F485453

General Info

Members Datasets Scaffolds Average Seq Length
910 423 829 120

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939657138|2939657773
Length 118
Sequence TLTSPETAAAHGVGLSDAAAQKVRSLMTQEGRDDLRLRVAVQPGGCSGLIYQLYFDERFLDGDASVDFGDGVEVVVDKMSVPYLMGASIDFEDTIQKQGFTIDNPNAAGSCACGDSFH

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
4 2643221546 Microbacterium sp. Root53 Isolate Unclassified
5 2643221549 Agromyces sp. Root1464 Isolate Unclassified
6 2643221553 Microbacterium sp. Root553 Isolate Unclassified
7 2643221572 Leifsonia sp. Root60 Isolate Unclassified
8 2643221575 Microbacterium sp. Root61 Isolate Unclassified
9 2643221616 Leifsonia sp. Root227 Isolate Unclassified
10 2643221619 Agromyces sp. Root81 Isolate Unclassified
11 2643221630 Microbacterium sp. Root322 Isolate Unclassified
12 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
13 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
14 2643221649 Leifsonia sp. Root4 Isolate Unclassified
15 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
16 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
17 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
18 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
19 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
20 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
21 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
22 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
23 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
24 2808606372 Agromyces sp. 23-23 Isolate Unclassified
25 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
26 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
27 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
28 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
29 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
30 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
31 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
32 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
33 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
34 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
35 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
36 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
37 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
38 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
39 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
40 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
41 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
42 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
43 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
44 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
45 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
46 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
47 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
48 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
49 2919069694 Microbacterium sp. 1154 Isolate Unclassified
50 2919395869 Microbacterium resistens 2980 Isolate Unclassified
51 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
52 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
53 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
54 2928153084 Leifsonia sp. 563 Isolate Unclassified
55 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
56 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
57 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
58 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
59 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
60 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
61 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
62 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
63 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
64 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
65 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
66 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
67 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
68 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
69 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
70 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
71 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
72 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
73 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
74 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
75 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
76 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
77 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
78 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
79 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
80 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
81 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
82 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
84 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
85 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
86 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
87 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
88 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
89 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
90 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
91 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
92 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
93 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
94 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
95 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
96 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
97 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
98 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
99 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
100 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
101 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
102 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
103 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
104 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
105 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
108 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
109 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
110 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
111 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
112 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
113 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
114 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
115 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
116 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
117 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
118 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
121 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
124 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
125 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
126 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
127 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
128 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
129 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
130 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
131 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
132 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
133 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
134 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
135 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
136 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
137 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
138 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
139 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
140 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
141 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
142 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
143 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
144 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
150 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
168 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
177 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
190 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
192 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
195 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
196 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
246 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
247 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
267 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
268 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
269 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
270 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
271 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
272 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
273 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
274 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
275 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
276 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
277 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
278 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
279 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
280 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
281 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
286 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
287 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
306 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
379 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
380 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
381 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
382 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
383 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
384 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
385 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
386 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
387 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
388 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
415 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
416 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
417 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
418 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
419 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
420 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
421 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
422 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
423 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.75
Metatranscriptomes 8.46
Isolates 8.79

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 10.44
Nodule 0
Rhizoplane 3.74
Rhizosphere 70.88
Stem 0
Stem Tuber 0.11
Unclassified 14.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10016630 3300001979 Bacteria 2653
2 JGI24740J21852_10032850 3300001979 Bacteria 1655
3 JGI24740J21852_10083933 3300001979 Bacteria 830
4 JGI24739J22299_10005914 3300001989 Bacteria 4633
5 JGI24739J22299_10036697 3300001989 Bacteria 1655
6 JGI24737J22298_10026723 3300001990 Bacteria 1822
7 JGI24737J22298_10262116 3300001990 Bacteria 511
8 JGI24735J21928_10000431 3300002067 Bacteria 14659
9 JGI24735J21928_10046826 3300002067 Bacteria 1254
10 JGI25162J39368_1006402 3300002737 Bacteria 2042
11 JGI25154J39366_1001125 3300002738 Bacteria 10388
12 JGI25164J39214_1000402 3300002772 Bacteria 24889
13 Ga0006778J45830_1009243 3300003162 Bacteria 511
14 Ga0006759J45824_1032353 3300003163 Bacteria 519
15 JGI25406J46586_10013791 3300003203 Bacteria 3456
16 JGI25165J46597_1000004 3300003214 Bacteria 667510
17 Ga0006777J48905_1027580 3300003308 Bacteria 503
18 rootH2_10099343 3300003320 Bacteria 2691
19 Ga0007427J51700_105914 3300003559 Bacteria 3546
20 Ga0006781J51513_1010598 3300003568 Bacteria 1801
21 Ga0006562J51391_1006898 3300003578 Bacteria 6416
22 Ga0006562J51391_1014808 3300003578 Bacteria 10498
23 Ga0006562J51391_1014811 3300003578 Bacteria 7630
24 Ga0007411J51799_112608 3300003611 Bacteria 678
25 Ga0006780_1007103 3300003735 Bacteria 3547
26 Ga0055539_1000008 3300003752 Bacteria 537665
27 Ga0055539_1012101 3300003752 Bacteria 1061
28 Ga0055533_1000001 3300003756 Bacteria 1863437
29 Ga0055532_1006376 3300003758 Bacteria 1580
30 Ga0055525_1000787 3300003759 Bacteria 10179
31 Ga0055525_1007188 3300003759 Bacteria 941
32 Ga0055527_1000001 3300003760 Bacteria 850044
33 Ga0055529_1000019 3300003763 Bacteria 332786
34 Ga0055529_1006166 3300003763 Bacteria 1690
35 Ga0055541_1002268 3300003841 Bacteria 3879
36 Ga0058860_10117912 3300004801 Bacteria 812
37 Ga0058860_12007059 3300004801 Bacteria 551
38 Ga0065714_10003468 3300005288 Bacteria 13259
39 Ga0065714_10175973 3300005288 Bacteria 983
40 Ga0065714_10437834 3300005288 Bacteria 562
41 Ga0070658_10002538 3300005327 Bacteria 15231
42 Ga0070658_10011276 3300005327 Bacteria 7164
43 Ga0070658_10018446 3300005327 Bacteria 5586
44 Ga0070658_10024386 3300005327 Bacteria 4852
45 Ga0070658_10119339 3300005327 Bacteria 2191
46 Ga0070658_10287880 3300005327 Bacteria 1400
47 Ga0070676_10170303 3300005328 Bacteria 1408
48 Ga0070677_10428159 3300005333 Bacteria 703
49 Ga0068869_100030634 3300005334 Bacteria 3778
