300014326 | Bacteria | 728 |
| 202 | Ga0157380_13127510 | 3300014326 | Bacteria | 528 |
| 203 | Ga0157380_13302440 | 3300014326 | Bacteria | 516 |
| 204 | Ga0157377_10864988 | 3300014745 | Bacteria | 673 |
| 205 | Ga0157377_10894545 | 3300014745 | Bacteria | 663 |
| 206 | Ga0157379_10014539 | 3300014968 | Bacteria | 6907 |
| 207 | Ga0157376_10186528 | 3300014969 | Bacteria | 1899 |
| 208 | Ga0163161_10801294 | 3300017792 | Bacteria | 792 |
| 209 | Ga0163161_10985481 | 3300017792 | Bacteria | 719 |
| 210 | Ga0197907_10314249 | 3300020069 | Bacteria | 507 |
| 211 | Ga0197907_10417701 | 3300020069 | Bacteria | 597 |
| 212 | Ga0197907_10693143 | 3300020069 | Bacteria | 1165 |
| 213 | Ga0206356_11397704 | 3300020070 | Bacteria | 1937 |
| 214 | Ga0206356_11659145 | 3300020070 | Bacteria | 1083 |
| 215 | Ga0206349_1042834 | 3300020075 | Bacteria | 548 |
| 216 | Ga0206349_1596473 | 3300020075 | Bacteria | 685 |
| 217 | Ga0206355_1252865 | 3300020076 | Bacteria | 511 |
| 218 | Ga0206355_1392808 | 3300020076 | Bacteria | 2286 |
| 219 | Ga0206351_10564076 | 3300020077 | Bacteria | 554 |
| 220 | Ga0206351_10579387 | 3300020077 | Bacteria | 550 |
| 221 | Ga0206350_10544471 | 3300020080 | Bacteria | 551 |
| 222 | Ga0206354_11320637 | 3300020081 | Bacteria | 1095 |
| 223 | Ga0206353_11470238 | 3300020082 | Bacteria | 684 |
| 224 | Ga0206353_11734878 | 3300020082 | Bacteria | 7424 |
| 225 | Ga0206353_11788619 | 3300020082 | Bacteria | 505 |
| 226 | Ga0154015_1609341 | 3300020610 | Bacteria | 853 |
| 227 | Ga0224712_10029729 | 3300022467 | Bacteria | 1965 |
| 228 | Ga0224712_10534805 | 3300022467 | Bacteria | 569 |
| 229 | Ga0209566_100149 | 3300025225 | Bacteria | 81626 |
| 230 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 231 | Ga0209674_118106 | 3300025226 | Bacteria | 562 |
| 232 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 233 | Ga0209147_100849 | 3300025229 | Bacteria | 14329 |
| 234 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 235 | Ga0209563_100381 | 3300025230 | Bacteria | 16054 |
| 236 | Ga0207427_100010 | 3300025231 | Bacteria | 648610 |
| 237 | Ga0209437_100216 | 3300025233 | Bacteria | 106353 |
| 238 | Ga0209258_105279 | 3300025242 | Bacteria | 2231 |
| 239 | Ga0209646_1000071 | 3300025246 | Bacteria | 228702 |
| 240 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 241 | Ga0209677_106708 | 3300025253 | Bacteria | 2647 |
| 242 | Ga0209677_118312 | 3300025253 | Bacteria | 856 |
| 243 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 244 | Ga0209148_1001437 | 3300025254 | Bacteria | 12129 |
| 245 | Ga0209148_1015796 | 3300025254 | Bacteria | 1311 |
| 246 | Ga0209129_1049499 | 3300025258 | Bacteria | 645 |
| 247 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 248 | Ga0209233_1040674 | 3300025261 | Bacteria | 1010 |
| 249 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 250 | Ga0209455_1000811 | 3300025272 | Bacteria | 17057 |
| 251 | Ga0209025_1131806 | 3300025294 | Bacteria | 725 |
| 252 | Ga0209051_1079735 | 3300025303 | Bacteria | 949 |
| 253 | Ga0207656_10000003 | 3300025321 | Bacteria | 771644 |
| 254 | Ga0207655_1083647 | 3300025728 | Bacteria | 1143 |
| 255 | Ga0207655_1092600 | 3300025728 | Bacteria | 1060 |
| 256 | Ga0207682_10215817 | 3300025893 | Bacteria | 886 |
| 257 | Ga0207710_10073034 | 3300025900 | Bacteria | 1577 |
| 258 | Ga0207710_10367985 | 3300025900 | Bacteria | 734 |
| 259 | Ga0207688_10074090 | 3300025901 | Bacteria | 1936 |
| 260 | Ga0207647_10006593 | 3300025904 | Bacteria | 8436 |
| 261 | Ga0207647_10025066 | 3300025904 | Bacteria | 3926 |
| 262 | Ga0207647_10069180 | 3300025904 | Bacteria | 2134 |
| 263 | Ga0207647_10112805 | 3300025904 | Bacteria | 1606 |
| 264 | Ga0207647_10381968 | 3300025904 | Bacteria | 795 |
| 265 | Ga0207645_10128671 | 3300025907 | Bacteria | 1647 |
| 266 | Ga0207643_10032675 | 3300025908 | Bacteria | 2907 |
| 267 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 268 | Ga0207705_10008164 | 3300025909 | Bacteria | 7667 |
| 269 | Ga0207705_10025391 | 3300025909 | Bacteria | 4229 |
| 270 | Ga0207705_10234676 | 3300025909 | Bacteria | 1396 |
| 271 | Ga0207705_10330783 | 3300025909 | Bacteria | 1172 |
| 272 | Ga0207705_10455403 | 3300025909 | Bacteria | 992 |
| 273 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 274 | Ga0207695_10028611 | 3300025913 | Bacteria | 6173 |
| 275 | Ga0207695_10037783 | 3300025913 | Bacteria | 5207 |
| 276 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 277 | Ga0207671_10021409 | 3300025914 | Bacteria | 4905 |
| 278 | Ga0207671_10260553 | 3300025914 | Bacteria | 1365 |
| 279 | Ga0207671_10912622 | 3300025914 | Bacteria | 694 |
| 280 | Ga0207693_10455530 | 3300025915 | Bacteria | 999 |
| 281 | Ga0207657_10016489 | 3300025919 | Bacteria | 7124 |
| 282 | Ga0207657_10571599 | 3300025919 | Bacteria | 883 |
| 283 | Ga0207649_10031676 | 3300025920 | Bacteria | 3145 |
| 284 | Ga0207694_10000433 | 3300025924 | Bacteria | 38856 |
| 285 | Ga0207694_10609233 | 3300025924 | Bacteria | 919 |
| 286 | Ga0207650_10657095 | 3300025925 | Bacteria | 884 |
| 287 | Ga0207659_10552450 | 3300025926 | Bacteria | 979 |
| 288 | Ga0207687_10014147 | 3300025927 | Bacteria | 5219 |
| 289 | Ga0207687_10063542 | 3300025927 | Bacteria | 2614 |
| 290 | Ga0207664_10612575 | 3300025929 | Bacteria | 978 |
| 291 | Ga0207690_10001456 | 3300025932 | Bacteria | 14803 |
| 292 | Ga0207690_10054780 | 3300025932 | Bacteria | 2683 |
| 293 | Ga0207690_11102840 | 3300025932 | Bacteria | 662 |
| 294 | Ga0207709_10469910 | 3300025935 | Bacteria | 976 |
| 295 | Ga0207709_10666094 | 3300025935 | Bacteria | 830 |
| 296 | Ga0207709_11334717 | 3300025935 | Bacteria | 593 |
| 297 | Ga0207691_10881965 | 3300025940 | Bacteria | 749 |
| 298 | Ga0207711_10001536 | 3300025941 | Bacteria | 21399 |
| 299 | Ga0207711_10015358 | 3300025941 | Bacteria | 6354 |
| 300 | Ga0207689_10023007 | 3300025942 | Bacteria | 5235 |
| 301 | Ga0207689_10327561 | 3300025942 | Bacteria | 1272 |
| 302 | Ga0207661_10347334 | 3300025944 | Bacteria | 1338 |
| 303 | Ga0207667_10003435 | 3300025949 | Bacteria | 19553 |
| 304 | Ga0207667_10037351 | 3300025949 | Bacteria | 5192 |
| 305 | Ga0207667_10076583 | 3300025949 | Bacteria | 3471 |
| 306 | Ga0207667_10126813 | 3300025949 | Bacteria | 2629 |
| 307 | Ga0207667_10248984 | 3300025949 | Bacteria | 1818 |
| 308 | Ga0207667_10373541 | 3300025949 | Bacteria | 1453 |
| 309 | Ga0207667_10620803 | 3300025949 | Bacteria | 1089 |
| 310 | Ga0207667_10661703 | 3300025949 | Bacteria | 1049 |
| 311 | Ga0207668_10116597 | 3300025972 | Bacteria | 2014 |
| 312 | Ga0207668_11117741 | 3300025972 | Bacteria | 707 |
| 313 | Ga0207658_10031506 | 3300025986 | Bacteria | 3766 |
| 314 | Ga0207677_10497308 | 3300026023 | Bacteria | 1053 |
| 315 | Ga0207703_10000044 | 3300026035 | Bacteria | 158471 |
| 316 | Ga0207639_10021744 | 3300026041 | Bacteria | 4610 |
| 317 | Ga0207639_11268143 | 3300026041 | Bacteria | 692 |
| 318 | Ga0207678_10162131 | 3300026067 | Bacteria | 1909 |
| 319 | Ga0207678_10505473 | 3300026067 | Bacteria | 1054 |
| 320 | Ga0207678_11092098 | 3300026067 | Bacteria | 706 |
| 321 | Ga0207702_10090684 | 3300026078 | Bacteria | 2675 |
| 322 | Ga0207702_10181739 | 3300026078 | Bacteria | 1937 |
| 323 | Ga0207702_10279247 | 3300026078 | Bacteria | 1578 |
| 324 | Ga0207702_11363217 | 3300026078 | Bacteria | 703 |
| 325 | Ga0207641_10366149 | 3300026088 | Bacteria | 1377 |
| 326 | Ga0207676_10100649 | 3300026095 | Bacteria | 2395 |
| 327 | Ga0207674_10004904 | 3300026116 | Bacteria | 16013 |
| 328 | Ga0207674_10674934 | 3300026116 | Bacteria | 998 |
| 329 | Ga0207674_10683890 | 3300026116 | Bacteria | 990 |
| 330 | Ga0207675_100118687 | 3300026118 | Bacteria | 2501 |
| 331 | Ga0207698_10001186 | 3300026142 | Bacteria | 15193 |
| 332 | Ga0207698_10504036 | 3300026142 | Bacteria | 1178 |
| 333 | Ga0207698_11549342 | 3300026142 | Bacteria | 678 |
| 334 | Ga0207698_11927699 | 3300026142 | Bacteria | 605 |
| 335 | Ga0268266_11686848 | 3300028379 | Bacteria | 609 |
| 336 | Ga0268265_11595556 | 3300028380 | Bacteria | 657 |
| 337 | Ga0265334_10001006 | 3300028573 | Bacteria | 13893 |
| 338 | Ga0307515_10203988 | 3300028794 | Bacteria | 1844 |
| 339 | Ga0307515_10344049 | 3300028794 | Bacteria | 1142 |
| 340 | Ga0307515_10923090 | 3300028794 | Bacteria | 506 |
| 341 | Ga0307513_10507126 | 3300031456 | Bacteria | 923 |
| 342 | Ga0307509_10134492 | 3300031507 | Bacteria | 2421 |
| 343 | Ga0307408_100262656 | 3300031548 | Bacteria | 1430 |
| 344 | Ga0307514_10427685 | 3300031649 | Bacteria | 662 |
| 345 | Ga0316575_10000026 | 3300031665 | Bacteria | 35925 |
| 346 | Ga0316576_10608975 | 3300031727 | Bacteria | 797 |
| 347 | Ga0307405_10497777 | 3300031731 | Bacteria | 976 |
| 348 | Ga0307405_10541090 | 3300031731 | Bacteria | 941 |
| 349 | Ga0307405_10650684 | 3300031731 | Bacteria | 867 |
| 350 | Ga0307413_10130391 | 3300031824 | Bacteria | 1720 |
| 351 | Ga0307410_11092339 | 3300031852 | Bacteria | 691 |
| 352 | Ga0307410_11819142 | 3300031852 | Bacteria | 541 |
| 353 | Ga0307406_10000235 | 3300031901 | Bacteria | 33683 |
| 354 | Ga0307406_10000548 | 3300031901 | Bacteria | 21663 |
| 355 | Ga0307406_10020290 | 3300031901 | Bacteria | 3912 |
| 356 | Ga0307406_10097957 | 3300031901 | Bacteria | 1990 |
| 357 | Ga0307406_10308533 | 3300031901 | Bacteria | 1219 |
| 358 | Ga0307407_10346411 | 3300031903 | Bacteria | 1051 |
| 359 | Ga0307407_11709533 | 3300031903 | Bacteria | 501 |
| 360 | Ga0307412_11361548 | 3300031911 | Bacteria | 641 |
| 361 | Ga0307409_101120909 | 3300031995 | Bacteria | 808 |
| 362 | Ga0307409_102077542 | 3300031995 | Bacteria | 598 |
| 363 | Ga0307416_100020599 | 3300032002 | Bacteria | 4711 |
| 364 | Ga0307416_101158349 | 3300032002 | Bacteria | 878 |
| 365 | Ga0307416_103565838 | 3300032002 | Bacteria | 521 |
| 366 | Ga0307414_10164755 | 3300032004 | Bacteria | 1765 |
| 367 | Ga0307414_10256236 | 3300032004 | Bacteria | 1457 |
| 368 | Ga0307414_10398261 | 3300032004 | Bacteria | 1195 |
| 369 | Ga0307414_10537095 | 3300032004 | Bacteria | 1040 |
| 370 | Ga0307414_10572465 | 3300032004 | Bacteria | 1009 |
| 371 | Ga0307414_10664597 | 3300032004 | Bacteria | 940 |
| 372 | Ga0307414_10738533 | 3300032004 | Bacteria | 894 |
| 373 | Ga0307414_10811145 | 3300032004 | Bacteria | 854 |
| 374 | Ga0307414_11930979 | 3300032004 | Bacteria | 551 |
| 375 | Ga0307411_10443118 | 3300032005 | Bacteria | 1084 |
| 376 | Ga0307411_10667529 | 3300032005 | Bacteria | 902 |
| 377 | Ga0307415_100076204 | 3300032126 | Bacteria | 2377 |
| 378 | Ga0307415_100658201 | 3300032126 | Bacteria | 940 |
| 379 | Ga0316587_1049386 | 3300033529 | Bacteria | 769 |
| 380 | Ga0316596_1021855 | 3300033541 | Bacteria | 1633 |
| 381 | Ga0395899_0007061 | 3300037312 | Bacteria | 8692 |
| 382 | Ga0395899_0575678 | 3300037312 | Bacteria | 720 |
| 383 | Ga0395900_0000774 | 3300037418 | Bacteria | 42584 |
| 384 | Ga0395900_0178902 | 3300037418 | Bacteria | 2156 |
| 385 | Ga0395900_0280888 | 3300037418 | Bacteria | 1657 |
| 386 | Ga0395900_1694093 | 3300037418 | Bacteria | 543 |
| 387 | Ga0395898_0000015 | 3300037466 | Bacteria | 439819 |
| 388 | Ga0395898_0018267 | 3300037466 | Bacteria | 7151 |
| 389 | Ga0395901_0023475 | 3300038443 | Bacteria | 6324 |
| 390 | Ga0395901_0033400 | 3300038443 | Bacteria | 5312 |
| 391 | Ga0395901_0791629 | 3300038443 | Bacteria | 938 |
| 392 | Ga0436363_0269928 | 3300039450 | Bacteria | 1153 |
| 393 | Ga0439465_0097231 | 3300041413 | Bacteria | 1013 |
| 394 | Ga0439465_0109232 | 3300041413 | Bacteria | 961 |
| 395 | Ga0439465_0122093 | 3300041413 | Bacteria | 914 |
| 396 | Ga0451787_134054 | 3300041441 | Bacteria | 561 |
| 397 | Ga0451787_619344 | 3300041441 | Bacteria | 572 |
| 398 | Ga0451789_0062393 | 3300041443 | Bacteria | 953 |
| 399 | Ga0451791_0106859 | 3300041451 | Bacteria | 988 |
| 400 | Ga0451791_1080276 | 3300041451 | Bacteria | 781 |
| 401 | Ga0451793_0891968 | 3300041452 | Bacteria | 1336 |
| 402 | Ga0451797_0342964 | 3300041453 | Bacteria | 561 |
| 403 | Ga0451797_0419015 | 3300041453 | Bacteria | 867 |
| 404 | Ga0451797_0977833 | 3300041453 | Bacteria | 556 |
| 405 | Ga0451800_1222319 | 3300041459 | Bacteria | 506 |
| 406 | Ga0451806_482414 | 3300041462 | Bacteria | 1275 |
| 407 | Ga0451806_769506 | 3300041462 | Bacteria | 1095 |
| 408 | Ga0451837_0986096 | 3300041494 | Bacteria | 1091 |
| 409 | Ga0451837_1152760 | 3300041494 | Bacteria | 739 |
| 410 | Ga0451837_1777354 | 3300041494 | Bacteria | 532 |
| 411 | Ga0451841_0952906 | 3300041498 | Bacteria | 813 |
| 412 | Ga0451841_1254032 | 3300041498 | Bacteria | 662 |
| 413 | Ga0451849_1108743 | 3300041505 | Bacteria | 755 |
| 414 | Ga0451843_0095480 | 3300041509 | Bacteria | 561 |
| 415 | Ga0451843_0345566 | 3300041509 | Bacteria | 659 |
| 416 | Ga0451853_2924470 | 3300041512 | Bacteria | 603 |
| 417 | Ga0451853_3391059 | 3300041512 | Bacteria | 741 |
| 418 | Ga0450907_050908 | 3300042146 | Bacteria | 712 |
| 419 | Ga0466972_0022794 | 3300044658 | Bacteria | 3116 |
| 420 | Ga0466972_0050505 | 3300044658 | Bacteria | 2007 |
| 421 | Ga0466972_0086023 | 3300044658 | Bacteria | 1494 |
