F485245

General Info

Members Datasets Scaffolds Average Seq Length
903 363 1806 80

Family's Representative Sequence

Representative Sequence 3300035115|Ga0373941_0055909|Ga0373941_0055909_34_312
Length 92
Sequence MVDPHSIKEGIAAGLSCEHVEVIGDGQHFQALIVSGEFAGKNRVQRHQLVYAALGERMREEIHALSMRTLTPEEWRADERRASAGEERRRDG

Samples

Sample ID Description Type Environment
1 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
191 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
193 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
194 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
232 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
235 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
238 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
239 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
240 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
241 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
242 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
243 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
244 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
245 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
248 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
249 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
250 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
253 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
308 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
309 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
310 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
311 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
335 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
336 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
337 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
341 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
342 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
343 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
358 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
359 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
360 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
361 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.89
Rhizosphere 98.56
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373941_0055909 3300035115 Bacteria 1270
2 2214821604 2209111006 Bacteria 664
3 JGI25406J46586_10050638 3300003203 Bacteria 1394
4 Ga0065704_10172219 3300005289 Bacteria 1284
5 Ga0065707_10353001 3300005295 Bacteria 907
6 Ga0065707_10806145 3300005295 Bacteria 597
7 Ga0070676_10708091 3300005328 Bacteria 736
8 Ga0070683_100146059 3300005329 Bacteria 2241
9 Ga0070683_102211646 3300005329 Bacteria 528
10 Ga0070690_100103612 3300005330 Bacteria 1889
11 Ga0070690_101342449 3300005330 Bacteria 574
12 Ga0068869_100000139 3300005334 Bacteria 35367
13 Ga0068869_100023856 3300005334 Bacteria 4233
14 Ga0068869_100705852 3300005334 Bacteria 860
15 Ga0068869_101235485 3300005334 Bacteria 657
16 Ga0068869_101552600 3300005334 Bacteria 589
17 Ga0070666_10508758 3300005335 Bacteria 873
18 Ga0070680_100000688 3300005336 Bacteria 23463
19 Ga0070680_100042008 3300005336 Bacteria 3708
20 Ga0070680_100063111 3300005336 Bacteria 3034
21 Ga0070680_100698374 3300005336 Bacteria 873
22 Ga0070680_100816370 3300005336 Bacteria 804
23 Ga0070680_100847944 3300005336 Bacteria 788
24 Ga0070680_100972843 3300005336 Bacteria 733
25 Ga0070682_100012632 3300005337 Bacteria 4845
26 Ga0068868_100000115 3300005338 Bacteria 50197
27 Ga0068868_100680657 3300005338 Bacteria 918
28 Ga0068868_101344206 3300005338 Bacteria 665
29 Ga0070689_100001743 3300005340 Bacteria 13915
30 Ga0070689_100025052 3300005340 Bacteria 4480
31 Ga0070689_100027458 3300005340 Bacteria 4292
32 Ga0070689_100356880 3300005340 Unclassified 1227
33 Ga0070689_100512367 3300005340 Bacteria 1029
34 Ga0070689_100689972 3300005340 Bacteria 891
35 Ga0070691_10003942 3300005341 Bacteria 6715
36 Ga0070691_10356339 3300005341 Bacteria 814
37 Ga0070687_100000091 3300005343 Bacteria 29810
38 Ga0070687_100027951 3300005343 Bacteria 2730
39 Ga0070687_100105247 3300005343 Bacteria 1587
40 Ga0070687_100302171 3300005343 Bacteria 1016
41 Ga0070687_100737844 3300005343 Bacteria 692
42 Ga0070687_100756709 3300005343 Bacteria 684
43 Ga0070687_101060375 3300005343 Bacteria 591
44 Ga0070687_101351317 3300005343 Bacteria 531
45 Ga0070692_10004059 3300005345 Bacteria 6050
46 Ga0070692_10258912 3300005345 Bacteria 1045
47 Ga0070692_10528637 3300005345 Bacteria 769
48 Ga0070675_100034538 3300005354 Bacteria 4105
49 Ga0070675_100368983 3300005354 Bacteria 1276
50 Ga0070675_101074380 3300005354 Bacteria 740
51 Ga0070675_101605578 3300005354 Bacteria 600
52 Ga0070673_100096295 3300005364 Bacteria 2429
53 Ga0070673_100582961 3300005364 Bacteria 1019
54 Ga0070673_100971160 3300005364 Bacteria 790
55 Ga0070688_100240777 3300005365 Bacteria 1284
56 Ga0070688_100288389 3300005365 Bacteria 1182
57 Ga0070688_100341788 3300005365 Bacteria 1093
58 Ga0070703_10267513 3300005406 Bacteria 700
59 Ga0070709_10076065 3300005434 Bacteria 2180
60 Ga0070709_10632748 3300005434 Bacteria 827
61 Ga0070714_100118661 3300005435 Bacteria 2350
62 Ga0070713_100036973 3300005436 Bacteria 3944
63 Ga0070713_100973381 3300005436 Bacteria 818
64 Ga0070713_101338477 3300005436 Bacteria 694
65 Ga0070710_10023439 3300005437 Bacteria 3245
66 Ga0070710_10364279 3300005437 Bacteria 960
67 Ga0070701_10000914 3300005438 Bacteria 10687
68 Ga0070701_10292701 3300005438 Bacteria 998
69 Ga0070701_10322986 3300005438 Bacteria 956
70 Ga0070701_10973717 3300005438 Bacteria 590
71 Ga0070701_11147561 3300005438 Bacteria 549
72 Ga0070701_11315252 3300005438 Bacteria 517
73 Ga0070711_100000407 3300005439 Bacteria 22299
74 Ga0070711_100506531 3300005439 Bacteria 996
75 Ga0070711_100550820 3300005439 Bacteria 957
76 Ga0070705_100000441 3300005440 Bacteria 23797
77 Ga0070705_100006747 3300005440 Bacteria 5646
78 Ga0070705_100153027 3300005440 Bacteria 1532
79 Ga0070705_100257986 3300005440 Bacteria 1228
80 Ga0070705_100376509 3300005440 Bacteria 1043
81 Ga0070705_100806819 3300005440 Bacteria 747
82 Ga0070705_100807574 3300005440 Bacteria 747
83 Ga0070700_100074600 3300005441 Bacteria 2174
84 Ga0070700_100580040 3300005441 Bacteria 875
85 Ga0070700_100996101 3300005441 Bacteria 689
86 Ga0070694_100000133 3300005444 Bacteria 37050
87 Ga0070694_100074414 3300005444 Bacteria 2348
88 Ga0070694_100089437 3300005444 Bacteria 2158
89 Ga0070694_100328676 3300005444 Bacteria 1179
90 Ga0070694_101268547 3300005444 Bacteria 619
91 Ga0070708_101363054 3300005445 Bacteria 662
92 Ga0070678_100626333 3300005456 Bacteria 963
93 Ga0070681_10000081 3300005458 Bacteria 71809
94 Ga0070681_10731117 3300005458 Bacteria 906
95 Ga0070681_11146055 3300005458 Bacteria 699
96 Ga0070681_11361776 3300005458 Bacteria 633
97 Ga0068867_100000084 3300005459 Bacteria 58558
98 Ga0068867_100240246 3300005459 Bacteria 1469
99 Ga0068867_100653246 3300005459 Bacteria 923
100 Ga0070685_10263235 3300005466 Bacteria 1147
101 Ga0070706_101653239 3300005467 Bacteria 584
102 Ga0070707_100322158 3300005468 Bacteria 1502
103 Ga0070707_100690100 3300005468 Bacteria 984
104 Ga0070707_101230374 3300005468 Bacteria 715
105 Ga0070698_100489798 3300005471 Bacteria 1167
106 Ga0070698_100572898 3300005471 Bacteria 1069
107 Ga0070698_100630431 3300005471 Bacteria 1013
108 Ga0070699_100003701 3300005518 Bacteria 13522
109 Ga0070699_101538284 3300005518 Bacteria 610
110 Ga0070699_102101442 3300005518 Bacteria 516
111 Ga0070679_100011998 3300005530 Bacteria 8270
112 Ga0070679_100054997 3300005530 Bacteria 3964
113 Ga0070697_100000299 3300005536 Bacteria 39638
114 Ga0070697_100004807 3300005536 Bacteria 10352
115 Ga0070697_100134189 3300005536 Bacteria 2078
116 Ga0070697_100395824 3300005536 Bacteria 1198
117 Ga0068853_100958826 3300005539 Bacteria 823
118 Ga0070686_100000193 3300005544 Bacteria 42276
119 Ga0070686_100152719 3300005544 Bacteria 1619
120 Ga0070686_100217809 3300005544 Bacteria 1378
121 Ga0070686_100296135 3300005544 Bacteria 1198
122 Ga0070686_100315644 3300005544 Bacteria 1164
123 Ga0070695_100000163 3300005545 Bacteria 31628
124 Ga0070695_100000641 3300005545 Bacteria 18567
125 Ga0070695_100007191 3300005545 Bacteria 6600
126 Ga0070695_100259426 3300005545 Bacteria 1269
127 Ga0070695_101133676 3300005545 Bacteria 641
128 Ga0070696_100000570 3300005546 Bacteria 23539
129 Ga0070696_100084784 3300005546 Bacteria 2248
130 Ga0070696_100143107 3300005546 Bacteria 1749
131 Ga0070696_100219444 3300005546 Bacteria 1426