50 Ga0068869_100334916 3300005334 Bacteria 1230
51 Ga0070682_100108313 3300005337 Bacteria 1847
52 Ga0070682_100205196 3300005337 Bacteria 1393
53 Ga0070682_100685039 3300005337 Bacteria 820
54 Ga0070682_101320142 3300005337 Bacteria 614
55 Ga0068868_100136422 3300005338 Bacteria 2012
56 Ga0068868_100668258 3300005338 Bacteria 927
57 Ga0068868_100844645 3300005338 Bacteria 829
58 Ga0070660_100153791 3300005339 Bacteria 1851
59 Ga0070660_100218590 3300005339 Bacteria 1548
60 Ga0070660_100637225 3300005339 Bacteria 892
61 Ga0070691_10431478 3300005341 Bacteria 749
62 Ga0070661_100121708 3300005344 Bacteria 1955
63 Ga0070668_100019550 3300005347 Bacteria 5098
64 Ga0070675_100373423 3300005354 Bacteria 1268
65 Ga0070671_100114768 3300005355 Bacteria 2264
66 Ga0070671_100296052 3300005355 Bacteria 1377
67 Ga0070659_100000366 3300005366 Bacteria 34220
68 Ga0070659_100076747 3300005366 Bacteria 2664
69 Ga0070667_100003912 3300005367 Bacteria 12649
70 Ga0070714_100211744 3300005435 Bacteria 1777
71 Ga0070714_100445987 3300005435 Bacteria 1229
72 Ga0070714_101325681 3300005435 Bacteria 703
73 Ga0070701_11350260 3300005438 Bacteria 511
74 Ga0070663_100592288 3300005455 Bacteria 932
75 Ga0070663_101109728 3300005455 Bacteria 692
76 Ga0070685_10142121 3300005466 Bacteria 1512
77 Ga0070679_101445306 3300005530 Bacteria 634
78 Ga0068853_100052456 3300005539 Bacteria 3513
79 Ga0068853_100072924 3300005539 Bacteria 2993
80 Ga0068853_100545653 3300005539 Bacteria 1098
81 Ga0070672_101314305 3300005543 Bacteria 646
82 Ga0070686_101424364 3300005544 Bacteria 582
83 Ga0068855_100004431 3300005563 Bacteria 17153
84 Ga0068855_100025012 3300005563 Bacteria 7146
85 Ga0068855_100167746 3300005563 Bacteria 2488
86 Ga0068855_100209693 3300005563 Bacteria 2190
87 Ga0068855_100984625 3300005563 Bacteria 887
88 Ga0068855_101114295 3300005563 Bacteria 824
89 Ga0068855_101650102 3300005563 Bacteria 655
90 Ga0068857_100002984 3300005577 Bacteria 13950
91 Ga0068857_100275842 3300005577 Bacteria 1546
92 Ga0068857_100494645 3300005577 Bacteria 1147
93 Ga0068854_101373225 3300005578 Bacteria 638
94 Ga0068856_100040400 3300005614 Bacteria 4582
95 Ga0068856_100056191 3300005614 Bacteria 3883
96 Ga0068856_100065521 3300005614 Bacteria 3591
97 Ga0068856_100201556 3300005614 Bacteria 2004
98 Ga0068856_100296655 3300005614 Bacteria 1634
99 Ga0068856_100533508 3300005614 Bacteria 1195
100 Ga0068856_101073892 3300005614 Bacteria 823
101 Ga0068852_100069820 3300005616 Bacteria 3080
102 Ga0068852_100793296 3300005616 Bacteria 961
103 Ga0068852_100886767 3300005616 Bacteria 909
104 Ga0068859_100462788 3300005617 Bacteria 1364
105 Ga0068864_100080524 3300005618 Bacteria 2853
106 Ga0068864_100118513 3300005618 Bacteria 2364
107 Ga0068861_100166387 3300005719 Bacteria 1823
108 Ga0068851_10000020 3300005834 Bacteria 133551
109 Ga0068870_10134526 3300005840 Bacteria 1440
110 Ga0068863_100058611 3300005841 Bacteria 3643
111 Ga0068858_100000233 3300005842 Bacteria 60097
112 Ga0068862_100389872 3300005844 Bacteria 1301
113 Ga0068862_101252275 3300005844 Bacteria 742
114 Ga0081540_1008305 3300005983 Bacteria 7264
115 Ga0081539_10000432 3300005985 Bacteria 89138
116 Ga0081539_10061848 3300005985 Bacteria 2049
117 Ga0081539_10135194 3300005985 Bacteria 1206
118 Ga0070717_11589490 3300006028 Bacteria 593
119 Ga0075365_10014081 3300006038 Bacteria 4804
120 Ga0075365_10016040 3300006038 Bacteria 4545
121 Ga0075365_10151737 3300006038 Bacteria 1612
122 Ga0075365_10487849 3300006038 Bacteria 871
123 Ga0075365_10509142 3300006038 Bacteria 851
124 Ga0075364_10000664 3300006051 Bacteria 17846
125 Ga0075364_10006010 3300006051 Bacteria 7096
126 Ga0075364_10072297 3300006051 Bacteria 2273
127 Ga0075364_10094417 3300006051 Bacteria 1987
128 Ga0075364_10244267 3300006051 Bacteria 1220
129 Ga0075364_10354878 3300006051 Bacteria 1000
130 Ga0070712_100500165 3300006175 Bacteria 1019
131 Ga0075369_10007782 3300006186 Bacteria 4098
132 Ga0075369_10039734 3300006186 Bacteria 2010
133 Ga0075369_10048476 3300006186 Bacteria 1833
134 Ga0075369_10222376 3300006186 Bacteria 874
135 Ga0075369_10538361 3300006186 Bacteria 557
136 Ga0075366_10431814 3300006195 Bacteria 812
137 Ga0075370_10771516 3300006353 Bacteria 586
138 Ga0075428_101876510 3300006844 Bacteria 623
139 Ga0097620_100462766 3300006931 Bacteria 1364
140 Ga0105244_10035710 3300009036 Bacteria 2610
141 Ga0105240_10002356 3300009093 Bacteria 30453
142 Ga0105240_10122729 3300009093 Bacteria 3126
143 Ga0111539_10455066 3300009094 Bacteria 1490
144 Ga0111539_10499896 3300009094 Bacteria 1416
145 Ga0105245_10051261 3300009098 Bacteria 3700
146 Ga0105245_10082967 3300009098 Bacteria 2933
147 Ga0105247_10091905 3300009101 Bacteria 1928
148 Ga0105247_11016577 3300009101 Bacteria 648
149 Ga0105243_10436524 3300009148 Bacteria 1225
150 Ga0105243_10717885 3300009148 Bacteria 976
151 Ga0105243_11195879 3300009148 Bacteria 773
152 Ga0105243_11745416 3300009148 Bacteria 652
153 Ga0105241_10000260 3300009174 Bacteria 39516
154 Ga0105241_10223011 3300009174 Bacteria 1586
155 Ga0105241_10317717 3300009174 Bacteria 1342
156 Ga0105248_10000714 3300009177 Bacteria 37567
157 Ga0105248_10162370 3300009177 Bacteria 2519
158 Ga0105237_10006375 3300009545 Bacteria 13100
159 Ga0105237_10505764 3300009545 Bacteria 1215
160 Ga0105237_10552930 3300009545 Bacteria 1158
161 Ga0105237_11779993 3300009545 Bacteria 624
162 Ga0105238_10023651 3300009551 Bacteria 6260
163 Ga0105238_10088136 3300009551 Bacteria 3090
164 Ga0105238_10702738 3300009551 Bacteria 1023
165 Ga0105238_11551022 3300009551 Bacteria 692
166 Ga0105238_12054234 3300009551 Bacteria 605
167 Ga0105249_11645121 3300009553 Bacteria 715
168 Ga0105239_10388730 3300010375 Bacteria 1578
169 Ga0105239_11618225 3300010375 Bacteria 749
170 Ga0105246_10046591 3300011119 Bacteria 2958
171 Ga0157373_10584333 3300013100 Bacteria 812
172 Ga0157371_10001714 3300013102 Bacteria 22297
173 Ga0157371_10890684 3300013102 Bacteria 674
174 Ga0157370_10040958 3300013104 Bacteria 4471
175 Ga0157370_10723688 3300013104 Bacteria 907
176 Ga0157370_11194763 3300013104 Bacteria 686
177 Ga0157370_11325577 3300013104 Bacteria 648
178 Ga0157370_11398024 3300013104 Bacteria 630
179 Ga0157369_10003460 3300013105 Bacteria 18728
180 Ga0157369_10065475 3300013105 Bacteria 3911
181 Ga0157369_10202739 3300013105 Bacteria 2082
182 Ga0157369_10304610 3300013105 Bacteria 1657
183 Ga0157369_10428088 3300013105 Bacteria 1372
184 Ga0157369_12346345 3300013105 Bacteria 541
185 Ga0157374_10196136 3300013296 Bacteria 1976
186 Ga0157374_10302225 3300013296 Bacteria 1583
187 Ga0157374_11711662 3300013296 Bacteria 654
188 Ga0163162_11222628 3300013306 Bacteria 853
189 Ga0157372_10050676 3300013307 Bacteria 4617
190 Ga0157372_10090442 3300013307 Bacteria 3480
191 Ga0157372_10497005 3300013307 Bacteria 1422
192 Ga0157372_10679855 3300013307 Bacteria 1198
193 Ga0157375_10089812 3300013308 Bacteria 3129
194 Ga0157375_10682888 3300013308 Bacteria 1181
195 Ga0157375_11164253 3300013308 Bacteria 904
196 Ga0157375_12954239 3300013308 Bacteria 568
197 Ga0163163_10048647 3300014325 Bacteria 4170
198 Ga0163163_13104411 3300014325 Bacteria 518
199 Ga0157380_10068168 3300014326 Bacteria 2867
200 Ga0157380_10935531 3300014326 Bacteria 896
201 Ga0157380_11498048 3300014326 Bacteria 728
202 Ga0157380_13127510 3300014326 Bacteria 528
203 Ga0157380_13302440 3300014326 Bacteria 516
204 Ga0157377_10864988 3300014745 Bacteria 673
205 Ga0157377_10894545 3300014745 Bacteria 663
206 Ga0157379_10014539 3300014968 Bacteria 6907
207 Ga0157376_10186528 3300014969 Bacteria 1899
208 Ga0163161_10801294 3300017792 Bacteria 792
209 Ga0163161_10985481 3300017792 Bacteria 719
210 Ga0197907_10314249 3300020069 Bacteria 507
211 Ga0197907_10417701 3300020069 Bacteria 597
212 Ga0197907_10693143 3300020069 Bacteria 1165
213 Ga0206356_11397704 3300020070 Bacteria 1937
214 Ga0206356_11659145 3300020070 Bacteria 1083
215 Ga0206349_1042834 3300020075 Bacteria 548
216 Ga0206349_1596473 3300020075 Bacteria 685
217 Ga0206355_1252865 3300020076 Bacteria 511
218 Ga0206355_1392808 3300020076 Bacteria 2286
219 Ga0206351_10564076 3300020077 Bacteria 554
220 Ga0206351_10579387 3300020077 Bacteria 550
221 Ga0206350_10544471 3300020080 Bacteria 551
222 Ga0206354_11320637 3300020081 Bacteria 1095
223 Ga0206353_11470238 3300020082 Bacteria 684
224 Ga0206353_11734878 3300020082 Bacteria 7424
225 Ga0206353_11788619 3300020082 Bacteria 505
226 Ga0154015_1609341 3300020610 Bacteria 853
227 Ga0224712_10029729 3300022467 Bacteria 1965
228 Ga0224712_10534805 3300022467 Bacteria 569
229 Ga0209566_100149 3300025225 Bacteria 81626
230 Ga0209674_100001 3300025226 Bacteria 4013750
231 Ga0209674_118106 3300025226 Bacteria 562
232 Ga0209672_100006 3300025228 Bacteria 1004497
233 Ga0209147_100849 3300025229 Bacteria 14329
234 Ga0209563_100001 3300025230 Bacteria 4013775
235 Ga0209563_100381 3300025230 Bacteria 16054
236 Ga0207427_100010 3300025231 Bacteria 648610
237 Ga0209437_100216 3300025233 Bacteria 106353
238 Ga0209258_105279 3300025242 Bacteria 2231
239 Ga0209646_1000071 3300025246 Bacteria 228702
240 Ga0209677_100001 3300025253 Bacteria 4013787
241 Ga0209677_106708 3300025253 Bacteria 2647
242 Ga0209677_118312 3300025253 Bacteria 856
243 Ga0209148_1000015 3300025254 Bacteria 850103
244 Ga0209148_1001437 3300025254 Bacteria 12129
245 Ga0209148_1015796 3300025254 Bacteria 1311
246 Ga0209129_1049499 3300025258 Bacteria 645
247 Ga0209233_1000001 3300025261 Bacteria 2992747
248 Ga0209233_1040674 3300025261 Bacteria 1010
249 Ga0209455_1000013 3300025272 Bacteria 850103
250 Ga0209455_1000811 3300025272 Bacteria 17057
251 Ga0209025_1131806 3300025294 Bacteria 725
252 Ga0209051_1079735 3300025303 Bacteria 949
253 Ga0207656_10000003 3300025321 Bacteria 771644
254 Ga0207655_1083647 3300025728 Bacteria 1143
255 Ga0207655_1092600 3300025728 Bacteria 1060
256 Ga0207682_10215817 3300025893 Bacteria 886
257 Ga0207710_10073034 3300025900 Bacteria 1577
258 Ga0207710_10367985 3300025900 Bacteria 734
259 Ga0207688_10074090 3300025901 Bacteria 1936
260 Ga0207647_10006593 3300025904 Bacteria 8436
261 Ga0207647_10025066 3300025904 Bacteria 3926
262 Ga0207647_10069180 3300025904 Bacteria 2134
263 Ga0207647_10112805 3300025904 Bacteria 1606
264 Ga0207647_10381968 3300025904 Bacteria 795
265 Ga0207645_10128671 3300025907 Bacteria 1647
266 Ga0207643_10032675 3300025908 Bacteria 2907
267 Ga0207705_10000006 3300025909 Bacteria 657147
268 Ga0207705_10008164 3300025909 Bacteria 7667
269 Ga0207705_10025391 3300025909 Bacteria 4229
270 Ga0207705_10234676 3300025909 Bacteria 1396
271 Ga0207705_10330783 3300025909 Bacteria 1172
272 Ga0207705_10455403 3300025909 Bacteria 992
273 Ga0207654_10000003 3300025911 Bacteria 1030378
274 Ga0207695_10028611 3300025913 Bacteria 6173
275 Ga0207695_10037783 3300025913 Bacteria 5207
276 Ga0207671_10000002 3300025914 Bacteria 1144816
277 Ga0207671_10021409 3300025914 Bacteria 4905
278 Ga0207671_10260553 3300025914 Bacteria 1365
279 Ga0207671_10912622 3300025914 Bacteria 694
280 Ga0207693_10455530 3300025915 Bacteria 999
281 Ga0207657_10016489 3300025919 Bacteria 7124
282 Ga0207657_10571599 3300025919 Bacteria 883
283 Ga0207649_10031676 3300025920 Bacteria 3145
284 Ga0207694_10000433 3300025924 Bacteria 38856
285 Ga0207694_10609233 3300025924 Bacteria 919
286 Ga0207650_10657095 3300025925 Bacteria 884
287 Ga0207659_10552450 3300025926 Bacteria 979
288 Ga0207687_10014147 3300025927 Bacteria 5219
289 Ga0207687_10063542 3300025927 Bacteria 2614
290 Ga0207664_10612575 3300025929 Bacteria 978
291 Ga0207690_10001456 3300025932 Bacteria 14803
292 Ga0207690_10054780 3300025932 Bacteria 2683
293 Ga0207690_11102840 3300025932 Bacteria 662
294 Ga0207709_10469910 3300025935 Bacteria 976
295 Ga0207709_10666094 3300025935 Bacteria 830
296 Ga0207709_11334717 3300025935 Bacteria 593
297 Ga0207691_10881965 3300025940 Bacteria 749
298 Ga0207711_10001536 3300025941 Bacteria 21399
299 Ga0207711_10015358 3300025941 Bacteria 6354
300 Ga0207689_10023007 3300025942 Bacteria 5235
301 Ga0207689_10327561 3300025942 Bacteria 1272
302 Ga0207661_10347334 3300025944 Bacteria 1338
303 Ga0207667_10003435 3300025949 Bacteria 19553
304 Ga0207667_10037351 3300025949 Bacteria 5192
305 Ga0207667_10076583 3300025949 Bacteria 3471
306 Ga0207667_10126813 3300025949 Bacteria 2629
307 Ga0207667_10248984 3300025949 Bacteria 1818
308 Ga0207667_10373541 3300025949 Bacteria 1453
309 Ga0207667_10620803 3300025949 Bacteria 1089
310 Ga0207667_10661703 3300025949 Bacteria 1049
311 Ga0207668_10116597 3300025972 Bacteria 2014
312 Ga0207668_11117741 3300025972 Bacteria 707
313 Ga0207658_10031506 3300025986 Bacteria 3766
314 Ga0207677_10497308 3300026023 Bacteria 1053
315 Ga0207703_10000044 3300026035 Bacteria 158471
316 Ga0207639_10021744 3300026041 Bacteria 4610
317 Ga0207639_11268143 3300026041 Bacteria 692
318 Ga0207678_10162131 3300026067 Bacteria 1909
319 Ga0207678_10505473 3300026067 Bacteria 1054
320 Ga0207678_11092098 3300026067 Bacteria 706
321 Ga0207702_10090684 3300026078 Bacteria 2675
322 Ga0207702_10181739 3300026078 Bacteria 1937
323 Ga0207702_10279247 3300026078 Bacteria 1578
324 Ga0207702_11363217 3300026078 Bacteria 703
325 Ga0207641_10366149 3300026088 Bacteria 1377
326 Ga0207676_10100649 3300026095 Bacteria 2395
327 Ga0207674_10004904 3300026116 Bacteria 16013
328 Ga0207674_10674934 3300026116 Bacteria 998
329 Ga0207674_10683890 3300026116 Bacteria 990