| 422 | Ga0466972_0519027 | 3300044658 | Bacteria | 561 |
| 423 | Ga0466965_0005583 | 3300044683 | Bacteria | 5676 |
| 424 | Ga0466965_0015519 | 3300044683 | Bacteria | 3618 |
| 425 | Ga0466965_0509897 | 3300044683 | Bacteria | 675 |
| 426 | Ga0466965_0916937 | 3300044683 | Bacteria | 512 |
| 427 | Ga0466966_0016995 | 3300044684 | Bacteria | 4808 |
| 428 | Ga0466966_0388569 | 3300044684 | Bacteria | 838 |
| 429 | Ga0466961_0240754 | 3300044693 | Bacteria | 1112 |
| 430 | Ga0466961_0302203 | 3300044693 | Bacteria | 977 |
| 431 | Ga0466961_0302257 | 3300044693 | Bacteria | 977 |
| 432 | Ga0466961_0339107 | 3300044693 | Bacteria | 915 |
| 433 | Ga0466964_0299131 | 3300044706 | Bacteria | 811 |
| 434 | Ga0466971_0026655 | 3300044719 | Bacteria | 2584 |
| 435 | Ga0466971_0055105 | 3300044719 | Bacteria | 1792 |
| 436 | Ga0466968_0023017 | 3300044735 | Bacteria | 2536 |
| 437 | Ga0466968_0503310 | 3300044735 | Bacteria | 604 |
| 438 | Ga0466970_0011041 | 3300044765 | Bacteria | 4598 |
| 439 | Ga0466970_0052295 | 3300044765 | Bacteria | 2180 |
| 440 | Ga0466970_0079419 | 3300044765 | Bacteria | 1771 |
| 441 | Ga0466970_0081797 | 3300044765 | Bacteria | 1746 |
| 442 | Ga0466970_0120196 | 3300044765 | Bacteria | 1438 |
| 443 | Ga0466970_0289161 | 3300044765 | Bacteria | 923 |
| 444 | Ga0466970_0470447 | 3300044765 | Bacteria | 722 |
| 445 | Ga0466957_0056094 | 3300044842 | Bacteria | 2408 |
| 446 | Ga0466957_0108420 | 3300044842 | Bacteria | 1759 |
| 447 | Ga0466957_0515504 | 3300044842 | Bacteria | 830 |
| 448 | Ga0466960_0020915 | 3300044901 | Bacteria | 2906 |
| 449 | Ga0466960_0030828 | 3300044901 | Bacteria | 2470 |
| 450 | Ga0466960_0032143 | 3300044901 | Bacteria | 2427 |
| 451 | Ga0466960_0134629 | 3300044901 | Bacteria | 1308 |
| 452 | Ga0466960_0794800 | 3300044901 | Bacteria | 572 |
| 453 | Ga0466959_0050215 | 3300045049 | Bacteria | 3062 |
| 454 | Ga0466959_0059052 | 3300045049 | Bacteria | 2793 |
| 455 | Ga0466959_0376557 | 3300045049 | Bacteria | 966 |
| 456 | Ga0466959_0455199 | 3300045049 | Bacteria | 867 |
| 457 | Ga0466958_0021235 | 3300045836 | Bacteria | 3792 |
| 458 | Ga0466958_0077002 | 3300045836 | Bacteria | 2048 |
| 459 | Ga0466958_0279983 | 3300045836 | Bacteria | 1069 |
| 460 | Ga0466958_0699823 | 3300045836 | Bacteria | 660 |
| 461 | Ga0466967_0307540 | 3300045976 | Bacteria | 1526 |
| 462 | Ga0466967_0698701 | 3300045976 | Bacteria | 1004 |
| 463 | Ga0466967_0787257 | 3300045976 | Bacteria | 944 |
| 464 | Ga0495590_0000612 | 3300046457 | Bacteria | 16650 |
| 465 | Ga0495638_0202553 | 3300046460 | Bacteria | 1119 |
| 466 | Ga0495650_0005523 | 3300046471 | Bacteria | 8173 |
| 467 | Ga0495650_0097309 | 3300046471 | Bacteria | 1110 |
| 468 | Ga0495650_0308833 | 3300046471 | Bacteria | 528 |
| 469 | Ga0495620_0362472 | 3300046515 | Bacteria | 549 |
| 470 | Ga0495628_0280445 | 3300046516 | Bacteria | 1238 |
| 471 | Ga0495609_0353690 | 3300046538 | Bacteria | 592 |
| 472 | Ga0495645_0066284 | 3300046543 | Bacteria | 2610 |
| 473 | Ga0495656_0005765 | 3300046615 | Bacteria | 4300 |
| 474 | Ga0495656_0044965 | 3300046615 | Bacteria | 1862 |
| 475 | Ga0495625_0262604 | 3300046660 | Bacteria | 1117 |
| 476 | Ga0495670_0427055 | 3300046691 | Bacteria | 717 |
| 477 | Ga0495649_0305702 | 3300046694 | Bacteria | 809 |
| 478 | Ga0495589_0104089 | 3300046794 | Bacteria | 1372 |
| 479 | Ga0495672_0038657 | 3300047320 | Bacteria | 2909 |
| 480 | Ga0495615_0108346 | 3300048090 | Bacteria | 792 |
| 481 | Ga0496100_0026172 | 3300048903 | Bacteria | 3574 |
| 482 | Ga0496100_0096739 | 3300048903 | Bacteria | 2026 |
| 483 | Ga0496101_0018547 | 3300048904 | Bacteria | 4733 |
| 484 | Ga0496101_0107724 | 3300048904 | Bacteria | 2094 |
| 485 | Ga0496102_0088257 | 3300048905 | Bacteria | 2866 |
| 486 | Ga0496102_0392047 | 3300048905 | Bacteria | 1306 |
| 487 | Ga0496104_0032709 | 3300048907 | Bacteria | 4841 |
| 488 | Ga0496104_0292885 | 3300048907 | Bacteria | 1540 |
| 489 | Ga0496105_0011758 | 3300048908 | Bacteria | 6926 |
| 490 | Ga0496105_0108308 | 3300048908 | Bacteria | 2294 |
| 491 | Ga0496105_0160742 | 3300048908 | Bacteria | 1844 |
| 492 | Ga0496105_0246297 | 3300048908 | Bacteria | 1449 |
| 493 | Ga0496107_0114841 | 3300048910 | Bacteria | 1981 |
| 494 | Ga0496107_0756380 | 3300048910 | Bacteria | 713 |
| 495 | Ga0496113_0082756 | 3300048916 | Bacteria | 2462 |
| 496 | Ga0496113_0153110 | 3300048916 | Bacteria | 1820 |
| 497 | Ga0496114_0054500 | 3300048917 | Bacteria | 3334 |
| 498 | Ga0496114_0055755 | 3300048917 | Bacteria | 3296 |
| 499 | Ga0496114_0058054 | 3300048917 | Bacteria | 3231 |
| 500 | Ga0496115_0007443 | 3300048918 | Bacteria | 8056 |
| 501 | Ga0496115_0049048 | 3300048918 | Bacteria | 3378 |
| 502 | Ga0496115_0429380 | 3300048918 | Bacteria | 1069 |
| 503 | Ga0496116_0003139 | 3300048919 | Bacteria | 16570 |
| 504 | Ga0496117_0000232 | 3300048920 | Bacteria | 105479 |
| 505 | Ga0496117_0000737 | 3300048920 | Bacteria | 51396 |
| 506 | Ga0496117_0004850 | 3300048920 | Bacteria | 14534 |
| 507 | Ga0496117_0005578 | 3300048920 | Bacteria | 13171 |
| 508 | Ga0496117_0014558 | 3300048920 | Bacteria | 6768 |
| 509 | Ga0496117_0054113 | 3300048920 | Bacteria | 2814 |
| 510 | Ga0496117_0059591 | 3300048920 | Bacteria | 2635 |
| 511 | Ga0496117_0067492 | 3300048920 | Bacteria | 2420 |
| 512 | Ga0496117_0108514 | 3300048920 | Bacteria | 1736 |
| 513 | Ga0496117_0116493 | 3300048920 | Bacteria | 1651 |
| 514 | Ga0496117_0217421 | 3300048920 | Bacteria | 1066 |
| 515 | Ga0496118_0003838 | 3300048921 | Bacteria | 18487 |
| 516 | Ga0496118_0008605 | 3300048921 | Bacteria | 10505 |
| 517 | Ga0496118_0105465 | 3300048921 | Bacteria | 1889 |
| 518 | Ga0496118_0139720 | 3300048921 | Bacteria | 1538 |
| 519 | Ga0496118_0182578 | 3300048921 | Bacteria | 1266 |
| 520 | Ga0496118_0375170 | 3300048921 | Bacteria | 748 |
| 521 | Ga0496118_0521608 | 3300048921 | Bacteria | 586 |
| 522 | Ga0496119_0001875 | 3300048922 | Bacteria | 24260 |
| 523 | Ga0496119_0002098 | 3300048922 | Bacteria | 22484 |
| 524 | Ga0496119_0009311 | 3300048922 | Bacteria | 8449 |
| 525 | Ga0496119_0017986 | 3300048922 | Bacteria | 5286 |
| 526 | Ga0496119_0323337 | 3300048922 | Bacteria | 754 |
| 527 | Ga0496119_0398745 | 3300048922 | Bacteria | 657 |
| 528 | Ga0496120_0000456 | 3300048923 | Bacteria | 64535 |
| 529 | Ga0496120_0001183 | 3300048923 | Bacteria | 33176 |
| 530 | Ga0496120_0001794 | 3300048923 | Bacteria | 24093 |
| 531 | Ga0496120_0001809 | 3300048923 | Bacteria | 23936 |
| 532 | Ga0496120_0008433 | 3300048923 | Bacteria | 7482 |
| 533 | Ga0496120_0016059 | 3300048923 | Bacteria | 4908 |
| 534 | Ga0496120_0022428 | 3300048923 | Bacteria | 3972 |
| 535 | Ga0496120_0072145 | 3300048923 | Bacteria | 1893 |
| 536 | Ga0496121_0075900 | 3300048924 | Bacteria | 2683 |
| 537 | Ga0496121_0313982 | 3300048924 | Bacteria | 1058 |
| 538 | Ga0496122_0000030 | 3300048925 | Bacteria | 331586 |
| 539 | Ga0496122_0000120 | 3300048925 | Bacteria | 182539 |
| 540 | Ga0496122_0009370 | 3300048925 | Bacteria | 10337 |
| 541 | Ga0496122_0014164 | 3300048925 | Bacteria | 7733 |
| 542 | Ga0496122_0194503 | 3300048925 | Bacteria | 1193 |
| 543 | Ga0496122_0249394 | 3300048925 | Bacteria | 994 |
| 544 | Ga0496122_0373829 | 3300048925 | Bacteria | 734 |
| 545 | Ga0496123_0000024 | 3300048926 | Bacteria | 331587 |
| 546 | Ga0496123_0000051 | 3300048926 | Bacteria | 237095 |
| 547 | Ga0496123_0001799 | 3300048926 | Bacteria | 28218 |
| 548 | Ga0496123_0045565 | 3300048926 | Bacteria | 2986 |
| 549 | Ga0496124_0005016 | 3300048927 | Bacteria | 15139 |
| 550 | Ga0496124_0008086 | 3300048927 | Bacteria | 11056 |
| 551 | Ga0496124_0070691 | 3300048927 | Bacteria | 2894 |
| 552 | Ga0496124_0124392 | 3300048927 | Bacteria | 2056 |
| 553 | Ga0496124_0322356 | 3300048927 | Bacteria | 1105 |
| 554 | Ga0496124_0692362 | 3300048927 | Bacteria | 647 |
| 555 | Ga0496125_0001405 | 3300048928 | Bacteria | 35141 |
| 556 | Ga0496125_0016870 | 3300048928 | Bacteria | 6992 |
| 557 | Ga0496125_0017389 | 3300048928 | Bacteria | 6858 |
| 558 | Ga0496125_0071871 | 3300048928 | Bacteria | 2700 |
| 559 | Ga0496125_0177610 | 3300048928 | Bacteria | 1423 |
| 560 | Ga0496126_0001194 | 3300048929 | Bacteria | 42334 |
| 561 | Ga0496126_0005417 | 3300048929 | Bacteria | 14558 |
| 562 | Ga0496126_0019688 | 3300048929 | Bacteria | 6641 |
| 563 | Ga0496126_0029608 | 3300048929 | Bacteria | 5200 |
| 564 | Ga0496126_0030513 | 3300048929 | Bacteria | 5105 |
| 565 | Ga0496126_0054593 | 3300048929 | Bacteria | 3617 |
| 566 | Ga0496126_0117274 | 3300048929 | Bacteria | 2313 |
| 567 | Ga0496126_0149987 | 3300048929 | Bacteria | 1999 |
| 568 | Ga0496126_0459928 | 3300048929 | Bacteria | 1023 |
| 569 | Ga0496126_0633464 | 3300048929 | Bacteria | 839 |
| 570 | Ga0501306_035622 | 3300049127 | Bacteria | 756 |
| 571 | Ga0501306_042829 | 3300049127 | Bacteria | 706 |
| 572 | Ga0501309_026745 | 3300049129 | Bacteria | 834 |
| 573 | Ga0501305_010456 | 3300049161 | Bacteria | 1239 |
| 574 | Ga0501311_088638 | 3300049527 | Bacteria | 535 |
| 575 | Ga0501312_076950 | 3300049528 | Bacteria | 599 |
| 576 | Ga0501313_059873 | 3300049529 | Bacteria | 538 |
| 577 | Ga0501315_056205 | 3300049531 | Bacteria | 628 |
| 578 | Ga0501315_095497 | 3300049531 | Bacteria | 520 |
| 579 | Ga0501317_004714 | 3300049533 | Bacteria | 1431 |
| 580 | Ga0501318_009202 | 3300049534 | Bacteria | 1072 |
| 581 | Ga0501321_011313 | 3300049537 | Bacteria | 993 |
| 582 | Ga0501323_061423 | 3300049539 | Bacteria | 587 |
| 583 | Ga0501031_0202098 | 3300049568 | Bacteria | 1296 |
| 584 | Ga0501031_0211242 | 3300049568 | Bacteria | 1264 |
| 585 | Ga0501031_0271693 | 3300049568 | Bacteria | 1100 |
| 586 | Ga0501032_0009953 | 3300049569 | Bacteria | 6865 |
| 587 | Ga0501032_0013515 | 3300049569 | Bacteria | 5804 |
| 588 | Ga0501032_0072404 | 3300049569 | Bacteria | 2297 |
| 589 | Ga0501032_0088939 | 3300049569 | Bacteria | 2050 |
| 590 | Ga0501032_0427289 | 3300049569 | Bacteria | 850 |
| 591 | Ga0501032_0823759 | 3300049569 | Bacteria | 586 |
| 592 | Ga0501033_0009978 | 3300049570 | Bacteria | 7292 |
| 593 | Ga0501033_0010126 | 3300049570 | Bacteria | 7236 |
| 594 | Ga0501033_0037603 | 3300049570 | Bacteria | 3622 |
| 595 | Ga0501033_0048914 | 3300049570 | Bacteria | 3140 |
| 596 | Ga0501033_0086936 | 3300049570 | Bacteria | 2288 |
| 597 | Ga0501033_0093765 | 3300049570 | Bacteria | 2195 |
| 598 | Ga0501033_0831184 | 3300049570 | Bacteria | 623 |
| 599 | Ga0501034_0000227 | 3300049571 | Bacteria | 106244 |
| 600 | Ga0501034_0005786 | 3300049571 | Bacteria | 13445 |
| 601 | Ga0501034_0009960 | 3300049571 | Bacteria | 9934 |
| 602 | Ga0501034_0015321 | 3300049571 | Bacteria | 7880 |
| 603 | Ga0501034_0016806 | 3300049571 | Bacteria | 7502 |
| 604 | Ga0501034_0019532 | 3300049571 | Bacteria | 6930 |
| 605 | Ga0501034_0039777 | 3300049571 | Bacteria | 4762 |
| 606 | Ga0501034_0063939 | 3300049571 | Bacteria | 3693 |
| 607 | Ga0501034_0067958 | 3300049571 | Bacteria | 3575 |
| 608 | Ga0501034_0085814 | 3300049571 | Bacteria | 3149 |
| 609 | Ga0501034_0171817 | 3300049571 | Bacteria | 2134 |
| 610 | Ga0501034_0172624 | 3300049571 | Bacteria | 2128 |
| 611 | Ga0501034_0194756 | 3300049571 | Bacteria | 1987 |
| 612 | Ga0501034_0241599 | 3300049571 | Bacteria | 1752 |
| 613 | Ga0501034_0686191 | 3300049571 | Bacteria | 923 |
| 614 | Ga0501034_0708609 | 3300049571 | Bacteria | 904 |
| 615 | Ga0501034_0875444 | 3300049571 | Bacteria | 787 |
| 616 | Ga0501036_0015582 | 3300049572 | Bacteria | 6349 |
| 617 | Ga0501036_0098223 | 3300049572 | Bacteria | 2475 |
| 618 | Ga0501036_0100885 | 3300049572 | Bacteria | 2441 |
| 619 | Ga0501036_0129312 | 3300049572 | Bacteria | 2132 |
| 620 | Ga0501037_0000671 | 3300049573 | Bacteria | 26204 |
| 621 | Ga0501037_0027690 | 3300049573 | Bacteria | 4188 |
| 622 | Ga0501037_0029509 | 3300049573 | Bacteria | 4052 |
| 623 | Ga0501037_0032155 | 3300049573 | Bacteria | 3873 |
| 624 | Ga0501037_0094752 | 3300049573 | Bacteria | 2158 |
| 625 | Ga0501037_0094895 | 3300049573 | Bacteria | 2156 |
| 626 | Ga0501037_0103443 | 3300049573 | Bacteria | 2054 |
| 627 | Ga0501037_0115191 | 3300049573 | Bacteria | 1935 |
| 628 | Ga0501037_0181934 | 3300049573 | Bacteria | 1491 |
| 629 | Ga0501037_0250708 | 3300049573 | Bacteria | 1239 |
| 630 | Ga0501038_0000454 | 3300049574 | Bacteria | 35793 |
| 631 | Ga0501038_0039749 | 3300049574 | Bacteria | 4114 |
| 632 | Ga0501038_0041553 | 3300049574 | Bacteria | 4009 |
| 633 | Ga0501038_0068332 | 3300049574 | Bacteria | 3020 |
| 634 | Ga0501038_0070034 | 3300049574 | Bacteria | 2978 |
| 635 | Ga0501038_0164977 | 3300049574 | Bacteria | 1797 |
| 636 | Ga0501038_0225008 | 3300049574 | Bacteria | 1495 |
| 637 | Ga0501038_0943342 | 3300049574 | Bacteria | 635 |
| 638 | Ga0501039_0016493 | 3300049575 | Bacteria | 5658 |
| 639 | Ga0501039_0065536 | 3300049575 | Bacteria | 2818 |
| 640 | Ga0501039_0067506 | 3300049575 | Bacteria | 2777 |
| 641 | Ga0501039_0145653 | 3300049575 | Bacteria | 1861 |
| 642 | Ga0501039_0371323 | 3300049575 | Bacteria | 1124 |
| 643 | Ga0501040_0003391 | 3300049576 | Bacteria | 10280 |