132 Ga0070696_101343494 3300005546 Bacteria 608
133 Ga0070693_100000111 3300005547 Bacteria 36381
134 Ga0070693_100039453 3300005547 Bacteria 2645
135 Ga0070665_100003736 3300005548 Bacteria 16125
136 Ga0070704_100000008 3300005549 Bacteria 71641
137 Ga0070704_100006181 3300005549 Bacteria 7037
138 Ga0070704_100062259 3300005549 Bacteria 2674
139 Ga0070704_100170922 3300005549 Bacteria 1729
140 Ga0070704_100681664 3300005549 Bacteria 910
141 Ga0070704_101611402 3300005549 Bacteria 599
142 Ga0068855_100000242 3300005563 Bacteria 68674
143 Ga0068855_100730178 3300005563 Bacteria 1058
144 Ga0068857_101642127 3300005577 Bacteria 628
145 Ga0068854_100040204 3300005578 Bacteria 3299
146 Ga0068856_100043238 3300005614 Bacteria 4433
147 Ga0068856_101704260 3300005614 Bacteria 643
148 Ga0070702_100000012 3300005615 Bacteria 58298
149 Ga0070702_100169859 3300005615 Bacteria 1417
150 Ga0070702_100379191 3300005615 Bacteria 1005
151 Ga0070702_101218170 3300005615 Bacteria 607
152 Ga0068852_100475803 3300005616 Bacteria 1240
153 Ga0068852_100971515 3300005616 Bacteria 868
154 Ga0068859_100001460 3300005617 Bacteria 24031
155 Ga0068859_100007534 3300005617 Bacteria 11052
156 Ga0068859_100010525 3300005617 Bacteria 9308
157 Ga0068859_100336094 3300005617 Bacteria 1605
158 Ga0068859_100459105 3300005617 Bacteria 1370
159 Ga0068859_100805648 3300005617 Bacteria 1027
160 Ga0068859_102581852 3300005617 Bacteria 559
161 Ga0068864_100013356 3300005618 Bacteria 6805
162 Ga0068864_100172881 3300005618 Bacteria 1971
163 Ga0068864_100908292 3300005618 Bacteria 870
164 Ga0068866_10000109 3300005718 Bacteria 35401
165 Ga0068866_10190247 3300005718 Bacteria 1219
166 Ga0068866_10675036 3300005718 Bacteria 706
167 Ga0068861_100000814 3300005719 Bacteria 18847
168 Ga0068861_100163185 3300005719 Bacteria 1840
169 Ga0068861_101559422 3300005719 Bacteria 650
170 Ga0068861_102020546 3300005719 Bacteria 575
171 Ga0068870_10026463 3300005840 Bacteria 2892
172 Ga0068870_10086650 3300005840 Bacteria 1743
173 Ga0068870_10375570 3300005840 Bacteria 919
174 Ga0068863_100000366 3300005841 Bacteria 45953
175 Ga0068863_100968479 3300005841 Bacteria 853
176 Ga0068863_100986381 3300005841 Bacteria 845
177 Ga0068863_101109902 3300005841 Bacteria 796
178 Ga0068858_100003588 3300005842 Bacteria 15356
179 Ga0068858_100013374 3300005842 Bacteria 7744
180 Ga0068858_102458409 3300005842 Bacteria 515
181 Ga0068860_100014674 3300005843 Bacteria 7665
182 Ga0068860_100126778 3300005843 Bacteria 2447
183 Ga0068860_100264467 3300005843 Bacteria 1677
184 Ga0068862_100005995 3300005844 Bacteria 10118
185 Ga0068862_100138128 3300005844 Bacteria 2161
186 Ga0068862_100407105 3300005844 Bacteria 1274
187 Ga0068862_101530693 3300005844 Bacteria 673
188 Ga0081539_10004782 3300005985 Bacteria 14603
189 Ga0075432_10267579 3300006058 Bacteria 699
190 Ga0070715_10004316 3300006163 Bacteria 4644
191 Ga0070715_10111467 3300006163 Bacteria 1291
192 Ga0070715_10288053 3300006163 Bacteria 874
193 Ga0070716_100103313 3300006173 Bacteria 1752
194 Ga0070716_100134860 3300006173 Bacteria 1566
195 Ga0070716_100389849 3300006173 Bacteria 998
196 Ga0070716_100785466 3300006173 Bacteria 736
197 Ga0075366_10956673 3300006195 Bacteria 534
198 Ga0097621_100018927 3300006237 Bacteria 5274
199 Ga0097621_100285245 3300006237 Bacteria 1454
200 Ga0097621_100532634 3300006237 Bacteria 1067
201 Ga0068871_100000559 3300006358 Bacteria 25362
202 Ga0068871_100238293 3300006358 Bacteria 1581
203 Ga0068871_100715127 3300006358 Bacteria 918
204 Ga0075428_100001187 3300006844 Bacteria 27861
205 Ga0075428_100525555 3300006844 Bacteria 1265
206 Ga0075428_101210628 3300006844 Bacteria 796
207 Ga0075428_101324503 3300006844 Bacteria 757
208 Ga0075428_101702199 3300006844 Bacteria 658
209 Ga0075430_100006533 3300006846 Bacteria 9834
210 Ga0075430_100134869 3300006846 Bacteria 2057
211 Ga0075430_100596369 3300006846 Bacteria 911
212 Ga0075430_100666734 3300006846 Bacteria 858
213 Ga0075431_100043576 3300006847 Bacteria 4628
214 Ga0075431_100269282 3300006847 Bacteria 1727
215 Ga0075431_100347809 3300006847 Bacteria 1491
216 Ga0075431_100469962 3300006847 Bacteria 1251
217 Ga0075431_100753585 3300006847 Bacteria 949
218 Ga0075431_100889224 3300006847 Bacteria 861
219 Ga0075431_101257569 3300006847 Bacteria 702
220 Ga0075433_10006494 3300006852 Bacteria 9246
221 Ga0075433_10043631 3300006852 Bacteria 3894
222 Ga0075433_10071445 3300006852 Bacteria 3051
223 Ga0075433_10101415 3300006852 Bacteria 2549
224 Ga0075433_10254495 3300006852 Bacteria 1558
225 Ga0075433_11045427 3300006852 Bacteria 711
226 Ga0075434_100000125 3300006871 Bacteria 45534
227 Ga0075434_100001287 3300006871 Bacteria 20920
228 Ga0075434_100312590 3300006871 Bacteria 1591
229 Ga0075434_100382579 3300006871 Bacteria 1428
230 Ga0075434_100771695 3300006871 Bacteria 978
231 Ga0075434_100830123 3300006871 Bacteria 940
232 Ga0075434_100831099 3300006871 Bacteria 939
233 Ga0075429_100000891 3300006880 Bacteria 23613
234 Ga0075429_100659444 3300006880 Bacteria 917
235 Ga0075429_101139868 3300006880 Bacteria 681
236 Ga0068865_100002206 3300006881 Bacteria 11476
237 Ga0068865_101123381 3300006881 Bacteria 693
238 Ga0068865_101527388 3300006881 Bacteria 599
239 Ga0068865_101939155 3300006881 Bacteria 534
240 Ga0075436_100000789 3300006914 Bacteria 21020
241 Ga0075436_100013534 3300006914 Bacteria 5588
242 Ga0075436_100050041 3300006914 Bacteria 2883
243 Ga0075436_100053555 3300006914 Bacteria 2786
244 Ga0075436_100076586 3300006914 Bacteria 2316
245 Ga0075436_100138447 3300006914 Bacteria 1710
246 Ga0075436_100886005 3300006914 Bacteria 667
247 Ga0097620_100001461 3300006931 Bacteria 24031
248 Ga0097620_100007535 3300006931 Bacteria 11052
249 Ga0097620_100010526 3300006931 Bacteria 9308
250 Ga0097620_100336128 3300006931 Bacteria 1605
251 Ga0097620_100459123 3300006931 Bacteria 1370
252 Ga0097620_100805596 3300006931 Bacteria 1027
253 Ga0097620_102581988 3300006931 Bacteria 559
254 Ga0075435_100000655 3300007076 Bacteria 21307
255 Ga0075435_100002909 3300007076 Bacteria 11493
256 Ga0075435_100025734 3300007076 Bacteria 4583
257 Ga0099794_10404690 3300007265 Bacteria 713
258 Ga0099794_10501610 3300007265 Bacteria 639
259 Ga0099794_10550482 3300007265 Bacteria 609
260 Ga0099795_10297031 3300007788 Bacteria 709
261 Ga0105250_10201114 3300009092 Bacteria 840
262 Ga0105240_10369816 3300009093 Bacteria 1621
263 Ga0111539_10011985 3300009094 Bacteria 10872
264 Ga0111539_10160623 3300009094 Bacteria 2628
265 Ga0111539_10269186 3300009094 Bacteria 1983
266 Ga0111539_10435051 3300009094 Bacteria 1527
267 Ga0111539_10923022 3300009094 Bacteria 1015
268 Ga0111539_11319098 3300009094 Bacteria 837
269 Ga0111539_11538485 3300009094 Bacteria 771
270 Ga0105245_10000245 3300009098 Bacteria 51952
271 Ga0105247_10003683 3300009101 Bacteria 9946
272 Ga0114129_10010044 3300009147 Bacteria 13495
273 Ga0114129_10413547 3300009147 Bacteria 1775
274 Ga0114129_10610629 3300009147 Bacteria 1412
275 Ga0114129_10655525 3300009147 Bacteria 1354
276 Ga0114129_10831445 3300009147 Bacteria 1175
277 Ga0114129_10944974 3300009147 Bacteria 1089
278 Ga0114129_11739981 3300009147 Bacteria 760
279 Ga0105243_10000279 3300009148 Bacteria 56997
280 Ga0105241_10029613 3300009174 Bacteria 4087
281 Ga0105241_11152729 3300009174 Bacteria 732
282 Ga0105242_10000480 3300009176 Bacteria 31755
283 Ga0105242_13076862 3300009176 Bacteria 517
284 Ga0105242_13175158 3300009176 Bacteria 510
285 Ga0105248_10466243 3300009177 Bacteria 1424
286 Ga0105237_12573454 3300009545 Bacteria 519
287 Ga0105249_10007151 3300009553 Bacteria 9742
288 Ga0105249_10024734 3300009553 Bacteria 5399
289 Ga0105249_10701534 3300009553 Bacteria 1072
290 Ga0099796_10279661 3300010159 Bacteria 701
291 Ga0105239_10142336 3300010375 Bacteria 2673
292 Ga0105239_11581117 3300010375 Bacteria 758
293 Ga0105246_10240815 3300011119 Bacteria 1430
294 Ga0105246_11614451 3300011119 Bacteria 613
295 Ga0157369_11871255 3300013105 Bacteria 609
296 Ga0157374_10005148 3300013296 Bacteria 10967
297 Ga0157378_10002150 3300013297 Bacteria 17495
298 Ga0157378_13289635 3300013297 Bacteria 502
299 Ga0163162_10436952 3300013306 Bacteria 1441
300 Ga0157372_10470914 3300013307 Bacteria 1464
301 Ga0157372_10473166 3300013307 Bacteria 1461
302 Ga0157375_10316375 3300013308 Bacteria 1725
303 Ga0157375_10961101 3300013308 Bacteria 996
304 Ga0163163_10474854 3300014325 Bacteria 1311
305 Ga0157380_10154148 3300014326 Bacteria 1990
306 Ga0157377_10184913 3300014745 Bacteria 1313
307 Ga0157377_10346965 3300014745 Bacteria 995