330 Ga0207675_100118687 3300026118 Bacteria 2501
331 Ga0207698_10001186 3300026142 Bacteria 15193
332 Ga0207698_10504036 3300026142 Bacteria 1178
333 Ga0207698_11549342 3300026142 Bacteria 678
334 Ga0207698_11927699 3300026142 Bacteria 605
335 Ga0268266_11686848 3300028379 Bacteria 609
336 Ga0268265_11595556 3300028380 Bacteria 657
337 Ga0265334_10001006 3300028573 Bacteria 13893
338 Ga0307515_10203988 3300028794 Bacteria 1844
339 Ga0307515_10344049 3300028794 Bacteria 1142
340 Ga0307515_10923090 3300028794 Bacteria 506
341 Ga0307513_10507126 3300031456 Bacteria 923
342 Ga0307509_10134492 3300031507 Bacteria 2421
343 Ga0307408_100262656 3300031548 Bacteria 1430
344 Ga0307514_10427685 3300031649 Bacteria 662
345 Ga0316575_10000026 3300031665 Bacteria 35925
346 Ga0316576_10608975 3300031727 Bacteria 797
347 Ga0307405_10497777 3300031731 Bacteria 976
348 Ga0307405_10541090 3300031731 Bacteria 941
349 Ga0307405_10650684 3300031731 Bacteria 867
350 Ga0307413_10130391 3300031824 Bacteria 1720
351 Ga0307410_11092339 3300031852 Bacteria 691
352 Ga0307410_11819142 3300031852 Bacteria 541
353 Ga0307406_10000235 3300031901 Bacteria 33683
354 Ga0307406_10000548 3300031901 Bacteria 21663
355 Ga0307406_10020290 3300031901 Bacteria 3912
356 Ga0307406_10097957 3300031901 Bacteria 1990
357 Ga0307406_10308533 3300031901 Bacteria 1219
358 Ga0307407_10346411 3300031903 Bacteria 1051
359 Ga0307407_11709533 3300031903 Bacteria 501
360 Ga0307412_11361548 3300031911 Bacteria 641
361 Ga0307409_101120909 3300031995 Bacteria 808
362 Ga0307409_102077542 3300031995 Bacteria 598
363 Ga0307416_100020599 3300032002 Bacteria 4711
364 Ga0307416_101158349 3300032002 Bacteria 878
365 Ga0307416_103565838 3300032002 Bacteria 521
366 Ga0307414_10164755 3300032004 Bacteria 1765
367 Ga0307414_10256236 3300032004 Bacteria 1457
368 Ga0307414_10398261 3300032004 Bacteria 1195
369 Ga0307414_10537095 3300032004 Bacteria 1040
370 Ga0307414_10572465 3300032004 Bacteria 1009
371 Ga0307414_10664597 3300032004 Bacteria 940
372 Ga0307414_10738533 3300032004 Bacteria 894
373 Ga0307414_10811145 3300032004 Bacteria 854
374 Ga0307414_11930979 3300032004 Bacteria 551
375 Ga0307411_10443118 3300032005 Bacteria 1084
376 Ga0307411_10667529 3300032005 Bacteria 902
377 Ga0307415_100076204 3300032126 Bacteria 2377
378 Ga0307415_100658201 3300032126 Bacteria 940
379 Ga0316587_1049386 3300033529 Bacteria 769
380 Ga0316596_1021855 3300033541 Bacteria 1633
381 Ga0395899_0007061 3300037312 Bacteria 8692
382 Ga0395899_0575678 3300037312 Bacteria 720
383 Ga0395900_0000774 3300037418 Bacteria 42584
384 Ga0395900_0178902 3300037418 Bacteria 2156
385 Ga0395900_0280888 3300037418 Bacteria 1657
386 Ga0395900_1694093 3300037418 Bacteria 543
387 Ga0395898_0000015 3300037466 Bacteria 439819
388 Ga0395898_0018267 3300037466 Bacteria 7151
389 Ga0395901_0023475 3300038443 Bacteria 6324
390 Ga0395901_0033400 3300038443 Bacteria 5312
391 Ga0395901_0791629 3300038443 Bacteria 938
392 Ga0436363_0269928 3300039450 Bacteria 1153
393 Ga0439465_0097231 3300041413 Bacteria 1013
394 Ga0439465_0109232 3300041413 Bacteria 961
395 Ga0439465_0122093 3300041413 Bacteria 914
396 Ga0451787_134054 3300041441 Bacteria 561
397 Ga0451787_619344 3300041441 Bacteria 572
398 Ga0451789_0062393 3300041443 Bacteria 953
399 Ga0451791_0106859 3300041451 Bacteria 988
400 Ga0451791_1080276 3300041451 Bacteria 781
401 Ga0451793_0891968 3300041452 Bacteria 1336
402 Ga0451797_0342964 3300041453 Bacteria 561
403 Ga0451797_0419015 3300041453 Bacteria 867
404 Ga0451797_0977833 3300041453 Bacteria 556
405 Ga0451800_1222319 3300041459 Bacteria 506
406 Ga0451806_482414 3300041462 Bacteria 1275
407 Ga0451806_769506 3300041462 Bacteria 1095
408 Ga0451837_0986096 3300041494 Bacteria 1091
409 Ga0451837_1152760 3300041494 Bacteria 739
410 Ga0451837_1777354 3300041494 Bacteria 532
411 Ga0451841_0952906 3300041498 Bacteria 813
412 Ga0451841_1254032 3300041498 Bacteria 662
413 Ga0451849_1108743 3300041505 Bacteria 755
414 Ga0451843_0095480 3300041509 Bacteria 561
415 Ga0451843_0345566 3300041509 Bacteria 659
416 Ga0451853_2924470 3300041512 Bacteria 603
417 Ga0451853_3391059 3300041512 Bacteria 741
418 Ga0450907_050908 3300042146 Bacteria 712
419 Ga0466972_0022794 3300044658 Bacteria 3116
420 Ga0466972_0050505 3300044658 Bacteria 2007
421 Ga0466972_0086023 3300044658 Bacteria 1494
422 Ga0466972_0519027 3300044658 Bacteria 561
423 Ga0466965_0005583 3300044683 Bacteria 5676
424 Ga0466965_0015519 3300044683 Bacteria 3618
425 Ga0466965_0509897 3300044683 Bacteria 675
426 Ga0466965_0916937 3300044683 Bacteria 512
427 Ga0466966_0016995 3300044684 Bacteria 4808
428 Ga0466966_0388569 3300044684 Bacteria 838
429 Ga0466961_0240754 3300044693 Bacteria 1112
430 Ga0466961_0302203 3300044693 Bacteria 977
431 Ga0466961_0302257 3300044693 Bacteria 977
432 Ga0466961_0339107 3300044693 Bacteria 915
433 Ga0466964_0299131 3300044706 Bacteria 811
434 Ga0466971_0026655 3300044719 Bacteria 2584
435 Ga0466971_0055105 3300044719 Bacteria 1792
436 Ga0466968_0023017 3300044735 Bacteria 2536
437 Ga0466968_0503310 3300044735 Bacteria 604
438 Ga0466970_0011041 3300044765 Bacteria 4598
439 Ga0466970_0052295 3300044765 Bacteria 2180
440 Ga0466970_0079419 3300044765 Bacteria 1771
441 Ga0466970_0081797 3300044765 Bacteria 1746
442 Ga0466970_0120196 3300044765 Bacteria 1438
443 Ga0466970_0289161 3300044765 Bacteria 923
444 Ga0466970_0470447 3300044765 Bacteria 722
445 Ga0466957_0056094 3300044842 Bacteria 2408
446 Ga0466957_0108420 3300044842 Bacteria 1759
447 Ga0466957_0515504 3300044842 Bacteria 830
448 Ga0466960_0020915 3300044901 Bacteria 2906
449 Ga0466960_0030828 3300044901 Bacteria 2470
450 Ga0466960_0032143 3300044901 Bacteria 2427
451 Ga0466960_0134629 3300044901 Bacteria 1308
452 Ga0466960_0794800 3300044901 Bacteria 572
453 Ga0466959_0050215 3300045049 Bacteria 3062
454 Ga0466959_0059052 3300045049 Bacteria 2793
455 Ga0466959_0376557 3300045049 Bacteria 966
456 Ga0466959_0455199 3300045049 Bacteria 867
457 Ga0466958_0021235 3300045836 Bacteria 3792
458 Ga0466958_0077002 3300045836 Bacteria 2048
459 Ga0466958_0279983 3300045836 Bacteria 1069
460 Ga0466958_0699823 3300045836 Bacteria 660
461 Ga0466967_0307540 3300045976 Bacteria 1526
462 Ga0466967_0698701 3300045976 Bacteria 1004
463 Ga0466967_0787257 3300045976 Bacteria 944
464 Ga0495590_0000612 3300046457 Bacteria 16650
465 Ga0495638_0202553 3300046460 Bacteria 1119
466 Ga0495650_0005523 3300046471 Bacteria 8173
467 Ga0495650_0097309 3300046471 Bacteria 1110
468 Ga0495650_0308833 3300046471 Bacteria 528
469 Ga0495620_0362472 3300046515 Bacteria 549
470 Ga0495628_0280445 3300046516 Bacteria 1238
471 Ga0495609_0353690 3300046538 Bacteria 592
472 Ga0495645_0066284 3300046543 Bacteria 2610
473 Ga0495656_0005765 3300046615 Bacteria 4300
474 Ga0495656_0044965 3300046615 Bacteria 1862
475 Ga0495625_0262604 3300046660 Bacteria 1117
476 Ga0495670_0427055 3300046691 Bacteria 717
477 Ga0495649_0305702 3300046694 Bacteria 809
478 Ga0495589_0104089 3300046794 Bacteria 1372
479 Ga0495672_0038657 3300047320 Bacteria 2909
480 Ga0495615_0108346 3300048090 Bacteria 792
481 Ga0496100_0026172 3300048903 Bacteria 3574
482 Ga0496100_0096739 3300048903 Bacteria 2026
483 Ga0496101_0018547 3300048904 Bacteria 4733
484 Ga0496101_0107724 3300048904 Bacteria 2094
485 Ga0496102_0088257 3300048905 Bacteria 2866
486 Ga0496102_0392047 3300048905 Bacteria 1306
487 Ga0496104_0032709 3300048907 Bacteria 4841
488 Ga0496104_0292885 3300048907 Bacteria 1540
489 Ga0496105_0011758 3300048908 Bacteria 6926
490 Ga0496105_0108308 3300048908 Bacteria 2294
491 Ga0496105_0160742 3300048908 Bacteria 1844
492 Ga0496105_0246297 3300048908 Bacteria 1449
493 Ga0496107_0114841 3300048910 Bacteria 1981
494 Ga0496107_0756380 3300048910 Bacteria 713
495 Ga0496113_0082756 3300048916 Bacteria 2462
496 Ga0496113_0153110 3300048916 Bacteria 1820
497 Ga0496114_0054500 3300048917 Bacteria 3334
498 Ga0496114_0055755 3300048917 Bacteria 3296
499 Ga0496114_0058054 3300048917 Bacteria 3231
500 Ga0496115_0007443 3300048918 Bacteria 8056
501 Ga0496115_0049048 3300048918 Bacteria 3378
502 Ga0496115_0429380 3300048918 Bacteria 1069
503 Ga0496116_0003139 3300048919 Bacteria 16570
504 Ga0496117_0000232 3300048920 Bacteria 105479
505 Ga0496117_0000737 3300048920 Bacteria 51396
506 Ga0496117_0004850 3300048920 Bacteria 14534
507 Ga0496117_0005578 3300048920 Bacteria 13171
508 Ga0496117_0014558 3300048920 Bacteria 6768
509 Ga0496117_0054113 3300048920 Bacteria 2814
510 Ga0496117_0059591 3300048920 Bacteria 2635
511 Ga0496117_0067492 3300048920 Bacteria 2420
512 Ga0496117_0108514 3300048920 Bacteria 1736
513 Ga0496117_0116493 3300048920 Bacteria 1651
514 Ga0496117_0217421 3300048920 Bacteria 1066
515 Ga0496118_0003838 3300048921 Bacteria 18487
516 Ga0496118_0008605 3300048921 Bacteria 10505
517 Ga0496118_0105465 3300048921 Bacteria 1889
518 Ga0496118_0139720 3300048921 Bacteria 1538
519 Ga0496118_0182578 3300048921 Bacteria 1266
520 Ga0496118_0375170 3300048921 Bacteria 748
521 Ga0496118_0521608 3300048921 Bacteria 586
522 Ga0496119_0001875 3300048922 Bacteria 24260
523 Ga0496119_0002098 3300048922 Bacteria 22484
524 Ga0496119_0009311 3300048922 Bacteria 8449
525 Ga0496119_0017986 3300048922 Bacteria 5286
526 Ga0496119_0323337 3300048922 Bacteria 754
527 Ga0496119_0398745 3300048922 Bacteria 657
528 Ga0496120_0000456 3300048923 Bacteria 64535
529 Ga0496120_0001183 3300048923 Bacteria 33176
530 Ga0496120_0001794 3300048923 Bacteria 24093
531 Ga0496120_0001809 3300048923 Bacteria 23936
532 Ga0496120_0008433 3300048923 Bacteria 7482
533 Ga0496120_0016059 3300048923 Bacteria 4908
534 Ga0496120_0022428 3300048923 Bacteria 3972
535 Ga0496120_0072145 3300048923 Bacteria 1893
536 Ga0496121_0075900 3300048924 Bacteria 2683
537 Ga0496121_0313982 3300048924 Bacteria 1058
538 Ga0496122_0000030 3300048925 Bacteria 331586
539 Ga0496122_0000120 3300048925 Bacteria 182539
540 Ga0496122_0009370 3300048925 Bacteria 10337
541 Ga0496122_0014164 3300048925 Bacteria 7733
542 Ga0496122_0194503 3300048925 Bacteria 1193
543 Ga0496122_0249394 3300048925 Bacteria 994
544 Ga0496122_0373829 3300048925 Bacteria 734
545 Ga0496123_0000024 3300048926 Bacteria 331587
546 Ga0496123_0000051 3300048926 Bacteria 237095
547 Ga0496123_0001799 3300048926 Bacteria 28218
548 Ga0496123_0045565 3300048926 Bacteria 2986
549 Ga0496124_0005016 3300048927 Bacteria 15139
550 Ga0496124_0008086 3300048927 Bacteria 11056
551 Ga0496124_0070691 3300048927 Bacteria 2894
552 Ga0496124_0124392 3300048927 Bacteria 2056
553 Ga0496124_0322356 3300048927 Bacteria 1105
554 Ga0496124_0692362 3300048927 Bacteria 647
555 Ga0496125_0001405 3300048928 Bacteria 35141
556 Ga0496125_0016870 3300048928 Bacteria 6992
557 Ga0496125_0017389 3300048928 Bacteria 6858
558 Ga0496125_0071871 3300048928 Bacteria 2700
559 Ga0496125_0177610 3300048928 Bacteria 1423
560 Ga0496126_0001194 3300048929 Bacteria 42334
561 Ga0496126_0005417 3300048929 Bacteria 14558
562 Ga0496126_0019688 3300048929 Bacteria 6641
563 Ga0496126_0029608 3300048929 Bacteria 5200
564 Ga0496126_0030513 3300048929 Bacteria 5105
565 Ga0496126_0054593 3300048929 Bacteria 3617
566 Ga0496126_0117274 3300048929 Bacteria 2313
567 Ga0496126_0149987 3300048929 Bacteria 1999
568 Ga0496126_0459928 3300048929 Bacteria 1023
569 Ga0496126_0633464 3300048929 Bacteria 839
570 Ga0501306_035622 3300049127 Bacteria 756
571 Ga0501306_042829 3300049127 Bacteria 706
572 Ga0501309_026745 3300049129 Bacteria 834
573 Ga0501305_010456 3300049161 Bacteria 1239
574 Ga0501311_088638 3300049527 Bacteria 535
575 Ga0501312_076950 3300049528 Bacteria 599
576 Ga0501313_059873 3300049529 Bacteria 538
577 Ga0501315_056205 3300049531 Bacteria 628
578 Ga0501315_095497 3300049531 Bacteria 520
579 Ga0501317_004714 3300049533 Bacteria 1431
580 Ga0501318_009202 3300049534 Bacteria 1072
581 Ga0501321_011313 3300049537 Bacteria 993
582 Ga0501323_061423 3300049539 Bacteria 587
583 Ga0501031_0202098 3300049568 Bacteria 1296
584 Ga0501031_0211242 3300049568 Bacteria 1264
585 Ga0501031_0271693 3300049568 Bacteria 1100
586 Ga0501032_0009953 3300049569 Bacteria 6865
587 Ga0501032_0013515 3300049569 Bacteria 5804
588 Ga0501032_0072404 3300049569 Bacteria 2297
589 Ga0501032_0088939 3300049569 Bacteria 2050
590 Ga0501032_0427289 3300049569 Bacteria 850
591 Ga0501032_0823759 3300049569 Bacteria 586
592 Ga0501033_0009978 3300049570 Bacteria 7292
593 Ga0501033_0010126 3300049570 Bacteria 7236
594 Ga0501033_0037603 3300049570 Bacteria 3622
595 Ga0501033_0048914 3300049570 Bacteria 3140
596 Ga0501033_0086936 3300049570 Bacteria 2288
597 Ga0501033_0093765 3300049570 Bacteria 2195
598 Ga0501033_0831184 3300049570 Bacteria 623
599 Ga0501034_0000227 3300049571 Bacteria 106244
600 Ga0501034_0005786 3300049571 Bacteria 13445
601 Ga0501034_0009960 3300049571 Bacteria 9934
602 Ga0501034_0015321 3300049571 Bacteria 7880
603 Ga0501034_0016806 3300049571 Bacteria 7502
604 Ga0501034_0019532 3300049571 Bacteria 6930
605 Ga0501034_0039777 3300049571 Bacteria 4762
606 Ga0501034_0063939 3300049571 Bacteria 3693
607 Ga0501034_0067958 3300049571 Bacteria 3575
608 Ga0501034_0085814 3300049571 Bacteria 3149
609 Ga0501034_0171817 3300049571 Bacteria 2134
610 Ga0501034_0172624 3300049571 Bacteria 2128
611 Ga0501034_0194756 3300049571 Bacteria 1987
612 Ga0501034_0241599 3300049571 Bacteria 1752
613 Ga0501034_0686191 3300049571 Bacteria 923