| 644 | Ga0501041_0120590 | 3300049577 | Bacteria | 1629 |
| 645 | Ga0501041_0842386 | 3300049577 | Bacteria | 588 |
| 646 | Ga0501042_0061222 | 3300049578 | Bacteria | 2689 |
| 647 | Ga0501042_0098051 | 3300049578 | Bacteria | 2107 |
| 648 | Ga0501042_0175344 | 3300049578 | Bacteria | 1547 |
| 649 | Ga0501042_0366605 | 3300049578 | Bacteria | 1042 |
| 650 | Ga0501042_0861660 | 3300049578 | Bacteria | 659 |
| 651 | Ga0501043_0002454 | 3300049579 | Bacteria | 15682 |
| 652 | Ga0501043_0008078 | 3300049579 | Bacteria | 8305 |
| 653 | Ga0501043_0018745 | 3300049579 | Bacteria | 5429 |
| 654 | Ga0501043_0024603 | 3300049579 | Bacteria | 4725 |
| 655 | Ga0501043_0089797 | 3300049579 | Bacteria | 2415 |
| 656 | Ga0501043_0102976 | 3300049579 | Bacteria | 2243 |
| 657 | Ga0501043_0111259 | 3300049579 | Bacteria | 2150 |
| 658 | Ga0501043_0112389 | 3300049579 | Bacteria | 2139 |
| 659 | Ga0501043_0328544 | 3300049579 | Bacteria | 1165 |
| 660 | Ga0501043_0535903 | 3300049579 | Bacteria | 871 |
| 661 | Ga0501046_0002630 | 3300049580 | Bacteria | 16774 |
| 662 | Ga0501046_0007016 | 3300049580 | Bacteria | 9925 |
| 663 | Ga0501046_0014629 | 3300049580 | Bacteria | 6610 |
| 664 | Ga0501046_0018002 | 3300049580 | Bacteria | 5888 |
| 665 | Ga0501046_0070479 | 3300049580 | Bacteria | 2718 |
| 666 | Ga0501046_0106879 | 3300049580 | Bacteria | 2141 |
| 667 | Ga0501046_0283590 | 3300049580 | Bacteria | 1213 |
| 668 | Ga0501047_0000983 | 3300049581 | Bacteria | 28745 |
| 669 | Ga0501047_0002218 | 3300049581 | Bacteria | 18603 |
| 670 | Ga0501047_0031241 | 3300049581 | Bacteria | 5136 |
| 671 | Ga0501047_0032946 | 3300049581 | Bacteria | 5003 |
| 672 | Ga0501047_0035220 | 3300049581 | Bacteria | 4835 |
| 673 | Ga0501047_0046979 | 3300049581 | Bacteria | 4171 |
| 674 | Ga0501047_0101716 | 3300049581 | Bacteria | 2753 |
| 675 | Ga0501047_0192489 | 3300049581 | Bacteria | 1902 |
| 676 | Ga0501047_0202951 | 3300049581 | Bacteria | 1843 |
| 677 | Ga0501048_0043285 | 3300049582 | Bacteria | 3224 |
| 678 | Ga0501048_0065475 | 3300049582 | Bacteria | 2569 |
| 679 | Ga0501048_0112980 | 3300049582 | Bacteria | 1918 |
| 680 | Ga0501048_0223670 | 3300049582 | Bacteria | 1335 |
| 681 | Ga0501048_0705657 | 3300049582 | Bacteria | 724 |
| 682 | Ga0501067_0253134 | 3300049583 | Bacteria | 980 |
| 683 | Ga0501067_0377762 | 3300049583 | Bacteria | 790 |
| 684 | Ga0501068_0774473 | 3300049584 | Bacteria | 629 |
| 685 | Ga0501069_0160844 | 3300049585 | Bacteria | 1293 |
| 686 | Ga0501069_0271572 | 3300049585 | Bacteria | 991 |
| 687 | Ga0501069_0524351 | 3300049585 | Bacteria | 708 |
| 688 | Ga0501070_0000167 | 3300049586 | Bacteria | 60680 |
| 689 | Ga0501070_0003401 | 3300049586 | Bacteria | 13809 |
| 690 | Ga0501070_0024474 | 3300049586 | Bacteria | 5064 |
| 691 | Ga0501070_0071839 | 3300049586 | Bacteria | 2865 |
| 692 | Ga0501070_0084094 | 3300049586 | Bacteria | 2635 |
| 693 | Ga0501070_0237250 | 3300049586 | Bacteria | 1493 |
| 694 | Ga0501070_0541137 | 3300049586 | Bacteria | 933 |
| 695 | Ga0501071_0087215 | 3300049587 | Bacteria | 2289 |
| 696 | Ga0501071_0378714 | 3300049587 | Bacteria | 1079 |
| 697 | Ga0501072_0071815 | 3300049588 | Bacteria | 2735 |
| 698 | Ga0501072_0139399 | 3300049588 | Bacteria | 1933 |
| 699 | Ga0501072_0734019 | 3300049588 | Bacteria | 775 |
| 700 | Ga0501073_0017669 | 3300049589 | Bacteria | 5163 |
| 701 | Ga0501073_0054013 | 3300049589 | Bacteria | 2813 |
| 702 | Ga0501073_0077343 | 3300049589 | Bacteria | 2315 |
| 703 | Ga0501073_0142168 | 3300049589 | Bacteria | 1663 |
| 704 | Ga0501073_0371190 | 3300049589 | Bacteria | 988 |
| 705 | Ga0501073_0918916 | 3300049589 | Bacteria | 602 |
| 706 | Ga0501074_0049308 | 3300049590 | Bacteria | 3040 |
| 707 | Ga0501074_0424789 | 3300049590 | Bacteria | 943 |
| 708 | Ga0501075_0004611 | 3300049591 | Bacteria | 9352 |
| 709 | Ga0501076_0069929 | 3300049592 | Bacteria | 2805 |
| 710 | Ga0501076_1113179 | 3300049592 | Bacteria | 650 |
| 711 | Ga0501077_0420505 | 3300049593 | Bacteria | 855 |
| 712 | Ga0501077_0963720 | 3300049593 | Bacteria | 549 |
| 713 | Ga0501079_0018295 | 3300049741 | Bacteria | 5354 |
| 714 | Ga0501080_0000084 | 3300049742 | Bacteria | 62784 |
| 715 | Ga0501080_0018161 | 3300049742 | Bacteria | 6510 |
| 716 | Ga0501080_0020642 | 3300049742 | Bacteria | 6102 |
| 717 | Ga0501080_0217030 | 3300049742 | Bacteria | 1751 |
| 718 | Ga0501080_0724153 | 3300049742 | Bacteria | 876 |
| 719 | Ga0501080_0994626 | 3300049742 | Bacteria | 728 |
| 720 | Ga0501081_0021306 | 3300049743 | Bacteria | 4324 |
| 721 | Ga0501083_0128965 | 3300049744 | Bacteria | 1658 |
| 722 | Ga0501035_0009087 | 3300049822 | Bacteria | 9241 |
| 723 | Ga0501035_0013503 | 3300049822 | Bacteria | 7538 |
| 724 | Ga0501035_0015949 | 3300049822 | Bacteria | 6933 |
| 725 | Ga0501035_0020737 | 3300049822 | Bacteria | 6039 |
| 726 | Ga0501035_0021800 | 3300049822 | Bacteria | 5887 |
| 727 | Ga0501035_0047185 | 3300049822 | Bacteria | 3868 |
| 728 | Ga0501035_0059173 | 3300049822 | Bacteria | 3412 |
| 729 | Ga0501035_0323430 | 3300049822 | Bacteria | 1295 |
| 730 | Ga0501035_0339508 | 3300049822 | Bacteria | 1259 |
| 731 | Ga0501035_0373953 | 3300049822 | Bacteria | 1189 |
| 732 | Ga0501035_0973007 | 3300049822 | Bacteria | 669 |
| 733 | Ga0501044_0001597 | 3300049823 | Bacteria | 26511 |
| 734 | Ga0501044_0004023 | 3300049823 | Bacteria | 16480 |
| 735 | Ga0501044_0040026 | 3300049823 | Bacteria | 4887 |
| 736 | Ga0501044_0046775 | 3300049823 | Bacteria | 4478 |
| 737 | Ga0501044_0117710 | 3300049823 | Bacteria | 2660 |
| 738 | Ga0501044_0136446 | 3300049823 | Bacteria | 2444 |
| 739 | Ga0501044_0255349 | 3300049823 | Bacteria | 1692 |
| 740 | Ga0501044_0544812 | 3300049823 | Bacteria | 1058 |
| 741 | Ga0501045_0005904 | 3300049824 | Bacteria | 8470 |
| 742 | Ga0501045_0142488 | 3300049824 | Bacteria | 1782 |
| 743 | Ga0501045_0153212 | 3300049824 | Bacteria | 1715 |
| 744 | nmdc:mga03n38_222350_c1 | 3300050490 | Bacteria | 986 |
| 745 | nmdc:mga00v17_126263_c1 | 3300050491 | Bacteria | 1632 |
| 746 | nmdc:mga00v17_171980_c1 | 3300050491 | Bacteria | 1397 |
| 747 | nmdc:mga00v17_207696_c1 | 3300050491 | Bacteria | 1267 |
| 748 | nmdc:mga00v17_324262_c1 | 3300050491 | Bacteria | 1001 |
| 749 | nmdc:mga00v17_372048_c1 | 3300050491 | Bacteria | 929 |
| 750 | nmdc:mga00v17_5626_c1 | 3300050491 | Bacteria | 6608 |
| 751 | nmdc:mga00v17_63564_c1 | 3300050491 | Bacteria | 2273 |
| 752 | nmdc:mga00v17_85051_c1 | 3300050491 | Bacteria | 1980 |
| 753 | nmdc:mga00v17_99382_c1 | 3300050491 | Bacteria | 1835 |
| 754 | nmdc:mga0yw44_522916_c1 | 3300050492 | Bacteria | 805 |
| 755 | nmdc:mga0yw44_7012_c1 | 3300050492 | Bacteria | 5510 |
| 756 | nmdc:mga0yw44_714536_c1 | 3300050492 | Bacteria | 681 |
| 757 | nmdc:mga0yw44_96810_c1 | 3300050492 | Bacteria | 1874 |
| 758 | nmdc:mga06z11_292094_c1 | 3300050494 | Bacteria | 967 |
| 759 | nmdc:mga07m45_43733_c1 | 3300050496 | Bacteria | 2511 |
| 760 | nmdc:mga0qj67_969409_c1 | 3300050509 | Bacteria | 668 |
| 761 | nmdc:mga08y16_1984630_c1 | 3300050511 | Bacteria | 531 |
| 762 | nmdc:mga08y16_571618_c1 | 3300050511 | Bacteria | 1142 |
| 763 | nmdc:mga0sz30_24672_c2 | 3300050516 | Bacteria | 1419 |
| 764 | nmdc:mga0sz30_55559_c1 | 3300050516 | Bacteria | 1685 |
| 765 | nmdc:mga0sz30_5766_c1 | 3300050516 | Bacteria | 4560 |
| 766 | Ga0500635_0000028 | 3300053080 | Bacteria | 104398 |
| 767 | Ga0500635_0255746 | 3300053080 | Bacteria | 687 |
| 768 | Ga0500651_0053181 | 3300053093 | Bacteria | 2539 |
| 769 | Ga0500556_0000393 | 3300053104 | Bacteria | 32091 |
| 770 | Ga0500562_000296 | 3300053108 | Bacteria | 12147 |
| 771 | Ga0500593_000123 | 3300053117 | Bacteria | 30512 |
| 772 | Ga0500628_162534 | 3300053129 | Bacteria | 630 |
| 773 | Ga0500559_0000218 | 3300053136 | Bacteria | 46051 |
| 774 | Ga0500559_0002382 | 3300053136 | Bacteria | 9789 |
| 775 | Ga0500559_0003021 | 3300053136 | Bacteria | 8417 |
| 776 | Ga0500559_0217272 | 3300053136 | Bacteria | 902 |
| 777 | Ga0500568_0000014 | 3300053139 | Bacteria | 223550 |
| 778 | Ga0500568_0004356 | 3300053139 | Bacteria | 7575 |
| 779 | Ga0500568_0015664 | 3300053139 | Bacteria | 3390 |
| 780 | Ga0500568_0018256 | 3300053139 | Bacteria | 3074 |
| 781 | Ga0500588_0336003 | 3300053146 | Bacteria | 573 |
| 782 | Ga0500590_164472 | 3300053148 | Bacteria | 984 |
| 783 | Ga0500616_0000088 | 3300053153 | Bacteria | 191662 |
| 784 | Ga0500616_0001402 | 3300053153 | Bacteria | 23217 |
| 785 | Ga0500616_0003545 | 3300053153 | Bacteria | 11827 |
| 786 | Ga0500616_0037251 | 3300053153 | Bacteria | 2634 |
| 787 | Ga0500620_122830 | 3300053155 | Bacteria | 910 |
| 788 | Ga0501084_0068090 | 3300054114 | Bacteria | 2981 |
| 789 | Ga0501084_0092926 | 3300054114 | Bacteria | 2532 |
| 790 | Ga0501084_0550353 | 3300054114 | Bacteria | 975 |
| 791 | Ga0501084_0705777 | 3300054114 | Bacteria | 851 |
| 792 | Ga0587084_000197 | 3300059477 | Bacteria | 3932 |
| 793 | Ga0587084_116430 | 3300059477 | Bacteria | 558 |
| 794 | Ga0587084_149055 | 3300059477 | Bacteria | 513 |
| 795 | Ga0587070_110923 | 3300059491 | Bacteria | 644 |
| 796 | Ga0587073_0284394 | 3300059492 | Bacteria | 532 |
| 797 | Ga0587077_266122 | 3300059493 | Bacteria | 501 |
| 798 | Ga0587083_0280918 | 3300059505 | Bacteria | 507 |
| 799 | Ga0587085_173807 | 3300059506 | Bacteria | 512 |
| 800 | Ga0587088_001021 | 3300059508 | Bacteria | 2731 |
| 801 | Ga0587091_174772 | 3300059511 | Bacteria | 561 |
| 802 | Ga0587091_207869 | 3300059511 | Bacteria | 529 |
| 803 | Ga0587094_000283 | 3300059513 | Bacteria | 3560 |
| 804 | Ga0587094_108599 | 3300059513 | Bacteria | 544 |
| 805 | Ga0587098_000238 | 3300059604 | Bacteria | 2927 |
| 806 | Ga0587106_000795 | 3300059605 | Bacteria | 2479 |
| 807 | Ga0587106_133668 | 3300059605 | Bacteria | 538 |
| 808 | Ga0587099_053653 | 3300059622 | Bacteria | 543 |
| 809 | Ga0587101_000138 | 3300059623 | Bacteria | 3849 |
| 810 | Ga0587127_027212 | 3300059629 | Bacteria | 534 |
| 811 | Ga0587128_001590 | 3300059630 | Bacteria | 2182 |
| 812 | Ga0587128_110085 | 3300059630 | Bacteria | 588 |
| 813 | Ga0587128_139134 | 3300059630 | Bacteria | 544 |
| 814 | Ga0587128_149068 | 3300059630 | Bacteria | 531 |
| 815 | Ga0587130_040113 | 3300059631 | Bacteria | 563 |
| 816 | Ga0587069_001336 | 3300059642 | Bacteria | 2231 |
| 817 | Ga0587075_087434 | 3300059644 | Bacteria | 604 |
| 818 | Ga0587076_084677 | 3300059645 | Bacteria | 683 |
| 819 | Ga0587076_206946 | 3300059645 | Bacteria | 507 |
| 820 | Ga0587102_026774 | 3300059649 | Bacteria | 684 |
| 821 | Ga0587071_173172 | 3300060344 | Bacteria | 550 |
| 822 | Ga0501082_0011166 | 3300060353 | Bacteria | 7721 |
| 823 | Ga0501082_0159734 | 3300060353 | Bacteria | 1958 |
| 824 | Ga0501082_0219676 | 3300060353 | Bacteria | 1653 |
| 825 | Ga0466962_0036505 | 3300061719 | Bacteria | 2352 |
| 826 | Ga0466962_0071396 | 3300061719 | Bacteria | 1659 |
| 827 | Ga0466962_0187704 | 3300061719 | Bacteria | 1008 |
| 828 | Ga0466962_0724769 | 3300061719 | Bacteria | 511 |
| 829 | Ga0530510_0003798 | 3300061734 | Bacteria | 10401 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048916 | Ga0496113_0153110 | Ga0496113_0153110_324_650 | 105 |
| 2 | 3300006844 | Ga0075428_101876510 | Ga0075428_1018765102 | 106 |
| 3 | 3300026116 | Ga0207674_10683890 | Ga0207674_106838901 | 107 |
| 4 | iso_pu_bacteria | 2643221635 | 2644199404 | 111 |
| 5 | iso_pu_bacteria | 2811994880 | 2812364921 | 111 |
| 6 | iso_pu_bacteria | 2835188231 | 2835191753 | 111 |
| 7 | iso_pu_bacteria | 2839986021 | 2839987157 | 111 |
| 8 | iso_pu_bacteria | 2844852863 | 2844855359 | 111 |
| 9 | iso_pu_bacteria | 2857710386 | 2857712151 | 111 |
| 10 | iso_pu_bacteria | 8004212874 | 8004214379 | 111 |
| 11 | iso_pu_bacteria | 8056037122 | 8056037716 | 111 |
| 12 | iso_pu_bacteria | 8057345674 | 8057348978 | 111 |
| 13 | 3300005341 | Ga0070691_10431478 | Ga0070691_104314781 | 112 |
| 14 | 3300014326 | Ga0157380_13302440 | Ga0157380_133024401 | 112 |
| 15 | iso_pu_bacteria | 2643221549 | 2643767585 | 112 |
| 16 | iso_pu_bacteria | 2643221619 | 2644110890 | 112 |
| 17 | iso_pu_bacteria | 2721755702 | 2723642151 | 112 |
| 18 | iso_pu_bacteria | 2808606372 | 2808902220 | 112 |
| 19 | iso_pu_bacteria | 2857720070 | 2857720562 | 112 |
| 20 | iso_pu_bacteria | 2862993130 | 2862996441 | 112 |
| 21 | iso_pu_bacteria | 2919443155 | 2919446090 | 112 |
| 22 | iso_pu_bacteria | 2935409751 | 2935411520 | 112 |
| 23 | iso_pu_bacteria | 2939657138 | 2939657773 | 112 |
| 24 | iso_pu_bacteria | 8002811521 | 8002812533 | 112 |
| 25 | iso_pu_bacteria | 8046352972 | 8046356297 | 112 |
| 26 | 3300003203 | JGI25406J46586_10013791 | JGI25406J46586_100137913 | 113 |
| 27 | 3300004801 | Ga0058860_12007059 | Ga0058860_120070591 | 113 |
| 28 | 3300005334 | Ga0068869_100030634 | Ga0068869_1000306343 | 113 |
| 29 | 3300005354 | Ga0070675_100373423 | Ga0070675_1003734232 | 113 |
| 30 | 3300005985 | Ga0081539_10000432 | Ga0081539_1000043238 | 113 |
| 31 | 3300005985 | Ga0081539_10061848 | Ga0081539_100618483 | 113 |
| 32 | 3300013308 | Ga0157375_10089812 | Ga0157375_100898122 | 113 |