308 Ga0157377_11171049 3300014745 Bacteria 593
309 Ga0157379_10008253 3300014968 Bacteria 9048
310 Ga0157379_10279422 3300014968 Bacteria 1519
311 Ga0157376_10002130 3300014969 Bacteria 13330
312 Ga0157376_10687184 3300014969 Bacteria 1027
313 Ga0157376_10857093 3300014969 Bacteria 924
314 Ga0163161_10453024 3300017792 Bacteria 1037
315 Ga0207696_1142833 3300025711 Bacteria 641
316 Ga0207653_10003892 3300025885 Bacteria 4691
317 Ga0207653_10389875 3300025885 Bacteria 546
318 Ga0207692_10238718 3300025898 Bacteria 1085
319 Ga0207692_10587853 3300025898 Bacteria 715
320 Ga0207692_10833636 3300025898 Bacteria 604
321 Ga0207642_10000702 3300025899 Bacteria 10369
322 Ga0207642_10406475 3300025899 Bacteria 816
323 Ga0207710_10006893 3300025900 Bacteria 4836
324 Ga0207688_10014848 3300025901 Bacteria 4227
325 Ga0207688_11105719 3300025901 Bacteria 500
326 Ga0207647_10098604 3300025904 Bacteria 1736
327 Ga0207685_10038230 3300025905 Bacteria 1773
328 Ga0207699_10252648 3300025906 Bacteria 1215
329 Ga0207645_10104524 3300025907 Bacteria 1829
330 Ga0207643_10037376 3300025908 Bacteria 2725
331 Ga0207643_10090168 3300025908 Bacteria 1787
332 Ga0207643_10249999 3300025908 Bacteria 1092
333 Ga0207684_10490446 3300025910 Bacteria 1053
334 Ga0207654_10057473 3300025911 Bacteria 2261
335 Ga0207707_10001519 3300025912 Bacteria 21403
336 Ga0207707_10954553 3300025912 Bacteria 706
337 Ga0207695_10795767 3300025913 Bacteria 825
338 Ga0207693_10000364 3300025915 Bacteria 41420
339 Ga0207663_10006677 3300025916 Bacteria 5931
340 Ga0207663_10165977 3300025916 Bacteria 1564
341 Ga0207663_10578728 3300025916 Bacteria 880
342 Ga0207660_10002762 3300025917 Bacteria 11505
343 Ga0207660_10037154 3300025917 Bacteria 3392
344 Ga0207660_10170200 3300025917 Bacteria 1686
345 Ga0207660_10309447 3300025917 Bacteria 1259
346 Ga0207660_10568454 3300025917 Bacteria 923
347 Ga0207660_10939213 3300025917 Bacteria 706
348 Ga0207660_11244616 3300025917 Bacteria 605
349 Ga0207662_10000176 3300025918 Bacteria 30450
350 Ga0207662_10046732 3300025918 Bacteria 2562
351 Ga0207662_10331534 3300025918 Bacteria 1018
352 Ga0207662_11055294 3300025918 Bacteria 577
353 Ga0207652_10016191 3300025921 Bacteria 6083
354 Ga0207652_10036881 3300025921 Bacteria 4134
355 Ga0207646_10340422 3300025922 Bacteria 1355
356 Ga0207681_11056113 3300025923 Bacteria 682
357 Ga0207650_11824808 3300025925 Bacteria 514
358 Ga0207659_10008745 3300025926 Bacteria 6305
359 Ga0207687_10008984 3300025927 Bacteria 6531
360 Ga0207687_10240919 3300025927 Bacteria 1433
361 Ga0207700_10732050 3300025928 Bacteria 883
362 Ga0207664_10442308 3300025929 Bacteria 1159
363 Ga0207644_11840653 3300025931 Bacteria 506
364 Ga0207686_10000627 3300025934 Bacteria 21927
365 Ga0207686_10566713 3300025934 Bacteria 890
366 Ga0207686_10671923 3300025934 Bacteria 821
367 Ga0207709_10000549 3300025935 Bacteria 32146
368 Ga0207670_10001899 3300025936 Bacteria 10919
369 Ga0207670_10083050 3300025936 Bacteria 2246
370 Ga0207670_10207272 3300025936 Bacteria 1493
371 Ga0207670_10339135 3300025936 Bacteria 1187
372 Ga0207670_10432911 3300025936 Bacteria 1058
373 Ga0207670_10643363 3300025936 Bacteria 874
374 Ga0207704_10000329 3300025938 Bacteria 22100
375 Ga0207704_10762105 3300025938 Bacteria 806
376 Ga0207704_11229540 3300025938 Bacteria 639
377 Ga0207704_11556866 3300025938 Bacteria 568
378 Ga0207665_10028373 3300025939 Bacteria 3697
379 Ga0207665_10037722 3300025939 Bacteria 3217
380 Ga0207665_10496303 3300025939 Bacteria 942
381 Ga0207665_10637761 3300025939 Bacteria 834
382 Ga0207665_10939559 3300025939 Bacteria 687
383 Ga0207691_10214687 3300025940 Bacteria 1670
384 Ga0207691_11651530 3300025940 Bacteria 520
385 Ga0207711_10398887 3300025941 Bacteria 1278
386 Ga0207711_11466989 3300025941 Bacteria 625
387 Ga0207689_10001276 3300025942 Bacteria 24276
388 Ga0207689_10333107 3300025942 Bacteria 1260
389 Ga0207689_10385395 3300025942 Bacteria 1167
390 Ga0207689_11030217 3300025942 Bacteria 694
391 Ga0207667_10066744 3300025949 Bacteria 3749
392 Ga0207667_10719247 3300025949 Bacteria 1000
393 Ga0207651_10263991 3300025960 Bacteria 1415
394 Ga0207651_10566679 3300025960 Bacteria 989
395 Ga0207712_10046117 3300025961 Bacteria 3020
396 Ga0207712_10122691 3300025961 Bacteria 1968
397 Ga0207712_10159075 3300025961 Bacteria 1753
398 Ga0207640_10008328 3300025981 Bacteria 5759
399 Ga0207677_10000669 3300026023 Bacteria 20376
400 Ga0207677_10201015 3300026023 Bacteria 1584
401 Ga0207677_10361011 3300026023 Bacteria 1220
402 Ga0207677_11627307 3300026023 Unclassified 598
403 Ga0207703_10001000 3300026035 Bacteria 27175
404 Ga0207703_10008924 3300026035 Bacteria 7897
405 Ga0207703_12406073 3300026035 Bacteria 502
406 Ga0207639_10077699 3300026041 Bacteria 2618
407 Ga0207639_10715458 3300026041 Bacteria 930
408 Ga0207708_10000275 3300026075 Bacteria 40312
409 Ga0207708_10411181 3300026075 Bacteria 1120
410 Ga0207708_10476078 3300026075 Bacteria 1043
411 Ga0207708_11141823 3300026075 Bacteria 680
412 Ga0207702_10017969 3300026078 Bacteria 5852
413 Ga0207641_10004677 3300026088 Bacteria 11809
414 Ga0207641_10193036 3300026088 Bacteria 1873
415 Ga0207641_10762950 3300026088 Bacteria 955
416 Ga0207641_10923160 3300026088 Bacteria 867
417 Ga0207648_10000185 3300026089 Bacteria 65925
418 Ga0207648_10216176 3300026089 Bacteria 1702
419 Ga0207676_10354370 3300026095 Bacteria 1358
420 Ga0207676_10853773 3300026095 Bacteria 891
421 Ga0207674_10328981 3300026116 Bacteria 1478
422 Ga0207675_100000150 3300026118 Bacteria 61064
423 Ga0207675_100562384 3300026118 Bacteria 1140
424 Ga0207675_100839527 3300026118 Bacteria 933
425 Ga0207675_101646254 3300026118 Bacteria 662
426 Ga0207683_10298065 3300026121 Bacteria 1475
427 Ga0207698_10051617 3300026142 Bacteria 3145
428 Ga0207698_10923416 3300026142 Bacteria 881
429 Ga0209969_1006848 3300027360 Bacteria 1605
430 Ga0209969_1007420 3300027360 Bacteria 1549
431 Ga0209969_1013988 3300027360 Bacteria 1165
432 Ga0209967_1000418 3300027364 Bacteria 5601
433 Ga0209967_1007350 3300027364 Bacteria 1505
434 Ga0209981_1001186 3300027378 Bacteria 3303
435 Ga0209981_1007240 3300027378 Bacteria 1495
436 Ga0209981_1023602 3300027378 Bacteria 886
437 Ga0209996_1013945 3300027395 Bacteria 1090
438 Ga0210000_1001614 3300027462 Bacteria 3184
439 Ga0210000_1010444 3300027462 Bacteria 1374
440 Ga0209995_1001807 3300027471 Bacteria 3336
441 Ga0209995_1015504 3300027471 Bacteria 1249
442 Ga0209968_1009343 3300027526 Bacteria 1501
443 Ga0209968_1039801 3300027526 Bacteria 802
444 Ga0209999_1001013 3300027543 Bacteria 4764
445 Ga0209999_1009303 3300027543 Bacteria 1775
446 Ga0209999_1016041 3300027543 Bacteria 1363
447 Ga0209999_1020643 3300027543 Bacteria 1209
448 Ga0209999_1124309 3300027543 Bacteria 506
449 Ga0209983_1100941 3300027665 Bacteria 653
450 Ga0209588_1197435 3300027671 Bacteria 628
451 Ga0209971_1013346 3300027682 Bacteria 1947
452 Ga0209971_1043224 3300027682 Bacteria 1085
453 Ga0209966_1015126 3300027695 Bacteria 1447
454 Ga0209966_1048953 3300027695 Bacteria 896
455 Ga0207428_10000290 3300027907 Bacteria 67367
456 Ga0268266_10008012 3300028379 Bacteria 9446
457 Ga0268265_10001010 3300028380 Bacteria 25458
458 Ga0268265_10162327 3300028380 Bacteria 1900
459 Ga0268265_10317321 3300028380 Bacteria 1410
460 Ga0268264_10000903 3300028381 Bacteria 31199
461 Ga0268264_10054842 3300028381 Bacteria 3329
462 Ga0268264_12065470 3300028381 Bacteria 579
463 Ga0265330_10079442 3300031235 Bacteria 1414
464 Ga0265331_10027126 3300031250 Bacteria 2874
465 Ga0307408_100460202 3300031548 Bacteria 1105
466 Ga0307408_101540448 3300031548 Bacteria 630
467 Ga0307408_101602362 3300031548 Bacteria 618
468 Ga0307408_102267587 3300031548 Bacteria 525
469 Ga0316575_10000119 3300031665 Bacteria 19810
470 Ga0316575_10017102 3300031665 Bacteria 2751
471 Ga0316578_10559794 3300031728 Bacteria 671
472 Ga0307405_10156945 3300031731 Bacteria 1607
473 Ga0307405_10262283 3300031731 Bacteria 1291
474 Ga0307405_10691095 3300031731 Bacteria 844
475 Ga0307405_11652608 3300031731 Bacteria 566
476 Ga0307413_11317238 3300031824 Bacteria 632
477 Ga0307410_11272369 3300031852 Bacteria 643
478 Ga0307406_10804135 3300031901 Bacteria 794
479 Ga0307406_10911749 3300031901 Bacteria 749
480 Ga0307412_10755790 3300031911 Bacteria 840
481 Ga0307412_12003024 3300031911 Bacteria 536
482 Ga0307416_100063169 3300032002 Bacteria 3031
483 Ga0307416_100367008 3300032002 Bacteria 1464
484 Ga0307416_100562428 3300032002 Bacteria 1215
485 Ga0307416_100570731 3300032002 Bacteria 1207