614 Ga0501034_0708609 3300049571 Bacteria 904
615 Ga0501034_0875444 3300049571 Bacteria 787
616 Ga0501036_0015582 3300049572 Bacteria 6349
617 Ga0501036_0098223 3300049572 Bacteria 2475
618 Ga0501036_0100885 3300049572 Bacteria 2441
619 Ga0501036_0129312 3300049572 Bacteria 2132
620 Ga0501037_0000671 3300049573 Bacteria 26204
621 Ga0501037_0027690 3300049573 Bacteria 4188
622 Ga0501037_0029509 3300049573 Bacteria 4052
623 Ga0501037_0032155 3300049573 Bacteria 3873
624 Ga0501037_0094752 3300049573 Bacteria 2158
625 Ga0501037_0094895 3300049573 Bacteria 2156
626 Ga0501037_0103443 3300049573 Bacteria 2054
627 Ga0501037_0115191 3300049573 Bacteria 1935
628 Ga0501037_0181934 3300049573 Bacteria 1491
629 Ga0501037_0250708 3300049573 Bacteria 1239
630 Ga0501038_0000454 3300049574 Bacteria 35793
631 Ga0501038_0039749 3300049574 Bacteria 4114
632 Ga0501038_0041553 3300049574 Bacteria 4009
633 Ga0501038_0068332 3300049574 Bacteria 3020
634 Ga0501038_0070034 3300049574 Bacteria 2978
635 Ga0501038_0164977 3300049574 Bacteria 1797
636 Ga0501038_0225008 3300049574 Bacteria 1495
637 Ga0501038_0943342 3300049574 Bacteria 635
638 Ga0501039_0016493 3300049575 Bacteria 5658
639 Ga0501039_0065536 3300049575 Bacteria 2818
640 Ga0501039_0067506 3300049575 Bacteria 2777
641 Ga0501039_0145653 3300049575 Bacteria 1861
642 Ga0501039_0371323 3300049575 Bacteria 1124
643 Ga0501040_0003391 3300049576 Bacteria 10280
644 Ga0501041_0120590 3300049577 Bacteria 1629
645 Ga0501041_0842386 3300049577 Bacteria 588
646 Ga0501042_0061222 3300049578 Bacteria 2689
647 Ga0501042_0098051 3300049578 Bacteria 2107
648 Ga0501042_0175344 3300049578 Bacteria 1547
649 Ga0501042_0366605 3300049578 Bacteria 1042
650 Ga0501042_0861660 3300049578 Bacteria 659
651 Ga0501043_0002454 3300049579 Bacteria 15682
652 Ga0501043_0008078 3300049579 Bacteria 8305
653 Ga0501043_0018745 3300049579 Bacteria 5429
654 Ga0501043_0024603 3300049579 Bacteria 4725
655 Ga0501043_0089797 3300049579 Bacteria 2415
656 Ga0501043_0102976 3300049579 Bacteria 2243
657 Ga0501043_0111259 3300049579 Bacteria 2150
658 Ga0501043_0112389 3300049579 Bacteria 2139
659 Ga0501043_0328544 3300049579 Bacteria 1165
660 Ga0501043_0535903 3300049579 Bacteria 871
661 Ga0501046_0002630 3300049580 Bacteria 16774
662 Ga0501046_0007016 3300049580 Bacteria 9925
663 Ga0501046_0014629 3300049580 Bacteria 6610
664 Ga0501046_0018002 3300049580 Bacteria 5888
665 Ga0501046_0070479 3300049580 Bacteria 2718
666 Ga0501046_0106879 3300049580 Bacteria 2141
667 Ga0501046_0283590 3300049580 Bacteria 1213
668 Ga0501047_0000983 3300049581 Bacteria 28745
669 Ga0501047_0002218 3300049581 Bacteria 18603
670 Ga0501047_0031241 3300049581 Bacteria 5136
671 Ga0501047_0032946 3300049581 Bacteria 5003
672 Ga0501047_0035220 3300049581 Bacteria 4835
673 Ga0501047_0046979 3300049581 Bacteria 4171
674 Ga0501047_0101716 3300049581 Bacteria 2753
675 Ga0501047_0192489 3300049581 Bacteria 1902
676 Ga0501047_0202951 3300049581 Bacteria 1843
677 Ga0501048_0043285 3300049582 Bacteria 3224
678 Ga0501048_0065475 3300049582 Bacteria 2569
679 Ga0501048_0112980 3300049582 Bacteria 1918
680 Ga0501048_0223670 3300049582 Bacteria 1335
681 Ga0501048_0705657 3300049582 Bacteria 724
682 Ga0501067_0253134 3300049583 Bacteria 980
683 Ga0501067_0377762 3300049583 Bacteria 790
684 Ga0501068_0774473 3300049584 Bacteria 629
685 Ga0501069_0160844 3300049585 Bacteria 1293
686 Ga0501069_0271572 3300049585 Bacteria 991
687 Ga0501069_0524351 3300049585 Bacteria 708
688 Ga0501070_0000167 3300049586 Bacteria 60680
689 Ga0501070_0003401 3300049586 Bacteria 13809
690 Ga0501070_0024474 3300049586 Bacteria 5064
691 Ga0501070_0071839 3300049586 Bacteria 2865
692 Ga0501070_0084094 3300049586 Bacteria 2635
693 Ga0501070_0237250 3300049586 Bacteria 1493
694 Ga0501070_0541137 3300049586 Bacteria 933
695 Ga0501071_0087215 3300049587 Bacteria 2289
696 Ga0501071_0378714 3300049587 Bacteria 1079
697 Ga0501072_0071815 3300049588 Bacteria 2735
698 Ga0501072_0139399 3300049588 Bacteria 1933
699 Ga0501072_0734019 3300049588 Bacteria 775
700 Ga0501073_0017669 3300049589 Bacteria 5163
701 Ga0501073_0054013 3300049589 Bacteria 2813
702 Ga0501073_0077343 3300049589 Bacteria 2315
703 Ga0501073_0142168 3300049589 Bacteria 1663
704 Ga0501073_0371190 3300049589 Bacteria 988
705 Ga0501073_0918916 3300049589 Bacteria 602
706 Ga0501074_0049308 3300049590 Bacteria 3040
707 Ga0501074_0424789 3300049590 Bacteria 943
708 Ga0501075_0004611 3300049591 Bacteria 9352
709 Ga0501076_0069929 3300049592 Bacteria 2805
710 Ga0501076_1113179 3300049592 Bacteria 650
711 Ga0501077_0420505 3300049593 Bacteria 855
712 Ga0501077_0963720 3300049593 Bacteria 549
713 Ga0501079_0018295 3300049741 Bacteria 5354
714 Ga0501080_0000084 3300049742 Bacteria 62784
715 Ga0501080_0018161 3300049742 Bacteria 6510
716 Ga0501080_0020642 3300049742 Bacteria 6102
717 Ga0501080_0217030 3300049742 Bacteria 1751
718 Ga0501080_0724153 3300049742 Bacteria 876
719 Ga0501080_0994626 3300049742 Bacteria 728
720 Ga0501081_0021306 3300049743 Bacteria 4324
721 Ga0501083_0128965 3300049744 Bacteria 1658
722 Ga0501035_0009087 3300049822 Bacteria 9241
723 Ga0501035_0013503 3300049822 Bacteria 7538
724 Ga0501035_0015949 3300049822 Bacteria 6933
725 Ga0501035_0020737 3300049822 Bacteria 6039
726 Ga0501035_0021800 3300049822 Bacteria 5887
727 Ga0501035_0047185 3300049822 Bacteria 3868
728 Ga0501035_0059173 3300049822 Bacteria 3412
729 Ga0501035_0323430 3300049822 Bacteria 1295
730 Ga0501035_0339508 3300049822 Bacteria 1259
731 Ga0501035_0373953 3300049822 Bacteria 1189
732 Ga0501035_0973007 3300049822 Bacteria 669
733 Ga0501044_0001597 3300049823 Bacteria 26511
734 Ga0501044_0004023 3300049823 Bacteria 16480
735 Ga0501044_0040026 3300049823 Bacteria 4887
736 Ga0501044_0046775 3300049823 Bacteria 4478
737 Ga0501044_0117710 3300049823 Bacteria 2660
738 Ga0501044_0136446 3300049823 Bacteria 2444
739 Ga0501044_0255349 3300049823 Bacteria 1692
740 Ga0501044_0544812 3300049823 Bacteria 1058
741 Ga0501045_0005904 3300049824 Bacteria 8470
742 Ga0501045_0142488 3300049824 Bacteria 1782
743 Ga0501045_0153212 3300049824 Bacteria 1715
744 nmdc:mga03n38_222350_c1 3300050490 Bacteria 986
745 nmdc:mga00v17_126263_c1 3300050491 Bacteria 1632
746 nmdc:mga00v17_171980_c1 3300050491 Bacteria 1397
747 nmdc:mga00v17_207696_c1 3300050491 Bacteria 1267
748 nmdc:mga00v17_324262_c1 3300050491 Bacteria 1001
749 nmdc:mga00v17_372048_c1 3300050491 Bacteria 929
750 nmdc:mga00v17_5626_c1 3300050491 Bacteria 6608
751 nmdc:mga00v17_63564_c1 3300050491 Bacteria 2273
752 nmdc:mga00v17_85051_c1 3300050491 Bacteria 1980
753 nmdc:mga00v17_99382_c1 3300050491 Bacteria 1835
754 nmdc:mga0yw44_522916_c1 3300050492 Bacteria 805
755 nmdc:mga0yw44_7012_c1 3300050492 Bacteria 5510
756 nmdc:mga0yw44_714536_c1 3300050492 Bacteria 681
757 nmdc:mga0yw44_96810_c1 3300050492 Bacteria 1874
758 nmdc:mga06z11_292094_c1 3300050494 Bacteria 967
759 nmdc:mga07m45_43733_c1 3300050496 Bacteria 2511
760 nmdc:mga0qj67_969409_c1 3300050509 Bacteria 668
761 nmdc:mga08y16_1984630_c1 3300050511 Bacteria 531
762 nmdc:mga08y16_571618_c1 3300050511 Bacteria 1142
763 nmdc:mga0sz30_24672_c2 3300050516 Bacteria 1419
764 nmdc:mga0sz30_55559_c1 3300050516 Bacteria 1685
765 nmdc:mga0sz30_5766_c1 3300050516 Bacteria 4560
766 Ga0500635_0000028 3300053080 Bacteria 104398
767 Ga0500635_0255746 3300053080 Bacteria 687
768 Ga0500651_0053181 3300053093 Bacteria 2539
769 Ga0500556_0000393 3300053104 Bacteria 32091
770 Ga0500562_000296 3300053108 Bacteria 12147
771 Ga0500593_000123 3300053117 Bacteria 30512
772 Ga0500628_162534 3300053129 Bacteria 630
773 Ga0500559_0000218 3300053136 Bacteria 46051
774 Ga0500559_0002382 3300053136 Bacteria 9789
775 Ga0500559_0003021 3300053136 Bacteria 8417
776 Ga0500559_0217272 3300053136 Bacteria 902
777 Ga0500568_0000014 3300053139 Bacteria 223550
778 Ga0500568_0004356 3300053139 Bacteria 7575
779 Ga0500568_0015664 3300053139 Bacteria 3390
780 Ga0500568_0018256 3300053139 Bacteria 3074
781 Ga0500588_0336003 3300053146 Bacteria 573
782 Ga0500590_164472 3300053148 Bacteria 984
783 Ga0500616_0000088 3300053153 Bacteria 191662
784 Ga0500616_0001402 3300053153 Bacteria 23217
785 Ga0500616_0003545 3300053153 Bacteria 11827
786 Ga0500616_0037251 3300053153 Bacteria 2634
787 Ga0500620_122830 3300053155 Bacteria 910
788 Ga0501084_0068090 3300054114 Bacteria 2981
789 Ga0501084_0092926 3300054114 Bacteria 2532
790 Ga0501084_0550353 3300054114 Bacteria 975
791 Ga0501084_0705777 3300054114 Bacteria 851
792 Ga0587084_000197 3300059477 Bacteria 3932
793 Ga0587084_116430 3300059477 Bacteria 558
794 Ga0587084_149055 3300059477 Bacteria 513
795 Ga0587070_110923 3300059491 Bacteria 644
796 Ga0587073_0284394 3300059492 Bacteria 532
797 Ga0587077_266122 3300059493 Bacteria 501
798 Ga0587083_0280918 3300059505 Bacteria 507
799 Ga0587085_173807 3300059506 Bacteria 512
800 Ga0587088_001021 3300059508 Bacteria 2731
801 Ga0587091_174772 3300059511 Bacteria 561
802 Ga0587091_207869 3300059511 Bacteria 529
803 Ga0587094_000283 3300059513 Bacteria 3560
804 Ga0587094_108599 3300059513 Bacteria 544
805 Ga0587098_000238 3300059604 Bacteria 2927
806 Ga0587106_000795 3300059605 Bacteria 2479
807 Ga0587106_133668 3300059605 Bacteria 538
808 Ga0587099_053653 3300059622 Bacteria 543
809 Ga0587101_000138 3300059623 Bacteria 3849
810 Ga0587127_027212 3300059629 Bacteria 534
811 Ga0587128_001590 3300059630 Bacteria 2182
812 Ga0587128_110085 3300059630 Bacteria 588
813 Ga0587128_139134 3300059630 Bacteria 544
814 Ga0587128_149068 3300059630 Bacteria 531
815 Ga0587130_040113 3300059631 Bacteria 563
816 Ga0587069_001336 3300059642 Bacteria 2231
817 Ga0587075_087434 3300059644 Bacteria 604
818 Ga0587076_084677 3300059645 Bacteria 683
819 Ga0587076_206946 3300059645 Bacteria 507
820 Ga0587102_026774 3300059649 Bacteria 684
821 Ga0587071_173172 3300060344 Bacteria 550
822 Ga0501082_0011166 3300060353 Bacteria 7721
823 Ga0501082_0159734 3300060353 Bacteria 1958
824 Ga0501082_0219676 3300060353 Bacteria 1653
825 Ga0466962_0036505 3300061719 Bacteria 2352
826 Ga0466962_0071396 3300061719 Bacteria 1659
827 Ga0466962_0187704 3300061719 Bacteria 1008
828 Ga0466962_0724769 3300061719 Bacteria 511
829 Ga0530510_0003798 3300061734 Bacteria 10401

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048916 Ga0496113_0153110 Ga0496113_0153110_324_650 105
2 3300006844 Ga0075428_101876510 Ga0075428_1018765102 106
3 3300026116 Ga0207674_10683890 Ga0207674_106838901 107
4 iso_pu_bacteria 2643221635 2644199404 111
5 iso_pu_bacteria 2811994880 2812364921 111
6 iso_pu_bacteria 2835188231 2835191753 111
7 iso_pu_bacteria 2839986021 2839987157 111
8 iso_pu_bacteria 2844852863 2844855359 111
9 iso_pu_bacteria 2857710386 2857712151 111
10 iso_pu_bacteria 8004212874 8004214379 111
11 iso_pu_bacteria 8056037122 8056037716 111
12 iso_pu_bacteria 8057345674 8057348978 111
13 3300005341 Ga0070691_10431478 Ga0070691_104314781 112
14 3300014326 Ga0157380_13302440 Ga0157380_133024401 112
15 iso_pu_bacteria 2643221549 2643767585 112
16 iso_pu_bacteria 2643221619 2644110890 112
17 iso_pu_bacteria 2721755702 2723642151 112
18 iso_pu_bacteria 2808606372 2808902220 112
19 iso_pu_bacteria 2857720070 2857720562 112
20 iso_pu_bacteria 2862993130 2862996441 112
21 iso_pu_bacteria 2919443155 2919446090 112
22 iso_pu_bacteria 2935409751 2935411520 112
23 iso_pu_bacteria 2939657138 2939657773 112
24 iso_pu_bacteria 8002811521 8002812533 112
25 iso_pu_bacteria 8046352972 8046356297 112
26 3300003203 JGI25406J46586_10013791 JGI25406J46586_100137913 113
27 3300004801 Ga0058860_12007059 Ga0058860_120070591 113
28 3300005334 Ga0068869_100030634 Ga0068869_1000306343 113
29 3300005354 Ga0070675_100373423 Ga0070675_1003734232 113
30 3300005985 Ga0081539_10000432 Ga0081539_1000043238 113
31 3300005985 Ga0081539_10061848 Ga0081539_100618483 113
32 3300013308 Ga0157375_10089812 Ga0157375_100898122 113
33 3300014326 Ga0157380_13127510 Ga0157380_131275101 113
34 3300025926 Ga0207659_10552450 Ga0207659_105524502 113
35 3300025942 Ga0207689_10023007 Ga0207689_100230073 113
36 3300031731 Ga0307405_10541090 Ga0307405_105410901 113
37 3300031903 Ga0307407_10346411 Ga0307407_103464111 113
38 3300031995 Ga0307409_101120909 Ga0307409_1011209092 113
39 3300032002 Ga0307416_100020599 Ga0307416_1000205992 113
40 3300032005 Ga0307411_10443118 Ga0307411_104431182 113
41 3300032126 Ga0307415_100076204 Ga0307415_1000762042 113
42 3300041441 Ga0451787_619344 Ga0451787_619344_87_434 113
43 3300049592 Ga0501076_1113179 Ga0501076_1113179_153_506 113
44 3300059645 Ga0587076_084677 Ga0587076_084677_133_495 113
45 iso_pu_bacteria 2643221542 2643733364 113
46 iso_pu_bacteria 2643221553 2643786151 113
47 iso_pu_bacteria 2643221630 2644169938 113
48 iso_pu_bacteria 2643221632 2644183641 113
49 iso_pu_bacteria 2643221724 2644680543 113
50 iso_pu_bacteria 2728369380 2730230002 113
51 iso_pu_bacteria 2747842429 2747952386 113
52 iso_pu_bacteria 2852646457 2852648704 113
53 iso_pu_bacteria 2852663356 2852666925 113
54 iso_pu_bacteria 2897561785 2897563523 113
55 iso_pu_bacteria 2945968032 2945968127 113
56 iso_pu_bacteria 2946033335 2946033463 113
57 iso_pu_bacteria 2946041624 2946044622 113
58 iso_pu_bacteria 8004182704 8004184849 113
59 3300005544 Ga0070686_101424364 Ga0070686_1014243641 114
60 3300005563 Ga0068855_100984625 Ga0068855_1009846252 114
61 3300009553 Ga0105249_11645121 Ga0105249_116451211 114