| 33 | 3300014326 | Ga0157380_13127510 | Ga0157380_131275101 | 113 |
| 34 | 3300025926 | Ga0207659_10552450 | Ga0207659_105524502 | 113 |
| 35 | 3300025942 | Ga0207689_10023007 | Ga0207689_100230073 | 113 |
| 36 | 3300031731 | Ga0307405_10541090 | Ga0307405_105410901 | 113 |
| 37 | 3300031903 | Ga0307407_10346411 | Ga0307407_103464111 | 113 |
| 38 | 3300031995 | Ga0307409_101120909 | Ga0307409_1011209092 | 113 |
| 39 | 3300032002 | Ga0307416_100020599 | Ga0307416_1000205992 | 113 |
| 40 | 3300032005 | Ga0307411_10443118 | Ga0307411_104431182 | 113 |
| 41 | 3300032126 | Ga0307415_100076204 | Ga0307415_1000762042 | 113 |
| 42 | 3300041441 | Ga0451787_619344 | Ga0451787_619344_87_434 | 113 |
| 43 | 3300049592 | Ga0501076_1113179 | Ga0501076_1113179_153_506 | 113 |
| 44 | 3300059645 | Ga0587076_084677 | Ga0587076_084677_133_495 | 113 |
| 45 | iso_pu_bacteria | 2643221542 | 2643733364 | 113 |
| 46 | iso_pu_bacteria | 2643221553 | 2643786151 | 113 |
| 47 | iso_pu_bacteria | 2643221630 | 2644169938 | 113 |
| 48 | iso_pu_bacteria | 2643221632 | 2644183641 | 113 |
| 49 | iso_pu_bacteria | 2643221724 | 2644680543 | 113 |
| 50 | iso_pu_bacteria | 2728369380 | 2730230002 | 113 |
| 51 | iso_pu_bacteria | 2747842429 | 2747952386 | 113 |
| 52 | iso_pu_bacteria | 2852646457 | 2852648704 | 113 |
| 53 | iso_pu_bacteria | 2852663356 | 2852666925 | 113 |
| 54 | iso_pu_bacteria | 2897561785 | 2897563523 | 113 |
| 55 | iso_pu_bacteria | 2945968032 | 2945968127 | 113 |
| 56 | iso_pu_bacteria | 2946033335 | 2946033463 | 113 |
| 57 | iso_pu_bacteria | 2946041624 | 2946044622 | 113 |
| 58 | iso_pu_bacteria | 8004182704 | 8004184849 | 113 |
| 59 | 3300005544 | Ga0070686_101424364 | Ga0070686_1014243641 | 114 |
| 60 | 3300005563 | Ga0068855_100984625 | Ga0068855_1009846252 | 114 |
| 61 | 3300009553 | Ga0105249_11645121 | Ga0105249_116451211 | 114 |
| 62 | 3300025932 | Ga0207690_11102840 | Ga0207690_111028401 | 114 |
| 63 | 3300026078 | Ga0207702_10181739 | Ga0207702_101817392 | 114 |
| 64 | 3300044684 | Ga0466966_0388569 | Ga0466966_0388569_426_785 | 114 |
| 65 | 3300044693 | Ga0466961_0302203 | Ga0466961_0302203_565_924 | 114 |
| 66 | 3300044901 | Ga0466960_0794800 | Ga0466960_0794800_89_439 | 114 |
| 67 | 3300045836 | Ga0466958_0077002 | Ga0466958_0077002_1440_1799 | 114 |
| 68 | 3300049568 | Ga0501031_0202098 | Ga0501031_0202098_770_1147 | 114 |
| 69 | 3300049569 | Ga0501032_0009953 | Ga0501032_0009953_2636_2986 | 114 |
| 70 | 3300049571 | Ga0501034_0015321 | Ga0501034_0015321_6428_6778 | 114 |
| 71 | 3300049571 | Ga0501034_0067958 | Ga0501034_0067958_2593_2940 | 114 |
| 72 | 3300049571 | Ga0501034_0875444 | Ga0501034_0875444_52_399 | 114 |
| 73 | 3300049572 | Ga0501036_0100885 | Ga0501036_0100885_1828_2205 | 114 |
| 74 | 3300049573 | Ga0501037_0027690 | Ga0501037_0027690_2243_2620 | 114 |
| 75 | 3300049573 | Ga0501037_0103443 | Ga0501037_0103443_1421_1771 | 114 |
| 76 | 3300049574 | Ga0501038_0000454 | Ga0501038_0000454_26848_27198 | 114 |
| 77 | 3300049574 | Ga0501038_0039749 | Ga0501038_0039749_1747_2124 | 114 |
| 78 | 3300049575 | Ga0501039_0145653 | Ga0501039_0145653_528_905 | 114 |
| 79 | 3300049576 | Ga0501040_0003391 | Ga0501040_0003391_102_479 | 114 |
| 80 | 3300049577 | Ga0501041_0842386 | Ga0501041_0842386_61_438 | 114 |
| 81 | 3300049578 | Ga0501042_0061222 | Ga0501042_0061222_1770_2147 | 114 |
| 82 | 3300049579 | Ga0501043_0111259 | Ga0501043_0111259_339_716 | 114 |
| 83 | 3300049579 | Ga0501043_0112389 | Ga0501043_0112389_1195_1545 | 114 |
| 84 | 3300049580 | Ga0501046_0018002 | Ga0501046_0018002_2716_3066 | 114 |
| 85 | 3300049580 | Ga0501046_0070479 | Ga0501046_0070479_1688_2065 | 114 |
| 86 | 3300049581 | Ga0501047_0002218 | Ga0501047_0002218_9059_9409 | 114 |
| 87 | 3300049582 | Ga0501048_0112980 | Ga0501048_0112980_1277_1654 | 114 |
| 88 | 3300049582 | Ga0501048_0223670 | Ga0501048_0223670_738_1088 | 114 |
| 89 | 3300049583 | Ga0501067_0377762 | Ga0501067_0377762_38_388 | 114 |
| 90 | 3300049584 | Ga0501068_0774473 | Ga0501068_0774473_150_527 | 114 |
| 91 | 3300049585 | Ga0501069_0524351 | Ga0501069_0524351_198_548 | 114 |
| 92 | 3300049586 | Ga0501070_0237250 | Ga0501070_0237250_901_1251 | 114 |
| 93 | 3300049587 | Ga0501071_0087215 | Ga0501071_0087215_1562_1939 | 114 |
| 94 | 3300049588 | Ga0501072_0071815 | Ga0501072_0071815_1713_2090 | 114 |
| 95 | 3300049589 | Ga0501073_0142168 | Ga0501073_0142168_40_417 | 114 |
| 96 | 3300049590 | Ga0501074_0424789 | Ga0501074_0424789_244_621 | 114 |
| 97 | 3300049591 | Ga0501075_0004611 | Ga0501075_0004611_8655_9032 | 114 |
| 98 | 3300049592 | Ga0501076_0069929 | Ga0501076_0069929_991_1368 | 114 |
| 99 | 3300049741 | Ga0501079_0018295 | Ga0501079_0018295_3502_3879 | 114 |
| 100 | 3300049742 | Ga0501080_0020642 | Ga0501080_0020642_1500_1877 | 114 |
| 101 | 3300049743 | Ga0501081_0021306 | Ga0501081_0021306_1581_1958 | 114 |
| 102 | 3300049822 | Ga0501035_0021800 | Ga0501035_0021800_4901_5251 | 114 |
| 103 | 3300049822 | Ga0501035_0059173 | Ga0501035_0059173_1794_2171 | 114 |
| 104 | 3300049823 | Ga0501044_0001597 | Ga0501044_0001597_6402_6752 | 114 |
| 105 | 3300049824 | Ga0501045_0142488 | Ga0501045_0142488_23_400 | 114 |
| 106 | 3300053146 | Ga0500588_0336003 | Ga0500588_0336003_180_527 | 114 |
| 107 | 3300054114 | Ga0501084_0092926 | Ga0501084_0092926_957_1334 | 114 |
| 108 | 3300054114 | Ga0501084_0550353 | Ga0501084_0550353_602_952 | 114 |
| 109 | 3300059630 | Ga0587128_139134 | Ga0587128_139134_25_453 | 114 |
| 110 | 3300059645 | Ga0587076_206946 | Ga0587076_206946_91_441 | 114 |
| 111 | 3300060353 | Ga0501082_0159734 | Ga0501082_0159734_997_1347 | 114 |
| 112 | 3300060353 | Ga0501082_0219676 | Ga0501082_0219676_957_1334 | 114 |
| 113 | 3300061719 | Ga0466962_0071396 | Ga0466962_0071396_86_445 | 114 |
| 114 | 3300061734 | Ga0530510_0003798 | Ga0530510_0003798_1953_2330 | 114 |
| 115 | iso_pu_bacteria | 2585428157 | 2588108208 | 114 |
| 116 | iso_pu_bacteria | 2643221546 | 2643753584 | 114 |
| 117 | iso_pu_bacteria | 2643221572 | 2643875350 | 114 |
| 118 | iso_pu_bacteria | 2643221575 | 2643885107 | 114 |
| 119 | iso_pu_bacteria | 2643221616 | 2644097101 | 114 |
| 120 | iso_pu_bacteria | 2643221649 | 2644279567 | 114 |
| 121 | iso_pu_bacteria | 2643221669 | 2644382405 | 114 |
| 122 | iso_pu_bacteria | 2757320536 | 2758227249 | 114 |
| 123 | iso_pu_bacteria | 2773857758 | 2774381651 | 114 |
| 124 | iso_pu_bacteria | 2784132109 | 2784471935 | 114 |
| 125 | iso_pu_bacteria | 2808606306 | 2808631440 | 114 |
| 126 | iso_pu_bacteria | 2811994872 | 2812322835 | 114 |
| 127 | iso_pu_bacteria | 2844841374 | 2844842729 | 114 |
| 128 | iso_pu_bacteria | 2870628048 | 2870630080 | 114 |
| 129 | iso_pu_bacteria | 2884763398 | 2884765707 | 114 |
| 130 | iso_pu_bacteria | 2895660088 | 2895661439 | 114 |
| 131 | iso_pu_bacteria | 2904509784 | 2904512693 | 114 |
| 132 | iso_pu_bacteria | 2906799679 | 2906800212 | 114 |
| 133 | iso_pu_bacteria | 2908678064 | 2908681309 | 114 |
| 134 | iso_pu_bacteria | 2919055335 | 2919058435 | 114 |
| 135 | iso_pu_bacteria | 2919069694 | 2919071473 | 114 |
| 136 | iso_pu_bacteria | 2919395869 | 2919398310 | 114 |
| 137 | iso_pu_bacteria | 2919523602 | 2919524818 | 114 |
| 138 | iso_pu_bacteria | 2928153084 | 2928156271 | 114 |
| 139 | iso_pu_bacteria | 2946080515 | 2946080607 | 114 |
| 140 | iso_pu_bacteria | 2964326757 | 2964326824 | 114 |
| 141 | iso_pu_bacteria | 2966924647 | 2966924729 | 114 |
| 142 | iso_pu_bacteria | 2974294766 | 2974297711 | 114 |
| 143 | iso_pu_bacteria | 2974324384 | 2974326054 | 114 |
| 144 | iso_pu_bacteria | 2977228692 | 2977231017 | 114 |
| 145 | iso_pu_bacteria | 2977236895 | 2977239811 | 114 |
| 146 | iso_pu_bacteria | 2977251589 | 2977253703 | 114 |
| 147 | iso_pu_bacteria | 2977264416 | 2977266253 | 114 |
| 148 | iso_pu_bacteria | 2984542743 | 2984545916 | 114 |
| 149 | iso_pu_bacteria | 2995726249 | 2995728133 | 114 |
| 150 | iso_pu_bacteria | 8016254467 | 8016257882 | 114 |
| 151 | iso_pu_bacteria | 8055034563 | 8055035857 | 114 |
| 152 | 3300005288 | Ga0065714_10003468 | Ga0065714_100034685 | 115 |
| 153 | 3300005288 | Ga0065714_10175973 | Ga0065714_101759731 | 115 |
| 154 | 3300005844 | Ga0068862_100389872 | Ga0068862_1003898722 | 115 |
| 155 | 3300005985 | Ga0081539_10135194 | Ga0081539_101351942 | 115 |
| 156 | 3300006038 | Ga0075365_10509142 | Ga0075365_105091422 | 115 |
| 157 | 3300009094 | Ga0111539_10499896 | Ga0111539_104998962 | 115 |
| 158 | 3300014326 | Ga0157380_10935531 | Ga0157380_109355312 | 115 |
| 159 | 3300017792 | Ga0163161_10801294 | Ga0163161_108012942 | 115 |
| 160 | 3300020082 | Ga0206353_11788619 | Ga0206353_117886191 | 115 |
| 161 | 3300025944 | Ga0207661_10347334 | Ga0207661_103473342 | 115 |
| 162 | 3300028573 | Ga0265334_10001006 | Ga0265334_1000100611 | 115 |
| 163 | 3300028794 | Ga0307515_10203988 | Ga0307515_102039883 | 115 |
| 164 | 3300031456 | Ga0307513_10507126 | Ga0307513_105071262 | 115 |
| 165 | 3300031507 | Ga0307509_10134492 | Ga0307509_101344921 | 115 |
| 166 | 3300031852 | Ga0307410_11092339 | Ga0307410_110923391 | 115 |
| 167 | 3300031901 | Ga0307406_10308533 | Ga0307406_103085331 | 115 |
| 168 | 3300032002 | Ga0307416_103565838 | Ga0307416_1035658381 | 115 |
| 169 | 3300032004 | Ga0307414_10811145 | Ga0307414_108111452 | 115 |
| 170 | 3300041443 | Ga0451789_0062393 | Ga0451789_0062393_552_917 | 115 |
| 171 | 3300041512 | Ga0451853_2924470 | Ga0451853_2924470_211_564 | 115 |
| 172 | 3300046694 | Ga0495649_0305702 | Ga0495649_0305702_383_754 | 115 |
| 173 | 3300048920 | Ga0496117_0000737 | Ga0496117_0000737_5406_5771 | 115 |
| 174 | 3300048920 | Ga0496117_0067492 | Ga0496117_0067492_1791_2159 | 115 |
| 175 | 3300048924 | Ga0496121_0313982 | Ga0496121_0313982_436_804 | 115 |
| 176 | 3300048925 | Ga0496122_0014164 | Ga0496122_0014164_5204_5569 | 115 |
| 177 | 3300048926 | Ga0496123_0045565 | Ga0496123_0045565_1353_1718 | 115 |
| 178 | 3300048927 | Ga0496124_0692362 | Ga0496124_0692362_59_427 | 115 |
| 179 | 3300048928 | Ga0496125_0071871 | Ga0496125_0071871_2124_2495 | 115 |
| 180 | 3300048929 | Ga0496126_0633464 | Ga0496126_0633464_330_680 | 115 |
| 181 | 3300049127 | Ga0501306_042829 | Ga0501306_042829_51_404 | 115 |
| 182 | 3300049129 | Ga0501309_026745 | Ga0501309_026745_174_527 | 115 |
| 183 | 3300049161 | Ga0501305_010456 | Ga0501305_010456_876_1229 | 115 |
| 184 | 3300049528 | Ga0501312_076950 | Ga0501312_076950_52_405 | 115 |
| 185 | 3300049529 | Ga0501313_059873 | Ga0501313_059873_175_528 | 115 |
| 186 | 3300049531 | Ga0501315_056205 | Ga0501315_056205_75_428 | 115 |
| 187 | 3300049533 | Ga0501317_004714 | Ga0501317_004714_50_403 | 115 |
| 188 | 3300049534 | Ga0501318_009202 | Ga0501318_009202_373_726 | 115 |
| 189 | 3300049537 | Ga0501321_011313 | Ga0501321_011313_583_936 | 115 |
| 190 | 3300049539 | Ga0501323_061423 | Ga0501323_061423_61_414 | 115 |
| 191 | 3300049569 | Ga0501032_0072404 | Ga0501032_0072404_1392_1739 | 115 |
| 192 | 3300049569 | Ga0501032_0088939 | Ga0501032_0088939_419_766 | 115 |
| 193 | 3300049569 | Ga0501032_0823759 | Ga0501032_0823759_173_520 | 115 |
| 194 | 3300049570 | Ga0501033_0010126 | Ga0501033_0010126_4699_5046 | 115 |
| 195 | 3300049570 | Ga0501033_0831184 | Ga0501033_0831184_238_585 | 115 |
| 196 | 3300049571 | Ga0501034_0009960 | Ga0501034_0009960_3117_3470 | 115 |
| 197 | 3300049571 | Ga0501034_0686191 | Ga0501034_0686191_333_689 | 115 |
| 198 | 3300049571 | Ga0501034_0708609 | Ga0501034_0708609_470_817 | 115 |
| 199 | 3300049573 | Ga0501037_0029509 | Ga0501037_0029509_247_603 | 115 |
| 200 | 3300049573 | Ga0501037_0032155 | Ga0501037_0032155_2100_2447 | 115 |
| 201 | 3300049573 | Ga0501037_0250708 | Ga0501037_0250708_159_506 | 115 |
| 202 | 3300049574 | Ga0501038_0164977 | Ga0501038_0164977_744_1091 | 115 |
| 203 | 3300049575 | Ga0501039_0065536 | Ga0501039_0065536_197_550 | 115 |
| 204 | 3300049575 | Ga0501039_0371323 | Ga0501039_0371323_188_535 | 115 |
| 205 | 3300049577 | Ga0501041_0120590 | Ga0501041_0120590_1056_1409 | 115 |
| 206 | 3300049578 | Ga0501042_0175344 | Ga0501042_0175344_834_1187 | 115 |
| 207 | 3300049579 | Ga0501043_0002454 | Ga0501043_0002454_8856_9212 | 115 |
| 208 | 3300049579 | Ga0501043_0089797 | Ga0501043_0089797_123_470 | 115 |
| 209 | 3300049579 | Ga0501043_0328544 | Ga0501043_0328544_660_1007 | 115 |
| 210 | 3300049580 | Ga0501046_0283590 | Ga0501046_0283590_579_935 | 115 |
| 211 | 3300049581 | Ga0501047_0000983 | Ga0501047_0000983_909_1265 | 115 |
| 212 | 3300049581 | Ga0501047_0192489 | Ga0501047_0192489_863_1210 | 115 |
| 213 | 3300049581 | Ga0501047_0202951 | Ga0501047_0202951_772_1128 | 115 |
| 214 | 3300049582 | Ga0501048_0705657 | Ga0501048_0705657_294_647 | 115 |
| 215 | 3300049585 | Ga0501069_0160844 | Ga0501069_0160844_68_424 | 115 |
| 216 | 3300049586 | Ga0501070_0003401 | Ga0501070_0003401_660_1016 | 115 |
| 217 | 3300049589 | Ga0501073_0054013 | Ga0501073_0054013_529_885 | 115 |
| 218 | 3300049593 | Ga0501077_0420505 | Ga0501077_0420505_284_640 | 115 |
| 219 | 3300049742 | Ga0501080_0000084 | Ga0501080_0000084_34648_35004 | 115 |
| 220 | 3300049744 | Ga0501083_0128965 | Ga0501083_0128965_555_911 | 115 |