486 Ga0307416_101144531 3300032002 Bacteria 883
487 Ga0307416_101146930 3300032002 Bacteria 882
488 Ga0307416_103245847 3300032002 Bacteria 544
489 Ga0307416_103289124 3300032002 Bacteria 541
490 Ga0307411_10124778 3300032005 Bacteria 1870
491 Ga0307411_10160498 3300032005 Bacteria 1683
492 Ga0307411_10726372 3300032005 Bacteria 868
493 Ga0307411_10731641 3300032005 Bacteria 865
494 Ga0307411_11637869 3300032005 Bacteria 594
495 Ga0316583_10068741 3300032133 Bacteria 1239
496 Ga0316593_10238880 3300032168 Bacteria 678
497 Ga0373958_0068617 3300034819 Bacteria 782
498 Ga0373959_0019010 3300034820 Bacteria 1298
499 Ga0373938_0014912 3300034957 Bacteria 1498
500 Ga0373938_0165042 3300034957 Bacteria 597
501 Ga0373926_0004032 3300035083 Bacteria 4793
502 Ga0373928_0002097 3300035084 Bacteria 3894
503 Ga0373929_0006911 3300035085 Bacteria 2062
504 Ga0373929_0009032 3300035085 Bacteria 1843
505 Ga0373929_0104352 3300035085 Bacteria 718
506 Ga0373929_0228514 3300035085 Bacteria 532
507 Ga0373934_0389189 3300035086 Bacteria 582
508 Ga0373940_0138688 3300035088 Bacteria 767
509 Ga0373940_0306678 3300035088 Bacteria 548
510 Ga0373944_0000377 3300035089 Bacteria 10072
511 Ga0373949_0006468 3300035090 Bacteria 2575
512 Ga0373951_0105056 3300035091 Bacteria 755
513 Ga0373951_0163820 3300035091 Bacteria 630
514 Ga0373952_0003000 3300035092 Bacteria 3048
515 Ga0373952_0009609 3300035092 Bacteria 1856
516 Ga0373952_0048730 3300035092 Bacteria 1003
517 Ga0373923_0017754 3300035111 Bacteria 2726
518 Ga0373923_0019060 3300035111 Bacteria 2651
519 Ga0373923_0113311 3300035111 Bacteria 1206
520 Ga0373932_0010946 3300035112 Bacteria 2206
521 Ga0373932_0208266 3300035112 Bacteria 698
522 Ga0373936_0020031 3300035113 Bacteria 2595
523 Ga0373936_0100404 3300035113 Bacteria 1221
524 Ga0373939_0100603 3300035114 Bacteria 991
525 Ga0373939_0171437 3300035114 Bacteria 803
526 Ga0373939_0210278 3300035114 Bacteria 740
527 Ga0373939_0371767 3300035114 Bacteria 586
528 Ga0373939_0481058 3300035114 Bacteria 527
529 Ga0373941_0149653 3300035115 Bacteria 855
530 Ga0373941_0244446 3300035115 Bacteria 698
531 Ga0373945_0008166 3300035116 Bacteria 3403
532 Ga0373953_0005017 3300035117 Bacteria 4264
533 Ga0373954_0005512 3300035118 Bacteria 5473
534 Ga0373954_0500601 3300035118 Bacteria 602
535 Ga0373956_0007945 3300035119 Bacteria 4285
536 Ga0373956_0129849 3300035119 Bacteria 1179
537 Ga0373956_0298565 3300035119 Bacteria 767
538 Ga0373956_0315458 3300035119 Bacteria 745
539 Ga0373957_0063498 3300035120 Bacteria 1434
540 Ga0373960_0076331 3300035121 Bacteria 1046
541 Ga0373960_0107993 3300035121 Bacteria 910
542 Ga0373943_0296253 3300035170 Bacteria 917
543 Ga0373946_0003939 3300035171 Bacteria 5279
544 Ga0373955_0008610 3300035172 Bacteria 4744
545 Ga0373955_0045128 3300035172 Bacteria 2377
546 Ga0373942_0004600 3300035207 Bacteria 3200
547 Ga0373942_0064445 3300035207 Bacteria 1057
548 Ga0373961_0042628 3300035241 Bacteria 1316
549 Ga0373961_0269836 3300035241 Bacteria 621
550 Ga0373962_0050332 3300035242 Bacteria 1199
551 Ga0373962_0165154 3300035242 Bacteria 732
552 Ga0316574_0002886 3300035398 Bacteria 8734
553 Ga0373924_0009740 3300035410 Bacteria 3528
554 Ga0373924_0020068 3300035410 Bacteria 2594
555 Ga0373931_0000163 3300035691 Bacteria 29108
556 Ga0373931_0005381 3300035691 Bacteria 5912
557 Ga0373931_0016115 3300035691 Bacteria 3675
558 Ga0373931_0019730 3300035691 Bacteria 3368
559 Ga0373931_0040885 3300035691 Bacteria 2434
560 Ga0373931_0056980 3300035691 Bacteria 2095
561 Ga0373931_0245137 3300035691 Bacteria 1088
562 Ga0373931_0474559 3300035691 Bacteria 803
563 Ga0373931_1061060 3300035691 Bacteria 550
564 Ga0373935_0080856 3300035692 Bacteria 2111
565 Ga0373935_1350822 3300035692 Bacteria 532
566 Ga0373927_0030265 3300035695 Bacteria 3532
567 Ga0373933_0015309 3300035724 Bacteria 4276
568 Ga0373933_0063689 3300035724 Bacteria 2229
569 Ga0373933_0365644 3300035724 Bacteria 938
570 Ga0373933_0626712 3300035724 Unclassified 707
571 Ga0373933_1021788 3300035724 Bacteria 544
572 Ga0373947_0831272 3300035725 Bacteria 630
573 Ga0373937_0188575 3300036401 Bacteria 1937
574 Ga0373937_0537280 3300036401 Bacteria 1110
575 Ga0373937_1352040 3300036401 Bacteria 660
576 Ga0373937_1921612 3300036401 Bacteria 538
577 Ga0316582_0392819 3300036647 Bacteria 955
578 Ga0373925_0017912 3300037068 Bacteria 5142
579 Ga0373925_0028634 3300037068 Bacteria 4081
580 Ga0373925_0217299 3300037068 Bacteria 1525
581 Ga0373925_0618186 3300037068 Bacteria 892
582 Ga0436360_0533797 3300039438 Bacteria 1638
583 Ga0439461_0031816 3300041410 Bacteria 1103
584 Ga0451804_0082086 3300041463 Bacteria 966
585 Ga0451807_1336088 3300041486 Bacteria 942
586 Ga0451807_2271692 3300041486 Bacteria 727
587 Ga0451839_1628095 3300041496 Bacteria 767
588 Ga0451845_0459515 3300041501 Bacteria 544
589 Ga0451853_0641740 3300041512 Bacteria 1278
590 Ga0439431_0016187 3300041997 Bacteria 1743
591 Ga0439433_0122117 3300041999 Bacteria 657
592 Ga0439441_000242 3300042001 Bacteria 5308
593 Ga0439441_018536 3300042001 Bacteria 1260
594 Ga0439441_042013 3300042001 Bacteria 919
595 Ga0439443_022792 3300042003 Bacteria 996
596 Ga0439451_084087 3300042009 Bacteria 640
597 Ga0450888_031172 3300042126 Bacteria 714
598 Ga0450904_037968 3300042139 Bacteria 512
599 Ga0450910_087232 3300042147 Bacteria 550
600 Ga0439446_0007516 3300042156 Bacteria 2866
601 Ga0439446_0163156 3300042156 Bacteria 738
602 Ga0439434_0029843 3300042435 Bacteria 1653
603 Ga0439435_0000145 3300042436 Bacteria 9631
604 Ga0439435_0059866 3300042436 Bacteria 1107
605 Ga0439444_0000161 3300042437 Bacteria 6042
606 Ga0439444_0103050 3300042437 Bacteria 649
607 Ga0439459_0067102 3300042438 Bacteria 822
608 Ga0439460_0000484 3300042461 Bacteria 8608
609 Ga0439460_0301743 3300042461 Bacteria 560
610 Ga0451577_0005927 3300042876 Bacteria 12320
611 Ga0451577_0314829 3300042876 Bacteria 1419
612 Ga0451577_0444344 3300042876 Bacteria 1177
613 Ga0451577_1033001 3300042876 Bacteria 737
614 Ga0453683_0047497 3300044673 Bacteria 2692
615 Ga0453683_1079165 3300044673 Bacteria 535
616 Ga0466965_0942604 3300044683 Bacteria 505
617 Ga0466963_0188072 3300044694 Bacteria 1442
618 Ga0466964_0346816 3300044706 Bacteria 762
619 Ga0453684_0027030 3300044712 Bacteria 8253
620 Ga0453684_0453613 3300044712 Bacteria 1427
621 Ga0453684_0789546 3300044712 Bacteria 1025
622 Ga0451576_0001107 3300045051 Bacteria 49185
623 Ga0451576_0002171 3300045051 Bacteria 30352
624 Ga0451576_0027642 3300045051 Bacteria 6089
625 Ga0451576_0028514 3300045051 Bacteria 5976
626 Ga0451576_0063201 3300045051 Bacteria 3859
627 Ga0451576_0123886 3300045051 Bacteria 2692
628 Ga0451576_2514298 3300045051 Bacteria 526
629 Ga0466967_0039326 3300045976 Bacteria 4065
630 Ga0495592_0517446 3300046454 Bacteria 738
631 Ga0495592_0590002 3300046454 Bacteria 679
632 Ga0495592_0645459 3300046454 Bacteria 641
633 Ga0495603_0004691 3300046455 Bacteria 8164
634 Ga0495603_0658384 3300046455 Bacteria 599
635 Ga0495651_0133500 3300046462 Bacteria 1810
636 Ga0495651_0383081 3300046462 Bacteria 922
637 Ga0495653_0311763 3300046463 Bacteria 1023
638 Ga0495580_0012751 3300046472 Bacteria 6441
639 Ga0495582_0058416 3300046473 Bacteria 2127
640 Ga0495639_0156122 3300046475 Bacteria 1102
641 Ga0495664_0760980 3300046477 Bacteria 570
642 Ga0495584_0102798 3300046491 Bacteria 1445
643 Ga0495594_0495349 3300046499 Bacteria 694
644 Ga0495628_0057267 3300046516 Bacteria 3066
645 Ga0495630_0107329 3300046517 Bacteria 2115
646 Ga0495644_0154566 3300046523 Bacteria 879
647 Ga0495644_0354323 3300046523 Bacteria 578
648 Ga0495666_0060727 3300046526 Bacteria 1806
649 Ga0495652_0121969 3300046529 Bacteria 2077
650 Ga0495665_0008515 3300046531 Bacteria 5568
651 Ga0495640_0104245 3300046533 Bacteria 1859
652 Ga0495586_0000624 3300046535 Bacteria 20417
653 Ga0495598_0034505 3300046537 Bacteria 1443
654 Ga0495598_0117883 3300046537 Bacteria 897
655 Ga0495609_0133354 3300046538 Bacteria 1063
656 Ga0495621_0023584 3300046539 Bacteria 2048
657 Ga0495621_0031229 3300046539 Bacteria 1826
658 Ga0495621_0311067 3300046539 Bacteria 655
659 Ga0495621_0475665 3300046539 Bacteria 537
660 Ga0495622_0098204 3300046557 Bacteria 1343
661 Ga0495667_0031621 3300046559 Bacteria 3551
662 Ga0495667_0694456 3300046559 Bacteria 631
663 Ga0495656_0069038 3300046615 Bacteria 1564
664 Ga0495635_0258710 3300046663 Bacteria 1172
665 Ga0495635_0265535 3300046663 Bacteria 1155
666 Ga0495659_0162087 3300046664 Bacteria 903
667 Ga0495659_0284532 3300046664 Bacteria 695
668 Ga0495659_0322759 3300046664 Bacteria 656