62 3300025932 Ga0207690_11102840 Ga0207690_111028401 114
63 3300026078 Ga0207702_10181739 Ga0207702_101817392 114
64 3300044684 Ga0466966_0388569 Ga0466966_0388569_426_785 114
65 3300044693 Ga0466961_0302203 Ga0466961_0302203_565_924 114
66 3300044901 Ga0466960_0794800 Ga0466960_0794800_89_439 114
67 3300045836 Ga0466958_0077002 Ga0466958_0077002_1440_1799 114
68 3300049568 Ga0501031_0202098 Ga0501031_0202098_770_1147 114
69 3300049569 Ga0501032_0009953 Ga0501032_0009953_2636_2986 114
70 3300049571 Ga0501034_0015321 Ga0501034_0015321_6428_6778 114
71 3300049571 Ga0501034_0067958 Ga0501034_0067958_2593_2940 114
72 3300049571 Ga0501034_0875444 Ga0501034_0875444_52_399 114
73 3300049572 Ga0501036_0100885 Ga0501036_0100885_1828_2205 114
74 3300049573 Ga0501037_0027690 Ga0501037_0027690_2243_2620 114
75 3300049573 Ga0501037_0103443 Ga0501037_0103443_1421_1771 114
76 3300049574 Ga0501038_0000454 Ga0501038_0000454_26848_27198 114
77 3300049574 Ga0501038_0039749 Ga0501038_0039749_1747_2124 114
78 3300049575 Ga0501039_0145653 Ga0501039_0145653_528_905 114
79 3300049576 Ga0501040_0003391 Ga0501040_0003391_102_479 114
80 3300049577 Ga0501041_0842386 Ga0501041_0842386_61_438 114
81 3300049578 Ga0501042_0061222 Ga0501042_0061222_1770_2147 114
82 3300049579 Ga0501043_0111259 Ga0501043_0111259_339_716 114
83 3300049579 Ga0501043_0112389 Ga0501043_0112389_1195_1545 114
84 3300049580 Ga0501046_0018002 Ga0501046_0018002_2716_3066 114
85 3300049580 Ga0501046_0070479 Ga0501046_0070479_1688_2065 114
86 3300049581 Ga0501047_0002218 Ga0501047_0002218_9059_9409 114
87 3300049582 Ga0501048_0112980 Ga0501048_0112980_1277_1654 114
88 3300049582 Ga0501048_0223670 Ga0501048_0223670_738_1088 114
89 3300049583 Ga0501067_0377762 Ga0501067_0377762_38_388 114
90 3300049584 Ga0501068_0774473 Ga0501068_0774473_150_527 114
91 3300049585 Ga0501069_0524351 Ga0501069_0524351_198_548 114
92 3300049586 Ga0501070_0237250 Ga0501070_0237250_901_1251 114
93 3300049587 Ga0501071_0087215 Ga0501071_0087215_1562_1939 114
94 3300049588 Ga0501072_0071815 Ga0501072_0071815_1713_2090 114
95 3300049589 Ga0501073_0142168 Ga0501073_0142168_40_417 114
96 3300049590 Ga0501074_0424789 Ga0501074_0424789_244_621 114
97 3300049591 Ga0501075_0004611 Ga0501075_0004611_8655_9032 114
98 3300049592 Ga0501076_0069929 Ga0501076_0069929_991_1368 114
99 3300049741 Ga0501079_0018295 Ga0501079_0018295_3502_3879 114
100 3300049742 Ga0501080_0020642 Ga0501080_0020642_1500_1877 114
101 3300049743 Ga0501081_0021306 Ga0501081_0021306_1581_1958 114
102 3300049822 Ga0501035_0021800 Ga0501035_0021800_4901_5251 114
103 3300049822 Ga0501035_0059173 Ga0501035_0059173_1794_2171 114
104 3300049823 Ga0501044_0001597 Ga0501044_0001597_6402_6752 114
105 3300049824 Ga0501045_0142488 Ga0501045_0142488_23_400 114
106 3300053146 Ga0500588_0336003 Ga0500588_0336003_180_527 114
107 3300054114 Ga0501084_0092926 Ga0501084_0092926_957_1334 114
108 3300054114 Ga0501084_0550353 Ga0501084_0550353_602_952 114
109 3300059630 Ga0587128_139134 Ga0587128_139134_25_453 114
110 3300059645 Ga0587076_206946 Ga0587076_206946_91_441 114
111 3300060353 Ga0501082_0159734 Ga0501082_0159734_997_1347 114
112 3300060353 Ga0501082_0219676 Ga0501082_0219676_957_1334 114
113 3300061719 Ga0466962_0071396 Ga0466962_0071396_86_445 114
114 3300061734 Ga0530510_0003798 Ga0530510_0003798_1953_2330 114
115 iso_pu_bacteria 2585428157 2588108208 114
116 iso_pu_bacteria 2643221546 2643753584 114
117 iso_pu_bacteria 2643221572 2643875350 114
118 iso_pu_bacteria 2643221575 2643885107 114
119 iso_pu_bacteria 2643221616 2644097101 114
120 iso_pu_bacteria 2643221649 2644279567 114
121 iso_pu_bacteria 2643221669 2644382405 114
122 iso_pu_bacteria 2757320536 2758227249 114
123 iso_pu_bacteria 2773857758 2774381651 114
124 iso_pu_bacteria 2784132109 2784471935 114
125 iso_pu_bacteria 2808606306 2808631440 114
126 iso_pu_bacteria 2811994872 2812322835 114
127 iso_pu_bacteria 2844841374 2844842729 114
128 iso_pu_bacteria 2870628048 2870630080 114
129 iso_pu_bacteria 2884763398 2884765707 114
130 iso_pu_bacteria 2895660088 2895661439 114
131 iso_pu_bacteria 2904509784 2904512693 114
132 iso_pu_bacteria 2906799679 2906800212 114
133 iso_pu_bacteria 2908678064 2908681309 114
134 iso_pu_bacteria 2919055335 2919058435 114
135 iso_pu_bacteria 2919069694 2919071473 114
136 iso_pu_bacteria 2919395869 2919398310 114
137 iso_pu_bacteria 2919523602 2919524818 114
138 iso_pu_bacteria 2928153084 2928156271 114
139 iso_pu_bacteria 2946080515 2946080607 114
140 iso_pu_bacteria 2964326757 2964326824 114
141 iso_pu_bacteria 2966924647 2966924729 114
142 iso_pu_bacteria 2974294766 2974297711 114
143 iso_pu_bacteria 2974324384 2974326054 114
144 iso_pu_bacteria 2977228692 2977231017 114
145 iso_pu_bacteria 2977236895 2977239811 114
146 iso_pu_bacteria 2977251589 2977253703 114
147 iso_pu_bacteria 2977264416 2977266253 114
148 iso_pu_bacteria 2984542743 2984545916 114
149 iso_pu_bacteria 2995726249 2995728133 114
150 iso_pu_bacteria 8016254467 8016257882 114
151 iso_pu_bacteria 8055034563 8055035857 114
152 3300005288 Ga0065714_10003468 Ga0065714_100034685 115
153 3300005288 Ga0065714_10175973 Ga0065714_101759731 115
154 3300005844 Ga0068862_100389872 Ga0068862_1003898722 115
155 3300005985 Ga0081539_10135194 Ga0081539_101351942 115
156 3300006038 Ga0075365_10509142 Ga0075365_105091422 115
157 3300009094 Ga0111539_10499896 Ga0111539_104998962 115
158 3300014326 Ga0157380_10935531 Ga0157380_109355312 115
159 3300017792 Ga0163161_10801294 Ga0163161_108012942 115
160 3300020082 Ga0206353_11788619 Ga0206353_117886191 115
161 3300025944 Ga0207661_10347334 Ga0207661_103473342 115
162 3300028573 Ga0265334_10001006 Ga0265334_1000100611 115
163 3300028794 Ga0307515_10203988 Ga0307515_102039883 115
164 3300031456 Ga0307513_10507126 Ga0307513_105071262 115
165 3300031507 Ga0307509_10134492 Ga0307509_101344921 115
166 3300031852 Ga0307410_11092339 Ga0307410_110923391 115
167 3300031901 Ga0307406_10308533 Ga0307406_103085331 115
168 3300032002 Ga0307416_103565838 Ga0307416_1035658381 115
169 3300032004 Ga0307414_10811145 Ga0307414_108111452 115
170 3300041443 Ga0451789_0062393 Ga0451789_0062393_552_917 115
171 3300041512 Ga0451853_2924470 Ga0451853_2924470_211_564 115
172 3300046694 Ga0495649_0305702 Ga0495649_0305702_383_754 115
173 3300048920 Ga0496117_0000737 Ga0496117_0000737_5406_5771 115
174 3300048920 Ga0496117_0067492 Ga0496117_0067492_1791_2159 115
175 3300048924 Ga0496121_0313982 Ga0496121_0313982_436_804 115
176 3300048925 Ga0496122_0014164 Ga0496122_0014164_5204_5569 115
177 3300048926 Ga0496123_0045565 Ga0496123_0045565_1353_1718 115
178 3300048927 Ga0496124_0692362 Ga0496124_0692362_59_427 115
179 3300048928 Ga0496125_0071871 Ga0496125_0071871_2124_2495 115
180 3300048929 Ga0496126_0633464 Ga0496126_0633464_330_680 115
181 3300049127 Ga0501306_042829 Ga0501306_042829_51_404 115
182 3300049129 Ga0501309_026745 Ga0501309_026745_174_527 115
183 3300049161 Ga0501305_010456 Ga0501305_010456_876_1229 115
184 3300049528 Ga0501312_076950 Ga0501312_076950_52_405 115
185 3300049529 Ga0501313_059873 Ga0501313_059873_175_528 115
186 3300049531 Ga0501315_056205 Ga0501315_056205_75_428 115
187 3300049533 Ga0501317_004714 Ga0501317_004714_50_403 115
188 3300049534 Ga0501318_009202 Ga0501318_009202_373_726 115
189 3300049537 Ga0501321_011313 Ga0501321_011313_583_936 115
190 3300049539 Ga0501323_061423 Ga0501323_061423_61_414 115
191 3300049569 Ga0501032_0072404 Ga0501032_0072404_1392_1739 115
192 3300049569 Ga0501032_0088939 Ga0501032_0088939_419_766 115
193 3300049569 Ga0501032_0823759 Ga0501032_0823759_173_520 115
194 3300049570 Ga0501033_0010126 Ga0501033_0010126_4699_5046 115
195 3300049570 Ga0501033_0831184 Ga0501033_0831184_238_585 115
196 3300049571 Ga0501034_0009960 Ga0501034_0009960_3117_3470 115
197 3300049571 Ga0501034_0686191 Ga0501034_0686191_333_689 115
198 3300049571 Ga0501034_0708609 Ga0501034_0708609_470_817 115
199 3300049573 Ga0501037_0029509 Ga0501037_0029509_247_603 115
200 3300049573 Ga0501037_0032155 Ga0501037_0032155_2100_2447 115
201 3300049573 Ga0501037_0250708 Ga0501037_0250708_159_506 115
202 3300049574 Ga0501038_0164977 Ga0501038_0164977_744_1091 115
203 3300049575 Ga0501039_0065536 Ga0501039_0065536_197_550 115
204 3300049575 Ga0501039_0371323 Ga0501039_0371323_188_535 115
205 3300049577 Ga0501041_0120590 Ga0501041_0120590_1056_1409 115
206 3300049578 Ga0501042_0175344 Ga0501042_0175344_834_1187 115
207 3300049579 Ga0501043_0002454 Ga0501043_0002454_8856_9212 115
208 3300049579 Ga0501043_0089797 Ga0501043_0089797_123_470 115
209 3300049579 Ga0501043_0328544 Ga0501043_0328544_660_1007 115
210 3300049580 Ga0501046_0283590 Ga0501046_0283590_579_935 115
211 3300049581 Ga0501047_0000983 Ga0501047_0000983_909_1265 115
212 3300049581 Ga0501047_0192489 Ga0501047_0192489_863_1210 115
213 3300049581 Ga0501047_0202951 Ga0501047_0202951_772_1128 115
214 3300049582 Ga0501048_0705657 Ga0501048_0705657_294_647 115
215 3300049585 Ga0501069_0160844 Ga0501069_0160844_68_424 115
216 3300049586 Ga0501070_0003401 Ga0501070_0003401_660_1016 115
217 3300049589 Ga0501073_0054013 Ga0501073_0054013_529_885 115
218 3300049593 Ga0501077_0420505 Ga0501077_0420505_284_640 115
219 3300049742 Ga0501080_0000084 Ga0501080_0000084_34648_35004 115
220 3300049744 Ga0501083_0128965 Ga0501083_0128965_555_911 115
221 3300049822 Ga0501035_0009087 Ga0501035_0009087_4044_4400 115
222 3300049822 Ga0501035_0339508 Ga0501035_0339508_299_649 115
223 3300049823 Ga0501044_0004023 Ga0501044_0004023_5598_5954 115
224 3300049823 Ga0501044_0544812 Ga0501044_0544812_302_649 115
225 3300050490 nmdc:mga03n38_222350_c1 nmdc:mga03n38_222350_c1_426_797 115
226 3300050492 nmdc:mga0yw44_522916_c1 nmdc:mga0yw44_522916_c1_362_730 115
227 3300050511 nmdc:mga08y16_1984630_c1 nmdc:mga08y16_1984630_c1_109_471 115
228 3300053139 Ga0500568_0000014 Ga0500568_0000014_180140_180487 115
229 3300053139 Ga0500568_0004356 Ga0500568_0004356_3330_3677 115
230 3300053153 Ga0500616_0000088 Ga0500616_0000088_102998_103363 115
231 3300054114 Ga0501084_0068090 Ga0501084_0068090_1757_2113 115
232 3300059477 Ga0587084_149055 Ga0587084_149055_66_437 115
233 3300059644 Ga0587075_087434 Ga0587075_087434_106_459 115
234 3300060353 Ga0501082_0011166 Ga0501082_0011166_4803_5156 115
235 iso_pu_bacteria 2848551377 2848552295 115
236 iso_pu_bacteria 2852677369 2852679495 115
237 iso_pu_bacteria 2857737099 2857737478 115
238 iso_pu_bacteria 2939660829 2939660954 115
239 3300001979 JGI24740J21852_10083933 JGI24740J21852_100839332 116
240 3300004801 Ga0058860_10117912 Ga0058860_101179122 116
241 3300005328 Ga0070676_10170303 Ga0070676_101703032 116
242 3300005333 Ga0070677_10428159 Ga0070677_104281591 116
243 3300005334 Ga0068869_100334916 Ga0068869_1003349161 116
244 3300005347 Ga0070668_100019550 Ga0070668_1000195502 116
245 3300005438 Ga0070701_11350260 Ga0070701_113502601 116
246 3300005455 Ga0070663_101109728 Ga0070663_1011097282 116
247 3300005577 Ga0068857_100494645 Ga0068857_1004946452 116
248 3300005618 Ga0068864_100118513 Ga0068864_1001185132 116
249 3300005719 Ga0068861_100166387 Ga0068861_1001663872 116
250 3300005840 Ga0068870_10134526 Ga0068870_101345262 116
251 3300009094 Ga0111539_10455066 Ga0111539_104550662 116
252 3300009148 Ga0105243_11195879 Ga0105243_111958792 116
253 3300011119 Ga0105246_10046591 Ga0105246_100465913 116
254 3300013105 Ga0157369_10065475 Ga0157369_100654754 116
255 3300013308 Ga0157375_10682888 Ga0157375_106828881 116
256 3300014326 Ga0157380_10068168 Ga0157380_100681682 116
257 3300014745 Ga0157377_10894545 Ga0157377_108945451 116
258 3300017792 Ga0163161_10985481 Ga0163161_109854811 116
259 3300025728 Ga0207655_1083647 Ga0207655_10836471 116
260 3300025893 Ga0207682_10215817 Ga0207682_102158172 116
261 3300025901 Ga0207688_10074090 Ga0207688_100740901 116
262 3300025907 Ga0207645_10128671 Ga0207645_101286712 116
263 3300025908 Ga0207643_10032675 Ga0207643_100326752 116
264 3300025925 Ga0207650_10657095 Ga0207650_106570952 116
265 3300025942 Ga0207689_10327561 Ga0207689_103275612 116
266 3300025972 Ga0207668_10116597 Ga0207668_101165972 116
267 3300026067 Ga0207678_11092098 Ga0207678_110920982 116
268 3300026118 Ga0207675_100118687 Ga0207675_1001186873 116
269 3300028379 Ga0268266_11686848 Ga0268266_116868481 116
270 3300028380 Ga0268265_11595556 Ga0268265_115955561 116
271 3300031548 Ga0307408_100262656 Ga0307408_1002626561 116
272 3300031665 Ga0316575_10000026 Ga0316575_1000002617 116
273 3300031727 Ga0316576_10608975 Ga0316576_106089752 116
274 3300031731 Ga0307405_10650684 Ga0307405_106506842 116
275 3300031852 Ga0307410_11819142 Ga0307410_118191421 116
276 3300031901 Ga0307406_10097957 Ga0307406_100979572 116
277 3300031903 Ga0307407_11709533 Ga0307407_117095331 116
278 3300031911 Ga0307412_11361548 Ga0307412_113615481 116
279 3300031995 Ga0307409_102077542 Ga0307409_1020775421 116
280 3300032002 Ga0307416_101158349 Ga0307416_1011583491 116
281 3300032004 Ga0307414_10398261 Ga0307414_103982612 116
282 3300032004 Ga0307414_10738533 Ga0307414_107385332 116
283 3300032004 Ga0307414_11930979 Ga0307414_119309791 116
284 3300032126 Ga0307415_100658201 Ga0307415_1006582012 116
285 3300033529 Ga0316587_1049386 Ga0316587_10493861 116
286 3300033541 Ga0316596_1021855 Ga0316596_10218553 116
287 3300041413 Ga0439465_0097231 Ga0439465_0097231_370_720 116