| 221 | 3300049822 | Ga0501035_0009087 | Ga0501035_0009087_4044_4400 | 115 |
| 222 | 3300049822 | Ga0501035_0339508 | Ga0501035_0339508_299_649 | 115 |
| 223 | 3300049823 | Ga0501044_0004023 | Ga0501044_0004023_5598_5954 | 115 |
| 224 | 3300049823 | Ga0501044_0544812 | Ga0501044_0544812_302_649 | 115 |
| 225 | 3300050490 | nmdc:mga03n38_222350_c1 | nmdc:mga03n38_222350_c1_426_797 | 115 |
| 226 | 3300050492 | nmdc:mga0yw44_522916_c1 | nmdc:mga0yw44_522916_c1_362_730 | 115 |
| 227 | 3300050511 | nmdc:mga08y16_1984630_c1 | nmdc:mga08y16_1984630_c1_109_471 | 115 |
| 228 | 3300053139 | Ga0500568_0000014 | Ga0500568_0000014_180140_180487 | 115 |
| 229 | 3300053139 | Ga0500568_0004356 | Ga0500568_0004356_3330_3677 | 115 |
| 230 | 3300053153 | Ga0500616_0000088 | Ga0500616_0000088_102998_103363 | 115 |
| 231 | 3300054114 | Ga0501084_0068090 | Ga0501084_0068090_1757_2113 | 115 |
| 232 | 3300059477 | Ga0587084_149055 | Ga0587084_149055_66_437 | 115 |
| 233 | 3300059644 | Ga0587075_087434 | Ga0587075_087434_106_459 | 115 |
| 234 | 3300060353 | Ga0501082_0011166 | Ga0501082_0011166_4803_5156 | 115 |
| 235 | iso_pu_bacteria | 2848551377 | 2848552295 | 115 |
| 236 | iso_pu_bacteria | 2852677369 | 2852679495 | 115 |
| 237 | iso_pu_bacteria | 2857737099 | 2857737478 | 115 |
| 238 | iso_pu_bacteria | 2939660829 | 2939660954 | 115 |
| 239 | 3300001979 | JGI24740J21852_10083933 | JGI24740J21852_100839332 | 116 |
| 240 | 3300004801 | Ga0058860_10117912 | Ga0058860_101179122 | 116 |
| 241 | 3300005328 | Ga0070676_10170303 | Ga0070676_101703032 | 116 |
| 242 | 3300005333 | Ga0070677_10428159 | Ga0070677_104281591 | 116 |
| 243 | 3300005334 | Ga0068869_100334916 | Ga0068869_1003349161 | 116 |
| 244 | 3300005347 | Ga0070668_100019550 | Ga0070668_1000195502 | 116 |
| 245 | 3300005438 | Ga0070701_11350260 | Ga0070701_113502601 | 116 |
| 246 | 3300005455 | Ga0070663_101109728 | Ga0070663_1011097282 | 116 |
| 247 | 3300005577 | Ga0068857_100494645 | Ga0068857_1004946452 | 116 |
| 248 | 3300005618 | Ga0068864_100118513 | Ga0068864_1001185132 | 116 |
| 249 | 3300005719 | Ga0068861_100166387 | Ga0068861_1001663872 | 116 |
| 250 | 3300005840 | Ga0068870_10134526 | Ga0068870_101345262 | 116 |
| 251 | 3300009094 | Ga0111539_10455066 | Ga0111539_104550662 | 116 |
| 252 | 3300009148 | Ga0105243_11195879 | Ga0105243_111958792 | 116 |
| 253 | 3300011119 | Ga0105246_10046591 | Ga0105246_100465913 | 116 |
| 254 | 3300013105 | Ga0157369_10065475 | Ga0157369_100654754 | 116 |
| 255 | 3300013308 | Ga0157375_10682888 | Ga0157375_106828881 | 116 |
| 256 | 3300014326 | Ga0157380_10068168 | Ga0157380_100681682 | 116 |
| 257 | 3300014745 | Ga0157377_10894545 | Ga0157377_108945451 | 116 |
| 258 | 3300017792 | Ga0163161_10985481 | Ga0163161_109854811 | 116 |
| 259 | 3300025728 | Ga0207655_1083647 | Ga0207655_10836471 | 116 |
| 260 | 3300025893 | Ga0207682_10215817 | Ga0207682_102158172 | 116 |
| 261 | 3300025901 | Ga0207688_10074090 | Ga0207688_100740901 | 116 |
| 262 | 3300025907 | Ga0207645_10128671 | Ga0207645_101286712 | 116 |
| 263 | 3300025908 | Ga0207643_10032675 | Ga0207643_100326752 | 116 |
| 264 | 3300025925 | Ga0207650_10657095 | Ga0207650_106570952 | 116 |
| 265 | 3300025942 | Ga0207689_10327561 | Ga0207689_103275612 | 116 |
| 266 | 3300025972 | Ga0207668_10116597 | Ga0207668_101165972 | 116 |
| 267 | 3300026067 | Ga0207678_11092098 | Ga0207678_110920982 | 116 |
| 268 | 3300026118 | Ga0207675_100118687 | Ga0207675_1001186873 | 116 |
| 269 | 3300028379 | Ga0268266_11686848 | Ga0268266_116868481 | 116 |
| 270 | 3300028380 | Ga0268265_11595556 | Ga0268265_115955561 | 116 |
| 271 | 3300031548 | Ga0307408_100262656 | Ga0307408_1002626561 | 116 |
| 272 | 3300031665 | Ga0316575_10000026 | Ga0316575_1000002617 | 116 |
| 273 | 3300031727 | Ga0316576_10608975 | Ga0316576_106089752 | 116 |
| 274 | 3300031731 | Ga0307405_10650684 | Ga0307405_106506842 | 116 |
| 275 | 3300031852 | Ga0307410_11819142 | Ga0307410_118191421 | 116 |
| 276 | 3300031901 | Ga0307406_10097957 | Ga0307406_100979572 | 116 |
| 277 | 3300031903 | Ga0307407_11709533 | Ga0307407_117095331 | 116 |
| 278 | 3300031911 | Ga0307412_11361548 | Ga0307412_113615481 | 116 |
| 279 | 3300031995 | Ga0307409_102077542 | Ga0307409_1020775421 | 116 |
| 280 | 3300032002 | Ga0307416_101158349 | Ga0307416_1011583491 | 116 |
| 281 | 3300032004 | Ga0307414_10398261 | Ga0307414_103982612 | 116 |
| 282 | 3300032004 | Ga0307414_10738533 | Ga0307414_107385332 | 116 |
| 283 | 3300032004 | Ga0307414_11930979 | Ga0307414_119309791 | 116 |
| 284 | 3300032126 | Ga0307415_100658201 | Ga0307415_1006582012 | 116 |
| 285 | 3300033529 | Ga0316587_1049386 | Ga0316587_10493861 | 116 |
| 286 | 3300033541 | Ga0316596_1021855 | Ga0316596_10218553 | 116 |
| 287 | 3300041413 | Ga0439465_0097231 | Ga0439465_0097231_370_720 | 116 |
| 288 | 3300041413 | Ga0439465_0109232 | Ga0439465_0109232_236_586 | 116 |
| 289 | 3300041413 | Ga0439465_0122093 | Ga0439465_0122093_69_419 | 116 |
| 290 | 3300041494 | Ga0451837_0986096 | Ga0451837_0986096_311_676 | 116 |
| 291 | 3300041498 | Ga0451841_1254032 | Ga0451841_1254032_148_513 | 116 |
| 292 | 3300042146 | Ga0450907_050908 | Ga0450907_050908_53_403 | 116 |
| 293 | 3300046460 | Ga0495638_0202553 | Ga0495638_0202553_598_948 | 116 |
| 294 | 3300046543 | Ga0495645_0066284 | Ga0495645_0066284_2137_2496 | 116 |
| 295 | 3300046615 | Ga0495656_0044965 | Ga0495656_0044965_790_1140 | 116 |
| 296 | 3300046660 | Ga0495625_0262604 | Ga0495625_0262604_77_427 | 116 |
| 297 | 3300046691 | Ga0495670_0427055 | Ga0495670_0427055_327_677 | 116 |
| 298 | 3300048916 | Ga0496113_0082756 | Ga0496113_0082756_1959_2309 | 116 |
| 299 | 3300048920 | Ga0496117_0116493 | Ga0496117_0116493_749_1114 | 116 |
| 300 | 3300048921 | Ga0496118_0105465 | Ga0496118_0105465_251_616 | 116 |
| 301 | 3300048925 | Ga0496122_0249394 | Ga0496122_0249394_502_867 | 116 |
| 302 | 3300048929 | Ga0496126_0459928 | Ga0496126_0459928_28_393 | 116 |
| 303 | 3300049127 | Ga0501306_035622 | Ga0501306_035622_26_376 | 116 |
| 304 | 3300049127 | Ga0501306_035622 | Ga0501306_035622_393_743 | 116 |
| 305 | 3300049587 | Ga0501071_0378714 | Ga0501071_0378714_540_890 | 116 |
| 306 | 3300049593 | Ga0501077_0963720 | Ga0501077_0963720_30_380 | 116 |
| 307 | 3300050509 | nmdc:mga0qj67_969409_c1 | nmdc:mga0qj67_969409_c1_203_553 | 116 |
| 308 | 3300050511 | nmdc:mga08y16_571618_c1 | nmdc:mga08y16_571618_c1_340_690 | 116 |
| 309 | iso_pu_bacteria | 2857729791 | 2857732519 | 116 |
| 310 | iso_pu_bacteria | 2928121344 | 2928122861 | 116 |
| 311 | 3300002738 | JGI25154J39366_1001125 | JGI25154J39366_10011257 | 117 |
| 312 | 3300003320 | rootH2_10099343 | rootH2_100993432 | 117 |
| 313 | 3300005578 | Ga0068854_101373225 | Ga0068854_1013732251 | 117 |
| 314 | 3300006038 | Ga0075365_10487849 | Ga0075365_104878491 | 117 |
| 315 | 3300006051 | Ga0075364_10072297 | Ga0075364_100722972 | 117 |
| 316 | 3300006051 | Ga0075364_10094417 | Ga0075364_100944172 | 117 |
| 317 | 3300006051 | Ga0075364_10244267 | Ga0075364_102442672 | 117 |
| 318 | 3300006195 | Ga0075366_10431814 | Ga0075366_104318142 | 117 |
| 319 | 3300006353 | Ga0075370_10771516 | Ga0075370_107715161 | 117 |
| 320 | 3300009148 | Ga0105243_10717885 | Ga0105243_107178852 | 117 |
| 321 | 3300013102 | Ga0157371_10890684 | Ga0157371_108906841 | 117 |
| 322 | 3300013104 | Ga0157370_11194763 | Ga0157370_111947631 | 117 |
| 323 | 3300013104 | Ga0157370_11325577 | Ga0157370_113255772 | 117 |
| 324 | 3300013105 | Ga0157369_10428088 | Ga0157369_104280881 | 117 |
| 325 | 3300013307 | Ga0157372_10050676 | Ga0157372_100506764 | 117 |
| 326 | 3300020075 | Ga0206349_1042834 | Ga0206349_10428341 | 117 |
| 327 | 3300020077 | Ga0206351_10564076 | Ga0206351_105640761 | 117 |
| 328 | 3300025246 | Ga0209646_1000071 | Ga0209646_1000071219 | 117 |
| 329 | 3300025258 | Ga0209129_1049499 | Ga0209129_10494991 | 117 |
| 330 | 3300025294 | Ga0209025_1131806 | Ga0209025_11318061 | 117 |
| 331 | 3300025935 | Ga0207709_11334717 | Ga0207709_113347171 | 117 |
| 332 | 3300031731 | Ga0307405_10497777 | Ga0307405_104977772 | 117 |
| 333 | 3300031824 | Ga0307413_10130391 | Ga0307413_101303912 | 117 |
| 334 | 3300031901 | Ga0307406_10020290 | Ga0307406_100202903 | 117 |
| 335 | 3300032004 | Ga0307414_10164755 | Ga0307414_101647553 | 117 |
| 336 | 3300032004 | Ga0307414_10256236 | Ga0307414_102562362 | 117 |
| 337 | 3300032004 | Ga0307414_10537095 | Ga0307414_105370951 | 117 |
| 338 | 3300032004 | Ga0307414_10572465 | Ga0307414_105724652 | 117 |
| 339 | 3300032004 | Ga0307414_10664597 | Ga0307414_106645971 | 117 |
| 340 | 3300032005 | Ga0307411_10667529 | Ga0307411_106675292 | 117 |
| 341 | 3300037418 | Ga0395900_1694093 | Ga0395900_1694093_75_437 | 117 |
| 342 | 3300037466 | Ga0395898_0018267 | Ga0395898_0018267_3554_3916 | 117 |
| 343 | 3300041462 | Ga0451806_769506 | Ga0451806_769506_133_501 | 117 |
| 344 | 3300044683 | Ga0466965_0509897 | Ga0466965_0509897_155_517 | 117 |
| 345 | 3300044765 | Ga0466970_0470447 | Ga0466970_0470447_11_373 | 117 |
| 346 | 3300044842 | Ga0466957_0515504 | Ga0466957_0515504_442_813 | 117 |
| 347 | 3300044901 | Ga0466960_0032143 | Ga0466960_0032143_468_839 | 117 |
| 348 | 3300044901 | Ga0466960_0134629 | Ga0466960_0134629_802_1164 | 117 |
| 349 | 3300045049 | Ga0466959_0376557 | Ga0466959_0376557_124_495 | 117 |
| 350 | 3300045976 | Ga0466967_0787257 | Ga0466967_0787257_106_477 | 117 |
| 351 | 3300046471 | Ga0495650_0005523 | Ga0495650_0005523_2449_2805 | 117 |
| 352 | 3300046516 | Ga0495628_0280445 | Ga0495628_0280445_165_557 | 117 |
| 353 | 3300048917 | Ga0496114_0058054 | Ga0496114_0058054_1460_1822 | 117 |
| 354 | 3300048929 | Ga0496126_0029608 | Ga0496126_0029608_3336_3692 | 117 |
| 355 | 3300048929 | Ga0496126_0149987 | Ga0496126_0149987_1320_1685 | 117 |
| 356 | 3300049571 | Ga0501034_0000227 | Ga0501034_0000227_72606_72971 | 117 |
| 357 | 3300049574 | Ga0501038_0070034 | Ga0501038_0070034_458_820 | 117 |
| 358 | 3300050491 | nmdc:mga00v17_324262_c1 | nmdc:mga00v17_324262_c1_387_749 | 117 |
| 359 | 3300050491 | nmdc:mga00v17_372048_c1 | nmdc:mga00v17_372048_c1_288_653 | 117 |
| 360 | 3300050491 | nmdc:mga00v17_63564_c1 | nmdc:mga00v17_63564_c1_796_1152 | 117 |
| 361 | 3300050491 | nmdc:mga00v17_99382_c1 | nmdc:mga00v17_99382_c1_288_650 | 117 |
| 362 | 3300050494 | nmdc:mga06z11_292094_c1 | nmdc:mga06z11_292094_c1_30_392 | 117 |
| 363 | 3300050496 | nmdc:mga07m45_43733_c1 | nmdc:mga07m45_43733_c1_1206_1571 | 117 |
| 364 | 3300053093 | Ga0500651_0053181 | Ga0500651_0053181_1444_1836 | 117 |
| 365 | 3300053148 | Ga0500590_164472 | Ga0500590_164472_378_770 | 117 |
| 366 | 3300059508 | Ga0587088_001021 | Ga0587088_001021_2224_2586 | 117 |
| 367 | 3300059604 | Ga0587098_000238 | Ga0587098_000238_606_968 | 117 |
| 368 | 3300059605 | Ga0587106_000795 | Ga0587106_000795_210_572 | 117 |
| 369 | 3300059630 | Ga0587128_001590 | Ga0587128_001590_412_774 | 117 |
| 370 | 3300059649 | Ga0587102_026774 | Ga0587102_026774_209_595 | 117 |
| 371 | iso_pu_bacteria | 2893684298 | 2893684469 | 117 |
| 372 | 3300001979 | JGI24740J21852_10016630 | JGI24740J21852_100166302 | 118 |
| 373 | 3300001979 | JGI24740J21852_10032850 | JGI24740J21852_100328502 | 118 |
| 374 | 3300001989 | JGI24739J22299_10005914 | JGI24739J22299_100059142 | 118 |
| 375 | 3300001989 | JGI24739J22299_10036697 | JGI24739J22299_100366973 | 118 |
| 376 | 3300001990 | JGI24737J22298_10026723 | JGI24737J22298_100267232 | 118 |
| 377 | 3300001990 | JGI24737J22298_10262116 | JGI24737J22298_102621161 | 118 |
| 378 | 3300002067 | JGI24735J21928_10000431 | JGI24735J21928_100004314 | 118 |
| 379 | 3300002067 | JGI24735J21928_10046826 | JGI24735J21928_100468262 | 118 |
| 380 | 3300002737 | JGI25162J39368_1006402 | JGI25162J39368_10064022 | 118 |
| 381 | 3300002772 | JGI25164J39214_1000402 | JGI25164J39214_100040212 | 118 |
| 382 | 3300003162 | Ga0006778J45830_1009243 | Ga0006778J45830_10092431 | 118 |
| 383 | 3300003163 | Ga0006759J45824_1032353 | Ga0006759J45824_10323531 | 118 |
| 384 | 3300003214 | JGI25165J46597_1000004 | JGI25165J46597_1000004433 | 118 |
| 385 | 3300003308 | Ga0006777J48905_1027580 | Ga0006777J48905_10275801 | 118 |
| 386 | 3300003559 | Ga0007427J51700_105914 | Ga0007427J51700_1059141 | 118 |
| 387 | 3300003568 | Ga0006781J51513_1010598 | Ga0006781J51513_10105981 | 118 |
| 388 | 3300003578 | Ga0006562J51391_1006898 | Ga0006562J51391_10068984 | 118 |
| 389 | 3300003578 | Ga0006562J51391_1014808 | Ga0006562J51391_10148088 | 118 |
| 390 | 3300003578 | Ga0006562J51391_1014811 | Ga0006562J51391_10148111 | 118 |
| 391 | 3300003611 | Ga0007411J51799_112608 | Ga0007411J51799_1126081 | 118 |
| 392 | 3300003735 | Ga0006780_1007103 | Ga0006780_10071031 | 118 |
| 393 | 3300003752 | Ga0055539_1000008 | Ga0055539_100000812 | 118 |
| 394 | 3300003752 | Ga0055539_1012101 | Ga0055539_10121012 | 118 |
| 395 | 3300003756 | Ga0055533_1000001 | Ga0055533_10000011058 | 118 |
| 396 | 3300003758 | Ga0055532_1006376 | Ga0055532_10063762 | 118 |
| 397 | 3300003759 | Ga0055525_1000787 | Ga0055525_10007873 | 118 |
| 398 | 3300003759 | Ga0055525_1007188 | Ga0055525_10071881 | 118 |