669 Ga0495588_0001603 3300046674 Bacteria 9665
670 Ga0495657_0475674 3300046675 Bacteria 730
671 Ga0495599_0678299 3300046678 Bacteria 595
672 Ga0495623_0095181 3300046679 Bacteria 1821
673 Ga0495623_0248193 3300046679 Bacteria 1002
674 Ga0495647_0009861 3300046681 Bacteria 3243
675 Ga0495658_0002606 3300046683 Bacteria 9064
676 Ga0495669_0003951 3300046684 Bacteria 6104
677 Ga0495669_0242167 3300046684 Bacteria 866
678 Ga0495670_0169358 3300046691 Bacteria 1150
679 Ga0495581_0129408 3300047315 Bacteria 1471
680 Ga0495604_0182519 3300047317 Bacteria 1467
681 Ga0495636_0002413 3300047318 Bacteria 7168
682 Ga0495636_0639142 3300047318 Bacteria 522
683 Ga0495674_0109115 3300047319 Bacteria 2348
684 Ga0495674_0290321 3300047319 Bacteria 1338
685 Ga0495676_0094536 3300047321 Bacteria 2226
686 Ga0495680_0122777 3300047322 Bacteria 1916
687 Ga0495675_0441689 3300047444 Bacteria 754
688 Ga0495675_0685923 3300047444 Bacteria 575
689 Ga0495684_0559724 3300047471 Bacteria 777
690 Ga0495602_0607547 3300048088 Bacteria 751
691 Ga0495602_0980954 3300048088 Bacteria 558
692 Ga0496101_0202190 3300048904 Bacteria 1536
693 Ga0496105_0001094 3300048908 Bacteria 18813
694 Ga0496106_0429243 3300048909 Bacteria 1062
695 Ga0496112_0304488 3300048915 Bacteria 1539
696 Ga0496115_0594741 3300048918 Bacteria 880
697 Ga0501291_040040 3300049514 Bacteria 821
698 Ga0501297_023686 3300049520 Bacteria 782
699 Ga0501298_114648 3300049521 Bacteria 628
700 Ga0501299_009849 3300049522 Bacteria 1585
701 Ga0501299_041984 3300049522 Bacteria 921
702 Ga0501299_168923 3300049522 Bacteria 564
703 Ga0501031_0101443 3300049568 Bacteria 1878
704 Ga0501031_0152727 3300049568 Bacteria 1509
705 Ga0501031_0332353 3300049568 Bacteria 984
706 Ga0501031_0511574 3300049568 Bacteria 774
707 Ga0501031_0576550 3300049568 Bacteria 724
708 Ga0501033_0023943 3300049570 Bacteria 4606
709 Ga0501033_1126398 3300049570 Bacteria 521
710 Ga0501036_0015965 3300049572 Bacteria 6272
711 Ga0501036_0026950 3300049572 Bacteria 4857
712 Ga0501036_0074299 3300049572 Bacteria 2875
713 Ga0501036_0220896 3300049572 Bacteria 1591
714 Ga0501036_0556430 3300049572 Bacteria 953
715 Ga0501036_0646150 3300049572 Bacteria 876
716 Ga0501036_1478588 3300049572 Bacteria 550
717 Ga0501036_1723557 3300049572 Bacteria 505
718 Ga0501037_0015423 3300049573 Bacteria 5622
719 Ga0501037_0172063 3300049573 Bacteria 1539
720 Ga0501037_0556443 3300049573 Bacteria 774
721 Ga0501038_0028048 3300049574 Bacteria 5002
722 Ga0501038_0521494 3300049574 Bacteria 907
723 Ga0501038_1050508 3300049574 Bacteria 596
724 Ga0501039_0004420 3300049575 Bacteria 10611
725 Ga0501039_0170885 3300049575 Bacteria 1709
726 Ga0501039_0216182 3300049575 Bacteria 1507
727 Ga0501039_0255235 3300049575 Bacteria 1378
728 Ga0501039_1034343 3300049575 Bacteria 637
729 Ga0501039_1047794 3300049575 Bacteria 633
730 Ga0501040_0002776 3300049576 Bacteria 11290
731 Ga0501040_0003267 3300049576 Bacteria 10476
732 Ga0501040_0101986 3300049576 Bacteria 2002
733 Ga0501040_0916375 3300049576 Bacteria 635
734 Ga0501041_0001563 3300049577 Bacteria 12746
735 Ga0501041_0007863 3300049577 Bacteria 6263
736 Ga0501041_0896150 3300049577 Bacteria 570
737 Ga0501041_0973712 3300049577 Bacteria 546
738 Ga0501042_0002917 3300049578 Bacteria 10616
739 Ga0501042_0193498 3300049578 Bacteria 1467
740 Ga0501042_0691804 3300049578 Bacteria 741
741 Ga0501042_0880820 3300049578 Bacteria 652
742 Ga0501042_1022441 3300049578 Bacteria 602
743 Ga0501043_0083620 3300049579 Bacteria 2509
744 Ga0501043_0292548 3300049579 Bacteria 1246
745 Ga0501046_0002700 3300049580 Bacteria 16517
746 Ga0501046_0048700 3300049580 Bacteria 3355
747 Ga0501046_0725936 3300049580 Bacteria 699
748 Ga0501046_0768793 3300049580 Bacteria 676
749 Ga0501046_0928099 3300049580 Bacteria 606
750 Ga0501048_0050036 3300049582 Bacteria 2977
751 Ga0501048_0079727 3300049582 Bacteria 2310
752 Ga0501048_0110430 3300049582 Bacteria 1942
753 Ga0501048_0974296 3300049582 Bacteria 610
754 Ga0501067_0506734 3300049583 Bacteria 675
755 Ga0501068_0014725 3300049584 Bacteria 4475
756 Ga0501068_0266509 3300049584 Bacteria 1093
757 Ga0501068_0489990 3300049584 Bacteria 797
758 Ga0501069_0138432 3300049585 Bacteria 1396
759 Ga0501069_0510480 3300049585 Bacteria 718
760 Ga0501069_0594974 3300049585 Bacteria 664
761 Ga0501070_0192841 3300049586 Bacteria 1674
762 Ga0501071_0004683 3300049587 Bacteria 8694
763 Ga0501071_0020331 3300049587 Bacteria 4612
764 Ga0501071_0060075 3300049587 Bacteria 2751
765 Ga0501071_0094628 3300049587 Bacteria 2198
766 Ga0501071_0214789 3300049587 Bacteria 1447
767 Ga0501071_0258944 3300049587 Bacteria 1314
768 Ga0501071_0318877 3300049587 Bacteria 1180
769 Ga0501071_0529164 3300049587 Bacteria 905
770 Ga0501071_0946180 3300049587 Bacteria 665
771 Ga0501071_1095850 3300049587 Bacteria 615
772 Ga0501072_0006099 3300049588 Bacteria 9196
773 Ga0501072_0008315 3300049588 Bacteria 7882
774 Ga0501072_0074526 3300049588 Bacteria 2684
775 Ga0501072_0081556 3300049588 Bacteria 2564
776 Ga0501072_0236855 3300049588 Bacteria 1454
777 Ga0501072_0592559 3300049588 Bacteria 874
778 Ga0501072_0711905 3300049588 Bacteria 789
779 Ga0501072_1026668 3300049588 Bacteria 642
780 Ga0501072_1161313 3300049588 Bacteria 600
781 Ga0501073_0216877 3300049589 Bacteria 1322
782 Ga0501074_0019204 3300049590 Bacteria 4963
783 Ga0501074_0169828 3300049590 Bacteria 1557
784 Ga0501074_0622374 3300049590 Bacteria 763
785 Ga0501075_0002198 3300049591 Bacteria 12907
786 Ga0501075_0017270 3300049591 Bacteria 5211
787 Ga0501075_0023103 3300049591 Bacteria 4550
788 Ga0501075_0123449 3300049591 Bacteria 1971
789 Ga0501075_0399451 3300049591 Bacteria 1048
790 Ga0501076_0001244 3300049592 Bacteria 16969
791 Ga0501076_0005555 3300049592 Bacteria 9084
792 Ga0501076_0152083 3300049592 Bacteria 1883
793 Ga0501076_0188740 3300049592 Bacteria 1682
794 Ga0501076_0379888 3300049592 Bacteria 1161
795 Ga0501077_0017448 3300049593 Bacteria 4530
796 Ga0501077_0152986 3300049593 Bacteria 1464
797 Ga0501077_0390531 3300049593 Bacteria 889
798 Ga0501077_0655861 3300049593 Bacteria 674
799 Ga0501206_038414 3300049653 Bacteria 732
800 Ga0501235_090665 3300049669 Bacteria 738
801 Ga0501249_072198 3300049679 Bacteria 807
802 Ga0501221_051465 3300049704 Bacteria 929
803 Ga0501079_0002346 3300049741 Bacteria 13734
804 Ga0501079_0004200 3300049741 Bacteria 10676
805 Ga0501079_0154202 3300049741 Bacteria 1790
806 Ga0501079_0400853 3300049741 Bacteria 1076
807 Ga0501079_0546962 3300049741 Bacteria 910
808 Ga0501079_1000801 3300049741 Bacteria 658
809 Ga0501080_0000634 3300049742 Bacteria 27899
810 Ga0501080_0027376 3300049742 Bacteria 5300
811 Ga0501080_1425826 3300049742 Bacteria 590
812 Ga0501081_0007514 3300049743 Bacteria 7067
813 Ga0501081_0053989 3300049743 Bacteria 2775
814 Ga0501081_0054336 3300049743 Bacteria 2767
815 Ga0501081_0508537 3300049743 Bacteria 898
816 Ga0501083_0132354 3300049744 Bacteria 1635
817 Ga0501083_0597503 3300049744 Bacteria 718
818 Ga0501271_051561 3300049768 Bacteria 560
819 Ga0501272_059093 3300049769 Bacteria 545
820 Ga0501035_0056735 3300049822 Bacteria 3493
821 Ga0501035_1226769 3300049822 Bacteria 581
822 Ga0501044_0177118 3300049823 Bacteria 2101
823 Ga0501044_0756931 3300049823 Bacteria 853
824 Ga0501045_0002510 3300049824 Bacteria 12474
825 Ga0501045_0003944 3300049824 Bacteria 10220
826 Ga0501045_0015600 3300049824 Bacteria 5391
827 Ga0501045_0360537 3300049824 Bacteria 1082
828 Ga0501045_0563117 3300049824 Bacteria 845
829 Ga0501045_0695644 3300049824 Bacteria 750
830 nmdc:mga0k408_120819_c1 3300050493 Bacteria 1551
831 nmdc:mga05p37_2094365_c1 3300050507 Bacteria 530
832 nmdc:mga05p37_2102607_c1 3300050507 Bacteria 529
833 nmdc:mga05p37_389_c1 3300050507 Bacteria 47594
834 nmdc:mga05p37_478776_c1 3300050507 Bacteria 1434
835 nmdc:mga05p37_492821_c1 3300050507 Bacteria 1408
836 nmdc:mga05p37_743720_c1 3300050507 Bacteria 1082
837 nmdc:mga09592_166_c1 3300050508 Bacteria 46469
838 nmdc:mga09592_325353_c1 3300050508 Bacteria 1331
839 nmdc:mga09592_345712_c1 3300050508 Bacteria 1288
840 nmdc:mga09592_441435_c1 3300050508 Bacteria 1123
841 nmdc:mga0qj67_328979_c1 3300050509 Bacteria 1237
842 nmdc:mga0qj67_4573_c1 3300050509 Bacteria 10035
843 nmdc:mga0qj67_467265_c1 3300050509 Bacteria 1016
844 nmdc:mga0qj67_562755_c1 3300050509 Bacteria 914
845 nmdc:mga0qj67_862833_c1 3300050509 Bacteria 715
846 nmdc:mga06r32_116159_c1 3300050510 Bacteria 2636
847 nmdc:mga06r32_141035_c1 3300050510 Bacteria 2386
848 nmdc:mga06r32_338797_c1 3300050510 Bacteria 1489