288 3300041413 Ga0439465_0109232 Ga0439465_0109232_236_586 116
289 3300041413 Ga0439465_0122093 Ga0439465_0122093_69_419 116
290 3300041494 Ga0451837_0986096 Ga0451837_0986096_311_676 116
291 3300041498 Ga0451841_1254032 Ga0451841_1254032_148_513 116
292 3300042146 Ga0450907_050908 Ga0450907_050908_53_403 116
293 3300046460 Ga0495638_0202553 Ga0495638_0202553_598_948 116
294 3300046543 Ga0495645_0066284 Ga0495645_0066284_2137_2496 116
295 3300046615 Ga0495656_0044965 Ga0495656_0044965_790_1140 116
296 3300046660 Ga0495625_0262604 Ga0495625_0262604_77_427 116
297 3300046691 Ga0495670_0427055 Ga0495670_0427055_327_677 116
298 3300048916 Ga0496113_0082756 Ga0496113_0082756_1959_2309 116
299 3300048920 Ga0496117_0116493 Ga0496117_0116493_749_1114 116
300 3300048921 Ga0496118_0105465 Ga0496118_0105465_251_616 116
301 3300048925 Ga0496122_0249394 Ga0496122_0249394_502_867 116
302 3300048929 Ga0496126_0459928 Ga0496126_0459928_28_393 116
303 3300049127 Ga0501306_035622 Ga0501306_035622_26_376 116
304 3300049127 Ga0501306_035622 Ga0501306_035622_393_743 116
305 3300049587 Ga0501071_0378714 Ga0501071_0378714_540_890 116
306 3300049593 Ga0501077_0963720 Ga0501077_0963720_30_380 116
307 3300050509 nmdc:mga0qj67_969409_c1 nmdc:mga0qj67_969409_c1_203_553 116
308 3300050511 nmdc:mga08y16_571618_c1 nmdc:mga08y16_571618_c1_340_690 116
309 iso_pu_bacteria 2857729791 2857732519 116
310 iso_pu_bacteria 2928121344 2928122861 116
311 3300002738 JGI25154J39366_1001125 JGI25154J39366_10011257 117
312 3300003320 rootH2_10099343 rootH2_100993432 117
313 3300005578 Ga0068854_101373225 Ga0068854_1013732251 117
314 3300006038 Ga0075365_10487849 Ga0075365_104878491 117
315 3300006051 Ga0075364_10072297 Ga0075364_100722972 117
316 3300006051 Ga0075364_10094417 Ga0075364_100944172 117
317 3300006051 Ga0075364_10244267 Ga0075364_102442672 117
318 3300006195 Ga0075366_10431814 Ga0075366_104318142 117
319 3300006353 Ga0075370_10771516 Ga0075370_107715161 117
320 3300009148 Ga0105243_10717885 Ga0105243_107178852 117
321 3300013102 Ga0157371_10890684 Ga0157371_108906841 117
322 3300013104 Ga0157370_11194763 Ga0157370_111947631 117
323 3300013104 Ga0157370_11325577 Ga0157370_113255772 117
324 3300013105 Ga0157369_10428088 Ga0157369_104280881 117
325 3300013307 Ga0157372_10050676 Ga0157372_100506764 117
326 3300020075 Ga0206349_1042834 Ga0206349_10428341 117
327 3300020077 Ga0206351_10564076 Ga0206351_105640761 117
328 3300025246 Ga0209646_1000071 Ga0209646_1000071219 117
329 3300025258 Ga0209129_1049499 Ga0209129_10494991 117
330 3300025294 Ga0209025_1131806 Ga0209025_11318061 117
331 3300025935 Ga0207709_11334717 Ga0207709_113347171 117
332 3300031731 Ga0307405_10497777 Ga0307405_104977772 117
333 3300031824 Ga0307413_10130391 Ga0307413_101303912 117
334 3300031901 Ga0307406_10020290 Ga0307406_100202903 117
335 3300032004 Ga0307414_10164755 Ga0307414_101647553 117
336 3300032004 Ga0307414_10256236 Ga0307414_102562362 117
337 3300032004 Ga0307414_10537095 Ga0307414_105370951 117
338 3300032004 Ga0307414_10572465 Ga0307414_105724652 117
339 3300032004 Ga0307414_10664597 Ga0307414_106645971 117
340 3300032005 Ga0307411_10667529 Ga0307411_106675292 117
341 3300037418 Ga0395900_1694093 Ga0395900_1694093_75_437 117
342 3300037466 Ga0395898_0018267 Ga0395898_0018267_3554_3916 117
343 3300041462 Ga0451806_769506 Ga0451806_769506_133_501 117
344 3300044683 Ga0466965_0509897 Ga0466965_0509897_155_517 117
345 3300044765 Ga0466970_0470447 Ga0466970_0470447_11_373 117
346 3300044842 Ga0466957_0515504 Ga0466957_0515504_442_813 117
347 3300044901 Ga0466960_0032143 Ga0466960_0032143_468_839 117
348 3300044901 Ga0466960_0134629 Ga0466960_0134629_802_1164 117
349 3300045049 Ga0466959_0376557 Ga0466959_0376557_124_495 117
350 3300045976 Ga0466967_0787257 Ga0466967_0787257_106_477 117
351 3300046471 Ga0495650_0005523 Ga0495650_0005523_2449_2805 117
352 3300046516 Ga0495628_0280445 Ga0495628_0280445_165_557 117
353 3300048917 Ga0496114_0058054 Ga0496114_0058054_1460_1822 117
354 3300048929 Ga0496126_0029608 Ga0496126_0029608_3336_3692 117
355 3300048929 Ga0496126_0149987 Ga0496126_0149987_1320_1685 117
356 3300049571 Ga0501034_0000227 Ga0501034_0000227_72606_72971 117
357 3300049574 Ga0501038_0070034 Ga0501038_0070034_458_820 117
358 3300050491 nmdc:mga00v17_324262_c1 nmdc:mga00v17_324262_c1_387_749 117
359 3300050491 nmdc:mga00v17_372048_c1 nmdc:mga00v17_372048_c1_288_653 117
360 3300050491 nmdc:mga00v17_63564_c1 nmdc:mga00v17_63564_c1_796_1152 117
361 3300050491 nmdc:mga00v17_99382_c1 nmdc:mga00v17_99382_c1_288_650 117
362 3300050494 nmdc:mga06z11_292094_c1 nmdc:mga06z11_292094_c1_30_392 117
363 3300050496 nmdc:mga07m45_43733_c1 nmdc:mga07m45_43733_c1_1206_1571 117
364 3300053093 Ga0500651_0053181 Ga0500651_0053181_1444_1836 117
365 3300053148 Ga0500590_164472 Ga0500590_164472_378_770 117
366 3300059508 Ga0587088_001021 Ga0587088_001021_2224_2586 117
367 3300059604 Ga0587098_000238 Ga0587098_000238_606_968 117
368 3300059605 Ga0587106_000795 Ga0587106_000795_210_572 117
369 3300059630 Ga0587128_001590 Ga0587128_001590_412_774 117
370 3300059649 Ga0587102_026774 Ga0587102_026774_209_595 117
371 iso_pu_bacteria 2893684298 2893684469 117
372 3300001979 JGI24740J21852_10016630 JGI24740J21852_100166302 118
373 3300001979 JGI24740J21852_10032850 JGI24740J21852_100328502 118
374 3300001989 JGI24739J22299_10005914 JGI24739J22299_100059142 118
375 3300001989 JGI24739J22299_10036697 JGI24739J22299_100366973 118
376 3300001990 JGI24737J22298_10026723 JGI24737J22298_100267232 118
377 3300001990 JGI24737J22298_10262116 JGI24737J22298_102621161 118
378 3300002067 JGI24735J21928_10000431 JGI24735J21928_100004314 118
379 3300002067 JGI24735J21928_10046826 JGI24735J21928_100468262 118
380 3300002737 JGI25162J39368_1006402 JGI25162J39368_10064022 118
381 3300002772 JGI25164J39214_1000402 JGI25164J39214_100040212 118
382 3300003162 Ga0006778J45830_1009243 Ga0006778J45830_10092431 118
383 3300003163 Ga0006759J45824_1032353 Ga0006759J45824_10323531 118
384 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004433 118
385 3300003308 Ga0006777J48905_1027580 Ga0006777J48905_10275801 118
386 3300003559 Ga0007427J51700_105914 Ga0007427J51700_1059141 118
387 3300003568 Ga0006781J51513_1010598 Ga0006781J51513_10105981 118
388 3300003578 Ga0006562J51391_1006898 Ga0006562J51391_10068984 118
389 3300003578 Ga0006562J51391_1014808 Ga0006562J51391_10148088 118
390 3300003578 Ga0006562J51391_1014811 Ga0006562J51391_10148111 118
391 3300003611 Ga0007411J51799_112608 Ga0007411J51799_1126081 118
392 3300003735 Ga0006780_1007103 Ga0006780_10071031 118
393 3300003752 Ga0055539_1000008 Ga0055539_100000812 118
394 3300003752 Ga0055539_1012101 Ga0055539_10121012 118
395 3300003756 Ga0055533_1000001 Ga0055533_10000011058 118
396 3300003758 Ga0055532_1006376 Ga0055532_10063762 118
397 3300003759 Ga0055525_1000787 Ga0055525_10007873 118
398 3300003759 Ga0055525_1007188 Ga0055525_10071881 118
399 3300003760 Ga0055527_1000001 Ga0055527_1000001543 118
400 3300003763 Ga0055529_1000019 Ga0055529_100001949 118
401 3300003763 Ga0055529_1006166 Ga0055529_10061662 118
402 3300003841 Ga0055541_1002268 Ga0055541_10022684 118
403 3300005288 Ga0065714_10437834 Ga0065714_104378341 118
404 3300005327 Ga0070658_10002538 Ga0070658_1000253815 118
405 3300005327 Ga0070658_10011276 Ga0070658_100112762 118
406 3300005327 Ga0070658_10018446 Ga0070658_100184463 118
407 3300005327 Ga0070658_10024386 Ga0070658_100243862 118
408 3300005327 Ga0070658_10119339 Ga0070658_101193392 118
409 3300005327 Ga0070658_10287880 Ga0070658_102878802 118
410 3300005337 Ga0070682_100108313 Ga0070682_1001083132 118
411 3300005337 Ga0070682_100205196 Ga0070682_1002051962 118
412 3300005337 Ga0070682_100685039 Ga0070682_1006850392 118
413 3300005337 Ga0070682_101320142 Ga0070682_1013201421 118
414 3300005338 Ga0068868_100136422 Ga0068868_1001364222 118
415 3300005338 Ga0068868_100668258 Ga0068868_1006682582 118
416 3300005338 Ga0068868_100844645 Ga0068868_1008446451 118
417 3300005339 Ga0070660_100153791 Ga0070660_1001537912 118
418 3300005339 Ga0070660_100218590 Ga0070660_1002185902 118
419 3300005339 Ga0070660_100637225 Ga0070660_1006372252 118
420 3300005344 Ga0070661_100121708 Ga0070661_1001217082 118
421 3300005355 Ga0070671_100114768 Ga0070671_1001147683 118
422 3300005355 Ga0070671_100296052 Ga0070671_1002960521 118
423 3300005366 Ga0070659_100000366 Ga0070659_10000036620 118
424 3300005366 Ga0070659_100076747 Ga0070659_1000767473 118
425 3300005367 Ga0070667_100003912 Ga0070667_10000391213 118
426 3300005435 Ga0070714_100211744 Ga0070714_1002117442 118
427 3300005435 Ga0070714_100445987 Ga0070714_1004459872 118
428 3300005435 Ga0070714_101325681 Ga0070714_1013256812 118
429 3300005455 Ga0070663_100592288 Ga0070663_1005922882 118
430 3300005466 Ga0070685_10142121 Ga0070685_101421212 118
431 3300005530 Ga0070679_101445306 Ga0070679_1014453061 118
432 3300005539 Ga0068853_100052456 Ga0068853_1000524564 118
433 3300005539 Ga0068853_100072924 Ga0068853_1000729242 118
434 3300005539 Ga0068853_100545653 Ga0068853_1005456531 118
435 3300005543 Ga0070672_101314305 Ga0070672_1013143051 118
436 3300005563 Ga0068855_100004431 Ga0068855_10000443116 118
437 3300005563 Ga0068855_100025012 Ga0068855_1000250124 118
438 3300005563 Ga0068855_100167746 Ga0068855_1001677462 118
439 3300005563 Ga0068855_100209693 Ga0068855_1002096932 118
440 3300005563 Ga0068855_101114295 Ga0068855_1011142951 118
441 3300005563 Ga0068855_101650102 Ga0068855_1016501021 118
442 3300005577 Ga0068857_100002984 Ga0068857_1000029848 118
443 3300005577 Ga0068857_100275842 Ga0068857_1002758422 118
444 3300005614 Ga0068856_100040400 Ga0068856_1000404002 118
445 3300005614 Ga0068856_100056191 Ga0068856_1000561911 118
446 3300005614 Ga0068856_100065521 Ga0068856_1000655212 118
447 3300005614 Ga0068856_100201556 Ga0068856_1002015562 118
448 3300005614 Ga0068856_100296655 Ga0068856_1002966552 118
449 3300005614 Ga0068856_100533508 Ga0068856_1005335081 118
450 3300005614 Ga0068856_101073892 Ga0068856_1010738922 118
451 3300005616 Ga0068852_100069820 Ga0068852_1000698203 118
452 3300005616 Ga0068852_100793296 Ga0068852_1007932962 118
453 3300005616 Ga0068852_100886767 Ga0068852_1008867671 118
454 3300005617 Ga0068859_100462788 Ga0068859_1004627882 118
455 3300005618 Ga0068864_100080524 Ga0068864_1000805242 118
456 3300005834 Ga0068851_10000020 Ga0068851_1000002079 118
457 3300005841 Ga0068863_100058611 Ga0068863_1000586114 118
458 3300005842 Ga0068858_100000233 Ga0068858_10000023353 118
459 3300005844 Ga0068862_101252275 Ga0068862_1012522751 118
460 3300005983 Ga0081540_1008305 Ga0081540_10083055 118
461 3300006028 Ga0070717_11589490 Ga0070717_115894902 118
462 3300006038 Ga0075365_10014081 Ga0075365_100140815 118
463 3300006038 Ga0075365_10016040 Ga0075365_100160403 118
464 3300006038 Ga0075365_10151737 Ga0075365_101517372 118
465 3300006051 Ga0075364_10000664 Ga0075364_1000066411 118
466 3300006051 Ga0075364_10006010 Ga0075364_100060102 118
467 3300006051 Ga0075364_10354878 Ga0075364_103548781 118
468 3300006175 Ga0070712_100500165 Ga0070712_1005001652 118
469 3300006186 Ga0075369_10007782 Ga0075369_100077824 118
470 3300006186 Ga0075369_10039734 Ga0075369_100397342 118
471 3300006186 Ga0075369_10048476 Ga0075369_100484762 118
472 3300006186 Ga0075369_10222376 Ga0075369_102223762 118
473 3300006186 Ga0075369_10538361 Ga0075369_105383612 118
474 3300006931 Ga0097620_100462766 Ga0097620_1004627662 118
475 3300009036 Ga0105244_10035710 Ga0105244_100357103 118
476 3300009093 Ga0105240_10002356 Ga0105240_1000235613 118
477 3300009093 Ga0105240_10122729 Ga0105240_101227293 118
478 3300009098 Ga0105245_10051261 Ga0105245_100512612 118
479 3300009098 Ga0105245_10082967 Ga0105245_100829673 118
480 3300009101 Ga0105247_10091905 Ga0105247_100919052 118
481 3300009101 Ga0105247_11016577 Ga0105247_110165772 118
482 3300009148 Ga0105243_10436524 Ga0105243_104365242 118
483 3300009148 Ga0105243_11745416 Ga0105243_117454161 118
484 3300009174 Ga0105241_10000260 Ga0105241_1000026032 118
485 3300009174 Ga0105241_10223011 Ga0105241_102230112 118
486 3300009174 Ga0105241_10317717 Ga0105241_103177172 118
487 3300009177 Ga0105248_10000714 Ga0105248_1000071431 118
488 3300009177 Ga0105248_10162370 Ga0105248_101623702 118
489 3300009545 Ga0105237_10006375 Ga0105237_100063759 118
490 3300009545 Ga0105237_10505764 Ga0105237_105057642 118
491 3300009545 Ga0105237_10552930 Ga0105237_105529302 118
492 3300009545 Ga0105237_11779993 Ga0105237_117799932 118
493 3300009551 Ga0105238_10023651 Ga0105238_100236513 118
494 3300009551 Ga0105238_10088136 Ga0105238_100881362 118
495 3300009551 Ga0105238_10702738 Ga0105238_107027381 118
496 3300009551 Ga0105238_11551022 Ga0105238_115510221 118
497 3300009551 Ga0105238_12054234 Ga0105238_120542341 118
498 3300010375 Ga0105239_10388730 Ga0105239_103887301 118
499 3300010375 Ga0105239_11618225 Ga0105239_116182252 118
500 3300013100 Ga0157373_10584333 Ga0157373_105843332 118
501 3300013102 Ga0157371_10001714 Ga0157371_1000171411 118
502 3300013104 Ga0157370_10040958 Ga0157370_100409584 118
503 3300013104 Ga0157370_10723688 Ga0157370_107236882 118
504 3300013104 Ga0157370_11398024 Ga0157370_113980241 118
505 3300013105 Ga0157369_10003460 Ga0157369_100034605 118
506 3300013105 Ga0157369_10202739 Ga0157369_102027392 118
507 3300013105 Ga0157369_10304610 Ga0157369_103046102 118