| 399 | 3300003760 | Ga0055527_1000001 | Ga0055527_1000001543 | 118 |
| 400 | 3300003763 | Ga0055529_1000019 | Ga0055529_100001949 | 118 |
| 401 | 3300003763 | Ga0055529_1006166 | Ga0055529_10061662 | 118 |
| 402 | 3300003841 | Ga0055541_1002268 | Ga0055541_10022684 | 118 |
| 403 | 3300005288 | Ga0065714_10437834 | Ga0065714_104378341 | 118 |
| 404 | 3300005327 | Ga0070658_10002538 | Ga0070658_1000253815 | 118 |
| 405 | 3300005327 | Ga0070658_10011276 | Ga0070658_100112762 | 118 |
| 406 | 3300005327 | Ga0070658_10018446 | Ga0070658_100184463 | 118 |
| 407 | 3300005327 | Ga0070658_10024386 | Ga0070658_100243862 | 118 |
| 408 | 3300005327 | Ga0070658_10119339 | Ga0070658_101193392 | 118 |
| 409 | 3300005327 | Ga0070658_10287880 | Ga0070658_102878802 | 118 |
| 410 | 3300005337 | Ga0070682_100108313 | Ga0070682_1001083132 | 118 |
| 411 | 3300005337 | Ga0070682_100205196 | Ga0070682_1002051962 | 118 |
| 412 | 3300005337 | Ga0070682_100685039 | Ga0070682_1006850392 | 118 |
| 413 | 3300005337 | Ga0070682_101320142 | Ga0070682_1013201421 | 118 |
| 414 | 3300005338 | Ga0068868_100136422 | Ga0068868_1001364222 | 118 |
| 415 | 3300005338 | Ga0068868_100668258 | Ga0068868_1006682582 | 118 |
| 416 | 3300005338 | Ga0068868_100844645 | Ga0068868_1008446451 | 118 |
| 417 | 3300005339 | Ga0070660_100153791 | Ga0070660_1001537912 | 118 |
| 418 | 3300005339 | Ga0070660_100218590 | Ga0070660_1002185902 | 118 |
| 419 | 3300005339 | Ga0070660_100637225 | Ga0070660_1006372252 | 118 |
| 420 | 3300005344 | Ga0070661_100121708 | Ga0070661_1001217082 | 118 |
| 421 | 3300005355 | Ga0070671_100114768 | Ga0070671_1001147683 | 118 |
| 422 | 3300005355 | Ga0070671_100296052 | Ga0070671_1002960521 | 118 |
| 423 | 3300005366 | Ga0070659_100000366 | Ga0070659_10000036620 | 118 |
| 424 | 3300005366 | Ga0070659_100076747 | Ga0070659_1000767473 | 118 |
| 425 | 3300005367 | Ga0070667_100003912 | Ga0070667_10000391213 | 118 |
| 426 | 3300005435 | Ga0070714_100211744 | Ga0070714_1002117442 | 118 |
| 427 | 3300005435 | Ga0070714_100445987 | Ga0070714_1004459872 | 118 |
| 428 | 3300005435 | Ga0070714_101325681 | Ga0070714_1013256812 | 118 |
| 429 | 3300005455 | Ga0070663_100592288 | Ga0070663_1005922882 | 118 |
| 430 | 3300005466 | Ga0070685_10142121 | Ga0070685_101421212 | 118 |
| 431 | 3300005530 | Ga0070679_101445306 | Ga0070679_1014453061 | 118 |
| 432 | 3300005539 | Ga0068853_100052456 | Ga0068853_1000524564 | 118 |
| 433 | 3300005539 | Ga0068853_100072924 | Ga0068853_1000729242 | 118 |
| 434 | 3300005539 | Ga0068853_100545653 | Ga0068853_1005456531 | 118 |
| 435 | 3300005543 | Ga0070672_101314305 | Ga0070672_1013143051 | 118 |
| 436 | 3300005563 | Ga0068855_100004431 | Ga0068855_10000443116 | 118 |
| 437 | 3300005563 | Ga0068855_100025012 | Ga0068855_1000250124 | 118 |
| 438 | 3300005563 | Ga0068855_100167746 | Ga0068855_1001677462 | 118 |
| 439 | 3300005563 | Ga0068855_100209693 | Ga0068855_1002096932 | 118 |
| 440 | 3300005563 | Ga0068855_101114295 | Ga0068855_1011142951 | 118 |
| 441 | 3300005563 | Ga0068855_101650102 | Ga0068855_1016501021 | 118 |
| 442 | 3300005577 | Ga0068857_100002984 | Ga0068857_1000029848 | 118 |
| 443 | 3300005577 | Ga0068857_100275842 | Ga0068857_1002758422 | 118 |
| 444 | 3300005614 | Ga0068856_100040400 | Ga0068856_1000404002 | 118 |
| 445 | 3300005614 | Ga0068856_100056191 | Ga0068856_1000561911 | 118 |
| 446 | 3300005614 | Ga0068856_100065521 | Ga0068856_1000655212 | 118 |
| 447 | 3300005614 | Ga0068856_100201556 | Ga0068856_1002015562 | 118 |
| 448 | 3300005614 | Ga0068856_100296655 | Ga0068856_1002966552 | 118 |
| 449 | 3300005614 | Ga0068856_100533508 | Ga0068856_1005335081 | 118 |
| 450 | 3300005614 | Ga0068856_101073892 | Ga0068856_1010738922 | 118 |
| 451 | 3300005616 | Ga0068852_100069820 | Ga0068852_1000698203 | 118 |
| 452 | 3300005616 | Ga0068852_100793296 | Ga0068852_1007932962 | 118 |
| 453 | 3300005616 | Ga0068852_100886767 | Ga0068852_1008867671 | 118 |
| 454 | 3300005617 | Ga0068859_100462788 | Ga0068859_1004627882 | 118 |
| 455 | 3300005618 | Ga0068864_100080524 | Ga0068864_1000805242 | 118 |
| 456 | 3300005834 | Ga0068851_10000020 | Ga0068851_1000002079 | 118 |
| 457 | 3300005841 | Ga0068863_100058611 | Ga0068863_1000586114 | 118 |
| 458 | 3300005842 | Ga0068858_100000233 | Ga0068858_10000023353 | 118 |
| 459 | 3300005844 | Ga0068862_101252275 | Ga0068862_1012522751 | 118 |
| 460 | 3300005983 | Ga0081540_1008305 | Ga0081540_10083055 | 118 |
| 461 | 3300006028 | Ga0070717_11589490 | Ga0070717_115894902 | 118 |
| 462 | 3300006038 | Ga0075365_10014081 | Ga0075365_100140815 | 118 |
| 463 | 3300006038 | Ga0075365_10016040 | Ga0075365_100160403 | 118 |
| 464 | 3300006038 | Ga0075365_10151737 | Ga0075365_101517372 | 118 |
| 465 | 3300006051 | Ga0075364_10000664 | Ga0075364_1000066411 | 118 |
| 466 | 3300006051 | Ga0075364_10006010 | Ga0075364_100060102 | 118 |
| 467 | 3300006051 | Ga0075364_10354878 | Ga0075364_103548781 | 118 |
| 468 | 3300006175 | Ga0070712_100500165 | Ga0070712_1005001652 | 118 |
| 469 | 3300006186 | Ga0075369_10007782 | Ga0075369_100077824 | 118 |
| 470 | 3300006186 | Ga0075369_10039734 | Ga0075369_100397342 | 118 |
| 471 | 3300006186 | Ga0075369_10048476 | Ga0075369_100484762 | 118 |
| 472 | 3300006186 | Ga0075369_10222376 | Ga0075369_102223762 | 118 |
| 473 | 3300006186 | Ga0075369_10538361 | Ga0075369_105383612 | 118 |
| 474 | 3300006931 | Ga0097620_100462766 | Ga0097620_1004627662 | 118 |
| 475 | 3300009036 | Ga0105244_10035710 | Ga0105244_100357103 | 118 |
| 476 | 3300009093 | Ga0105240_10002356 | Ga0105240_1000235613 | 118 |
| 477 | 3300009093 | Ga0105240_10122729 | Ga0105240_101227293 | 118 |
| 478 | 3300009098 | Ga0105245_10051261 | Ga0105245_100512612 | 118 |
| 479 | 3300009098 | Ga0105245_10082967 | Ga0105245_100829673 | 118 |
| 480 | 3300009101 | Ga0105247_10091905 | Ga0105247_100919052 | 118 |
| 481 | 3300009101 | Ga0105247_11016577 | Ga0105247_110165772 | 118 |
| 482 | 3300009148 | Ga0105243_10436524 | Ga0105243_104365242 | 118 |
| 483 | 3300009148 | Ga0105243_11745416 | Ga0105243_117454161 | 118 |
| 484 | 3300009174 | Ga0105241_10000260 | Ga0105241_1000026032 | 118 |
| 485 | 3300009174 | Ga0105241_10223011 | Ga0105241_102230112 | 118 |
| 486 | 3300009174 | Ga0105241_10317717 | Ga0105241_103177172 | 118 |
| 487 | 3300009177 | Ga0105248_10000714 | Ga0105248_1000071431 | 118 |
| 488 | 3300009177 | Ga0105248_10162370 | Ga0105248_101623702 | 118 |
| 489 | 3300009545 | Ga0105237_10006375 | Ga0105237_100063759 | 118 |
| 490 | 3300009545 | Ga0105237_10505764 | Ga0105237_105057642 | 118 |
| 491 | 3300009545 | Ga0105237_10552930 | Ga0105237_105529302 | 118 |
| 492 | 3300009545 | Ga0105237_11779993 | Ga0105237_117799932 | 118 |
| 493 | 3300009551 | Ga0105238_10023651 | Ga0105238_100236513 | 118 |
| 494 | 3300009551 | Ga0105238_10088136 | Ga0105238_100881362 | 118 |
| 495 | 3300009551 | Ga0105238_10702738 | Ga0105238_107027381 | 118 |
| 496 | 3300009551 | Ga0105238_11551022 | Ga0105238_115510221 | 118 |
| 497 | 3300009551 | Ga0105238_12054234 | Ga0105238_120542341 | 118 |
| 498 | 3300010375 | Ga0105239_10388730 | Ga0105239_103887301 | 118 |
| 499 | 3300010375 | Ga0105239_11618225 | Ga0105239_116182252 | 118 |
| 500 | 3300013100 | Ga0157373_10584333 | Ga0157373_105843332 | 118 |
| 501 | 3300013102 | Ga0157371_10001714 | Ga0157371_1000171411 | 118 |
| 502 | 3300013104 | Ga0157370_10040958 | Ga0157370_100409584 | 118 |
| 503 | 3300013104 | Ga0157370_10723688 | Ga0157370_107236882 | 118 |
| 504 | 3300013104 | Ga0157370_11398024 | Ga0157370_113980241 | 118 |
| 505 | 3300013105 | Ga0157369_10003460 | Ga0157369_100034605 | 118 |
| 506 | 3300013105 | Ga0157369_10202739 | Ga0157369_102027392 | 118 |
| 507 | 3300013105 | Ga0157369_10304610 | Ga0157369_103046102 | 118 |
| 508 | 3300013105 | Ga0157369_12346345 | Ga0157369_123463451 | 118 |
| 509 | 3300013296 | Ga0157374_10196136 | Ga0157374_101961363 | 118 |
| 510 | 3300013296 | Ga0157374_10302225 | Ga0157374_103022252 | 118 |
| 511 | 3300013296 | Ga0157374_11711662 | Ga0157374_117116622 | 118 |
| 512 | 3300013306 | Ga0163162_11222628 | Ga0163162_112226282 | 118 |
| 513 | 3300013307 | Ga0157372_10090442 | Ga0157372_100904422 | 118 |
| 514 | 3300013307 | Ga0157372_10497005 | Ga0157372_104970051 | 118 |
| 515 | 3300013307 | Ga0157372_10679855 | Ga0157372_106798552 | 118 |
| 516 | 3300013308 | Ga0157375_11164253 | Ga0157375_111642532 | 118 |
| 517 | 3300013308 | Ga0157375_12954239 | Ga0157375_129542391 | 118 |
| 518 | 3300014325 | Ga0163163_10048647 | Ga0163163_100486472 | 118 |
| 519 | 3300014325 | Ga0163163_13104411 | Ga0163163_131044111 | 118 |
| 520 | 3300014326 | Ga0157380_11498048 | Ga0157380_114980482 | 118 |
| 521 | 3300014745 | Ga0157377_10864988 | Ga0157377_108649881 | 118 |
| 522 | 3300014968 | Ga0157379_10014539 | Ga0157379_100145396 | 118 |
| 523 | 3300014969 | Ga0157376_10186528 | Ga0157376_101865282 | 118 |
| 524 | 3300020069 | Ga0197907_10314249 | Ga0197907_103142491 | 118 |
| 525 | 3300020069 | Ga0197907_10417701 | Ga0197907_104177011 | 118 |
| 526 | 3300020069 | Ga0197907_10693143 | Ga0197907_106931431 | 118 |
| 527 | 3300020070 | Ga0206356_11397704 | Ga0206356_113977043 | 118 |
| 528 | 3300020070 | Ga0206356_11659145 | Ga0206356_116591451 | 118 |
| 529 | 3300020075 | Ga0206349_1596473 | Ga0206349_15964731 | 118 |
| 530 | 3300020076 | Ga0206355_1252865 | Ga0206355_12528651 | 118 |
| 531 | 3300020076 | Ga0206355_1392808 | Ga0206355_13928083 | 118 |
| 532 | 3300020077 | Ga0206351_10579387 | Ga0206351_105793872 | 118 |
| 533 | 3300020080 | Ga0206350_10544471 | Ga0206350_105444712 | 118 |
| 534 | 3300020081 | Ga0206354_11320637 | Ga0206354_113206371 | 118 |
| 535 | 3300020082 | Ga0206353_11470238 | Ga0206353_114702382 | 118 |
| 536 | 3300020082 | Ga0206353_11734878 | Ga0206353_117348783 | 118 |
| 537 | 3300020610 | Ga0154015_1609341 | Ga0154015_16093411 | 118 |
| 538 | 3300022467 | Ga0224712_10029729 | Ga0224712_100297293 | 118 |
| 539 | 3300022467 | Ga0224712_10534805 | Ga0224712_105348051 | 118 |
| 540 | 3300025225 | Ga0209566_100149 | Ga0209566_1001495 | 118 |
| 541 | 3300025226 | Ga0209674_100001 | Ga0209674_1000011058 | 118 |
| 542 | 3300025226 | Ga0209674_118106 | Ga0209674_1181061 | 118 |
| 543 | 3300025228 | Ga0209672_100006 | Ga0209672_100006432 | 118 |
| 544 | 3300025229 | Ga0209147_100849 | Ga0209147_1008493 | 118 |
| 545 | 3300025230 | Ga0209563_100001 | Ga0209563_1000011058 | 118 |
| 546 | 3300025230 | Ga0209563_100381 | Ga0209563_10038114 | 118 |
| 547 | 3300025231 | Ga0207427_100010 | Ga0207427_100010148 | 118 |
| 548 | 3300025233 | Ga0209437_100216 | Ga0209437_10021658 | 118 |
| 549 | 3300025242 | Ga0209258_105279 | Ga0209258_1052793 | 118 |
| 550 | 3300025253 | Ga0209677_100001 | Ga0209677_1000011058 | 118 |
| 551 | 3300025253 | Ga0209677_106708 | Ga0209677_1067082 | 118 |
| 552 | 3300025253 | Ga0209677_118312 | Ga0209677_1183121 | 118 |
| 553 | 3300025254 | Ga0209148_1000015 | Ga0209148_1000015276 | 118 |
| 554 | 3300025254 | Ga0209148_1001437 | Ga0209148_10014373 | 118 |
| 555 | 3300025254 | Ga0209148_1015796 | Ga0209148_10157962 | 118 |
| 556 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000011801 | 118 |
| 557 | 3300025261 | Ga0209233_1040674 | Ga0209233_10406742 | 118 |
| 558 | 3300025272 | Ga0209455_1000013 | Ga0209455_1000013276 | 118 |
| 559 | 3300025272 | Ga0209455_1000811 | Ga0209455_10008117 | 118 |
| 560 | 3300025303 | Ga0209051_1079735 | Ga0209051_10797351 | 118 |
| 561 | 3300025321 | Ga0207656_10000003 | Ga0207656_100000032 | 118 |
| 562 | 3300025728 | Ga0207655_1092600 | Ga0207655_10926001 | 118 |
| 563 | 3300025900 | Ga0207710_10073034 | Ga0207710_100730342 | 118 |
| 564 | 3300025900 | Ga0207710_10367985 | Ga0207710_103679852 | 118 |
| 565 | 3300025904 | Ga0207647_10006593 | Ga0207647_100065933 | 118 |
| 566 | 3300025904 | Ga0207647_10025066 | Ga0207647_100250663 | 118 |
| 567 | 3300025904 | Ga0207647_10069180 | Ga0207647_100691802 | 118 |
| 568 | 3300025904 | Ga0207647_10112805 | Ga0207647_101128052 | 118 |
| 569 | 3300025904 | Ga0207647_10381968 | Ga0207647_103819682 | 118 |
| 570 | 3300025909 | Ga0207705_10000006 | Ga0207705_10000006550 | 118 |
| 571 | 3300025909 | Ga0207705_10008164 | Ga0207705_100081644 | 118 |
| 572 | 3300025909 | Ga0207705_10025391 | Ga0207705_100253914 | 118 |
| 573 | 3300025909 | Ga0207705_10234676 | Ga0207705_102346762 | 118 |
| 574 | 3300025909 | Ga0207705_10330783 | Ga0207705_103307832 | 118 |
| 575 | 3300025909 | Ga0207705_10455403 | Ga0207705_104554032 | 118 |
| 576 | 3300025911 | Ga0207654_10000003 | Ga0207654_10000003217 | 118 |
| 577 | 3300025913 | Ga0207695_10028611 | Ga0207695_100286115 | 118 |
| 578 | 3300025913 | Ga0207695_10037783 | Ga0207695_100377833 | 118 |
| 579 | 3300025914 | Ga0207671_10000002 | Ga0207671_10000002108 | 118 |
| 580 | 3300025914 | Ga0207671_10021409 | Ga0207671_100214093 | 118 |
| 581 | 3300025914 | Ga0207671_10260553 | Ga0207671_102605532 | 118 |
| 582 | 3300025914 | Ga0207671_10912622 | Ga0207671_109126221 | 118 |
| 583 | 3300025915 | Ga0207693_10455530 | Ga0207693_104555301 | 118 |
| 584 | 3300025919 | Ga0207657_10016489 | Ga0207657_100164892 | 118 |