849 nmdc:mga06r32_344872_c1 3300050510 Bacteria 1474
850 nmdc:mga08y16_2159_c1 3300050511 Bacteria 20171
851 nmdc:mga08y16_48378_c1 3300050511 Bacteria 4451
852 nmdc:mga08y16_54762_c1 3300050511 Bacteria 4168
853 nmdc:mga08y16_589943_c1 3300050511 Bacteria 1121
854 nmdc:mga08y16_788732_c1 3300050511 Bacteria 944
855 nmdc:mga0n895_101468_c1 3300050512 Bacteria 2888
856 nmdc:mga0n895_1728240_c1 3300050512 Bacteria 588
857 nmdc:mga0n895_196_c1 3300050512 Bacteria 37551
858 nmdc:mga0n895_342027_c1 3300050512 Bacteria 1515
859 nmdc:mga0n895_49390_c1 3300050512 Bacteria 4121
860 nmdc:mga0n895_497525_c1 3300050512 Bacteria 1228
861 nmdc:mga0n895_608586_c1 3300050512 Bacteria 1094
862 nmdc:mga0n895_77969_c1 3300050512 Bacteria 3297
863 nmdc:mga0rr50_1267257_c1 3300050513 Bacteria 626
864 nmdc:mga0rr50_23614_c1 3300050513 Bacteria 4244
865 nmdc:mga0rr50_29506_c1 3300050513 Bacteria 3870
866 nmdc:mga0rr50_312479_c1 3300050513 Bacteria 1316
867 nmdc:mga0rr50_48101_c1 3300050513 Bacteria 3151
868 nmdc:mga08x19_15616_c1 3300050514 Bacteria 4620
869 nmdc:mga08x19_1688_c1 3300050514 Bacteria 13577
870 nmdc:mga08x19_258_c1 3300050514 Bacteria 28365
871 nmdc:mga08x19_43255_c1 3300050514 Bacteria 2873
872 nmdc:mga08x19_60152_c1 3300050514 Bacteria 2460
873 nmdc:mga08x19_67637_c1 3300050514 Bacteria 2324
874 nmdc:mga08x19_724181_c1 3300050514 Bacteria 706
875 nmdc:mga08x19_72933_c1 3300050514 Bacteria 2240
876 nmdc:mga08x19_759_c1 3300050514 Bacteria 20607
877 nmdc:mga0a205_17979_c1 3300050515 Bacteria 6639
878 nmdc:mga0a205_24715_c1 3300050515 Bacteria 5715
879 nmdc:mga0a205_247874_c1 3300050515 Bacteria 1661
880 nmdc:mga0a205_403264_c1 3300050515 Bacteria 1231
881 nmdc:mga0a205_427981_c1 3300050515 Bacteria 1185
882 nmdc:mga0a205_648660_c1 3300050515 Bacteria 907
883 nmdc:mga0a205_726336_c1 3300050515 Bacteria 842
884 Ga0495595_0334940 3300053084 Bacteria 763
885 Ga0501084_0005520 3300054114 Bacteria 10383
886 Ga0501084_0215760 3300054114 Bacteria 1619
887 Ga0501084_0271446 3300054114 Bacteria 1432
888 Ga0501084_0276297 3300054114 Bacteria 1418
889 Ga0501084_0568893 3300054114 Bacteria 958
890 Ga0501084_1237901 3300054114 Bacteria 626
891 Ga0590071_005157 3300059421 Bacteria 3152
892 Ga0590071_042317 3300059421 Bacteria 1097
893 Ga0590074_100979 3300059423 Bacteria 563
894 Ga0590077_008460 3300059426 Bacteria 2107
895 Ga0501082_0002298 3300060353 Bacteria 16717
896 Ga0501082_0017077 3300060353 Bacteria 6252
897 Ga0501082_1257019 3300060353 Bacteria 647
898 Ga0501082_1379821 3300060353 Bacteria 616
899 Ga0530510_0000245 3300061734 Bacteria 34065
900 Ga0530510_0004031 3300061734 Bacteria 10140
901 Ga0530510_0391997 3300061734 Bacteria 1046
902 Ga0530510_0583731 3300061734 Bacteria 850
903 Ga0530510_0620413 3300061734 Bacteria 823
904 Ga0373941_0055909
905 2214821604
906 JGI25406J46586_10050638
907 Ga0065704_10172219
908 Ga0065707_10353001
909 Ga0065707_10806145
910 Ga0070676_10708091
911 Ga0070683_100146059
912 Ga0070683_102211646
913 Ga0070690_100103612
914 Ga0070690_101342449
915 Ga0068869_100000139
916 Ga0068869_100023856
917 Ga0068869_100705852
918 Ga0068869_101235485
919 Ga0068869_101552600
920 Ga0070666_10508758
921 Ga0070680_100000688
922 Ga0070680_100042008
923 Ga0070680_100063111
924 Ga0070680_100698374
925 Ga0070680_100816370
926 Ga0070680_100847944
927 Ga0070680_100972843
928 Ga0070682_100012632
929 Ga0068868_100000115
930 Ga0068868_100680657
931 Ga0068868_101344206
932 Ga0070689_100001743
933 Ga0070689_100025052
934 Ga0070689_100027458
935 Ga0070689_100356880
936 Ga0070689_100512367
937 Ga0070689_100689972
938 Ga0070691_10003942
939 Ga0070691_10356339
940 Ga0070687_100000091
941 Ga0070687_100027951
942 Ga0070687_100105247
943 Ga0070687_100302171
944 Ga0070687_100737844
945 Ga0070687_100756709
946 Ga0070687_101060375
947 Ga0070687_101351317
948 Ga0070692_10004059
949 Ga0070692_10258912
950 Ga0070692_10528637
951 Ga0070675_100034538
952 Ga0070675_100368983
953 Ga0070675_101074380
954 Ga0070675_101605578
955 Ga0070673_100096295
956 Ga0070673_100582961
957 Ga0070673_100971160
958 Ga0070688_100240777
959 Ga0070688_100288389
960 Ga0070688_100341788
961 Ga0070703_10267513
962 Ga0070709_10076065
963 Ga0070709_10632748
964 Ga0070714_100118661
965 Ga0070713_100036973
966 Ga0070713_100973381
967 Ga0070713_101338477
968 Ga0070710_10023439
969 Ga0070710_10364279
970 Ga0070701_10000914
971 Ga0070701_10292701
972 Ga0070701_10322986
973 Ga0070701_10973717
974 Ga0070701_11147561
975 Ga0070701_11315252
976 Ga0070711_100000407
977 Ga0070711_100506531
978 Ga0070711_100550820
979 Ga0070705_100000441
980 Ga0070705_100006747
981 Ga0070705_100153027
982 Ga0070705_100257986
983 Ga0070705_100376509
984 Ga0070705_100806819
985 Ga0070705_100807574
986 Ga0070700_100074600
987 Ga0070700_100580040
988 Ga0070700_100996101
989 Ga0070694_100000133
990 Ga0070694_100074414
991 Ga0070694_100089437
992 Ga0070694_100328676
993 Ga0070694_101268547
994 Ga0070708_101363054
995 Ga0070678_100626333
996 Ga0070681_10000081
997 Ga0070681_10731117
998 Ga0070681_11146055
999 Ga0070681_11361776
1000 Ga0068867_100000084
1001 Ga0068867_100240246
1002 Ga0068867_100653246
1003 Ga0070685_10263235
1004 Ga0070706_101653239
1005 Ga0070707_100322158
1006 Ga0070707_100690100
1007 Ga0070707_101230374
1008 Ga0070698_100489798
1009 Ga0070698_100572898
1010 Ga0070698_100630431
1011 Ga0070699_100003701
1012 Ga0070699_101538284
1013 Ga0070699_102101442
1014 Ga0070679_100011998
1015 Ga0070679_100054997
1016 Ga0070697_100000299
1017 Ga0070697_100004807
1018 Ga0070697_100134189
1019 Ga0070697_100395824
1020 Ga0068853_100958826
1021 Ga0070686_100000193
1022 Ga0070686_100152719
1023 Ga0070686_100217809
1024 Ga0070686_100296135
1025 Ga0070686_100315644
1026 Ga0070695_100000163
1027 Ga0070695_100000641
1028 Ga0070695_100007191
1029 Ga0070695_100259426
1030 Ga0070695_101133676
1031 Ga0070696_100000570
1032 Ga0070696_100084784
1033 Ga0070696_100143107
1034 Ga0070696_100219444
1035 Ga0070696_101343494
1036 Ga0070693_100000111
1037 Ga0070693_100039453
1038 Ga0070665_100003736
1039 Ga0070704_100000008
1040 Ga0070704_100006181
1041 Ga0070704_100062259
1042 Ga0070704_100170922
1043 Ga0070704_100681664
1044 Ga0070704_101611402
1045 Ga0068855_100000242
1046 Ga0068855_100730178
1047 Ga0068857_101642127
1048 Ga0068854_100040204
1049 Ga0068856_100043238
1050 Ga0068856_101704260
1051 Ga0070702_100000012
1052 Ga0070702_100169859
1053 Ga0070702_100379191
1054 Ga0070702_101218170
1055 Ga0068852_100475803
1056 Ga0068852_100971515
1057 Ga0068859_100001460
1058 Ga0068859_100007534
1059 Ga0068859_100010525
1060 Ga0068859_100336094
1061 Ga0068859_100459105
1062 Ga0068859_100805648
1063 Ga0068859_102581852
1064 Ga0068864_100013356
1065 Ga0068864_100172881
1066 Ga0068864_100908292
1067 Ga0068866_10000109
1068 Ga0068866_10190247
1069 Ga0068866_10675036
1070 Ga0068861_100000814
1071 Ga0068861_100163185
1072 Ga0068861_101559422
1073 Ga0068861_102020546
1074 Ga0068870_10026463
1075 Ga0068870_10086650
1076 Ga0068870_10375570
1077 Ga0068863_100000366
1078 Ga0068863_100968479
1079 Ga0068863_100986381
1080 Ga0068863_101109902
1081 Ga0068858_100003588
1082 Ga0068858_100013374
1083 Ga0068858_102458409
1084 Ga0068860_100014674
1085 Ga0068860_100126778
1086 Ga0068860_100264467
1087 Ga0068862_100005995
1088 Ga0068862_100138128
1089 Ga0068862_100407105
1090 Ga0068862_101530693
1091 Ga0081539_10004782
1092 Ga0075432_10267579
1093 Ga0070715_10004316
1094 Ga0070715_10111467
1095 Ga0070715_10288053
1096 Ga0070716_100103313
1097 Ga0070716_100134860
1098 Ga0070716_100389849
1099 Ga0070716_100785466
1100 Ga0075366_10956673
1101 Ga0097621_100018927
1102 Ga0097621_100285245
1103 Ga0097621_100532634
1104 Ga0068871_100000559
1105 Ga0068871_100238293
1106 Ga0068871_100715127
1107 Ga0075428_100001187
1108 Ga0075428_100525555
1109 Ga0075428_101210628
1110 Ga0075428_101324503
1111 Ga0075428_101702199
1112 Ga0075430_100006533
1113 Ga0075430_100134869
1114 Ga0075430_100596369
1115 Ga0075430_100666734
1116 Ga0075431_100043576
1117 Ga0075431_100269282
1118 Ga0075431_100347809
1119 Ga0075431_100469962
1120 Ga0075431_100753585
1121 Ga0075431_100889224
1122 Ga0075431_101257569
1123 Ga0075433_10006494
1124 Ga0075433_10043631
1125 Ga0075433_10071445
1126 Ga0075433_10101415
1127 Ga0075433_10254495
1128 Ga0075433_11045427
1129 Ga0075434_100000125
1130 Ga0075434_100001287
1131 Ga0075434_100312590
1132 Ga0075434_100382579
1133 Ga0075434_100771695
1134 Ga0075434_100830123
1135 Ga0075434_100831099
1136 Ga0075429_100000891
1137 Ga0075429_100659444
1138 Ga0075429_101139868
1139 Ga0068865_100002206
1140 Ga0068865_101123381