508 3300013105 Ga0157369_12346345 Ga0157369_123463451 118
509 3300013296 Ga0157374_10196136 Ga0157374_101961363 118
510 3300013296 Ga0157374_10302225 Ga0157374_103022252 118
511 3300013296 Ga0157374_11711662 Ga0157374_117116622 118
512 3300013306 Ga0163162_11222628 Ga0163162_112226282 118
513 3300013307 Ga0157372_10090442 Ga0157372_100904422 118
514 3300013307 Ga0157372_10497005 Ga0157372_104970051 118
515 3300013307 Ga0157372_10679855 Ga0157372_106798552 118
516 3300013308 Ga0157375_11164253 Ga0157375_111642532 118
517 3300013308 Ga0157375_12954239 Ga0157375_129542391 118
518 3300014325 Ga0163163_10048647 Ga0163163_100486472 118
519 3300014325 Ga0163163_13104411 Ga0163163_131044111 118
520 3300014326 Ga0157380_11498048 Ga0157380_114980482 118
521 3300014745 Ga0157377_10864988 Ga0157377_108649881 118
522 3300014968 Ga0157379_10014539 Ga0157379_100145396 118
523 3300014969 Ga0157376_10186528 Ga0157376_101865282 118
524 3300020069 Ga0197907_10314249 Ga0197907_103142491 118
525 3300020069 Ga0197907_10417701 Ga0197907_104177011 118
526 3300020069 Ga0197907_10693143 Ga0197907_106931431 118
527 3300020070 Ga0206356_11397704 Ga0206356_113977043 118
528 3300020070 Ga0206356_11659145 Ga0206356_116591451 118
529 3300020075 Ga0206349_1596473 Ga0206349_15964731 118
530 3300020076 Ga0206355_1252865 Ga0206355_12528651 118
531 3300020076 Ga0206355_1392808 Ga0206355_13928083 118
532 3300020077 Ga0206351_10579387 Ga0206351_105793872 118
533 3300020080 Ga0206350_10544471 Ga0206350_105444712 118
534 3300020081 Ga0206354_11320637 Ga0206354_113206371 118
535 3300020082 Ga0206353_11470238 Ga0206353_114702382 118
536 3300020082 Ga0206353_11734878 Ga0206353_117348783 118
537 3300020610 Ga0154015_1609341 Ga0154015_16093411 118
538 3300022467 Ga0224712_10029729 Ga0224712_100297293 118
539 3300022467 Ga0224712_10534805 Ga0224712_105348051 118
540 3300025225 Ga0209566_100149 Ga0209566_1001495 118
541 3300025226 Ga0209674_100001 Ga0209674_1000011058 118
542 3300025226 Ga0209674_118106 Ga0209674_1181061 118
543 3300025228 Ga0209672_100006 Ga0209672_100006432 118
544 3300025229 Ga0209147_100849 Ga0209147_1008493 118
545 3300025230 Ga0209563_100001 Ga0209563_1000011058 118
546 3300025230 Ga0209563_100381 Ga0209563_10038114 118
547 3300025231 Ga0207427_100010 Ga0207427_100010148 118
548 3300025233 Ga0209437_100216 Ga0209437_10021658 118
549 3300025242 Ga0209258_105279 Ga0209258_1052793 118
550 3300025253 Ga0209677_100001 Ga0209677_1000011058 118
551 3300025253 Ga0209677_106708 Ga0209677_1067082 118
552 3300025253 Ga0209677_118312 Ga0209677_1183121 118
553 3300025254 Ga0209148_1000015 Ga0209148_1000015276 118
554 3300025254 Ga0209148_1001437 Ga0209148_10014373 118
555 3300025254 Ga0209148_1015796 Ga0209148_10157962 118
556 3300025261 Ga0209233_1000001 Ga0209233_10000011801 118
557 3300025261 Ga0209233_1040674 Ga0209233_10406742 118
558 3300025272 Ga0209455_1000013 Ga0209455_1000013276 118
559 3300025272 Ga0209455_1000811 Ga0209455_10008117 118
560 3300025303 Ga0209051_1079735 Ga0209051_10797351 118
561 3300025321 Ga0207656_10000003 Ga0207656_100000032 118
562 3300025728 Ga0207655_1092600 Ga0207655_10926001 118
563 3300025900 Ga0207710_10073034 Ga0207710_100730342 118
564 3300025900 Ga0207710_10367985 Ga0207710_103679852 118
565 3300025904 Ga0207647_10006593 Ga0207647_100065933 118
566 3300025904 Ga0207647_10025066 Ga0207647_100250663 118
567 3300025904 Ga0207647_10069180 Ga0207647_100691802 118
568 3300025904 Ga0207647_10112805 Ga0207647_101128052 118
569 3300025904 Ga0207647_10381968 Ga0207647_103819682 118
570 3300025909 Ga0207705_10000006 Ga0207705_10000006550 118
571 3300025909 Ga0207705_10008164 Ga0207705_100081644 118
572 3300025909 Ga0207705_10025391 Ga0207705_100253914 118
573 3300025909 Ga0207705_10234676 Ga0207705_102346762 118
574 3300025909 Ga0207705_10330783 Ga0207705_103307832 118
575 3300025909 Ga0207705_10455403 Ga0207705_104554032 118
576 3300025911 Ga0207654_10000003 Ga0207654_10000003217 118
577 3300025913 Ga0207695_10028611 Ga0207695_100286115 118
578 3300025913 Ga0207695_10037783 Ga0207695_100377833 118
579 3300025914 Ga0207671_10000002 Ga0207671_10000002108 118
580 3300025914 Ga0207671_10021409 Ga0207671_100214093 118
581 3300025914 Ga0207671_10260553 Ga0207671_102605532 118
582 3300025914 Ga0207671_10912622 Ga0207671_109126221 118
583 3300025915 Ga0207693_10455530 Ga0207693_104555301 118
584 3300025919 Ga0207657_10016489 Ga0207657_100164892 118
585 3300025919 Ga0207657_10571599 Ga0207657_105715992 118
586 3300025920 Ga0207649_10031676 Ga0207649_100316762 118
587 3300025924 Ga0207694_10000433 Ga0207694_1000043340 118
588 3300025924 Ga0207694_10609233 Ga0207694_106092331 118
589 3300025927 Ga0207687_10014147 Ga0207687_100141474 118
590 3300025927 Ga0207687_10063542 Ga0207687_100635422 118
591 3300025929 Ga0207664_10612575 Ga0207664_106125752 118
592 3300025932 Ga0207690_10001456 Ga0207690_1000145614 118
593 3300025932 Ga0207690_10054780 Ga0207690_100547802 118
594 3300025935 Ga0207709_10469910 Ga0207709_104699101 118
595 3300025935 Ga0207709_10666094 Ga0207709_106660941 118
596 3300025940 Ga0207691_10881965 Ga0207691_108819652 118
597 3300025941 Ga0207711_10001536 Ga0207711_1000153618 118
598 3300025941 Ga0207711_10015358 Ga0207711_100153582 118
599 3300025949 Ga0207667_10003435 Ga0207667_1000343516 118
600 3300025949 Ga0207667_10037351 Ga0207667_100373514 118
601 3300025949 Ga0207667_10076583 Ga0207667_100765832 118
602 3300025949 Ga0207667_10126813 Ga0207667_101268132 118
603 3300025949 Ga0207667_10248984 Ga0207667_102489841 118
604 3300025949 Ga0207667_10373541 Ga0207667_103735412 118
605 3300025949 Ga0207667_10620803 Ga0207667_106208032 118
606 3300025949 Ga0207667_10661703 Ga0207667_106617031 118
607 3300025972 Ga0207668_11117741 Ga0207668_111177411 118
608 3300025986 Ga0207658_10031506 Ga0207658_100315062 118
609 3300026023 Ga0207677_10497308 Ga0207677_104973082 118
610 3300026035 Ga0207703_10000044 Ga0207703_1000004421 118
611 3300026041 Ga0207639_10021744 Ga0207639_100217442 118
612 3300026041 Ga0207639_11268143 Ga0207639_112681432 118
613 3300026067 Ga0207678_10162131 Ga0207678_101621312 118
614 3300026067 Ga0207678_10505473 Ga0207678_105054732 118
615 3300026078 Ga0207702_10090684 Ga0207702_100906843 118
616 3300026078 Ga0207702_10279247 Ga0207702_102792472 118
617 3300026078 Ga0207702_11363217 Ga0207702_113632172 118
618 3300026088 Ga0207641_10366149 Ga0207641_103661491 118
619 3300026095 Ga0207676_10100649 Ga0207676_101006492 118
620 3300026116 Ga0207674_10004904 Ga0207674_100049048 118
621 3300026116 Ga0207674_10674934 Ga0207674_106749342 118
622 3300026142 Ga0207698_10001186 Ga0207698_100011864 118
623 3300026142 Ga0207698_10504036 Ga0207698_105040362 118
624 3300026142 Ga0207698_11549342 Ga0207698_115493421 118
625 3300026142 Ga0207698_11927699 Ga0207698_119276991 118
626 3300028794 Ga0307515_10344049 Ga0307515_103440492 118
627 3300028794 Ga0307515_10923090 Ga0307515_109230901 118
628 3300031649 Ga0307514_10427685 Ga0307514_104276851 118
629 3300031901 Ga0307406_10000235 Ga0307406_100002355 118
630 3300031901 Ga0307406_10000548 Ga0307406_100005488 118
631 3300037312 Ga0395899_0007061 Ga0395899_0007061_3441_3797 118
632 3300037312 Ga0395899_0575678 Ga0395899_0575678_111_467 118
633 3300037418 Ga0395900_0000774 Ga0395900_0000774_37544_37900 118
634 3300037418 Ga0395900_0178902 Ga0395900_0178902_1413_1769 118
635 3300037418 Ga0395900_0280888 Ga0395900_0280888_202_570 118
636 3300037466 Ga0395898_0000015 Ga0395898_0000015_108694_109050 118
637 3300038443 Ga0395901_0023475 Ga0395901_0023475_1705_2073 118
638 3300038443 Ga0395901_0033400 Ga0395901_0033400_3235_3600 118
639 3300038443 Ga0395901_0791629 Ga0395901_0791629_60_446 118
640 3300039450 Ga0436363_0269928 Ga0436363_0269928_153_527 118
641 3300041441 Ga0451787_134054 Ga0451787_134054_181_543 118
642 3300041451 Ga0451791_0106859 Ga0451791_0106859_508_885 118
643 3300041451 Ga0451791_1080276 Ga0451791_1080276_35_400 118
644 3300041452 Ga0451793_0891968 Ga0451793_0891968_609_971 118
645 3300041453 Ga0451797_0342964 Ga0451797_0342964_170_532 118
646 3300041453 Ga0451797_0419015 Ga0451797_0419015_282_644 118
647 3300041453 Ga0451797_0977833 Ga0451797_0977833_55_417 118
648 3300041459 Ga0451800_1222319 Ga0451800_1222319_94_462 118
649 3300041462 Ga0451806_482414 Ga0451806_482414_128_502 118
650 3300041494 Ga0451837_1152760 Ga0451837_1152760_260_622 118
651 3300041494 Ga0451837_1777354 Ga0451837_1777354_71_454 118
652 3300041498 Ga0451841_0952906 Ga0451841_0952906_66_434 118
653 3300041505 Ga0451849_1108743 Ga0451849_1108743_133_498 118
654 3300041509 Ga0451843_0095480 Ga0451843_0095480_176_538 118
655 3300041509 Ga0451843_0345566 Ga0451843_0345566_251_616 118
656 3300041512 Ga0451853_3391059 Ga0451853_3391059_215_580 118
657 3300044658 Ga0466972_0022794 Ga0466972_0022794_2234_2590 118
658 3300044658 Ga0466972_0050505 Ga0466972_0050505_1286_1642 118
659 3300044658 Ga0466972_0086023 Ga0466972_0086023_814_1170 118
660 3300044658 Ga0466972_0519027 Ga0466972_0519027_20_394 118
661 3300044683 Ga0466965_0005583 Ga0466965_0005583_3557_3913 118
662 3300044683 Ga0466965_0015519 Ga0466965_0015519_1414_1770 118
663 3300044683 Ga0466965_0916937 Ga0466965_0916937_44_412 118
664 3300044684 Ga0466966_0016995 Ga0466966_0016995_3907_4263 118
665 3300044693 Ga0466961_0240754 Ga0466961_0240754_736_1092 118
666 3300044693 Ga0466961_0302257 Ga0466961_0302257_424_780 118
667 3300044693 Ga0466961_0339107 Ga0466961_0339107_480_836 118
668 3300044706 Ga0466964_0299131 Ga0466964_0299131_178_546 118
669 3300044719 Ga0466971_0026655 Ga0466971_0026655_1849_2205 118
670 3300044719 Ga0466971_0055105 Ga0466971_0055105_11_385 118
671 3300044735 Ga0466968_0023017 Ga0466968_0023017_1422_1778 118
672 3300044735 Ga0466968_0503310 Ga0466968_0503310_228_584 118
673 3300044765 Ga0466970_0011041 Ga0466970_0011041_3483_3839 118
674 3300044765 Ga0466970_0052295 Ga0466970_0052295_414_770 118
675 3300044765 Ga0466970_0079419 Ga0466970_0079419_1393_1749 118
676 3300044765 Ga0466970_0081797 Ga0466970_0081797_1156_1530 118
677 3300044765 Ga0466970_0120196 Ga0466970_0120196_860_1216 118
678 3300044765 Ga0466970_0289161 Ga0466970_0289161_34_402 118
679 3300044842 Ga0466957_0056094 Ga0466957_0056094_822_1178 118
680 3300044842 Ga0466957_0108420 Ga0466957_0108420_1373_1729 118
681 3300044901 Ga0466960_0020915 Ga0466960_0020915_2103_2459 118
682 3300044901 Ga0466960_0030828 Ga0466960_0030828_1915_2271 118
683 3300045049 Ga0466959_0050215 Ga0466959_0050215_327_683 118
684 3300045049 Ga0466959_0059052 Ga0466959_0059052_12_368 118
685 3300045049 Ga0466959_0455199 Ga0466959_0455199_214_570 118
686 3300045836 Ga0466958_0021235 Ga0466958_0021235_2272_2628 118
687 3300045836 Ga0466958_0279983 Ga0466958_0279983_672_1028 118
688 3300045836 Ga0466958_0699823 Ga0466958_0699823_98_472 118
689 3300045976 Ga0466967_0307540 Ga0466967_0307540_786_1142 118
690 3300045976 Ga0466967_0698701 Ga0466967_0698701_50_424 118
691 3300046457 Ga0495590_0000612 Ga0495590_0000612_5830_6213 118
692 3300046471 Ga0495650_0097309 Ga0495650_0097309_657_1025 118
693 3300046471 Ga0495650_0308833 Ga0495650_0308833_71_442 118
694 3300046515 Ga0495620_0362472 Ga0495620_0362472_31_402 118
695 3300046538 Ga0495609_0353690 Ga0495609_0353690_177_548 118
696 3300046615 Ga0495656_0005765 Ga0495656_0005765_1951_2340 118
697 3300046794 Ga0495589_0104089 Ga0495589_0104089_290_679 118
698 3300047320 Ga0495672_0038657 Ga0495672_0038657_859_1242 118
699 3300048090 Ga0495615_0108346 Ga0495615_0108346_297_686 118
700 3300048903 Ga0496100_0026172 Ga0496100_0026172_892_1248 118
701 3300048903 Ga0496100_0096739 Ga0496100_0096739_629_985 118
702 3300048904 Ga0496101_0018547 Ga0496101_0018547_2513_2869 118
703 3300048904 Ga0496101_0107724 Ga0496101_0107724_1575_1931 118
704 3300048905 Ga0496102_0088257 Ga0496102_0088257_1865_2221 118
705 3300048905 Ga0496102_0392047 Ga0496102_0392047_200_556 118
706 3300048907 Ga0496104_0032709 Ga0496104_0032709_1161_1517 118
707 3300048907 Ga0496104_0292885 Ga0496104_0292885_467_823 118
708 3300048908 Ga0496105_0011758 Ga0496105_0011758_1034_1390 118
709 3300048908 Ga0496105_0108308 Ga0496105_0108308_699_1055 118
710 3300048908 Ga0496105_0160742 Ga0496105_0160742_734_1090 118
711 3300048908 Ga0496105_0246297 Ga0496105_0246297_291_656 118
712 3300048910 Ga0496107_0114841 Ga0496107_0114841_950_1306 118
713 3300048910 Ga0496107_0756380 Ga0496107_0756380_205_561 118
714 3300048917 Ga0496114_0054500 Ga0496114_0054500_531_887 118
715 3300048917 Ga0496114_0055755 Ga0496114_0055755_1724_2080 118
716 3300048918 Ga0496115_0007443 Ga0496115_0007443_5816_6172 118
717 3300048918 Ga0496115_0049048 Ga0496115_0049048_643_999 118
718 3300048918 Ga0496115_0429380 Ga0496115_0429380_693_1049 118
719 3300048919 Ga0496116_0003139 Ga0496116_0003139_12164_12529 118
720 3300048920 Ga0496117_0000232 Ga0496117_0000232_52830_53195 118
721 3300048920 Ga0496117_0004850 Ga0496117_0004850_2561_2935 118
722 3300048920 Ga0496117_0005578 Ga0496117_0005578_11392_11748 118
723 3300048920 Ga0496117_0014558 Ga0496117_0014558_4598_4963 118
724 3300048920 Ga0496117_0054113 Ga0496117_0054113_2303_2659 118
725 3300048920 Ga0496117_0059591 Ga0496117_0059591_1387_1755 118
726 3300048920 Ga0496117_0108514 Ga0496117_0108514_28_405 118
727 3300048920 Ga0496117_0217421 Ga0496117_0217421_563_919 118
728 3300048921 Ga0496118_0003838 Ga0496118_0003838_8552_8917 118