| 585 | 3300025919 | Ga0207657_10571599 | Ga0207657_105715992 | 118 |
| 586 | 3300025920 | Ga0207649_10031676 | Ga0207649_100316762 | 118 |
| 587 | 3300025924 | Ga0207694_10000433 | Ga0207694_1000043340 | 118 |
| 588 | 3300025924 | Ga0207694_10609233 | Ga0207694_106092331 | 118 |
| 589 | 3300025927 | Ga0207687_10014147 | Ga0207687_100141474 | 118 |
| 590 | 3300025927 | Ga0207687_10063542 | Ga0207687_100635422 | 118 |
| 591 | 3300025929 | Ga0207664_10612575 | Ga0207664_106125752 | 118 |
| 592 | 3300025932 | Ga0207690_10001456 | Ga0207690_1000145614 | 118 |
| 593 | 3300025932 | Ga0207690_10054780 | Ga0207690_100547802 | 118 |
| 594 | 3300025935 | Ga0207709_10469910 | Ga0207709_104699101 | 118 |
| 595 | 3300025935 | Ga0207709_10666094 | Ga0207709_106660941 | 118 |
| 596 | 3300025940 | Ga0207691_10881965 | Ga0207691_108819652 | 118 |
| 597 | 3300025941 | Ga0207711_10001536 | Ga0207711_1000153618 | 118 |
| 598 | 3300025941 | Ga0207711_10015358 | Ga0207711_100153582 | 118 |
| 599 | 3300025949 | Ga0207667_10003435 | Ga0207667_1000343516 | 118 |
| 600 | 3300025949 | Ga0207667_10037351 | Ga0207667_100373514 | 118 |
| 601 | 3300025949 | Ga0207667_10076583 | Ga0207667_100765832 | 118 |
| 602 | 3300025949 | Ga0207667_10126813 | Ga0207667_101268132 | 118 |
| 603 | 3300025949 | Ga0207667_10248984 | Ga0207667_102489841 | 118 |
| 604 | 3300025949 | Ga0207667_10373541 | Ga0207667_103735412 | 118 |
| 605 | 3300025949 | Ga0207667_10620803 | Ga0207667_106208032 | 118 |
| 606 | 3300025949 | Ga0207667_10661703 | Ga0207667_106617031 | 118 |
| 607 | 3300025972 | Ga0207668_11117741 | Ga0207668_111177411 | 118 |
| 608 | 3300025986 | Ga0207658_10031506 | Ga0207658_100315062 | 118 |
| 609 | 3300026023 | Ga0207677_10497308 | Ga0207677_104973082 | 118 |
| 610 | 3300026035 | Ga0207703_10000044 | Ga0207703_1000004421 | 118 |
| 611 | 3300026041 | Ga0207639_10021744 | Ga0207639_100217442 | 118 |
| 612 | 3300026041 | Ga0207639_11268143 | Ga0207639_112681432 | 118 |
| 613 | 3300026067 | Ga0207678_10162131 | Ga0207678_101621312 | 118 |
| 614 | 3300026067 | Ga0207678_10505473 | Ga0207678_105054732 | 118 |
| 615 | 3300026078 | Ga0207702_10090684 | Ga0207702_100906843 | 118 |
| 616 | 3300026078 | Ga0207702_10279247 | Ga0207702_102792472 | 118 |
| 617 | 3300026078 | Ga0207702_11363217 | Ga0207702_113632172 | 118 |
| 618 | 3300026088 | Ga0207641_10366149 | Ga0207641_103661491 | 118 |
| 619 | 3300026095 | Ga0207676_10100649 | Ga0207676_101006492 | 118 |
| 620 | 3300026116 | Ga0207674_10004904 | Ga0207674_100049048 | 118 |
| 621 | 3300026116 | Ga0207674_10674934 | Ga0207674_106749342 | 118 |
| 622 | 3300026142 | Ga0207698_10001186 | Ga0207698_100011864 | 118 |
| 623 | 3300026142 | Ga0207698_10504036 | Ga0207698_105040362 | 118 |
| 624 | 3300026142 | Ga0207698_11549342 | Ga0207698_115493421 | 118 |
| 625 | 3300026142 | Ga0207698_11927699 | Ga0207698_119276991 | 118 |
| 626 | 3300028794 | Ga0307515_10344049 | Ga0307515_103440492 | 118 |
| 627 | 3300028794 | Ga0307515_10923090 | Ga0307515_109230901 | 118 |
| 628 | 3300031649 | Ga0307514_10427685 | Ga0307514_104276851 | 118 |
| 629 | 3300031901 | Ga0307406_10000235 | Ga0307406_100002355 | 118 |
| 630 | 3300031901 | Ga0307406_10000548 | Ga0307406_100005488 | 118 |
| 631 | 3300037312 | Ga0395899_0007061 | Ga0395899_0007061_3441_3797 | 118 |
| 632 | 3300037312 | Ga0395899_0575678 | Ga0395899_0575678_111_467 | 118 |
| 633 | 3300037418 | Ga0395900_0000774 | Ga0395900_0000774_37544_37900 | 118 |
| 634 | 3300037418 | Ga0395900_0178902 | Ga0395900_0178902_1413_1769 | 118 |
| 635 | 3300037418 | Ga0395900_0280888 | Ga0395900_0280888_202_570 | 118 |
| 636 | 3300037466 | Ga0395898_0000015 | Ga0395898_0000015_108694_109050 | 118 |
| 637 | 3300038443 | Ga0395901_0023475 | Ga0395901_0023475_1705_2073 | 118 |
| 638 | 3300038443 | Ga0395901_0033400 | Ga0395901_0033400_3235_3600 | 118 |
| 639 | 3300038443 | Ga0395901_0791629 | Ga0395901_0791629_60_446 | 118 |
| 640 | 3300039450 | Ga0436363_0269928 | Ga0436363_0269928_153_527 | 118 |
| 641 | 3300041441 | Ga0451787_134054 | Ga0451787_134054_181_543 | 118 |
| 642 | 3300041451 | Ga0451791_0106859 | Ga0451791_0106859_508_885 | 118 |
| 643 | 3300041451 | Ga0451791_1080276 | Ga0451791_1080276_35_400 | 118 |
| 644 | 3300041452 | Ga0451793_0891968 | Ga0451793_0891968_609_971 | 118 |
| 645 | 3300041453 | Ga0451797_0342964 | Ga0451797_0342964_170_532 | 118 |
| 646 | 3300041453 | Ga0451797_0419015 | Ga0451797_0419015_282_644 | 118 |
| 647 | 3300041453 | Ga0451797_0977833 | Ga0451797_0977833_55_417 | 118 |
| 648 | 3300041459 | Ga0451800_1222319 | Ga0451800_1222319_94_462 | 118 |
| 649 | 3300041462 | Ga0451806_482414 | Ga0451806_482414_128_502 | 118 |
| 650 | 3300041494 | Ga0451837_1152760 | Ga0451837_1152760_260_622 | 118 |
| 651 | 3300041494 | Ga0451837_1777354 | Ga0451837_1777354_71_454 | 118 |
| 652 | 3300041498 | Ga0451841_0952906 | Ga0451841_0952906_66_434 | 118 |
| 653 | 3300041505 | Ga0451849_1108743 | Ga0451849_1108743_133_498 | 118 |
| 654 | 3300041509 | Ga0451843_0095480 | Ga0451843_0095480_176_538 | 118 |
| 655 | 3300041509 | Ga0451843_0345566 | Ga0451843_0345566_251_616 | 118 |
| 656 | 3300041512 | Ga0451853_3391059 | Ga0451853_3391059_215_580 | 118 |
| 657 | 3300044658 | Ga0466972_0022794 | Ga0466972_0022794_2234_2590 | 118 |
| 658 | 3300044658 | Ga0466972_0050505 | Ga0466972_0050505_1286_1642 | 118 |
| 659 | 3300044658 | Ga0466972_0086023 | Ga0466972_0086023_814_1170 | 118 |
| 660 | 3300044658 | Ga0466972_0519027 | Ga0466972_0519027_20_394 | 118 |
| 661 | 3300044683 | Ga0466965_0005583 | Ga0466965_0005583_3557_3913 | 118 |
| 662 | 3300044683 | Ga0466965_0015519 | Ga0466965_0015519_1414_1770 | 118 |
| 663 | 3300044683 | Ga0466965_0916937 | Ga0466965_0916937_44_412 | 118 |
| 664 | 3300044684 | Ga0466966_0016995 | Ga0466966_0016995_3907_4263 | 118 |
| 665 | 3300044693 | Ga0466961_0240754 | Ga0466961_0240754_736_1092 | 118 |
| 666 | 3300044693 | Ga0466961_0302257 | Ga0466961_0302257_424_780 | 118 |
| 667 | 3300044693 | Ga0466961_0339107 | Ga0466961_0339107_480_836 | 118 |
| 668 | 3300044706 | Ga0466964_0299131 | Ga0466964_0299131_178_546 | 118 |
| 669 | 3300044719 | Ga0466971_0026655 | Ga0466971_0026655_1849_2205 | 118 |
| 670 | 3300044719 | Ga0466971_0055105 | Ga0466971_0055105_11_385 | 118 |
| 671 | 3300044735 | Ga0466968_0023017 | Ga0466968_0023017_1422_1778 | 118 |
| 672 | 3300044735 | Ga0466968_0503310 | Ga0466968_0503310_228_584 | 118 |
| 673 | 3300044765 | Ga0466970_0011041 | Ga0466970_0011041_3483_3839 | 118 |
| 674 | 3300044765 | Ga0466970_0052295 | Ga0466970_0052295_414_770 | 118 |
| 675 | 3300044765 | Ga0466970_0079419 | Ga0466970_0079419_1393_1749 | 118 |
| 676 | 3300044765 | Ga0466970_0081797 | Ga0466970_0081797_1156_1530 | 118 |
| 677 | 3300044765 | Ga0466970_0120196 | Ga0466970_0120196_860_1216 | 118 |
| 678 | 3300044765 | Ga0466970_0289161 | Ga0466970_0289161_34_402 | 118 |
| 679 | 3300044842 | Ga0466957_0056094 | Ga0466957_0056094_822_1178 | 118 |
| 680 | 3300044842 | Ga0466957_0108420 | Ga0466957_0108420_1373_1729 | 118 |
| 681 | 3300044901 | Ga0466960_0020915 | Ga0466960_0020915_2103_2459 | 118 |
| 682 | 3300044901 | Ga0466960_0030828 | Ga0466960_0030828_1915_2271 | 118 |
| 683 | 3300045049 | Ga0466959_0050215 | Ga0466959_0050215_327_683 | 118 |
| 684 | 3300045049 | Ga0466959_0059052 | Ga0466959_0059052_12_368 | 118 |
| 685 | 3300045049 | Ga0466959_0455199 | Ga0466959_0455199_214_570 | 118 |
| 686 | 3300045836 | Ga0466958_0021235 | Ga0466958_0021235_2272_2628 | 118 |
| 687 | 3300045836 | Ga0466958_0279983 | Ga0466958_0279983_672_1028 | 118 |
| 688 | 3300045836 | Ga0466958_0699823 | Ga0466958_0699823_98_472 | 118 |
| 689 | 3300045976 | Ga0466967_0307540 | Ga0466967_0307540_786_1142 | 118 |
| 690 | 3300045976 | Ga0466967_0698701 | Ga0466967_0698701_50_424 | 118 |
| 691 | 3300046457 | Ga0495590_0000612 | Ga0495590_0000612_5830_6213 | 118 |
| 692 | 3300046471 | Ga0495650_0097309 | Ga0495650_0097309_657_1025 | 118 |
| 693 | 3300046471 | Ga0495650_0308833 | Ga0495650_0308833_71_442 | 118 |
| 694 | 3300046515 | Ga0495620_0362472 | Ga0495620_0362472_31_402 | 118 |
| 695 | 3300046538 | Ga0495609_0353690 | Ga0495609_0353690_177_548 | 118 |
| 696 | 3300046615 | Ga0495656_0005765 | Ga0495656_0005765_1951_2340 | 118 |
| 697 | 3300046794 | Ga0495589_0104089 | Ga0495589_0104089_290_679 | 118 |
| 698 | 3300047320 | Ga0495672_0038657 | Ga0495672_0038657_859_1242 | 118 |
| 699 | 3300048090 | Ga0495615_0108346 | Ga0495615_0108346_297_686 | 118 |
| 700 | 3300048903 | Ga0496100_0026172 | Ga0496100_0026172_892_1248 | 118 |
| 701 | 3300048903 | Ga0496100_0096739 | Ga0496100_0096739_629_985 | 118 |
| 702 | 3300048904 | Ga0496101_0018547 | Ga0496101_0018547_2513_2869 | 118 |
| 703 | 3300048904 | Ga0496101_0107724 | Ga0496101_0107724_1575_1931 | 118 |
| 704 | 3300048905 | Ga0496102_0088257 | Ga0496102_0088257_1865_2221 | 118 |
| 705 | 3300048905 | Ga0496102_0392047 | Ga0496102_0392047_200_556 | 118 |
| 706 | 3300048907 | Ga0496104_0032709 | Ga0496104_0032709_1161_1517 | 118 |
| 707 | 3300048907 | Ga0496104_0292885 | Ga0496104_0292885_467_823 | 118 |
| 708 | 3300048908 | Ga0496105_0011758 | Ga0496105_0011758_1034_1390 | 118 |
| 709 | 3300048908 | Ga0496105_0108308 | Ga0496105_0108308_699_1055 | 118 |
| 710 | 3300048908 | Ga0496105_0160742 | Ga0496105_0160742_734_1090 | 118 |
| 711 | 3300048908 | Ga0496105_0246297 | Ga0496105_0246297_291_656 | 118 |
| 712 | 3300048910 | Ga0496107_0114841 | Ga0496107_0114841_950_1306 | 118 |
| 713 | 3300048910 | Ga0496107_0756380 | Ga0496107_0756380_205_561 | 118 |
| 714 | 3300048917 | Ga0496114_0054500 | Ga0496114_0054500_531_887 | 118 |
| 715 | 3300048917 | Ga0496114_0055755 | Ga0496114_0055755_1724_2080 | 118 |
| 716 | 3300048918 | Ga0496115_0007443 | Ga0496115_0007443_5816_6172 | 118 |
| 717 | 3300048918 | Ga0496115_0049048 | Ga0496115_0049048_643_999 | 118 |
| 718 | 3300048918 | Ga0496115_0429380 | Ga0496115_0429380_693_1049 | 118 |
| 719 | 3300048919 | Ga0496116_0003139 | Ga0496116_0003139_12164_12529 | 118 |
| 720 | 3300048920 | Ga0496117_0000232 | Ga0496117_0000232_52830_53195 | 118 |
| 721 | 3300048920 | Ga0496117_0004850 | Ga0496117_0004850_2561_2935 | 118 |
| 722 | 3300048920 | Ga0496117_0005578 | Ga0496117_0005578_11392_11748 | 118 |
| 723 | 3300048920 | Ga0496117_0014558 | Ga0496117_0014558_4598_4963 | 118 |
| 724 | 3300048920 | Ga0496117_0054113 | Ga0496117_0054113_2303_2659 | 118 |
| 725 | 3300048920 | Ga0496117_0059591 | Ga0496117_0059591_1387_1755 | 118 |
| 726 | 3300048920 | Ga0496117_0108514 | Ga0496117_0108514_28_405 | 118 |
| 727 | 3300048920 | Ga0496117_0217421 | Ga0496117_0217421_563_919 | 118 |
| 728 | 3300048921 | Ga0496118_0003838 | Ga0496118_0003838_8552_8917 | 118 |
| 729 | 3300048921 | Ga0496118_0008605 | Ga0496118_0008605_8825_9202 | 118 |
| 730 | 3300048921 | Ga0496118_0139720 | Ga0496118_0139720_327_683 | 118 |
| 731 | 3300048921 | Ga0496118_0182578 | Ga0496118_0182578_660_1028 | 118 |
| 732 | 3300048921 | Ga0496118_0375170 | Ga0496118_0375170_188_556 | 118 |
| 733 | 3300048921 | Ga0496118_0521608 | Ga0496118_0521608_13_378 | 118 |
| 734 | 3300048922 | Ga0496119_0001875 | Ga0496119_0001875_18285_18662 | 118 |
| 735 | 3300048922 | Ga0496119_0002098 | Ga0496119_0002098_11437_11811 | 118 |
| 736 | 3300048922 | Ga0496119_0009311 | Ga0496119_0009311_5952_6317 | 118 |
| 737 | 3300048922 | Ga0496119_0017986 | Ga0496119_0017986_1506_1871 | 118 |
| 738 | 3300048922 | Ga0496119_0323337 | Ga0496119_0323337_258_623 | 118 |
| 739 | 3300048922 | Ga0496119_0398745 | Ga0496119_0398745_248_604 | 118 |
| 740 | 3300048923 | Ga0496120_0000456 | Ga0496120_0000456_24975_25352 | 118 |
| 741 | 3300048923 | Ga0496120_0001183 | Ga0496120_0001183_28799_29164 | 118 |
| 742 | 3300048923 | Ga0496120_0001794 | Ga0496120_0001794_8147_8512 | 118 |
| 743 | 3300048923 | Ga0496120_0001809 | Ga0496120_0001809_15597_15962 | 118 |
| 744 | 3300048923 | Ga0496120_0008433 | Ga0496120_0008433_2154_2528 | 118 |
| 745 | 3300048923 | Ga0496120_0016059 | Ga0496120_0016059_177_545 | 118 |
| 746 | 3300048923 | Ga0496120_0022428 | Ga0496120_0022428_1875_2258 | 118 |
| 747 | 3300048923 | Ga0496120_0072145 | Ga0496120_0072145_551_928 | 118 |
| 748 | 3300048924 | Ga0496121_0075900 | Ga0496121_0075900_1872_2228 | 118 |
| 749 | 3300048925 | Ga0496122_0000030 | Ga0496122_0000030_155597_155962 | 118 |
| 750 | 3300048925 | Ga0496122_0000120 | Ga0496122_0000120_18100_18474 | 118 |
| 751 | 3300048925 | Ga0496122_0009370 | Ga0496122_0009370_3868_4233 | 118 |
| 752 | 3300048925 | Ga0496122_0194503 | Ga0496122_0194503_183_551 | 118 |
| 753 | 3300048925 | Ga0496122_0373829 | Ga0496122_0373829_14_385 | 118 |
| 754 | 3300048926 | Ga0496123_0000024 | Ga0496123_0000024_155598_155963 | 118 |
| 755 | 3300048926 | Ga0496123_0000051 | Ga0496123_0000051_47995_48369 | 118 |
| 756 | 3300048926 | Ga0496123_0001799 | Ga0496123_0001799_3877_4242 | 118 |
| 757 | 3300048927 | Ga0496124_0005016 | Ga0496124_0005016_14580_14945 | 118 |
| 758 | 3300048927 | Ga0496124_0008086 | Ga0496124_0008086_6177_6551 | 118 |
| 759 | 3300048927 | Ga0496124_0070691 | Ga0496124_0070691_2144_2515 | 118 |