1141 Ga0068865_101527388
1142 Ga0068865_101939155
1143 Ga0075436_100000789
1144 Ga0075436_100013534
1145 Ga0075436_100050041
1146 Ga0075436_100053555
1147 Ga0075436_100076586
1148 Ga0075436_100138447
1149 Ga0075436_100886005
1150 Ga0097620_100001461
1151 Ga0097620_100007535
1152 Ga0097620_100010526
1153 Ga0097620_100336128
1154 Ga0097620_100459123
1155 Ga0097620_100805596
1156 Ga0097620_102581988
1157 Ga0075435_100000655
1158 Ga0075435_100002909
1159 Ga0075435_100025734
1160 Ga0099794_10404690
1161 Ga0099794_10501610
1162 Ga0099794_10550482
1163 Ga0099795_10297031
1164 Ga0105250_10201114
1165 Ga0105240_10369816
1166 Ga0111539_10011985
1167 Ga0111539_10160623
1168 Ga0111539_10269186
1169 Ga0111539_10435051
1170 Ga0111539_10923022
1171 Ga0111539_11319098
1172 Ga0111539_11538485
1173 Ga0105245_10000245
1174 Ga0105247_10003683
1175 Ga0114129_10010044
1176 Ga0114129_10413547
1177 Ga0114129_10610629
1178 Ga0114129_10655525
1179 Ga0114129_10831445
1180 Ga0114129_10944974
1181 Ga0114129_11739981
1182 Ga0105243_10000279
1183 Ga0105241_10029613
1184 Ga0105241_11152729
1185 Ga0105242_10000480
1186 Ga0105242_13076862
1187 Ga0105242_13175158
1188 Ga0105248_10466243
1189 Ga0105237_12573454
1190 Ga0105249_10007151
1191 Ga0105249_10024734
1192 Ga0105249_10701534
1193 Ga0099796_10279661
1194 Ga0105239_10142336
1195 Ga0105239_11581117
1196 Ga0105246_10240815
1197 Ga0105246_11614451
1198 Ga0157369_11871255
1199 Ga0157374_10005148
1200 Ga0157378_10002150
1201 Ga0157378_13289635
1202 Ga0163162_10436952
1203 Ga0157372_10470914
1204 Ga0157372_10473166
1205 Ga0157375_10316375
1206 Ga0157375_10961101
1207 Ga0163163_10474854
1208 Ga0157380_10154148
1209 Ga0157377_10184913
1210 Ga0157377_10346965
1211 Ga0157377_11171049
1212 Ga0157379_10008253
1213 Ga0157379_10279422
1214 Ga0157376_10002130
1215 Ga0157376_10687184
1216 Ga0157376_10857093
1217 Ga0163161_10453024
1218 Ga0207696_1142833
1219 Ga0207653_10003892
1220 Ga0207653_10389875
1221 Ga0207692_10238718
1222 Ga0207692_10587853
1223 Ga0207692_10833636
1224 Ga0207642_10000702
1225 Ga0207642_10406475
1226 Ga0207710_10006893
1227 Ga0207688_10014848
1228 Ga0207688_11105719
1229 Ga0207647_10098604
1230 Ga0207685_10038230
1231 Ga0207699_10252648
1232 Ga0207645_10104524
1233 Ga0207643_10037376
1234 Ga0207643_10090168
1235 Ga0207643_10249999
1236 Ga0207684_10490446
1237 Ga0207654_10057473
1238 Ga0207707_10001519
1239 Ga0207707_10954553
1240 Ga0207695_10795767
1241 Ga0207693_10000364
1242 Ga0207663_10006677
1243 Ga0207663_10165977
1244 Ga0207663_10578728
1245 Ga0207660_10002762
1246 Ga0207660_10037154
1247 Ga0207660_10170200
1248 Ga0207660_10309447
1249 Ga0207660_10568454
1250 Ga0207660_10939213
1251 Ga0207660_11244616
1252 Ga0207662_10000176
1253 Ga0207662_10046732
1254 Ga0207662_10331534
1255 Ga0207662_11055294
1256 Ga0207652_10016191
1257 Ga0207652_10036881
1258 Ga0207646_10340422
1259 Ga0207681_11056113
1260 Ga0207650_11824808
1261 Ga0207659_10008745
1262 Ga0207687_10008984
1263 Ga0207687_10240919
1264 Ga0207700_10732050
1265 Ga0207664_10442308
1266 Ga0207644_11840653
1267 Ga0207686_10000627
1268 Ga0207686_10566713
1269 Ga0207686_10671923
1270 Ga0207709_10000549
1271 Ga0207670_10001899
1272 Ga0207670_10083050
1273 Ga0207670_10207272
1274 Ga0207670_10339135
1275 Ga0207670_10432911
1276 Ga0207670_10643363
1277 Ga0207704_10000329
1278 Ga0207704_10762105
1279 Ga0207704_11229540
1280 Ga0207704_11556866
1281 Ga0207665_10028373
1282 Ga0207665_10037722
1283 Ga0207665_10496303
1284 Ga0207665_10637761
1285 Ga0207665_10939559
1286 Ga0207691_10214687
1287 Ga0207691_11651530
1288 Ga0207711_10398887
1289 Ga0207711_11466989
1290 Ga0207689_10001276
1291 Ga0207689_10333107
1292 Ga0207689_10385395
1293 Ga0207689_11030217
1294 Ga0207667_10066744
1295 Ga0207667_10719247
1296 Ga0207651_10263991
1297 Ga0207651_10566679
1298 Ga0207712_10046117
1299 Ga0207712_10122691
1300 Ga0207712_10159075
1301 Ga0207640_10008328
1302 Ga0207677_10000669
1303 Ga0207677_10201015
1304 Ga0207677_10361011
1305 Ga0207677_11627307
1306 Ga0207703_10001000
1307 Ga0207703_10008924
1308 Ga0207703_12406073
1309 Ga0207639_10077699
1310 Ga0207639_10715458
1311 Ga0207708_10000275
1312 Ga0207708_10411181
1313 Ga0207708_10476078
1314 Ga0207708_11141823
1315 Ga0207702_10017969
1316 Ga0207641_10004677
1317 Ga0207641_10193036
1318 Ga0207641_10762950
1319 Ga0207641_10923160
1320 Ga0207648_10000185
1321 Ga0207648_10216176
1322 Ga0207676_10354370
1323 Ga0207676_10853773
1324 Ga0207674_10328981
1325 Ga0207675_100000150
1326 Ga0207675_100562384
1327 Ga0207675_100839527
1328 Ga0207675_101646254
1329 Ga0207683_10298065
1330 Ga0207698_10051617
1331 Ga0207698_10923416
1332 Ga0209969_1006848
1333 Ga0209969_1007420
1334 Ga0209969_1013988
1335 Ga0209967_1000418
1336 Ga0209967_1007350
1337 Ga0209981_1001186
1338 Ga0209981_1007240
1339 Ga0209981_1023602
1340 Ga0209996_1013945
1341 Ga0210000_1001614
1342 Ga0210000_1010444
1343 Ga0209995_1001807
1344 Ga0209995_1015504
1345 Ga0209968_1009343
1346 Ga0209968_1039801
1347 Ga0209999_1001013
1348 Ga0209999_1009303
1349 Ga0209999_1016041
1350 Ga0209999_1020643
1351 Ga0209999_1124309
1352 Ga0209983_1100941
1353 Ga0209588_1197435
1354 Ga0209971_1013346
1355 Ga0209971_1043224
1356 Ga0209966_1015126
1357 Ga0209966_1048953
1358 Ga0207428_10000290
1359 Ga0268266_10008012
1360 Ga0268265_10001010
1361 Ga0268265_10162327
1362 Ga0268265_10317321
1363 Ga0268264_10000903
1364 Ga0268264_10054842
1365 Ga0268264_12065470
1366 Ga0265330_10079442
1367 Ga0265331_10027126
1368 Ga0307408_100460202
1369 Ga0307408_101540448
1370 Ga0307408_101602362
1371 Ga0307408_102267587
1372 Ga0316575_10000119
1373 Ga0316575_10017102
1374 Ga0316578_10559794
1375 Ga0307405_10156945
1376 Ga0307405_10262283
1377 Ga0307405_10691095
1378 Ga0307405_11652608
1379 Ga0307413_11317238
1380 Ga0307410_11272369
1381 Ga0307406_10804135
1382 Ga0307406_10911749
1383 Ga0307412_10755790
1384 Ga0307412_12003024
1385 Ga0307416_100063169
1386 Ga0307416_100367008
1387 Ga0307416_100562428
1388 Ga0307416_100570731
1389 Ga0307416_101144531
1390 Ga0307416_101146930
1391 Ga0307416_103245847
1392 Ga0307416_103289124
1393 Ga0307411_10124778
1394 Ga0307411_10160498
1395 Ga0307411_10726372
1396 Ga0307411_10731641
1397 Ga0307411_11637869
1398 Ga0316583_10068741
1399 Ga0316593_10238880
1400 Ga0373958_0068617
1401 Ga0373959_0019010
1402 Ga0373938_0014912
1403 Ga0373938_0165042
1404 Ga0373926_0004032
1405 Ga0373928_0002097
1406 Ga0373929_0006911
1407 Ga0373929_0009032
1408 Ga0373929_0104352
1409 Ga0373929_0228514
1410 Ga0373934_0389189
1411 Ga0373940_0138688
1412 Ga0373940_0306678
1413 Ga0373944_0000377
1414 Ga0373949_0006468
1415 Ga0373951_0105056
1416 Ga0373951_0163820
1417 Ga0373952_0003000
1418 Ga0373952_0009609
1419 Ga0373952_0048730
1420 Ga0373923_0017754
1421 Ga0373923_0019060
1422 Ga0373923_0113311
1423 Ga0373932_0010946
1424 Ga0373932_0208266
1425 Ga0373936_0020031
1426 Ga0373936_0100404
1427 Ga0373939_0100603
1428 Ga0373939_0171437
1429 Ga0373939_0210278
1430 Ga0373939_0371767
1431 Ga0373939_0481058
1432 Ga0373941_0149653
1433 Ga0373941_0244446
1434 Ga0373945_0008166
1435 Ga0373953_0005017
1436 Ga0373954_0005512
1437 Ga0373954_0500601
1438 Ga0373956_0007945
1439 Ga0373956_0129849
1440 Ga0373956_0298565
1441 Ga0373956_0315458
1442 Ga0373957_0063498
1443 Ga0373960_0076331
1444 Ga0373960_0107993
1445 Ga0373943_0296253
1446 Ga0373946_0003939
1447 Ga0373955_0008610
1448 Ga0373955_0045128
1449 Ga0373942_0004600
1450 Ga0373942_0064445
1451 Ga0373961_0042628
1452 Ga0373961_0269836
1453 Ga0373962_0050332
1454 Ga0373962_0165154
1455 Ga0316574_0002886
1456 Ga0373924_0009740
1457 Ga0373924_0020068
1458 Ga0373931_0000163
1459 Ga0373931_0005381
1460 Ga0373931_0016115
1461 Ga0373931_0019730
1462 Ga0373931_0040885
1463 Ga0373931_0056980
1464 Ga0373931_0245137
1465 Ga0373931_0474559
1466 Ga0373931_1061060
1467 Ga0373935_0080856
1468 Ga0373935_1350822
1469 Ga0373927_0030265
1470 Ga0373933_0015309
1471 Ga0373933_0063689
1472 Ga0373933_0365644
1473 Ga0373933_0626712
1474 Ga0373933_1021788
1475 Ga0373947_0831272
1476 Ga0373937_0188575
1477 Ga0373937_0537280
1478 Ga0373937_1352040
1479 Ga0373937_1921612
1480 Ga0316582_0392819
1481 Ga0373925_0017912
1482 Ga0373925_0028634
1483 Ga0373925_0217299
1484 Ga0373925_0618186
1485 Ga0436360_0533797
1486 Ga0439461_0031816
1487 Ga0451804_0082086
1488 Ga0451807_1336088
1489 Ga0451807_2271692
1490 Ga0451839_1628095
1491 Ga0451845_0459515
1492 Ga0451853_0641740
1493 Ga0439431_0016187
1494 Ga0439433_0122117
1495 Ga0439441_000242
1496 Ga0439441_018536
1497 Ga0439441_042013
1498 Ga0439443_022792
1499 Ga0439451_084087
1500 Ga0450888_031172
1501 Ga0450904_037968
1502 Ga0450910_087232
1503 Ga0439446_0007516
1504 Ga0439446_0163156
1505 Ga0439434_0029843
1506 Ga0439435_0000145
1507 Ga0439435_0059866
1508 Ga0439444_0000161
1509 Ga0439444_0103050
1510 Ga0439459_0067102
1511 Ga0439460_0000484
1512 Ga0439460_0301743
1513 Ga0451577_0005927
1514 Ga0451577_0314829
1515 Ga0451577_0444344
1516 Ga0451577_1033001
1517 Ga0453683_0047497
1518 Ga0453683_1079165
1519 Ga0466965_0942604
1520 Ga0466963_0188072
1521 Ga0466964_0346816
1522 Ga0453684_0027030
1523 Ga0453684_0453613
1524 Ga0453684_0789546
1525 Ga0451576_0001107
1526 Ga0451576_0002171
1527 Ga0451576_0027642
1528 Ga0451576_0028514
1529 Ga0451576_0063201
1530 Ga0451576_0123886
1531 Ga0451576_2514298
1532 Ga0466967_0039326
1533 Ga0495592_0517446
1534 Ga0495592_0590002
1535 Ga0495592_0645459
1536 Ga0495603_0004691
1537 Ga0495603_0658384
1538 Ga0495651_0133500
1539 Ga0495651_0383081
1540 Ga0495653_0311763
1541 Ga0495580_0012751
1542 Ga0495582_0058416
1543 Ga0495639_0156122
1544 Ga0495664_0760980
1545 Ga0495584_0102798
1546 Ga0495594_0495349
1547 Ga0495628_0057267
1548 Ga0495630_0107329
1549 Ga0495644_0154566
1550 Ga0495644_0354323
1551 Ga0495666_0060727
1552 Ga0495652_0121969
1553 Ga0495665_0008515
1554 Ga0495640_0104245
1555 Ga0495586_0000624
1556 Ga0495598_0034505
1557 Ga0495598_0117883
1558 Ga0495609_0133354
1559 Ga0495621_0023584
1560 Ga0495621_0031229
1561 Ga0495621_0311067
1562 Ga0495621_0475665
1563 Ga0495622_0098204
1564 Ga0495667_0031621
1565 Ga0495667_0694456
1566 Ga0495656_0069038
1567 Ga0495635_0258710
1568 Ga0495635_0265535
1569 Ga0495659_0162087
1570 Ga0495659_0284532
1571 Ga0495659_0322759
1572 Ga0495588_0001603
1573 Ga0495657_0475674
1574 Ga0495599_0678299
1575 Ga0495623_0095181
1576 Ga0495623_0248193
1577 Ga0495647_0009861
1578 Ga0495658_0002606
1579 Ga0495669_0003951
1580 Ga0495669_0242167
1581 Ga0495670_0169358
1582 Ga0495581_0129408
1583 Ga0495604_0182519
1584 Ga0495636_0002413
1585 Ga0495636_0639142
1586 Ga0495674_0109115
1587 Ga0495674_0290321
1588 Ga0495676_0094536
1589 Ga0495680_0122777
1590 Ga0495675_0441689
1591 Ga0495675_0685923
1592 Ga0495684_0559724
1593 Ga0495602_0607547
1594 Ga0495602_0980954
1595 Ga0496101_0202190
1596 Ga0496105_0001094
1597 Ga0496106_0429243
1598 Ga0496112_0304488
1599 Ga0496115_0594741
1600 Ga0501291_040040
1601 Ga0501297_023686
1602 Ga0501298_114648
1603 Ga0501299_009849
1604 Ga0501299_041984
1605 Ga0501299_168923
1606 Ga0501031_0101443
1607 Ga0501031_0152727
1608 Ga0501031_0332353
1609 Ga0501031_0511574
1610 Ga0501031_0576550
1611 Ga0501033_0023943
1612 Ga0501033_1126398
1613 Ga0501036_0015965
1614 Ga0501036_0026950
1615 Ga0501036_0074299
1616 Ga0501036_0220896
1617 Ga0501036_0556430
1618 Ga0501036_0646150
1619 Ga0501036_1478588
1620 Ga0501036_1723557
1621 Ga0501037_0015423
1622 Ga0501037_0172063
1623 Ga0501037_0556443
1624 Ga0501038_0028048
1625 Ga0501038_0521494
1626 Ga0501038_1050508
1627 Ga0501039_0004420
1628 Ga0501039_0170885
1629 Ga0501039_0216182
1630 Ga0501039_0255235
1631 Ga0501039_1034343
1632 Ga0501039_1047794
1633 Ga0501040_0002776
1634 Ga0501040_0003267
1635 Ga0501040_0101986
1636 Ga0501040_0916375
1637 Ga0501041_0001563
1638 Ga0501041_0007863
1639 Ga0501041_0896150
1640 Ga0501041_0973712
1641 Ga0501042_0002917
1642 Ga0501042_0193498
1643 Ga0501042_0691804
1644 Ga0501042_0880820
1645 Ga0501042_1022441
1646 Ga0501043_0083620
1647 Ga0501043_0292548
1648 Ga0501046_0002700
1649 Ga0501046_0048700
1650 Ga0501046_0725936
1651 Ga0501046_0768793
1652 Ga0501046_0928099
1653 Ga0501048_0050036
1654 Ga0501048_0079727
1655 Ga0501048_0110430
1656 Ga0501048_0974296
1657 Ga0501067_0506734
1658 Ga0501068_0014725
1659 Ga0501068_0266509
1660 Ga0501068_0489990
1661 Ga0501069_0138432
1662 Ga0501069_0510480
1663 Ga0501069_0594974
1664 Ga0501070_0192841
1665 Ga0501071_0004683
1666 Ga0501071_0020331
1667 Ga0501071_0060075
1668 Ga0501071_0094628
1669 Ga0501071_0214789
1670 Ga0501071_0258944
1671 Ga0501071_0318877
1672 Ga0501071_0529164
1673 Ga0501071_0946180
1674 Ga0501071_1095850
1675 Ga0501072_0006099
1676 Ga0501072_0008315
1677 Ga0501072_0074526
1678 Ga0501072_0081556
1679 Ga0501072_0236855
1680 Ga0501072_0592559
1681 Ga0501072_0711905
1682 Ga0501072_1026668
1683 Ga0501072_1161313
1684 Ga0501073_0216877
1685 Ga0501074_0019204
1686 Ga0501074_0169828
1687 Ga0501074_0622374
1688 Ga0501075_0002198
1689 Ga0501075_0017270
1690 Ga0501075_0023103
1691 Ga0501075_0123449
1692 Ga0501075_0399451
1693 Ga0501076_0001244
1694 Ga0501076_0005555
1695 Ga0501076_0152083
1696 Ga0501076_0188740
1697 Ga0501076_0379888
1698 Ga0501077_0017448
1699 Ga0501077_0152986
1700 Ga0501077_0390531
1701 Ga0501077_0655861
1702 Ga0501206_038414
1703 Ga0501235_090665
1704 Ga0501249_072198
1705 Ga0501221_051465
1706 Ga0501079_0002346
1707 Ga0501079_0004200
1708 Ga0501079_0154202
1709 Ga0501079_0400853
1710 Ga0501079_0546962
1711 Ga0501079_1000801
1712 Ga0501080_0000634
1713 Ga0501080_0027376
1714 Ga0501080_1425826
1715 Ga0501081_0007514
1716 Ga0501081_0053989
1717 Ga0501081_0054336
1718 Ga0501081_0508537
1719 Ga0501083_0132354
1720 Ga0501083_0597503
1721 Ga0501271_051561
1722 Ga0501272_059093
1723 Ga0501035_0056735
1724 Ga0501035_1226769
1725 Ga0501044_0177118
1726 Ga0501044_0756931
1727 Ga0501045_0002510
1728 Ga0501045_0003944
1729 Ga0501045_0015600
1730 Ga0501045_0360537
1731 Ga0501045_0563117
1732 Ga0501045_0695644
1733 nmdc:mga0k408_120819_c1
1734 nmdc:mga05p37_2094365_c1
1735 nmdc:mga05p37_2102607_c1
1736 nmdc:mga05p37_389_c1
1737 nmdc:mga05p37_478776_c1
1738 nmdc:mga05p37_492821_c1
1739 nmdc:mga05p37_743720_c1
1740 nmdc:mga09592_166_c1
1741 nmdc:mga09592_325353_c1
1742 nmdc:mga09592_345712_c1
1743 nmdc:mga09592_441435_c1
1744 nmdc:mga0qj67_328979_c1
1745 nmdc:mga0qj67_4573_c1
1746 nmdc:mga0qj67_467265_c1
1747 nmdc:mga0qj67_562755_c1
1748 nmdc:mga0qj67_862833_c1
1749 nmdc:mga06r32_116159_c1
1750 nmdc:mga06r32_141035_c1
1751 nmdc:mga06r32_338797_c1
1752 nmdc:mga06r32_344872_c1
1753 nmdc:mga08y16_2159_c1
1754 nmdc:mga08y16_48378_c1
1755 nmdc:mga08y16_54762_c1
1756 nmdc:mga08y16_589943_c1
1757 nmdc:mga08y16_788732_c1
1758 nmdc:mga0n895_101468_c1
1759 nmdc:mga0n895_1728240_c1
1760 nmdc:mga0n895_196_c1
1761 nmdc:mga0n895_342027_c1
1762 nmdc:mga0n895_49390_c1
1763 nmdc:mga0n895_497525_c1
1764 nmdc:mga0n895_608586_c1
1765 nmdc:mga0n895_77969_c1
1766 nmdc:mga0rr50_1267257_c1
1767 nmdc:mga0rr50_23614_c1
1768 nmdc:mga0rr50_29506_c1
1769 nmdc:mga0rr50_312479_c1
1770 nmdc:mga0rr50_48101_c1
1771 nmdc:mga08x19_15616_c1
1772 nmdc:mga08x19_1688_c1
1773 nmdc:mga08x19_258_c1
1774 nmdc:mga08x19_43255_c1
1775 nmdc:mga08x19_60152_c1
1776 nmdc:mga08x19_67637_c1
1777 nmdc:mga08x19_724181_c1
1778 nmdc:mga08x19_72933_c1
1779 nmdc:mga08x19_759_c1
1780 nmdc:mga0a205_17979_c1
1781 nmdc:mga0a205_24715_c1
1782 nmdc:mga0a205_247874_c1
1783 nmdc:mga0a205_403264_c1
1784 nmdc:mga0a205_427981_c1
1785 nmdc:mga0a205_648660_c1
1786 nmdc:mga0a205_726336_c1
1787 Ga0495595_0334940
1788 Ga0501084_0005520
1789 Ga0501084_0215760
1790 Ga0501084_0271446
1791 Ga0501084_0276297
1792 Ga0501084_0568893
1793 Ga0501084_1237901
1794 Ga0590071_005157
1795 Ga0590071_042317
1796 Ga0590074_100979
1797 Ga0590077_008460
1798 Ga0501082_0002298
1799 Ga0501082_0017077
1800 Ga0501082_1257019
1801 Ga0501082_1379821
1802 Ga0530510_0000245
1803 Ga0530510_0004031
1804 Ga0530510_0391997
1805 Ga0530510_0583731
1806 Ga0530510_0620413

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

11

74

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.9031 1 76
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8844 3 72
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8826 2 76
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8797 1 77
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.8713 1 76
ID Description Score Start End Superfamily
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9181 2 77 3.10.20.90
af_P0A9W6_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.916 2 77 3.30.300.90
af_O14280_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9096 1 77 3.30.300.90
3tr3A00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9048 2 76 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8926 4 79 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A536WBI8-F1-model_v4 BolA family transcriptional regulator 0.9977 1 77
AF-A0A431JYZ0-F1-model_v4 BolA family transcriptional regulator 0.9855 2 75
AF-A0A238DVQ8-F1-model_v4 deleted 0.9808 1 74
AF-A0A1H8CLX6-F1-model_v4 Transcriptional regulator, BolA protein family 0.9742 1 77
AF-A0A4P7BH98-F1-model_v4 deleted 0.9734 2 78

Map