729 3300048921 Ga0496118_0008605 Ga0496118_0008605_8825_9202 118
730 3300048921 Ga0496118_0139720 Ga0496118_0139720_327_683 118
731 3300048921 Ga0496118_0182578 Ga0496118_0182578_660_1028 118
732 3300048921 Ga0496118_0375170 Ga0496118_0375170_188_556 118
733 3300048921 Ga0496118_0521608 Ga0496118_0521608_13_378 118
734 3300048922 Ga0496119_0001875 Ga0496119_0001875_18285_18662 118
735 3300048922 Ga0496119_0002098 Ga0496119_0002098_11437_11811 118
736 3300048922 Ga0496119_0009311 Ga0496119_0009311_5952_6317 118
737 3300048922 Ga0496119_0017986 Ga0496119_0017986_1506_1871 118
738 3300048922 Ga0496119_0323337 Ga0496119_0323337_258_623 118
739 3300048922 Ga0496119_0398745 Ga0496119_0398745_248_604 118
740 3300048923 Ga0496120_0000456 Ga0496120_0000456_24975_25352 118
741 3300048923 Ga0496120_0001183 Ga0496120_0001183_28799_29164 118
742 3300048923 Ga0496120_0001794 Ga0496120_0001794_8147_8512 118
743 3300048923 Ga0496120_0001809 Ga0496120_0001809_15597_15962 118
744 3300048923 Ga0496120_0008433 Ga0496120_0008433_2154_2528 118
745 3300048923 Ga0496120_0016059 Ga0496120_0016059_177_545 118
746 3300048923 Ga0496120_0022428 Ga0496120_0022428_1875_2258 118
747 3300048923 Ga0496120_0072145 Ga0496120_0072145_551_928 118
748 3300048924 Ga0496121_0075900 Ga0496121_0075900_1872_2228 118
749 3300048925 Ga0496122_0000030 Ga0496122_0000030_155597_155962 118
750 3300048925 Ga0496122_0000120 Ga0496122_0000120_18100_18474 118
751 3300048925 Ga0496122_0009370 Ga0496122_0009370_3868_4233 118
752 3300048925 Ga0496122_0194503 Ga0496122_0194503_183_551 118
753 3300048925 Ga0496122_0373829 Ga0496122_0373829_14_385 118
754 3300048926 Ga0496123_0000024 Ga0496123_0000024_155598_155963 118
755 3300048926 Ga0496123_0000051 Ga0496123_0000051_47995_48369 118
756 3300048926 Ga0496123_0001799 Ga0496123_0001799_3877_4242 118
757 3300048927 Ga0496124_0005016 Ga0496124_0005016_14580_14945 118
758 3300048927 Ga0496124_0008086 Ga0496124_0008086_6177_6551 118
759 3300048927 Ga0496124_0070691 Ga0496124_0070691_2144_2515 118
760 3300048927 Ga0496124_0124392 Ga0496124_0124392_27_392 118
761 3300048927 Ga0496124_0322356 Ga0496124_0322356_356_727 118
762 3300048928 Ga0496125_0001405 Ga0496125_0001405_26252_26617 118
763 3300048928 Ga0496125_0016870 Ga0496125_0016870_2744_3109 118
764 3300048928 Ga0496125_0017389 Ga0496125_0017389_6078_6452 118
765 3300048928 Ga0496125_0177610 Ga0496125_0177610_872_1228 118
766 3300048929 Ga0496126_0001194 Ga0496126_0001194_22616_22981 118
767 3300048929 Ga0496126_0005417 Ga0496126_0005417_11448_11816 118
768 3300048929 Ga0496126_0019688 Ga0496126_0019688_4063_4437 118
769 3300048929 Ga0496126_0030513 Ga0496126_0030513_2556_2921 118
770 3300048929 Ga0496126_0054593 Ga0496126_0054593_2327_2683 118
771 3300048929 Ga0496126_0117274 Ga0496126_0117274_1311_1673 118
772 3300049527 Ga0501311_088638 Ga0501311_088638_111_473 118
773 3300049531 Ga0501315_095497 Ga0501315_095497_41_406 118
774 3300049568 Ga0501031_0211242 Ga0501031_0211242_889_1245 118
775 3300049568 Ga0501031_0271693 Ga0501031_0271693_501_875 118
776 3300049569 Ga0501032_0013515 Ga0501032_0013515_524_880 118
777 3300049569 Ga0501032_0427289 Ga0501032_0427289_407_763 118
778 3300049570 Ga0501033_0009978 Ga0501033_0009978_3931_4305 118
779 3300049570 Ga0501033_0037603 Ga0501033_0037603_3130_3486 118
780 3300049570 Ga0501033_0048914 Ga0501033_0048914_2747_3103 118
781 3300049570 Ga0501033_0086936 Ga0501033_0086936_1717_2091 118
782 3300049570 Ga0501033_0093765 Ga0501033_0093765_1441_1815 118
783 3300049571 Ga0501034_0005786 Ga0501034_0005786_9260_9628 118
784 3300049571 Ga0501034_0016806 Ga0501034_0016806_4166_4540 118
785 3300049571 Ga0501034_0019532 Ga0501034_0019532_890_1246 118
786 3300049571 Ga0501034_0039777 Ga0501034_0039777_2923_3306 118
787 3300049571 Ga0501034_0063939 Ga0501034_0063939_2536_2907 118
788 3300049571 Ga0501034_0085814 Ga0501034_0085814_56_412 118
789 3300049571 Ga0501034_0171817 Ga0501034_0171817_1032_1406 118
790 3300049571 Ga0501034_0172624 Ga0501034_0172624_186_560 118
791 3300049571 Ga0501034_0194756 Ga0501034_0194756_1585_1956 118
792 3300049571 Ga0501034_0241599 Ga0501034_0241599_232_588 118
793 3300049572 Ga0501036_0015582 Ga0501036_0015582_4956_5312 118
794 3300049572 Ga0501036_0098223 Ga0501036_0098223_912_1286 118
795 3300049572 Ga0501036_0129312 Ga0501036_0129312_190_564 118
796 3300049573 Ga0501037_0000671 Ga0501037_0000671_23313_23669 118
797 3300049573 Ga0501037_0094752 Ga0501037_0094752_215_589 118
798 3300049573 Ga0501037_0094895 Ga0501037_0094895_214_588 118
799 3300049573 Ga0501037_0115191 Ga0501037_0115191_969_1325 118
800 3300049573 Ga0501037_0181934 Ga0501037_0181934_885_1259 118
801 3300049574 Ga0501038_0041553 Ga0501038_0041553_890_1246 118
802 3300049574 Ga0501038_0068332 Ga0501038_0068332_1917_2285 118
803 3300049574 Ga0501038_0225008 Ga0501038_0225008_214_588 118
804 3300049574 Ga0501038_0943342 Ga0501038_0943342_215_589 118
805 3300049575 Ga0501039_0016493 Ga0501039_0016493_1922_2278 118
806 3300049575 Ga0501039_0067506 Ga0501039_0067506_1844_2218 118
807 3300049578 Ga0501042_0098051 Ga0501042_0098051_820_1194 118
808 3300049578 Ga0501042_0366605 Ga0501042_0366605_66_422 118
809 3300049578 Ga0501042_0861660 Ga0501042_0861660_78_452 118
810 3300049579 Ga0501043_0008078 Ga0501043_0008078_1987_2361 118
811 3300049579 Ga0501043_0018745 Ga0501043_0018745_3447_3803 118
812 3300049579 Ga0501043_0024603 Ga0501043_0024603_2348_2722 118
813 3300049579 Ga0501043_0102976 Ga0501043_0102976_214_588 118
814 3300049579 Ga0501043_0535903 Ga0501043_0535903_379_735 118
815 3300049580 Ga0501046_0002630 Ga0501046_0002630_18_374 118
816 3300049580 Ga0501046_0007016 Ga0501046_0007016_1569_1943 118
817 3300049580 Ga0501046_0014629 Ga0501046_0014629_5876_6232 118
818 3300049580 Ga0501046_0106879 Ga0501046_0106879_1569_1943 118
819 3300049581 Ga0501047_0031241 Ga0501047_0031241_3194_3568 118
820 3300049581 Ga0501047_0032946 Ga0501047_0032946_2760_3134 118
821 3300049581 Ga0501047_0035220 Ga0501047_0035220_1570_1944 118
822 3300049581 Ga0501047_0046979 Ga0501047_0046979_1166_1522 118
823 3300049581 Ga0501047_0101716 Ga0501047_0101716_1568_1924 118
824 3300049582 Ga0501048_0043285 Ga0501048_0043285_1979_2335 118
825 3300049582 Ga0501048_0065475 Ga0501048_0065475_1769_2143 118
826 3300049583 Ga0501067_0253134 Ga0501067_0253134_243_614 118
827 3300049585 Ga0501069_0271572 Ga0501069_0271572_54_428 118
828 3300049586 Ga0501070_0000167 Ga0501070_0000167_40609_40965 118
829 3300049586 Ga0501070_0024474 Ga0501070_0024474_1126_1482 118
830 3300049586 Ga0501070_0071839 Ga0501070_0071839_221_577 118
831 3300049586 Ga0501070_0084094 Ga0501070_0084094_1746_2138 118
832 3300049586 Ga0501070_0541137 Ga0501070_0541137_338_712 118
833 3300049588 Ga0501072_0139399 Ga0501072_0139399_1275_1646 118
834 3300049588 Ga0501072_0734019 Ga0501072_0734019_346_720 118
835 3300049589 Ga0501073_0017669 Ga0501073_0017669_489_860 118
836 3300049589 Ga0501073_0077343 Ga0501073_0077343_1601_1975 118
837 3300049589 Ga0501073_0371190 Ga0501073_0371190_581_937 118
838 3300049589 Ga0501073_0918916 Ga0501073_0918916_97_480 118
839 3300049590 Ga0501074_0049308 Ga0501074_0049308_383_757 118
840 3300049742 Ga0501080_0018161 Ga0501080_0018161_4201_4593 118
841 3300049742 Ga0501080_0217030 Ga0501080_0217030_1340_1714 118
842 3300049742 Ga0501080_0724153 Ga0501080_0724153_233_625 118
843 3300049742 Ga0501080_0994626 Ga0501080_0994626_113_475 118
844 3300049822 Ga0501035_0013503 Ga0501035_0013503_4284_4658 118
845 3300049822 Ga0501035_0015949 Ga0501035_0015949_1438_1794 118
846 3300049822 Ga0501035_0020737 Ga0501035_0020737_1244_1618 118
847 3300049822 Ga0501035_0047185 Ga0501035_0047185_1102_1476 118
848 3300049822 Ga0501035_0323430 Ga0501035_0323430_697_1053 118
849 3300049822 Ga0501035_0373953 Ga0501035_0373953_812_1168 118
850 3300049822 Ga0501035_0973007 Ga0501035_0973007_36_410 118
851 3300049823 Ga0501044_0040026 Ga0501044_0040026_1551_1907 118
852 3300049823 Ga0501044_0046775 Ga0501044_0046775_1540_1914 118
853 3300049823 Ga0501044_0117710 Ga0501044_0117710_1627_1983 118
854 3300049823 Ga0501044_0136446 Ga0501044_0136446_502_876 118
855 3300049823 Ga0501044_0255349 Ga0501044_0255349_217_591 118
856 3300049824 Ga0501045_0005904 Ga0501045_0005904_2204_2560 118
857 3300049824 Ga0501045_0153212 Ga0501045_0153212_1312_1686 118
858 3300050491 nmdc:mga00v17_126263_c1 nmdc:mga00v17_126263_c1_975_1337 118
859 3300050491 nmdc:mga00v17_171980_c1 nmdc:mga00v17_171980_c1_697_1065 118
860 3300050491 nmdc:mga00v17_207696_c1 nmdc:mga00v17_207696_c1_79_447 118
861 3300050491 nmdc:mga00v17_5626_c1 nmdc:mga00v17_5626_c1_2458_2823 118
862 3300050491 nmdc:mga00v17_85051_c1 nmdc:mga00v17_85051_c1_169_531 118
863 3300050492 nmdc:mga0yw44_7012_c1 nmdc:mga0yw44_7012_c1_4799_5161 118
864 3300050492 nmdc:mga0yw44_714536_c1 nmdc:mga0yw44_714536_c1_199_564 118
865 3300050492 nmdc:mga0yw44_96810_c1 nmdc:mga0yw44_96810_c1_1191_1553 118
866 3300050516 nmdc:mga0sz30_24672_c2 nmdc:mga0sz30_24672_c2_681_1046 118
867 3300050516 nmdc:mga0sz30_55559_c1 nmdc:mga0sz30_55559_c1_949_1305 118
868 3300050516 nmdc:mga0sz30_5766_c1 nmdc:mga0sz30_5766_c1_2081_2443 118
869 3300053080 Ga0500635_0000028 Ga0500635_0000028_31759_32115 118
870 3300053080 Ga0500635_0255746 Ga0500635_0255746_162_545 118
871 3300053104 Ga0500556_0000393 Ga0500556_0000393_14964_15326 118
872 3300053108 Ga0500562_000296 Ga0500562_000296_2585_2947 118
873 3300053117 Ga0500593_000123 Ga0500593_000123_15003_15365 118
874 3300053129 Ga0500628_162534 Ga0500628_162534_115_495 118
875 3300053136 Ga0500559_0000218 Ga0500559_0000218_45510_45872 118
876 3300053136 Ga0500559_0002382 Ga0500559_0002382_1582_1965 118
877 3300053136 Ga0500559_0003021 Ga0500559_0003021_6431_6814 118
878 3300053136 Ga0500559_0217272 Ga0500559_0217272_436_798 118
879 3300053139 Ga0500568_0015664 Ga0500568_0015664_1538_1921 118
880 3300053139 Ga0500568_0018256 Ga0500568_0018256_2227_2610 118
881 3300053153 Ga0500616_0001402 Ga0500616_0001402_20900_21271 118
882 3300053153 Ga0500616_0003545 Ga0500616_0003545_4847_5230 118
883 3300053153 Ga0500616_0037251 Ga0500616_0037251_1698_2060 118
884 3300053155 Ga0500620_122830 Ga0500620_122830_165_539 118
885 3300054114 Ga0501084_0705777 Ga0501084_0705777_145_519 118
886 3300059477 Ga0587084_000197 Ga0587084_000197_419_787 118
887 3300059477 Ga0587084_116430 Ga0587084_116430_103_477 118
888 3300059491 Ga0587070_110923 Ga0587070_110923_116_490 118
889 3300059492 Ga0587073_0284394 Ga0587073_0284394_63_446 118
890 3300059493 Ga0587077_266122 Ga0587077_266122_79_453 118
891 3300059505 Ga0587083_0280918 Ga0587083_0280918_71_445 118
892 3300059506 Ga0587085_173807 Ga0587085_173807_84_458 118
893 3300059511 Ga0587091_174772 Ga0587091_174772_79_453 118
894 3300059511 Ga0587091_207869 Ga0587091_207869_95_478 118
895 3300059513 Ga0587094_000283 Ga0587094_000283_3144_3512 118
896 3300059513 Ga0587094_108599 Ga0587094_108599_63_437 118
897 3300059605 Ga0587106_133668 Ga0587106_133668_103_477 118
898 3300059622 Ga0587099_053653 Ga0587099_053653_58_432 118
899 3300059623 Ga0587101_000138 Ga0587101_000138_3146_3514 118
900 3300059629 Ga0587127_027212 Ga0587127_027212_65_448 118
901 3300059630 Ga0587128_110085 Ga0587128_110085_31_387 118
902 3300059630 Ga0587128_149068 Ga0587128_149068_90_473 118
903 3300059631 Ga0587130_040113 Ga0587130_040113_57_440 118
904 3300059642 Ga0587069_001336 Ga0587069_001336_1793_2176 118
905 3300060344 Ga0587071_173172 Ga0587071_173172_97_471 118
906 3300061719 Ga0466962_0036505 Ga0466962_0036505_1392_1748 118
907 3300061719 Ga0466962_0187704 Ga0466962_0187704_314_670 118
908 3300061719 Ga0466962_0724769 Ga0466962_0724769_33_401 118
909 iso_pu_bacteria 2585428094 2587862680 118
910 iso_pu_bacteria 2966921586 2966923320 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

12

115

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8858 14 108
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.8646 13 107
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.861 13 109
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8525 14 108
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.845 13 109
ID Description Score Start End Superfamily
af_B6SR68_68_176_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9004 14 117 2.60.300.12
af_Q54P40_100_209_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8897 14 116 2.60.300.12
1s98A00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8858 14 108 2.60.300.12
af_P77667_17_122_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8721 13 117 2.60.300.12
af_O96161_49_160_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8684 14 116 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A1F3B8W7-F1-model_v4 Heme biosynthesis protein HemY 0.946 14 107 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A531KMU7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9332 14 109 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A1F3B8W7-F1-model_v4 Heme biosynthesis protein HemY 0.9271 14 107 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A3B0VMK9-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.927 13 108 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A0R2Q3V8-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.925 7 109 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035

Feature Viewer

pLDDT pTM Quality
81.32 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map