| 760 | 3300048927 | Ga0496124_0124392 | Ga0496124_0124392_27_392 | 118 |
| 761 | 3300048927 | Ga0496124_0322356 | Ga0496124_0322356_356_727 | 118 |
| 762 | 3300048928 | Ga0496125_0001405 | Ga0496125_0001405_26252_26617 | 118 |
| 763 | 3300048928 | Ga0496125_0016870 | Ga0496125_0016870_2744_3109 | 118 |
| 764 | 3300048928 | Ga0496125_0017389 | Ga0496125_0017389_6078_6452 | 118 |
| 765 | 3300048928 | Ga0496125_0177610 | Ga0496125_0177610_872_1228 | 118 |
| 766 | 3300048929 | Ga0496126_0001194 | Ga0496126_0001194_22616_22981 | 118 |
| 767 | 3300048929 | Ga0496126_0005417 | Ga0496126_0005417_11448_11816 | 118 |
| 768 | 3300048929 | Ga0496126_0019688 | Ga0496126_0019688_4063_4437 | 118 |
| 769 | 3300048929 | Ga0496126_0030513 | Ga0496126_0030513_2556_2921 | 118 |
| 770 | 3300048929 | Ga0496126_0054593 | Ga0496126_0054593_2327_2683 | 118 |
| 771 | 3300048929 | Ga0496126_0117274 | Ga0496126_0117274_1311_1673 | 118 |
| 772 | 3300049527 | Ga0501311_088638 | Ga0501311_088638_111_473 | 118 |
| 773 | 3300049531 | Ga0501315_095497 | Ga0501315_095497_41_406 | 118 |
| 774 | 3300049568 | Ga0501031_0211242 | Ga0501031_0211242_889_1245 | 118 |
| 775 | 3300049568 | Ga0501031_0271693 | Ga0501031_0271693_501_875 | 118 |
| 776 | 3300049569 | Ga0501032_0013515 | Ga0501032_0013515_524_880 | 118 |
| 777 | 3300049569 | Ga0501032_0427289 | Ga0501032_0427289_407_763 | 118 |
| 778 | 3300049570 | Ga0501033_0009978 | Ga0501033_0009978_3931_4305 | 118 |
| 779 | 3300049570 | Ga0501033_0037603 | Ga0501033_0037603_3130_3486 | 118 |
| 780 | 3300049570 | Ga0501033_0048914 | Ga0501033_0048914_2747_3103 | 118 |
| 781 | 3300049570 | Ga0501033_0086936 | Ga0501033_0086936_1717_2091 | 118 |
| 782 | 3300049570 | Ga0501033_0093765 | Ga0501033_0093765_1441_1815 | 118 |
| 783 | 3300049571 | Ga0501034_0005786 | Ga0501034_0005786_9260_9628 | 118 |
| 784 | 3300049571 | Ga0501034_0016806 | Ga0501034_0016806_4166_4540 | 118 |
| 785 | 3300049571 | Ga0501034_0019532 | Ga0501034_0019532_890_1246 | 118 |
| 786 | 3300049571 | Ga0501034_0039777 | Ga0501034_0039777_2923_3306 | 118 |
| 787 | 3300049571 | Ga0501034_0063939 | Ga0501034_0063939_2536_2907 | 118 |
| 788 | 3300049571 | Ga0501034_0085814 | Ga0501034_0085814_56_412 | 118 |
| 789 | 3300049571 | Ga0501034_0171817 | Ga0501034_0171817_1032_1406 | 118 |
| 790 | 3300049571 | Ga0501034_0172624 | Ga0501034_0172624_186_560 | 118 |
| 791 | 3300049571 | Ga0501034_0194756 | Ga0501034_0194756_1585_1956 | 118 |
| 792 | 3300049571 | Ga0501034_0241599 | Ga0501034_0241599_232_588 | 118 |
| 793 | 3300049572 | Ga0501036_0015582 | Ga0501036_0015582_4956_5312 | 118 |
| 794 | 3300049572 | Ga0501036_0098223 | Ga0501036_0098223_912_1286 | 118 |
| 795 | 3300049572 | Ga0501036_0129312 | Ga0501036_0129312_190_564 | 118 |
| 796 | 3300049573 | Ga0501037_0000671 | Ga0501037_0000671_23313_23669 | 118 |
| 797 | 3300049573 | Ga0501037_0094752 | Ga0501037_0094752_215_589 | 118 |
| 798 | 3300049573 | Ga0501037_0094895 | Ga0501037_0094895_214_588 | 118 |
| 799 | 3300049573 | Ga0501037_0115191 | Ga0501037_0115191_969_1325 | 118 |
| 800 | 3300049573 | Ga0501037_0181934 | Ga0501037_0181934_885_1259 | 118 |
| 801 | 3300049574 | Ga0501038_0041553 | Ga0501038_0041553_890_1246 | 118 |
| 802 | 3300049574 | Ga0501038_0068332 | Ga0501038_0068332_1917_2285 | 118 |
| 803 | 3300049574 | Ga0501038_0225008 | Ga0501038_0225008_214_588 | 118 |
| 804 | 3300049574 | Ga0501038_0943342 | Ga0501038_0943342_215_589 | 118 |
| 805 | 3300049575 | Ga0501039_0016493 | Ga0501039_0016493_1922_2278 | 118 |
| 806 | 3300049575 | Ga0501039_0067506 | Ga0501039_0067506_1844_2218 | 118 |
| 807 | 3300049578 | Ga0501042_0098051 | Ga0501042_0098051_820_1194 | 118 |
| 808 | 3300049578 | Ga0501042_0366605 | Ga0501042_0366605_66_422 | 118 |
| 809 | 3300049578 | Ga0501042_0861660 | Ga0501042_0861660_78_452 | 118 |
| 810 | 3300049579 | Ga0501043_0008078 | Ga0501043_0008078_1987_2361 | 118 |
| 811 | 3300049579 | Ga0501043_0018745 | Ga0501043_0018745_3447_3803 | 118 |
| 812 | 3300049579 | Ga0501043_0024603 | Ga0501043_0024603_2348_2722 | 118 |
| 813 | 3300049579 | Ga0501043_0102976 | Ga0501043_0102976_214_588 | 118 |
| 814 | 3300049579 | Ga0501043_0535903 | Ga0501043_0535903_379_735 | 118 |
| 815 | 3300049580 | Ga0501046_0002630 | Ga0501046_0002630_18_374 | 118 |
| 816 | 3300049580 | Ga0501046_0007016 | Ga0501046_0007016_1569_1943 | 118 |
| 817 | 3300049580 | Ga0501046_0014629 | Ga0501046_0014629_5876_6232 | 118 |
| 818 | 3300049580 | Ga0501046_0106879 | Ga0501046_0106879_1569_1943 | 118 |
| 819 | 3300049581 | Ga0501047_0031241 | Ga0501047_0031241_3194_3568 | 118 |
| 820 | 3300049581 | Ga0501047_0032946 | Ga0501047_0032946_2760_3134 | 118 |
| 821 | 3300049581 | Ga0501047_0035220 | Ga0501047_0035220_1570_1944 | 118 |
| 822 | 3300049581 | Ga0501047_0046979 | Ga0501047_0046979_1166_1522 | 118 |
| 823 | 3300049581 | Ga0501047_0101716 | Ga0501047_0101716_1568_1924 | 118 |
| 824 | 3300049582 | Ga0501048_0043285 | Ga0501048_0043285_1979_2335 | 118 |
| 825 | 3300049582 | Ga0501048_0065475 | Ga0501048_0065475_1769_2143 | 118 |
| 826 | 3300049583 | Ga0501067_0253134 | Ga0501067_0253134_243_614 | 118 |
| 827 | 3300049585 | Ga0501069_0271572 | Ga0501069_0271572_54_428 | 118 |
| 828 | 3300049586 | Ga0501070_0000167 | Ga0501070_0000167_40609_40965 | 118 |
| 829 | 3300049586 | Ga0501070_0024474 | Ga0501070_0024474_1126_1482 | 118 |
| 830 | 3300049586 | Ga0501070_0071839 | Ga0501070_0071839_221_577 | 118 |
| 831 | 3300049586 | Ga0501070_0084094 | Ga0501070_0084094_1746_2138 | 118 |
| 832 | 3300049586 | Ga0501070_0541137 | Ga0501070_0541137_338_712 | 118 |
| 833 | 3300049588 | Ga0501072_0139399 | Ga0501072_0139399_1275_1646 | 118 |
| 834 | 3300049588 | Ga0501072_0734019 | Ga0501072_0734019_346_720 | 118 |
| 835 | 3300049589 | Ga0501073_0017669 | Ga0501073_0017669_489_860 | 118 |
| 836 | 3300049589 | Ga0501073_0077343 | Ga0501073_0077343_1601_1975 | 118 |
| 837 | 3300049589 | Ga0501073_0371190 | Ga0501073_0371190_581_937 | 118 |
| 838 | 3300049589 | Ga0501073_0918916 | Ga0501073_0918916_97_480 | 118 |
| 839 | 3300049590 | Ga0501074_0049308 | Ga0501074_0049308_383_757 | 118 |
| 840 | 3300049742 | Ga0501080_0018161 | Ga0501080_0018161_4201_4593 | 118 |
| 841 | 3300049742 | Ga0501080_0217030 | Ga0501080_0217030_1340_1714 | 118 |
| 842 | 3300049742 | Ga0501080_0724153 | Ga0501080_0724153_233_625 | 118 |
| 843 | 3300049742 | Ga0501080_0994626 | Ga0501080_0994626_113_475 | 118 |
| 844 | 3300049822 | Ga0501035_0013503 | Ga0501035_0013503_4284_4658 | 118 |
| 845 | 3300049822 | Ga0501035_0015949 | Ga0501035_0015949_1438_1794 | 118 |
| 846 | 3300049822 | Ga0501035_0020737 | Ga0501035_0020737_1244_1618 | 118 |
| 847 | 3300049822 | Ga0501035_0047185 | Ga0501035_0047185_1102_1476 | 118 |
| 848 | 3300049822 | Ga0501035_0323430 | Ga0501035_0323430_697_1053 | 118 |
| 849 | 3300049822 | Ga0501035_0373953 | Ga0501035_0373953_812_1168 | 118 |
| 850 | 3300049822 | Ga0501035_0973007 | Ga0501035_0973007_36_410 | 118 |
| 851 | 3300049823 | Ga0501044_0040026 | Ga0501044_0040026_1551_1907 | 118 |
| 852 | 3300049823 | Ga0501044_0046775 | Ga0501044_0046775_1540_1914 | 118 |
| 853 | 3300049823 | Ga0501044_0117710 | Ga0501044_0117710_1627_1983 | 118 |
| 854 | 3300049823 | Ga0501044_0136446 | Ga0501044_0136446_502_876 | 118 |
| 855 | 3300049823 | Ga0501044_0255349 | Ga0501044_0255349_217_591 | 118 |
| 856 | 3300049824 | Ga0501045_0005904 | Ga0501045_0005904_2204_2560 | 118 |
| 857 | 3300049824 | Ga0501045_0153212 | Ga0501045_0153212_1312_1686 | 118 |
| 858 | 3300050491 | nmdc:mga00v17_126263_c1 | nmdc:mga00v17_126263_c1_975_1337 | 118 |
| 859 | 3300050491 | nmdc:mga00v17_171980_c1 | nmdc:mga00v17_171980_c1_697_1065 | 118 |
| 860 | 3300050491 | nmdc:mga00v17_207696_c1 | nmdc:mga00v17_207696_c1_79_447 | 118 |
| 861 | 3300050491 | nmdc:mga00v17_5626_c1 | nmdc:mga00v17_5626_c1_2458_2823 | 118 |
| 862 | 3300050491 | nmdc:mga00v17_85051_c1 | nmdc:mga00v17_85051_c1_169_531 | 118 |
| 863 | 3300050492 | nmdc:mga0yw44_7012_c1 | nmdc:mga0yw44_7012_c1_4799_5161 | 118 |
| 864 | 3300050492 | nmdc:mga0yw44_714536_c1 | nmdc:mga0yw44_714536_c1_199_564 | 118 |
| 865 | 3300050492 | nmdc:mga0yw44_96810_c1 | nmdc:mga0yw44_96810_c1_1191_1553 | 118 |
| 866 | 3300050516 | nmdc:mga0sz30_24672_c2 | nmdc:mga0sz30_24672_c2_681_1046 | 118 |
| 867 | 3300050516 | nmdc:mga0sz30_55559_c1 | nmdc:mga0sz30_55559_c1_949_1305 | 118 |
| 868 | 3300050516 | nmdc:mga0sz30_5766_c1 | nmdc:mga0sz30_5766_c1_2081_2443 | 118 |
| 869 | 3300053080 | Ga0500635_0000028 | Ga0500635_0000028_31759_32115 | 118 |
| 870 | 3300053080 | Ga0500635_0255746 | Ga0500635_0255746_162_545 | 118 |
| 871 | 3300053104 | Ga0500556_0000393 | Ga0500556_0000393_14964_15326 | 118 |
| 872 | 3300053108 | Ga0500562_000296 | Ga0500562_000296_2585_2947 | 118 |
| 873 | 3300053117 | Ga0500593_000123 | Ga0500593_000123_15003_15365 | 118 |
| 874 | 3300053129 | Ga0500628_162534 | Ga0500628_162534_115_495 | 118 |
| 875 | 3300053136 | Ga0500559_0000218 | Ga0500559_0000218_45510_45872 | 118 |
| 876 | 3300053136 | Ga0500559_0002382 | Ga0500559_0002382_1582_1965 | 118 |
| 877 | 3300053136 | Ga0500559_0003021 | Ga0500559_0003021_6431_6814 | 118 |
| 878 | 3300053136 | Ga0500559_0217272 | Ga0500559_0217272_436_798 | 118 |
| 879 | 3300053139 | Ga0500568_0015664 | Ga0500568_0015664_1538_1921 | 118 |
| 880 | 3300053139 | Ga0500568_0018256 | Ga0500568_0018256_2227_2610 | 118 |
| 881 | 3300053153 | Ga0500616_0001402 | Ga0500616_0001402_20900_21271 | 118 |
| 882 | 3300053153 | Ga0500616_0003545 | Ga0500616_0003545_4847_5230 | 118 |
| 883 | 3300053153 | Ga0500616_0037251 | Ga0500616_0037251_1698_2060 | 118 |
| 884 | 3300053155 | Ga0500620_122830 | Ga0500620_122830_165_539 | 118 |
| 885 | 3300054114 | Ga0501084_0705777 | Ga0501084_0705777_145_519 | 118 |
| 886 | 3300059477 | Ga0587084_000197 | Ga0587084_000197_419_787 | 118 |
| 887 | 3300059477 | Ga0587084_116430 | Ga0587084_116430_103_477 | 118 |
| 888 | 3300059491 | Ga0587070_110923 | Ga0587070_110923_116_490 | 118 |
| 889 | 3300059492 | Ga0587073_0284394 | Ga0587073_0284394_63_446 | 118 |
| 890 | 3300059493 | Ga0587077_266122 | Ga0587077_266122_79_453 | 118 |
| 891 | 3300059505 | Ga0587083_0280918 | Ga0587083_0280918_71_445 | 118 |
| 892 | 3300059506 | Ga0587085_173807 | Ga0587085_173807_84_458 | 118 |
| 893 | 3300059511 | Ga0587091_174772 | Ga0587091_174772_79_453 | 118 |
| 894 | 3300059511 | Ga0587091_207869 | Ga0587091_207869_95_478 | 118 |
| 895 | 3300059513 | Ga0587094_000283 | Ga0587094_000283_3144_3512 | 118 |
| 896 | 3300059513 | Ga0587094_108599 | Ga0587094_108599_63_437 | 118 |
| 897 | 3300059605 | Ga0587106_133668 | Ga0587106_133668_103_477 | 118 |
| 898 | 3300059622 | Ga0587099_053653 | Ga0587099_053653_58_432 | 118 |
| 899 | 3300059623 | Ga0587101_000138 | Ga0587101_000138_3146_3514 | 118 |
| 900 | 3300059629 | Ga0587127_027212 | Ga0587127_027212_65_448 | 118 |
| 901 | 3300059630 | Ga0587128_110085 | Ga0587128_110085_31_387 | 118 |
| 902 | 3300059630 | Ga0587128_149068 | Ga0587128_149068_90_473 | 118 |
| 903 | 3300059631 | Ga0587130_040113 | Ga0587130_040113_57_440 | 118 |
| 904 | 3300059642 | Ga0587069_001336 | Ga0587069_001336_1793_2176 | 118 |
| 905 | 3300060344 | Ga0587071_173172 | Ga0587071_173172_97_471 | 118 |
| 906 | 3300061719 | Ga0466962_0036505 | Ga0466962_0036505_1392_1748 | 118 |
| 907 | 3300061719 | Ga0466962_0187704 | Ga0466962_0187704_314_670 | 118 |
| 908 | 3300061719 | Ga0466962_0724769 | Ga0466962_0724769_33_401 | 118 |
| 909 | iso_pu_bacteria | 2585428094 | 2587862680 | 118 |
| 910 | iso_pu_bacteria | 2966921586 | 2966923320 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.8858 | 14 | 108 |
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.8646 | 13 | 107 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.861 | 13 | 109 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.8525 | 14 | 108 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.845 | 13 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6SR68_68_176_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9004 | 14 | 117 | 2.60.300.12 |
| af_Q54P40_100_209_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8897 | 14 | 116 | 2.60.300.12 |
| 1s98A00 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8858 | 14 | 108 | 2.60.300.12 |
| af_P77667_17_122_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8721 | 13 | 117 | 2.60.300.12 |
| af_O96161_49_160_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8684 | 14 | 116 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3B8W7-F1-model_v4 | Heme biosynthesis protein HemY | 0.946 | 14 | 107 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A531KMU7-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.9332 | 14 | 109 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A1F3B8W7-F1-model_v4 | Heme biosynthesis protein HemY | 0.9271 | 14 | 107 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A3B0VMK9-F1-model_v4 | Iron-sulfur cluster insertion protein ErpA | 0.927 | 13 | 108 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A0R2Q3V8-F1-model_v4 | Iron-sulfur cluster insertion protein ErpA | 0.925 | 7 | 109 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar