F485228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 902 | 417 | 879 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0202384|Ga0501047_0202384_721_1608 |
| Length | 295 |
| Sequence | MDAPQSAPRQPRVGLFVTCLVDLIRPSIGFAAVKLVEDAGCTVEVPPQSCCGQPAFNSGDRATTRAIAEQVITTFAPYDYVVAPSGSCAGMLKTHYPELFAGDADWTERVRAFCAKTYELVSFLTDVMKVKAVAAQFDGTVTYHDSCSGLRELGIRAQPRRLLGSVAGLTLKEMTDADVCCGFGGTFCVKYPDISNAIVGKKTECIAAAGADTLLAGDLGCLMNMAGKLQREGRAVRARHIAEVLAGMSDTPAIGEAKTHPVHSRASGNPAATQQVFRSADSGSPLTRGRTAVNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 5 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 6 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 7 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 8 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 9 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 10 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 11 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 12 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 13 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 14 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 15 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 16 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 17 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 18 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 19 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 20 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 21 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 22 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 25 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 26 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 27 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 152 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 153 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 156 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 243 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 258 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 261 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 268 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 269 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 270 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 271 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 272 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 273 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 274 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 275 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 276 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 277 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 278 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 348 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 349 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 350 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 351 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 352 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 353 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 354 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 355 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 356 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 392 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 405 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 406 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 407 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 408 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 410 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 411 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 412 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 415 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 416 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 417 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.45 |
| Metatranscriptomes | 0 |
| Isolates | 2.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.77 |
| Nodule | 0.22 |
| Rhizoplane | 4.55 |
| Rhizosphere | 85.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1628267 | 2162886007 | Bacteria | 5198 |
| 2 | JGI24747J21853_1003541 | 3300001978 | Unclassified | 1354 |
| 3 | JGI24737J22298_10018418 | 3300001990 | Bacteria | 2241 |
| 4 | JGI24735J21928_10007894 | 3300002067 | Bacteria | 3458 |
| 5 | JGI24735J21928_10048699 | 3300002067 | Unclassified | 1226 |
| 6 | JGI24750J21931_1001174 | 3300002070 | Bacteria | 3346 |
| 7 | JGI24738J21930_10019629 | 3300002075 | Unclassified | 1408 |
| 8 | JGI25406J46586_10002350 | 3300003203 | Bacteria | 8942 |
| 9 | JGI25406J46586_10017460 | 3300003203 | Bacteria | 2966 |
| 10 | rootH2_10021524 | 3300003320 | Bacteria | 1781 |
| 11 | Ga0065704_10001326 | 3300005289 | Bacteria | 14211 |
| 12 | Ga0065707_10352757 | 3300005295 | Bacteria | 916 |
| 13 | Ga0070658_10075828 | 3300005327 | Bacteria | 2759 |
| 14 | Ga0070658_10107484 | 3300005327 | Bacteria | 2309 |
| 15 | Ga0070676_10015602 | 3300005328 | Bacteria | 4193 |
| 16 | Ga0070690_100000374 | 3300005330 | Bacteria | 22867 |
| 17 | Ga0070690_100092392 | 3300005330 | Unclassified | 1995 |
| 18 | Ga0070670_100003963 | 3300005331 | Bacteria | 12358 |
| 19 | Ga0070666_10004674 | 3300005335 | Bacteria | 8361 |
| 20 | Ga0070666_10005915 | 3300005335 | Bacteria | 7513 |
| 21 | Ga0070680_100000765 | 3300005336 | Bacteria | 22520 |
| 22 | Ga0070680_100008223 | 3300005336 | Bacteria | 7976 |
| 23 | Ga0070680_100219367 | 3300005336 | Bacteria | 1605 |
| 24 | Ga0070682_100001371 | 3300005337 | Bacteria | 13761 |
| 25 | Ga0068868_100046239 | 3300005338 | Bacteria | 3407 |
| 26 | Ga0070660_100000601 | 3300005339 | Bacteria | 24041 |
| 27 | Ga0070689_100001212 | 3300005340 | Bacteria | 16341 |
| 28 | Ga0070689_100056545 | 3300005340 | Bacteria | 3042 |
| 29 | Ga0070689_100151980 | 3300005340 | Bacteria | 1867 |
| 30 | Ga0070689_100513560 | 3300005340 | Bacteria | 1028 |
| 31 | Ga0070691_10000403 | 3300005341 | Bacteria | 15716 |
| 32 | Ga0070687_100001226 | 3300005343 | Bacteria | 8889 |
| 33 | Ga0070687_100050738 | 3300005343 | Bacteria | 2144 |
| 34 | Ga0070687_100062502 | 3300005343 | Bacteria | 1972 |
| 35 | Ga0070661_100000694 | 3300005344 | Bacteria | 24691 |
| 36 | Ga0070661_100002128 | 3300005344 | Bacteria | 13642 |
| 37 | Ga0070661_100018400 | 3300005344 | Bacteria | 4967 |
| 38 | Ga0070692_10000588 | 3300005345 | Bacteria | 11410 |
| 39 | Ga0070692_10061066 | 3300005345 | Bacteria | 1986 |
| 40 | Ga0070692_10226109 | 3300005345 | Bacteria | 1108 |
| 41 | Ga0070668_100000244 | 3300005347 | Bacteria | 35854 |
| 42 | Ga0070668_100008885 | 3300005347 | Bacteria | 7461 |
| 43 | Ga0070668_100146731 | 3300005347 | Bacteria | 1905 |
| 44 | Ga0070668_100534842 | 3300005347 | Bacteria | 1018 |
| 45 | Ga0070669_100003798 | 3300005353 | Bacteria | 10910 |
| 46 | Ga0070669_100341123 | 3300005353 | Bacteria | 1214 |
| 47 | Ga0070675_100001316 | 3300005354 | Bacteria | 18150 |
| 48 | Ga0070675_100046662 | 3300005354 | Bacteria | 3548 |
| 49 | Ga0070671_100001369 | 3300005355 | Bacteria | 18273 |
| 50 | Ga0070671_100604909 | 3300005355 | Bacteria | 947 |
| 51 | Ga0070674_100002970 | 3300005356 | Bacteria | 9417 |
| 52 | Ga0070674_100026232 | 3300005356 | Bacteria | 3803 |
| 53 | Ga0070673_100000356 | 3300005364 | Bacteria | 24037 |
| 54 | Ga0070688_100001697 | 3300005365 | Bacteria | 11003 |
| 55 | Ga0070688_100232067 | 3300005365 | Bacteria | 1306 |
| 56 | Ga0070688_100342702 | 3300005365 | Bacteria | 1092 |
| 57 | Ga0070659_100001001 | 3300005366 | Bacteria | 20737 |
| 58 | Ga0070667_100002918 | 3300005367 | Bacteria | 14694 |
| 59 | Ga0070667_100155382 | 3300005367 | Bacteria | 2012 |
| 60 | Ga0070667_100169664 | 3300005367 | Unclassified | 1926 |
| 61 | Ga0070709_10000515 | 3300005434 | Bacteria | 22848 |
| 62 | Ga0070709_10001330 | 3300005434 | Bacteria | 13469 |
| 63 | Ga0070709_10005045 | 3300005434 | Bacteria | 7139 |
| 64 | Ga0070709_10288579 | 3300005434 | Unclassified | 1195 |
| 65 | Ga0070714_100001611 | 3300005435 | Bacteria | 16397 |
| 66 | Ga0070714_100144596 | 3300005435 | Bacteria | 2138 |
| 67 | Ga0070713_100000001 | 3300005436 | Bacteria | 257984 |
| 68 | Ga0070713_100014697 | 3300005436 | Bacteria | 5823 |
| 69 | Ga0070713_100437131 | 3300005436 | Bacteria | 1227 |
| 70 | Ga0070710_10000792 | 3300005437 | Bacteria | 15161 |
| 71 | Ga0070701_10004797 | 3300005438 | Bacteria | 5527 |
| 72 | Ga0070711_100000456 | 3300005439 | Bacteria | 21377 |
| 73 | Ga0070711_100012997 | 3300005439 | Bacteria | 5218 |
| 74 | Ga0070711_100084148 | 3300005439 | Bacteria | 2275 |
| 75 | Ga0070711_100255241 | 3300005439 | Unclassified | 1377 |
| 76 | Ga0070705_100000465 | 3300005440 | Bacteria | 23331 |
| 77 | Ga0070700_100000474 | 3300005441 | Bacteria | 20131 |
| 78 | Ga0070694_100014944 | 3300005444 | Bacteria | 4864 |
| 79 | Ga0070694_100139104 | 3300005444 | Bacteria | 1762 |
| 80 | Ga0070663_100005700 | 3300005455 | Bacteria | 7422 |
| 81 | Ga0070678_100000779 | 3300005456 | Bacteria | 15981 |
| 82 | Ga0070678_100104255 | 3300005456 | Bacteria | 2205 |
| 83 | Ga0070678_100771195 | 3300005456 | Bacteria | 871 |
| 84 | Ga0070662_100009283 | 3300005457 | Bacteria | 6429 |
| 85 | Ga0070681_10013519 | 3300005458 | Bacteria | 8116 |
| 86 | Ga0070681_10020432 | 3300005458 | Bacteria | 6637 |
| 87 | Ga0070681_10544914 | 3300005458 | Bacteria | 1074 |
| 88 | Ga0068867_100088225 | 3300005459 | Bacteria | 2350 |
| 89 | Ga0070685_10026919 | 3300005466 | Bacteria | 3174 |
| 90 | Ga0070685_10225201 | 3300005466 | Bacteria | 1231 |
| 91 | Ga0070706_100116209 | 3300005467 | Bacteria | 2492 |
| 92 | Ga0070706_100704209 | 3300005467 | Bacteria | 937 |
| 93 | Ga0070698_100002001 | 3300005471 | Bacteria | 22625 |
| 94 | Ga0070698_100027820 | 3300005471 | Bacteria | 5875 |
| 95 | Ga0070698_100359061 | 3300005471 | Bacteria | 1388 |
| 96 | Ga0070699_100031429 | 3300005518 | Bacteria | 4584 |
| 97 | Ga0070699_100098175 | 3300005518 | Bacteria | 2566 |
| 98 | Ga0070679_100024967 | 3300005530 | Bacteria | 5858 |
| 99 | Ga0070679_100046195 | 3300005530 | Bacteria | 4340 |
| 100 | Ga0070679_100060704 | 3300005530 | Bacteria | 3768 |
| 101 | Ga0070684_100008442 | 3300005535 | Bacteria | 8052 |
| 102 | Ga0070697_100002257 | 3300005536 | Bacteria | 14782 |
| 103 | Ga0070697_100230417 | 3300005536 | Bacteria | 1580 |
| 104 | Ga0068853_100001967 | 3300005539 | Bacteria | 15139 |
| 105 | Ga0068853_100020387 | 3300005539 | Bacteria | 5513 |
| 106 | Ga0068853_100045111 | 3300005539 | Bacteria | 3775 |
| 107 | Ga0070672_100000593 | 3300005543 | Bacteria | 21257 |
| 108 | Ga0070672_100199351 | 3300005543 | Bacteria | 1673 |
| 109 | Ga0070672_100395483 | 3300005543 | Bacteria | 1184 |
| 110 | Ga0070686_100000944 | 3300005544 | Bacteria | 16747 |
| 111 | Ga0070695_100001660 | 3300005545 | Bacteria | 12514 |
| 112 | Ga0070695_100262542 | 3300005545 | Bacteria | 1262 |
| 113 | Ga0070696_100045582 | 3300005546 | Bacteria | 3038 |
| 114 | Ga0070696_100072374 | 3300005546 | Bacteria | 2428 |
| 115 | Ga0070696_100206639 | 3300005546 | Bacteria | 1468 |
| 116 | Ga0070696_100318465 | 3300005546 | Bacteria | 1196 |
| 117 | Ga0070693_100000655 | 3300005547 | Bacteria | 15269 |
| 118 | Ga0070693_100214111 | 3300005547 | Bacteria | 1259 |
| 119 | Ga0070665_100015319 | 3300005548 | Bacteria | 7698 |
| 120 | Ga0070665_100026167 | 3300005548 | Bacteria | 5874 |
| 121 | Ga0070665_100094013 | 3300005548 | Unclassified | 3003 |
| 122 | Ga0070704_100000439 | 3300005549 | Bacteria | 19514 |
| 123 | Ga0070704_100377604 | 3300005549 | Bacteria | 1203 |
| 124 | Ga0068855_100007707 | 3300005563 | Bacteria | 13002 |
| 125 | Ga0068855_100477661 | 3300005563 | Bacteria | 1357 |
| 126 | Ga0070664_100002755 | 3300005564 | Bacteria | 14186 |
| 127 | Ga0070664_100038470 | 3300005564 | Bacteria | 4027 |
| 128 | Ga0070664_100263764 | 3300005564 | Bacteria | 1550 |
| 129 | Ga0070664_100751667 | 3300005564 | Bacteria | 910 |
| 130 | Ga0068857_100003709 | 3300005577 | Bacteria | 12814 |
| 131 | Ga0068857_100116672 | 3300005577 | Bacteria | 2402 |
| 132 | Ga0068857_100181140 | 3300005577 | Bacteria | 1917 |
| 133 | Ga0068857_100415561 | 3300005577 | Bacteria | 1253 |
| 134 | Ga0068854_100002052 | 3300005578 | Bacteria | 12335 |
| 135 | Ga0068854_100013354 | 3300005578 | Bacteria | 5388 |
| 136 | Ga0068854_100045272 | 3300005578 | Bacteria | 3128 |
| 137 | Ga0068856_100002475 | 3300005614 | Bacteria | 19007 |
| 138 | Ga0068856_100003275 | 3300005614 | Bacteria | 16459 |
| 139 | Ga0068856_100004362 | 3300005614 | Bacteria | 14097 |
| 140 | Ga0068856_100293509 | 3300005614 | Bacteria | 1643 |
| 141 | Ga0070702_100000613 | 3300005615 | Bacteria | 13135 |
| 142 | Ga0070702_100063557 | 3300005615 | Bacteria | 2156 |
| 143 | Ga0068852_100091581 | 3300005616 | Unclassified | 2721 |
| 144 | Ga0068859_100002629 | 3300005617 | Bacteria | 18276 |
| 145 | Ga0068859_100003484 | 3300005617 | Bacteria | 16020 |
| 146 | Ga0068859_100329241 | 3300005617 | Bacteria | 1622 |
| 147 | Ga0068864_100001166 | 3300005618 | Bacteria | 21843 |
| 148 | Ga0068864_100149266 | 3300005618 | Bacteria | 2116 |
| 149 | Ga0068866_10000608 | 3300005718 | Bacteria | 16359 |
| 150 | Ga0068866_10079080 | 3300005718 | Bacteria | 1761 |
| 151 | Ga0068861_100002476 | 3300005719 | Bacteria | 12034 |
| 152 | Ga0068861_100063454 | 3300005719 | Bacteria | 2840 |
| 153 | Ga0068863_100002189 | 3300005841 | Bacteria | 19391 |
| 154 | Ga0068863_100160466 | 3300005841 | Bacteria | 2154 |
| 155 | Ga0068863_100199480 | 3300005841 | Bacteria | 1924 |
| 156 | Ga0068863_100297872 | 3300005841 | Bacteria | 1564 |
| 157 | Ga0068858_100008733 | 3300005842 | Bacteria | 9730 |
| 158 | Ga0068858_100018569 | 3300005842 | Bacteria | 6512 |
| 159 | Ga0068858_100078766 | 3300005842 | Bacteria | 3062 |
| 160 | Ga0068858_100222740 | 3300005842 | Bacteria | 1787 |
| 161 | Ga0068860_100001510 | 3300005843 | Bacteria | 25075 |
| 162 | Ga0068860_100160721 | 3300005843 | Bacteria | 2166 |
| 163 | Ga0068860_100178732 | 3300005843 | Bacteria | 2051 |
| 164 | Ga0068860_100796095 | 3300005843 | Bacteria | 958 |
| 165 | Ga0068862_100006358 | 3300005844 | Bacteria | 9823 |
| 166 | Ga0068862_100052142 | 3300005844 | Bacteria | 3499 |
| 167 | Ga0081455_10028476 | 3300005937 | Bacteria | 5104 |
| 168 | Ga0081455_10096167 | 3300005937 | Bacteria | 2389 |
| 169 | Ga0081538_10000527 | 3300005981 | Bacteria | 42416 |
| 170 | Ga0081538_10011188 | 3300005981 | Bacteria | 7289 |
| 171 | Ga0081540_1000726 | 3300005983 | Bacteria | 30344 |
| 172 | Ga0081540_1020212 | 3300005983 | Bacteria | 4014 |
| 173 | Ga0081540_1036314 | 3300005983 | Bacteria | 2629 |
| 174 | Ga0081539_10000881 | 3300005985 | Bacteria | 57379 |
| 175 | Ga0081539_10002027 | 3300005985 | Bacteria | 30522 |
| 176 | Ga0070717_10025097 | 3300006028 | Bacteria | 4735 |
| 177 | Ga0070717_10150400 | 3300006028 | Bacteria | 2013 |
| 178 | Ga0075365_10032574 | 3300006038 | Bacteria | 3352 |
| 179 | Ga0070715_10000212 | 3300006163 | Bacteria | 13730 |
| 180 | Ga0070716_100002398 | 3300006173 | Bacteria | 8629 |
| 181 | Ga0070712_100000109 | 3300006175 | Bacteria | 42842 |
| 182 | Ga0070712_100000499 | 3300006175 | Bacteria | 22474 |
| 183 | Ga0070712_100001371 | 3300006175 | Bacteria | 14772 |
| 184 | Ga0070712_100045294 | 3300006175 | Bacteria | 3037 |
| 185 | Ga0075367_10036467 | 3300006178 | Bacteria | 2852 |
| 186 | Ga0075366_10055843 | 3300006195 | Bacteria | 2345 |
| 187 | Ga0097621_100035352 | 3300006237 | Bacteria | 3992 |
| 188 | Ga0097621_100189565 | 3300006237 | Bacteria | 1780 |
| 189 | Ga0097621_100409465 | 3300006237 | Bacteria | 1215 |
| 190 | Ga0097621_100618057 | 3300006237 | Bacteria | 992 |
| 191 | Ga0075370_10187156 | 3300006353 | Bacteria | 1219 |
| 192 | Ga0075428_100015161 | 3300006844 | Bacteria | 8548 |
| 193 | Ga0075431_100001142 | 3300006847 | Bacteria | 23867 |
| 194 | Ga0075431_100115431 | 3300006847 | Bacteria | 2772 |
| 195 | Ga0075431_100365845 | 3300006847 | Bacteria | 1448 |
| 196 | Ga0075433_10010430 | 3300006852 | Bacteria | 7457 |
| 197 | Ga0075434_100687493 | 3300006871 | Bacteria | 1041 |
| 198 | Ga0075429_100009251 | 3300006880 | Bacteria | 8551 |
| 199 | Ga0068865_100003706 | 3300006881 | Bacteria | 9180 |
| 200 | Ga0068865_100077410 | 3300006881 | Bacteria | 2377 |
| 201 | Ga0075436_100004097 | 3300006914 | Bacteria | 9996 |
| 202 | Ga0075436_100077423 | 3300006914 | Bacteria | 2303 |
| 203 | Ga0097620_100002628 | 3300006931 | Bacteria | 18276 |
| 204 | Ga0097620_100003484 | 3300006931 | Bacteria | 16020 |
| 205 | Ga0097620_100329236 | 3300006931 | Bacteria | 1622 |
| 206 | Ga0075435_100023169 | 3300007076 | Bacteria | 4798 |
| 207 | Ga0075435_100051231 | 3300007076 | Bacteria | 3325 |
| 208 | Ga0075435_100259981 | 3300007076 | Bacteria | 1479 |
| 209 | Ga0105240_10013652 | 3300009093 | Bacteria | 11140 |
| 210 | Ga0105240_10025951 | 3300009093 | Bacteria | 7695 |
| 211 | Ga0105240_10213361 | 3300009093 | Bacteria | 2254 |
| 212 | Ga0105240_10349402 | 3300009093 | Bacteria | 1678 |
| 213 | Ga0105240_10841749 | 3300009093 | Bacteria | 991 |
| 214 | Ga0111539_10000501 | 3300009094 | Bacteria | 49848 |
| 215 | Ga0111539_10040323 | 3300009094 | Bacteria | 5623 |
| 216 | Ga0111539_10103915 | 3300009094 | Bacteria | 3333 |
| 217 | Ga0111539_10307186 | 3300009094 | Bacteria | 1846 |
| 218 | Ga0111539_10414638 | 3300009094 | Bacteria | 1569 |
| 219 | Ga0111539_10458803 | 3300009094 | Bacteria | 1484 |
| 220 | Ga0111539_10644185 | 3300009094 | Bacteria | 1234 |
| 221 | Ga0105245_10475455 | 3300009098 | Bacteria | 1262 |
| 222 | Ga0105247_10000949 | 3300009101 | Bacteria | 21875 |
| 223 | Ga0105247_10005372 | 3300009101 | Bacteria | 8074 |
| 224 | Ga0105247_10025190 | 3300009101 | Bacteria | 3589 |
| 225 | Ga0114129_10014638 | 3300009147 | Bacteria | 11176 |
| 226 | Ga0114129_10053142 | 3300009147 | Bacteria | 5682 |
| 227 | Ga0114129_10189296 | 3300009147 | Bacteria | 2795 |
| 228 | Ga0105243_10003755 | 3300009148 | Bacteria | 12171 |
| 229 | Ga0105243_10030666 | 3300009148 | Bacteria | 4142 |
| 230 | Ga0105243_10598668 | 3300009148 | Bacteria | 1061 |
| 231 | Ga0105241_10000973 | 3300009174 | Bacteria | 21702 |
| 232 | Ga0105241_10011564 | 3300009174 | Bacteria | 6472 |
| 233 | Ga0105241_10176527 | 3300009174 | Bacteria | 1769 |
| 234 | Ga0105242_10000217 | 3300009176 | Bacteria | 45033 |
| 235 | Ga0105242_10022142 | 3300009176 | Bacteria | 4993 |
| 236 | Ga0105248_10000487 | 3300009177 | Bacteria | 45265 |
| 237 | Ga0105248_10082500 | 3300009177 | Bacteria | 3615 |
| 238 | Ga0105237_10000638 | 3300009545 | Bacteria | 48948 |
| 239 | Ga0105237_10008094 | 3300009545 | Bacteria | 11423 |
| 240 | Ga0105237_10056562 | 3300009545 | Bacteria | 3926 |
| 241 | Ga0105237_10251446 | 3300009545 | Bacteria | 1769 |
| 242 | Ga0105238_10006899 | 3300009551 | Bacteria | 11340 |
| 243 | Ga0105238_10009653 | 3300009551 | Bacteria | 9659 |
| 244 | Ga0105238_10020723 | 3300009551 | Bacteria | 6696 |
| 245 | Ga0105238_10168921 | 3300009551 | Bacteria | 2163 |
| 246 | Ga0105249_10001683 | 3300009553 | Bacteria | 19395 |
| 247 | Ga0105249_10025863 | 3300009553 | Bacteria | 5287 |
| 248 | Ga0105249_10137950 | 3300009553 | Bacteria | 2336 |
| 249 | Ga0105249_10144660 | 3300009553 | Bacteria | 2283 |
| 250 | Ga0105249_10262130 | 3300009553 | Bacteria | 1718 |
| 251 | Ga0099796_10037228 | 3300010159 | Bacteria | 1625 |
| 252 | Ga0105239_10000221 | 3300010375 | Bacteria | 83919 |
| 253 | Ga0105239_10539533 | 3300010375 | Bacteria | 1328 |
| 254 | Ga0105246_10002121 | 3300011119 | Bacteria | 11963 |
| 255 | Ga0105246_10140328 | 3300011119 | Bacteria | 1816 |
| 256 | Ga0105246_10262350 | 3300011119 | Bacteria | 1377 |
| 257 | Ga0157373_10007104 | 3300013100 | Bacteria | 8348 |
| 258 | Ga0157373_10018963 | 3300013100 | Bacteria | 5008 |
| 259 | Ga0157373_10026360 | 3300013100 | Bacteria | 4198 |
| 260 | Ga0157371_10012149 | 3300013102 | Bacteria | 6596 |
| 261 | Ga0157370_10003943 | 3300013104 | Bacteria | 17267 |
| 262 | Ga0157370_10085148 | 3300013104 | Bacteria | 2969 |
| 263 | Ga0157369_10001385 | 3300013105 | Bacteria | 29863 |
| 264 | Ga0157369_10003800 | 3300013105 | Bacteria | 17944 |
| 265 | Ga0157369_10013165 | 3300013105 | Bacteria | 9360 |
| 266 | Ga0157369_10107813 | 3300013105 | Bacteria | 2963 |
| 267 | Ga0157374_10006058 | 3300013296 | Bacteria | 10235 |
| 268 | Ga0157374_10391275 | 3300013296 | Bacteria | 1386 |
| 269 | Ga0157378_10001965 | 3300013297 | Bacteria | 18425 |
| 270 | Ga0157378_10182150 | 3300013297 | Bacteria | 1977 |
| 271 | Ga0163162_10000935 | 3300013306 | Bacteria | 27140 |
| 272 | Ga0157372_10002028 | 3300013307 | Bacteria | 22018 |
| 273 | Ga0157372_10022136 | 3300013307 | Bacteria | 6876 |
| 274 | Ga0157372_10027275 | 3300013307 | Bacteria | 6218 |
| 275 | Ga0157372_10042356 | 3300013307 | Bacteria | 5036 |
| 276 | Ga0157372_10094572 | 3300013307 | Bacteria | 3403 |
| 277 | Ga0157372_10208828 | 3300013307 | Bacteria | 2262 |
| 278 | Ga0157372_10363157 | 3300013307 | Bacteria | 1687 |
| 279 | Ga0157375_10002243 | 3300013308 | Bacteria | 16710 |
| 280 | Ga0163163_10005752 | 3300014325 | Bacteria | 10764 |
| 281 | Ga0163163_10178962 | 3300014325 | Bacteria | 2168 |
| 282 | Ga0163163_10185462 | 3300014325 | Bacteria | 2128 |
| 283 | Ga0163163_10230666 | 3300014325 | Bacteria | 1900 |
| 284 | Ga0163163_10384228 | 3300014325 | Unclassified | 1461 |
| 285 | Ga0157380_10245387 | 3300014326 | Bacteria | 1617 |
| 286 | Ga0157380_10448235 | 3300014326 | Bacteria | 1239 |
| 287 | Ga0157377_10012188 | 3300014745 | Bacteria | 4316 |
| 288 | Ga0157379_10003497 | 3300014968 | Bacteria | 13312 |
| 289 | Ga0157379_10006441 | 3300014968 | Bacteria | 10116 |
| 290 | Ga0157379_10038374 | 3300014968 | Bacteria | 4275 |
| 291 | Ga0157379_10065537 | 3300014968 | Bacteria | 3247 |
| 292 | Ga0157379_10083969 | 3300014968 | Bacteria | 2854 |
| 293 | Ga0157379_10096430 | 3300014968 | Bacteria | 2654 |
| 294 | Ga0157379_10181307 | 3300014968 | Bacteria | 1902 |
| 295 | Ga0157379_10354966 | 3300014968 | Bacteria | 1343 |
| 296 | Ga0157376_10001063 | 3300014969 | Bacteria | 17989 |
| 297 | Ga0183361_10006 | 3300016635 | Bacteria | 368532 |
| 298 | Ga0163161_10007187 | 3300017792 | Bacteria | 7695 |
| 299 | Ga0163161_10159133 | 3300017792 | Bacteria | 1721 |
| 300 | Ga0213873_10000953 | 3300021358 | Bacteria | 4685 |
| 301 | Ga0213872_10002733 | 3300021361 | Bacteria | 10128 |
| 302 | Ga0213872_10051545 | 3300021361 | Bacteria | 1868 |
| 303 | Ga0213874_10006983 | 3300021377 | Bacteria | 2693 |
| 304 | Ga0213874_10008240 | 3300021377 | Bacteria | 2535 |
| 305 | Ga0213874_10018298 | 3300021377 | Bacteria | 1891 |
| 306 | Ga0213876_10000115 | 3300021384 | Bacteria | 87113 |
| 307 | Ga0213876_10000409 | 3300021384 | Bacteria | 36093 |
| 308 | Ga0213876_10004022 | 3300021384 | Bacteria | 8269 |
| 309 | Ga0213876_10052455 | 3300021384 | Bacteria | 2156 |
| 310 | Ga0213876_10082908 | 3300021384 | Bacteria | 1696 |
| 311 | Ga0213876_10099082 | 3300021384 | Bacteria | 1545 |
| 312 | Ga0213876_10214187 | 3300021384 | Bacteria | 1024 |
| 313 | Ga0213875_10000074 | 3300021388 | Bacteria | 118349 |
| 314 | Ga0213875_10000205 | 3300021388 | Bacteria | 60682 |
| 315 | Ga0213875_10006582 | 3300021388 | Bacteria | 6079 |
| 316 | Ga0213875_10120815 | 3300021388 | Bacteria | 1224 |
| 317 | Ga0209147_101859 | 3300025229 | Bacteria | 6456 |
| 318 | Ga0209147_103316 | 3300025229 | Bacteria | 3208 |
| 319 | Ga0207697_10021964 | 3300025315 | Bacteria | 2614 |
| 320 | Ga0207682_10006656 | 3300025893 | Bacteria | 4644 |
| 321 | Ga0207692_10006876 | 3300025898 | Bacteria | 4633 |
| 322 | Ga0207642_10017008 | 3300025899 | Unclassified | 2755 |
| 323 | Ga0207710_10002675 | 3300025900 | Bacteria | 8183 |
| 324 | Ga0207688_10000431 | 3300025901 | Bacteria | 19793 |
| 325 | Ga0207680_10003350 | 3300025903 | Bacteria | 7550 |
| 326 | Ga0207680_10018948 | 3300025903 | Bacteria | 3672 |
| 327 | Ga0207647_10057873 | 3300025904 | Bacteria | 2375 |
| 328 | Ga0207647_10087908 | 3300025904 | Bacteria | 1856 |
| 329 | Ga0207685_10000775 | 3300025905 | Bacteria | 5865 |
| 330 | Ga0207699_10000096 | 3300025906 | Bacteria | 63442 |
| 331 | Ga0207699_10002089 | 3300025906 | Bacteria | 9436 |
| 332 | Ga0207699_10020473 | 3300025906 | Bacteria | 3547 |
| 333 | Ga0207699_10108246 | 3300025906 | Bacteria | 1777 |
| 334 | Ga0207645_10009143 | 3300025907 | Bacteria | 6871 |
| 335 | Ga0207643_10064544 | 3300025908 | Bacteria | 2095 |
| 336 | Ga0207705_10088398 | 3300025909 | Unclassified | 2267 |
| 337 | Ga0207684_10127359 | 3300025910 | Bacteria | 2185 |
| 338 | Ga0207654_10002198 | 3300025911 | Bacteria | 9990 |
| 339 | Ga0207654_10017452 | 3300025911 | Bacteria | 3752 |
| 340 | Ga0207654_10268231 | 3300025911 | Bacteria | 1150 |
| 341 | Ga0207707_10012865 | 3300025912 | Bacteria | 7282 |
| 342 | Ga0207707_10097771 | 3300025912 | Unclassified | 2566 |
| 343 | Ga0207707_10270699 | 3300025912 | Bacteria | 1472 |
| 344 | Ga0207695_10052409 | 3300025913 | Bacteria | 4275 |
| 345 | Ga0207695_10494159 | 3300025913 | Bacteria | 1106 |
| 346 | Ga0207671_10004388 | 3300025914 | Bacteria | 13522 |
| 347 | Ga0207671_10009191 | 3300025914 | Bacteria | 8290 |
| 348 | Ga0207693_10000094 | 3300025915 | Bacteria | 79297 |
| 349 | Ga0207693_10000278 | 3300025915 | Bacteria | 47482 |
| 350 | Ga0207693_10000372 | 3300025915 | Bacteria | 41220 |
| 351 | Ga0207663_10000927 | 3300025916 | Bacteria | 13405 |
| 352 | Ga0207663_10017715 | 3300025916 | Bacteria | 3977 |
| 353 | Ga0207663_10031792 | 3300025916 | Bacteria | 3127 |
| 354 | Ga0207660_10033667 | 3300025917 | Bacteria | 3547 |
| 355 | Ga0207660_10199477 | 3300025917 | Bacteria | 1562 |
| 356 | Ga0207662_10002352 | 3300025918 | Bacteria | 9475 |
| 357 | Ga0207662_10102469 | 3300025918 | Bacteria | 1775 |
| 358 | Ga0207662_10155932 | 3300025918 | Bacteria | 1455 |
| 359 | Ga0207657_10000047 | 3300025919 | Bacteria | 111686 |
| 360 | Ga0207657_10328816 | 3300025919 | Bacteria | 1207 |
| 361 | Ga0207649_10000112 | 3300025920 | Bacteria | 68472 |
| 362 | Ga0207649_10001651 | 3300025920 | Bacteria | 12925 |
| 363 | Ga0207649_10007415 | 3300025920 | Bacteria | 5965 |
| 364 | Ga0207652_10024920 | 3300025921 | Bacteria | 4967 |
| 365 | Ga0207652_10064848 | 3300025921 | Bacteria | 3161 |
| 366 | Ga0207652_10089883 | 3300025921 | Bacteria | 2697 |
| 367 | Ga0207681_10019291 | 3300025923 | Bacteria | 4307 |
| 368 | Ga0207681_10154716 | 3300025923 | Bacteria | 1722 |
| 369 | Ga0207694_10009551 | 3300025924 | Bacteria | 7317 |
| 370 | Ga0207694_10039783 | 3300025924 | Bacteria | 3619 |
| 371 | Ga0207694_10085251 | 3300025924 | Bacteria | 2486 |
| 372 | Ga0207650_10015241 | 3300025925 | Bacteria | 5350 |
| 373 | Ga0207659_10004845 | 3300025926 | Bacteria | 8154 |
| 374 | Ga0207659_10176394 | 3300025926 | Bacteria | 1690 |
| 375 | Ga0207687_10022268 | 3300025927 | Bacteria | 4215 |
| 376 | Ga0207700_10000015 | 3300025928 | Bacteria | 224772 |
| 377 | Ga0207700_10024152 | 3300025928 | Bacteria | 4203 |
| 378 | Ga0207664_10002197 | 3300025929 | Bacteria | 12849 |
| 379 | Ga0207664_10028677 | 3300025929 | Bacteria | 4233 |
| 380 | Ga0207644_10010820 | 3300025931 | Bacteria | 6022 |
| 381 | Ga0207690_10001227 | 3300025932 | Bacteria | 16187 |
| 382 | Ga0207706_10000079 | 3300025933 | Bacteria | 100592 |
| 383 | Ga0207706_10583701 | 3300025933 | Unclassified | 961 |
| 384 | Ga0207686_10008938 | 3300025934 | Bacteria | 5420 |
| 385 | Ga0207686_10052075 | 3300025934 | Bacteria | 2553 |
| 386 | Ga0207686_10315874 | 3300025934 | Bacteria | 1165 |
| 387 | Ga0207709_10004350 | 3300025935 | Bacteria | 8199 |
| 388 | Ga0207709_10306837 | 3300025935 | Bacteria | 1182 |
| 389 | Ga0207670_10001314 | 3300025936 | Bacteria | 13111 |
| 390 | Ga0207669_10025717 | 3300025937 | Unclassified | 3187 |
| 391 | Ga0207669_10152994 | 3300025937 | Bacteria | 1618 |
| 392 | Ga0207669_10271535 | 3300025937 | Unclassified | 1274 |
| 393 | Ga0207704_10389730 | 3300025938 | Unclassified | 1096 |
| 394 | Ga0207665_10000432 | 3300025939 | Bacteria | 28864 |
| 395 | Ga0207665_10115385 | 3300025939 | Bacteria | 1892 |
| 396 | Ga0207691_10007351 | 3300025940 | Bacteria | 10620 |
| 397 | Ga0207691_10037600 | 3300025940 | Bacteria | 4482 |
| 398 | Ga0207691_10216569 | 3300025940 | Bacteria | 1662 |
| 399 | Ga0207711_10022514 | 3300025941 | Bacteria | 5270 |
| 400 | Ga0207711_10027232 | 3300025941 | Bacteria | 4801 |
| 401 | Ga0207661_10027569 | 3300025944 | Bacteria | 4340 |
| 402 | Ga0207661_10588122 | 3300025944 | Bacteria | 1021 |
| 403 | Ga0207679_10001961 | 3300025945 | Bacteria | 12762 |
| 404 | Ga0207679_10519231 | 3300025945 | Bacteria | 1065 |
| 405 | Ga0207667_10009433 | 3300025949 | Bacteria | 11495 |
| 406 | Ga0207667_10055598 | 3300025949 | Bacteria | 4160 |
| 407 | Ga0207651_10003659 | 3300025960 | Bacteria | 7586 |
| 408 | Ga0207712_10004439 | 3300025961 | Bacteria | 8861 |
| 409 | Ga0207712_10088983 | 3300025961 | Bacteria | 2269 |
| 410 | Ga0207668_10004917 | 3300025972 | Bacteria | 7860 |
| 411 | Ga0207640_10008947 | 3300025981 | Bacteria | 5580 |
| 412 | Ga0207640_10048623 | 3300025981 | Bacteria | 2743 |
| 413 | Ga0207640_10189216 | 3300025981 | Unclassified | 1550 |
| 414 | Ga0207658_10004453 | 3300025986 | Bacteria | 9739 |
| 415 | Ga0207658_10034047 | 3300025986 | Bacteria | 3638 |
| 416 | Ga0207658_10117160 | 3300025986 | Unclassified | 2117 |
| 417 | Ga0207658_10185552 | 3300025986 | Bacteria | 1725 |
| 418 | Ga0207658_10709209 | 3300025986 | Bacteria | 910 |
| 419 | Ga0207703_10013192 | 3300026035 | Bacteria | 6436 |
| 420 | Ga0207703_10015168 | 3300026035 | Bacteria | 6014 |
| 421 | Ga0207703_10021441 | 3300026035 | Bacteria | 5058 |
| 422 | Ga0207703_10083120 | 3300026035 | Bacteria | 2674 |
| 423 | Ga0207703_10412947 | 3300026035 | Bacteria | 1255 |
| 424 | Ga0207639_10006696 | 3300026041 | Bacteria | 7837 |
| 425 | Ga0207639_10036256 | 3300026041 | Bacteria | 3653 |
| 426 | Ga0207639_10240214 | 3300026041 | Bacteria | 1574 |
| 427 | Ga0207678_10000111 | 3300026067 | Bacteria | 67188 |
| 428 | Ga0207678_10071670 | 3300026067 | Bacteria | 2971 |
| 429 | Ga0207708_10004157 | 3300026075 | Bacteria | 10648 |
| 430 | Ga0207702_10000011 | 3300026078 | Bacteria | 284514 |
| 431 | Ga0207702_10000465 | 3300026078 | Bacteria | 45960 |
| 432 | Ga0207702_10004141 | 3300026078 | Bacteria | 12999 |
| 433 | Ga0207702_10316289 | 3300026078 | Bacteria | 1486 |
| 434 | Ga0207641_10008713 | 3300026088 | Bacteria | 8379 |
| 435 | Ga0207641_10261841 | 3300026088 | Bacteria | 1620 |
| 436 | Ga0207648_10015812 | 3300026089 | Bacteria | 6918 |
| 437 | Ga0207648_10024949 | 3300026089 | Bacteria | 5329 |
| 438 | Ga0207648_10043435 | 3300026089 | Bacteria | 3946 |
| 439 | Ga0207676_10005911 | 3300026095 | Bacteria | 8645 |
| 440 | Ga0207676_10045063 | 3300026095 | Bacteria | 3406 |
| 441 | Ga0207676_10069316 | 3300026095 | Bacteria | 2823 |
| 442 | Ga0207674_10000002 | 3300026116 | Bacteria | 279738 |
| 443 | Ga0207674_10054075 | 3300026116 | Bacteria | 4089 |
| 444 | Ga0207674_10060194 | 3300026116 | Bacteria | 3841 |
| 445 | Ga0207674_10063465 | 3300026116 | Bacteria | 3729 |
| 446 | Ga0207675_100000424 | 3300026118 | Bacteria | 40885 |
| 447 | Ga0207675_100209857 | 3300026118 | Bacteria | 1873 |
| 448 | Ga0207675_100685424 | 3300026118 | Unclassified | 1033 |
| 449 | Ga0207683_10000026 | 3300026121 | Bacteria | 111890 |
| 450 | Ga0207683_10025989 | 3300026121 | Bacteria | 5055 |
| 451 | Ga0207683_10170094 | 3300026121 | Bacteria | 1973 |
| 452 | Ga0207698_10016682 | 3300026142 | Bacteria | 4961 |
| 453 | Ga0207698_10035270 | 3300026142 | Bacteria | 3657 |
| 454 | Ga0209998_10003426 | 3300027717 | Bacteria | 3469 |
| 455 | Ga0207428_10077375 | 3300027907 | Bacteria | 2604 |
| 456 | Ga0268266_10008327 | 3300028379 | Bacteria | 9233 |
| 457 | Ga0268266_10009369 | 3300028379 | Bacteria | 8630 |
| 458 | Ga0268265_10008336 | 3300028380 | Bacteria | 6999 |
| 459 | Ga0268265_10081927 | 3300028380 | Bacteria | 2550 |
| 460 | Ga0265334_10004071 | 3300028573 | Bacteria | 6560 |
| 461 | Ga0265318_10029776 | 3300028577 | Bacteria | 2127 |
| 462 | Ga0265338_10000378 | 3300028800 | Bacteria | 79834 |
| 463 | Ga0265338_10010745 | 3300028800 | Bacteria | 10684 |
| 464 | Ga0265338_10034019 | 3300028800 | Bacteria | 4936 |
| 465 | Ga0265338_10139074 | 3300028800 | Bacteria | 1904 |
| 466 | Ga0265332_10026240 | 3300031238 | Bacteria | 2555 |
| 467 | Ga0265332_10132127 | 3300031238 | Bacteria | 1047 |
| 468 | Ga0265320_10001320 | 3300031240 | Bacteria | 18140 |
| 469 | Ga0265320_10082411 | 3300031240 | Bacteria | 1500 |
| 470 | Ga0265320_10100703 | 3300031240 | Bacteria | 1331 |
| 471 | Ga0265320_10175548 | 3300031240 | Bacteria | 961 |
| 472 | Ga0265325_10000003 | 3300031241 | Bacteria | 370490 |
| 473 | Ga0265325_10001297 | 3300031241 | Bacteria | 17699 |
| 474 | Ga0265325_10099231 | 3300031241 | Bacteria | 1427 |
| 475 | Ga0265325_10118973 | 3300031241 | Bacteria | 1275 |
| 476 | Ga0265325_10166224 | 3300031241 | Bacteria | 1035 |
| 477 | Ga0265340_10011212 | 3300031247 | Bacteria | 4773 |
| 478 | Ga0265340_10024605 | 3300031247 | Bacteria | 3056 |
| 479 | Ga0265340_10041626 | 3300031247 | Bacteria | 2257 |
| 480 | Ga0265340_10050965 | 3300031247 | Bacteria | 2006 |
| 481 | Ga0265340_10148477 | 3300031247 | Bacteria | 1069 |
| 482 | Ga0265339_10001140 | 3300031249 | Bacteria | 20068 |
| 483 | Ga0265339_10036206 | 3300031249 | Bacteria | 2764 |
| 484 | Ga0265331_10000003 | 3300031250 | Bacteria | 499358 |
| 485 | Ga0265331_10000699 | 3300031250 | Bacteria | 28634 |
| 486 | Ga0265331_10006363 | 3300031250 | Bacteria | 6990 |
| 487 | Ga0265331_10028837 | 3300031250 | Bacteria | 2774 |
| 488 | Ga0265327_10000150 | 3300031251 | Bacteria | 150039 |
| 489 | Ga0265316_10018544 | 3300031344 | Bacteria | 5976 |
| 490 | Ga0265316_10035465 | 3300031344 | Bacteria | 4043 |
| 491 | Ga0265316_10105874 | 3300031344 | Bacteria | 2134 |
| 492 | Ga0265316_10150075 | 3300031344 | Bacteria | 1746 |
| 493 | Ga0265316_10160787 | 3300031344 | Bacteria | 1679 |
| 494 | Ga0265316_10171365 | 3300031344 | Bacteria | 1619 |
| 495 | Ga0265316_10329324 | 3300031344 | Bacteria | 1108 |
| 496 | Ga0307513_10241655 | 3300031456 | Bacteria | 1610 |
| 497 | Ga0307513_10279912 | 3300031456 | Bacteria | 1446 |
| 498 | Ga0265313_10001099 | 3300031595 | Bacteria | 25965 |
| 499 | Ga0265313_10002518 | 3300031595 | Bacteria | 15753 |
| 500 | Ga0265313_10030601 | 3300031595 | Bacteria | 2769 |
| 501 | Ga0265313_10167319 | 3300031595 | Bacteria | 931 |
| 502 | Ga0316575_10024405 | 3300031665 | Bacteria | 2341 |
| 503 | Ga0265314_10006918 | 3300031711 | Bacteria | 9933 |
| 504 | Ga0265314_10009671 | 3300031711 | Bacteria | 8117 |
| 505 | Ga0265314_10023184 | 3300031711 | Bacteria | 4739 |
| 506 | Ga0265314_10085876 | 3300031711 | Bacteria | 2062 |
| 507 | Ga0265314_10108482 | 3300031711 | Unclassified | 1769 |
| 508 | Ga0265314_10145783 | 3300031711 | Bacteria | 1458 |
| 509 | Ga0265314_10215336 | 3300031711 | Unclassified | 1125 |
| 510 | Ga0265314_10217066 | 3300031711 | Bacteria | 1119 |
| 511 | Ga0265314_10260755 | 3300031711 | Bacteria | 990 |
| 512 | Ga0265342_10009892 | 3300031712 | Bacteria | 6670 |
| 513 | Ga0265342_10025719 | 3300031712 | Bacteria | 3695 |
| 514 | Ga0265342_10069700 | 3300031712 | Bacteria | 2053 |
| 515 | Ga0265342_10111875 | 3300031712 | Bacteria | 1545 |
| 516 | Ga0316578_10016633 | 3300031728 | Bacteria | 3985 |
| 517 | Ga0307416_100627194 | 3300032002 | Bacteria | 1158 |
| 518 | Ga0307415_100365661 | 3300032126 | Bacteria | 1220 |
| 519 | Ga0373929_0018745 | 3300035085 | Unclassified | 1378 |
| 520 | Ga0373940_0027937 | 3300035088 | Unclassified | 1486 |
| 521 | Ga0373944_0082042 | 3300035089 | Bacteria | 1066 |
| 522 | Ga0373949_0010516 | 3300035090 | Unclassified | 2029 |
| 523 | Ga0373932_0026197 | 3300035112 | Unclassified | 1585 |
| 524 | Ga0373941_0010659 | 3300035115 | Bacteria | 2355 |
| 525 | Ga0373941_0036236 | 3300035115 | Bacteria | 1499 |
| 526 | Ga0373960_0001193 | 3300035121 | Bacteria | 5678 |
| 527 | Ga0373943_0010429 | 3300035170 | Bacteria | 4162 |
| 528 | Ga0373943_0014259 | 3300035170 | Bacteria | 3596 |
| 529 | Ga0373943_0089402 | 3300035170 | Bacteria | 1593 |
| 530 | Ga0373946_0012816 | 3300035171 | Bacteria | 3144 |
| 531 | Ga0373955_0068871 | 3300035172 | Bacteria | 1973 |
| 532 | Ga0373955_0206275 | 3300035172 | Bacteria | 1171 |
| 533 | Ga0373962_0004899 | 3300035242 | Bacteria | 3237 |
| 534 | Ga0316574_0004127 | 3300035398 | Bacteria | 7561 |
| 535 | Ga0373931_0013273 | 3300035691 | Bacteria | 4009 |
| 536 | Ga0373931_0068865 | 3300035691 | Bacteria | 1927 |
| 537 | Ga0373935_0107237 | 3300035692 | Bacteria | 1849 |
| 538 | Ga0373927_0053502 | 3300035695 | Bacteria | 2612 |
| 539 | Ga0373927_0152571 | 3300035695 | Bacteria | 1513 |
| 540 | Ga0373933_0007105 | 3300035724 | Bacteria | 6096 |
| 541 | Ga0373937_0004901 | 3300036401 | Bacteria | 11380 |
| 542 | Ga0373937_0095808 | 3300036401 | Bacteria | 2752 |
| 543 | Ga0373937_0136411 | 3300036401 | Bacteria | 2294 |
| 544 | Ga0373937_0218762 | 3300036401 | Bacteria | 1793 |
| 545 | Ga0373937_0269393 | 3300036401 | Bacteria | 1607 |
| 546 | Ga0373937_0584210 | 3300036401 | Bacteria | 1061 |
| 547 | Ga0316582_0015435 | 3300036647 | Bacteria | 4369 |
| 548 | Ga0316584_0038854 | 3300036712 | Bacteria | 3541 |
| 549 | Ga0373925_0002314 | 3300037068 | Bacteria | 15327 |
| 550 | Ga0373925_0079599 | 3300037068 | Bacteria | 2490 |
| 551 | Ga0395900_0000066 | 3300037418 | Bacteria | 194825 |
| 552 | Ga0395898_0000225 | 3300037466 | Bacteria | 144962 |
| 553 | Ga0436364_0056243 | 3300037853 | Bacteria | 52545 |
| 554 | Ga0436364_0090740 | 3300037853 | Bacteria | 19290 |
| 555 | Ga0436364_0111944 | 3300037853 | Bacteria | 3844 |
| 556 | Ga0436364_0334510 | 3300037853 | Bacteria | 15151 |
| 557 | Ga0436364_1001667 | 3300037853 | Bacteria | 2454 |
| 558 | Ga0395901_0163693 | 3300038443 | Bacteria | 2336 |
| 559 | Ga0436365_0503854 | 3300039437 | Bacteria | 5430 |
| 560 | Ga0436365_0507621 | 3300039437 | Bacteria | 122643 |
| 561 | Ga0436365_0747668 | 3300039437 | Bacteria | 5486 |
| 562 | Ga0436365_0834196 | 3300039437 | Bacteria | 8304 |
| 563 | Ga0436365_1039466 | 3300039437 | Bacteria | 1084 |
| 564 | Ga0436365_1105030 | 3300039437 | Bacteria | 1531 |
| 565 | Ga0436365_1222514 | 3300039437 | Bacteria | 1683 |
| 566 | Ga0436365_1234622 | 3300039437 | Bacteria | 117941 |
| 567 | Ga0436365_1364317 | 3300039437 | Bacteria | 7467 |
| 568 | Ga0436365_1456072 | 3300039437 | Bacteria | 1824 |
| 569 | Ga0436365_1837679 | 3300039437 | Bacteria | 2173 |
| 570 | Ga0436365_1846878 | 3300039437 | Bacteria | 3242 |
| 571 | Ga0436360_0339219 | 3300039438 | Bacteria | 1117 |
| 572 | Ga0436361_0288663 | 3300039447 | Bacteria | 28800 |
| 573 | Ga0436361_0495760 | 3300039447 | Bacteria | 2255 |
| 574 | Ga0436361_0686387 | 3300039447 | Bacteria | 1792 |
| 575 | Ga0436361_0692813 | 3300039447 | Bacteria | 11618 |
| 576 | Ga0436363_0605002 | 3300039450 | Bacteria | 1001 |
| 577 | Ga0436363_0930623 | 3300039450 | Bacteria | 5017 |
| 578 | Ga0436363_1243663 | 3300039450 | Bacteria | 2050 |
| 579 | Ga0436362_0144215 | 3300039453 | Bacteria | 8467 |
| 580 | Ga0436362_0250120 | 3300039453 | Bacteria | 1621 |
| 581 | Ga0439453_0000160 | 3300041408 | Bacteria | 6117 |
| 582 | Ga0439441_050560 | 3300042001 | Bacteria | 855 |
| 583 | Ga0439443_000672 | 3300042003 | Bacteria | 3269 |
| 584 | Ga0439449_0018538 | 3300042007 | Bacteria | 2612 |
| 585 | Ga0439449_0177297 | 3300042007 | Bacteria | 797 |
| 586 | Ga0439455_0034480 | 3300042012 | Bacteria | 1274 |
| 587 | Ga0439462_0008948 | 3300042015 | Bacteria | 2533 |
| 588 | Ga0439435_0000392 | 3300042436 | Bacteria | 6774 |
| 589 | Ga0451577_0015015 | 3300042876 | Bacteria | 7206 |
| 590 | Ga0466969_0000878 | 3300044656 | Bacteria | 16294 |
| 591 | Ga0466969_0008588 | 3300044656 | Bacteria | 5418 |
| 592 | Ga0466966_0056181 | 3300044684 | Bacteria | 2491 |
| 593 | Ga0466966_0149525 | 3300044684 | Bacteria | 1425 |
| 594 | Ga0466961_0014578 | 3300044693 | Bacteria | 5050 |
| 595 | Ga0466957_0438750 | 3300044842 | Bacteria | 898 |
| 596 | Ga0451576_0008894 | 3300045051 | Bacteria | 11715 |
| 597 | Ga0495603_0000133 | 3300046455 | Bacteria | 36636 |
| 598 | Ga0495629_0060445 | 3300046459 | Bacteria | 2648 |
| 599 | Ga0495638_0013717 | 3300046460 | Bacteria | 5506 |
| 600 | Ga0495638_0020278 | 3300046460 | Bacteria | 4392 |
| 601 | Ga0495641_0032986 | 3300046461 | Bacteria | 2461 |
| 602 | Ga0495580_0000173 | 3300046472 | Bacteria | 47996 |
| 603 | Ga0495580_0015567 | 3300046472 | Bacteria | 5732 |
| 604 | Ga0495580_0044066 | 3300046472 | Bacteria | 3174 |
| 605 | Ga0495582_0000518 | 3300046473 | Bacteria | 21209 |
| 606 | Ga0495582_0009505 | 3300046473 | Bacteria | 5357 |
| 607 | Ga0495639_0001342 | 3300046475 | Bacteria | 11041 |
| 608 | Ga0495639_0120754 | 3300046475 | Unclassified | 1250 |
| 609 | Ga0495662_0031180 | 3300046476 | Bacteria | 2575 |
| 610 | Ga0495662_0130977 | 3300046476 | Bacteria | 1233 |
| 611 | Ga0495664_0241033 | 3300046477 | Bacteria | 1094 |
| 612 | Ga0495584_0018076 | 3300046491 | Bacteria | 3584 |
| 613 | Ga0495584_0058378 | 3300046491 | Bacteria | 1941 |
| 614 | Ga0495594_0000755 | 3300046499 | Bacteria | 16602 |
| 615 | Ga0495610_0000102 | 3300046512 | Bacteria | 98985 |
| 616 | Ga0495630_0080926 | 3300046517 | Bacteria | 2451 |
| 617 | Ga0495630_0640460 | 3300046517 | Unclassified | 814 |
| 618 | Ga0495632_0000013 | 3300046519 | Bacteria | 247879 |
| 619 | Ga0495632_0137310 | 3300046519 | Bacteria | 1136 |
| 620 | Ga0495637_0000229 | 3300046520 | Bacteria | 43471 |
| 621 | Ga0495637_0003875 | 3300046520 | Bacteria | 7853 |
| 622 | Ga0495643_0000010 | 3300046522 | Bacteria | 341431 |
| 623 | Ga0495644_0154709 | 3300046523 | Bacteria | 878 |
| 624 | Ga0495648_0005640 | 3300046524 | Bacteria | 10360 |
| 625 | Ga0495648_0135133 | 3300046524 | Bacteria | 1305 |
| 626 | Ga0495663_0000004 | 3300046525 | Bacteria | 355166 |
| 627 | Ga0495665_0009595 | 3300046531 | Bacteria | 5244 |
| 628 | Ga0495640_0072857 | 3300046533 | Bacteria | 2300 |
| 629 | Ga0495640_0113802 | 3300046533 | Bacteria | 1765 |
| 630 | Ga0495621_0003815 | 3300046539 | Bacteria | 4185 |
| 631 | Ga0495622_0024401 | 3300046557 | Bacteria | 2823 |
| 632 | Ga0495633_0000092 | 3300046558 | Bacteria | 121446 |
| 633 | Ga0495633_0002370 | 3300046558 | Bacteria | 13352 |
| 634 | Ga0495633_0009961 | 3300046558 | Bacteria | 5217 |
| 635 | Ga0495656_0041985 | 3300046615 | Bacteria | 1914 |
| 636 | Ga0495634_0005211 | 3300046642 | Bacteria | 10044 |
| 637 | Ga0495625_0010628 | 3300046660 | Bacteria | 7595 |
| 638 | Ga0495588_0001185 | 3300046674 | Bacteria | 11237 |
| 639 | Ga0495647_0001112 | 3300046681 | Bacteria | 8215 |
| 640 | Ga0495658_0000605 | 3300046683 | Bacteria | 19637 |
| 641 | Ga0495658_0000939 | 3300046683 | Bacteria | 15508 |
| 642 | Ga0495613_0087936 | 3300046689 | Bacteria | 2252 |
| 643 | Ga0495624_0109294 | 3300046690 | Bacteria | 1701 |
| 644 | Ga0495671_0000014 | 3300046692 | Bacteria | 341431 |
| 645 | Ga0495581_0004284 | 3300047315 | Bacteria | 8234 |
| 646 | Ga0495636_0045156 | 3300047318 | Bacteria | 1836 |
| 647 | Ga0495674_0082897 | 3300047319 | Bacteria | 2749 |
| 648 | Ga0495674_0320878 | 3300047319 | Bacteria | 1262 |
| 649 | Ga0495672_0061206 | 3300047320 | Bacteria | 2171 |
| 650 | Ga0495672_0115438 | 3300047320 | Bacteria | 1435 |
| 651 | Ga0495676_0022592 | 3300047321 | Bacteria | 5471 |
| 652 | Ga0495680_0238470 | 3300047322 | Bacteria | 1292 |
| 653 | Ga0495680_0297523 | 3300047322 | Bacteria | 1134 |
| 654 | Ga0495685_042723 | 3300047447 | Bacteria | 1547 |
| 655 | Ga0495685_078127 | 3300047447 | Bacteria | 1104 |
| 656 | Ga0495681_0000104 | 3300047470 | Bacteria | 74261 |
| 657 | Ga0495681_0001853 | 3300047470 | Bacteria | 15548 |
| 658 | Ga0495684_0326339 | 3300047471 | Bacteria | 1096 |
| 659 | Ga0495686_0014266 | 3300047472 | Bacteria | 5474 |
| 660 | Ga0495593_0000542 | 3300047673 | Bacteria | 21364 |
| 661 | Ga0495614_0032376 | 3300048089 | Bacteria | 2250 |
| 662 | Ga0495615_0004280 | 3300048090 | Bacteria | 2478 |
| 663 | Ga0496100_0005987 | 3300048903 | Bacteria | 6596 |
| 664 | Ga0496101_0003489 | 3300048904 | Bacteria | 9808 |
| 665 | Ga0496101_0195260 | 3300048904 | Bacteria | 1563 |
| 666 | Ga0496101_0224439 | 3300048904 | Bacteria | 1459 |
| 667 | Ga0496101_0488644 | 3300048904 | Unclassified | 972 |
| 668 | Ga0496102_0024330 | 3300048905 | Bacteria | 5383 |
| 669 | Ga0496102_0096628 | 3300048905 | Bacteria | 2739 |
| 670 | Ga0496102_0139782 | 3300048905 | Bacteria | 2270 |
| 671 | Ga0496102_0163209 | 3300048905 | Bacteria | 2096 |
| 672 | Ga0496103_0048675 | 3300048906 | Bacteria | 2620 |
| 673 | Ga0496104_0033474 | 3300048907 | Bacteria | 4787 |
| 674 | Ga0496105_0029366 | 3300048908 | Bacteria | 4500 |
| 675 | Ga0496105_0051384 | 3300048908 | Bacteria | 3406 |
| 676 | Ga0496106_0000023 | 3300048909 | Bacteria | 165457 |
| 677 | Ga0496106_0005954 | 3300048909 | Bacteria | 9005 |
| 678 | Ga0496106_0258245 | 3300048909 | Bacteria | 1394 |
| 679 | Ga0496106_0268266 | 3300048909 | Bacteria | 1366 |
| 680 | Ga0496107_0003242 | 3300048910 | Bacteria | 10826 |
| 681 | Ga0496107_0129153 | 3300048910 | Bacteria | 1865 |
| 682 | Ga0496107_0327157 | 3300048910 | Bacteria | 1140 |
| 683 | Ga0496108_0001293 | 3300048911 | Bacteria | 19659 |
| 684 | Ga0496108_0009953 | 3300048911 | Bacteria | 7708 |
| 685 | Ga0496108_0096466 | 3300048911 | Bacteria | 2519 |
| 686 | Ga0496108_0494415 | 3300048911 | Bacteria | 1068 |
| 687 | Ga0496109_0014922 | 3300048912 | Bacteria | 6762 |
| 688 | Ga0496109_0025936 | 3300048912 | Bacteria | 5223 |
| 689 | Ga0496109_0571873 | 3300048912 | Bacteria | 1065 |
| 690 | Ga0496109_0707682 | 3300048912 | Bacteria | 945 |
| 691 | Ga0496110_0007501 | 3300048913 | Bacteria | 8716 |
| 692 | Ga0496110_0148154 | 3300048913 | Bacteria | 2124 |
| 693 | Ga0496110_0205934 | 3300048913 | Bacteria | 1788 |
| 694 | Ga0496111_0007534 | 3300048914 | Bacteria | 7139 |
| 695 | Ga0496111_0139261 | 3300048914 | Bacteria | 1798 |
| 696 | Ga0496112_0005647 | 3300048915 | Bacteria | 10859 |
| 697 | Ga0496112_0049717 | 3300048915 | Bacteria | 4109 |
| 698 | Ga0496113_0004308 | 3300048916 | Bacteria | 8716 |
| 699 | Ga0496113_0317301 | 3300048916 | Bacteria | 1249 |
| 700 | Ga0496114_0008772 | 3300048917 | Bacteria | 8010 |
| 701 | Ga0496115_0030526 | 3300048918 | Bacteria | 4240 |
| 702 | Ga0496115_0483296 | 3300048918 | Bacteria | 997 |
| 703 | Ga0496116_0080861 | 3300048919 | Bacteria | 2017 |
| 704 | Ga0496119_0188909 | 3300048922 | Bacteria | 1075 |
| 705 | Ga0496120_0021622 | 3300048923 | Bacteria | 4063 |
| 706 | Ga0496121_0003339 | 3300048924 | Bacteria | 23035 |
| 707 | Ga0496121_0005179 | 3300048924 | Bacteria | 16904 |
| 708 | Ga0496122_0017867 | 3300048925 | Bacteria | 6592 |
| 709 | Ga0496122_0075458 | 3300048925 | Bacteria | 2378 |
| 710 | Ga0496123_0024445 | 3300048926 | Bacteria | 4591 |
| 711 | Ga0496123_0068760 | 3300048926 | Bacteria | 2228 |
| 712 | Ga0496123_0069603 | 3300048926 | Bacteria | 2208 |
| 713 | Ga0496123_0233305 | 3300048926 | Bacteria | 919 |
| 714 | Ga0496124_0000325 | 3300048927 | Bacteria | 88310 |
| 715 | Ga0496124_0014367 | 3300048927 | Bacteria | 7656 |
| 716 | Ga0496124_0018025 | 3300048927 | Bacteria | 6630 |
| 717 | Ga0496124_0268110 | 3300048927 | Bacteria | 1252 |
| 718 | Ga0496124_0301108 | 3300048927 | Bacteria | 1158 |
| 719 | Ga0496125_0027815 | 3300048928 | Bacteria | 5117 |
| 720 | Ga0496126_0000782 | 3300048929 | Bacteria | 57324 |
| 721 | Ga0496126_0001279 | 3300048929 | Bacteria | 40379 |
| 722 | Ga0496126_0254287 | 3300048929 | Bacteria | 1463 |
| 723 | Ga0495678_008677 | 3300049459 | Bacteria | 5106 |
| 724 | Ga0495682_0148234 | 3300049460 | Bacteria | 837 |
| 725 | Ga0501031_0136768 | 3300049568 | Bacteria | 1601 |
| 726 | Ga0501032_0112362 | 3300049569 | Bacteria | 1802 |
| 727 | Ga0501032_0147504 | 3300049569 | Bacteria | 1548 |
| 728 | Ga0501033_0026669 | 3300049570 | Bacteria | 4347 |
| 729 | Ga0501033_0186309 | 3300049570 | Bacteria | 1487 |
| 730 | Ga0501034_0055432 | 3300049571 | Bacteria | 3989 |
| 731 | Ga0501034_0068135 | 3300049571 | Bacteria | 3570 |
| 732 | Ga0501034_0078229 | 3300049571 | Bacteria | 3312 |
| 733 | Ga0501034_0397564 | 3300049571 | Bacteria | 1301 |
| 734 | Ga0501036_0017141 | 3300049572 | Bacteria | 6054 |
| 735 | Ga0501036_0097649 | 3300049572 | Bacteria | 2483 |
| 736 | Ga0501037_0054569 | 3300049573 | Bacteria | 2923 |
| 737 | Ga0501038_0044737 | 3300049574 | Bacteria | 3845 |
| 738 | Ga0501038_0106273 | 3300049574 | Bacteria | 2330 |
| 739 | Ga0501038_0228006 | 3300049574 | Bacteria | 1484 |
| 740 | Ga0501038_0560672 | 3300049574 | Bacteria | 868 |
| 741 | Ga0501039_0445032 | 3300049575 | Bacteria | 1017 |
| 742 | Ga0501039_0539221 | 3300049575 | Bacteria | 916 |
| 743 | Ga0501040_0000178 | 3300049576 | Bacteria | 36163 |
| 744 | Ga0501040_0021923 | 3300049576 | Bacteria | 4271 |
| 745 | Ga0501040_0207714 | 3300049576 | Bacteria | 1391 |
| 746 | Ga0501040_0340935 | 3300049576 | Bacteria | 1073 |
| 747 | Ga0501041_0008832 | 3300049577 | Bacteria | 5929 |
| 748 | Ga0501041_0101960 | 3300049577 | Bacteria | 1777 |
| 749 | Ga0501042_0010204 | 3300049578 | Bacteria | 6285 |
| 750 | Ga0501042_0020236 | 3300049578 | Bacteria | 4630 |
| 751 | Ga0501042_0041034 | 3300049578 | Bacteria | 3290 |
| 752 | Ga0501042_0055688 | 3300049578 | Bacteria | 2822 |
| 753 | Ga0501042_0178016 | 3300049578 | Bacteria | 1534 |
| 754 | Ga0501042_0445641 | 3300049578 | Bacteria | 939 |
| 755 | Ga0501043_0135711 | 3300049579 | Bacteria | 1927 |
| 756 | Ga0501043_0257779 | 3300049579 | Bacteria | 1342 |
| 757 | Ga0501043_0391976 | 3300049579 | Bacteria | 1050 |
| 758 | Ga0501046_0104840 | 3300049580 | Bacteria | 2166 |
| 759 | Ga0501046_0419166 | 3300049580 | Bacteria | 965 |
| 760 | Ga0501047_0009634 | 3300049581 | Bacteria | 9131 |
| 761 | Ga0501047_0012180 | 3300049581 | Bacteria | 8140 |
| 762 | Ga0501047_0100815 | 3300049581 | Bacteria | 2767 |
| 763 | Ga0501047_0202384 | 3300049581 | Bacteria | 1846 |
| 764 | Ga0501047_0317529 | 3300049581 | Bacteria | 1398 |
| 765 | Ga0501047_0676146 | 3300049581 | Bacteria | 850 |
| 766 | Ga0501048_0029946 | 3300049582 | Bacteria | 3943 |
| 767 | Ga0501048_0077188 | 3300049582 | Bacteria | 2351 |
| 768 | Ga0501048_0183665 | 3300049582 | Bacteria | 1483 |
| 769 | Ga0501048_0206170 | 3300049582 | Bacteria | 1394 |
| 770 | Ga0501067_0002177 | 3300049583 | Bacteria | 10804 |
| 771 | Ga0501067_0016101 | 3300049583 | Bacteria | 4135 |
| 772 | Ga0501067_0199945 | 3300049583 | Bacteria | 1113 |
| 773 | Ga0501068_0021442 | 3300049584 | Bacteria | 3773 |
| 774 | Ga0501068_0054780 | 3300049584 | Bacteria | 2416 |
| 775 | Ga0501069_0011138 | 3300049585 | Bacteria | 4772 |
| 776 | Ga0501069_0016812 | 3300049585 | Bacteria | 3930 |
| 777 | Ga0501069_0130828 | 3300049585 | Bacteria | 1437 |
| 778 | Ga0501070_0008192 | 3300049586 | Bacteria | 8838 |
| 779 | Ga0501070_0016381 | 3300049586 | Bacteria | 6226 |
| 780 | Ga0501070_0055650 | 3300049586 | Bacteria | 3279 |
| 781 | Ga0501070_0080501 | 3300049586 | Bacteria | 2695 |
| 782 | Ga0501070_0294523 | 3300049586 | Bacteria | 1323 |
| 783 | Ga0501070_0388996 | 3300049586 | Bacteria | 1129 |
| 784 | Ga0501070_0484876 | 3300049586 | Bacteria | 994 |
| 785 | Ga0501070_0509116 | 3300049586 | Unclassified | 967 |
| 786 | Ga0501071_0034708 | 3300049587 | Bacteria | 3591 |
| 787 | Ga0501072_0003589 | 3300049588 | Bacteria | 11679 |
| 788 | Ga0501072_0015972 | 3300049588 | Bacteria | 5756 |
| 789 | Ga0501072_0018775 | 3300049588 | Bacteria | 5333 |
| 790 | Ga0501072_0023859 | 3300049588 | Bacteria | 4752 |
| 791 | Ga0501072_0034700 | 3300049588 | Bacteria | 3953 |
| 792 | Ga0501072_0130881 | 3300049588 | Bacteria | 2000 |
| 793 | Ga0501073_0003777 | 3300049589 | Bacteria | 11381 |
| 794 | Ga0501073_0003871 | 3300049589 | Bacteria | 11242 |
| 795 | Ga0501073_0042263 | 3300049589 | Bacteria | 3218 |
| 796 | Ga0501074_0015640 | 3300049590 | Bacteria | 5515 |
| 797 | Ga0501074_0030037 | 3300049590 | Bacteria | 3938 |
| 798 | Ga0501074_0039299 | 3300049590 | Bacteria | 3427 |
| 799 | Ga0501074_0178821 | 3300049590 | Bacteria | 1514 |
| 800 | Ga0501075_0015402 | 3300049591 | Bacteria | 5487 |
| 801 | Ga0501075_0092992 | 3300049591 | Bacteria | 2289 |
| 802 | Ga0501075_0318449 | 3300049591 | Bacteria | 1185 |
| 803 | Ga0501075_0329907 | 3300049591 | Bacteria | 1163 |
| 804 | Ga0501076_0098197 | 3300049592 | Bacteria | 2359 |
| 805 | Ga0501076_0177522 | 3300049592 | Bacteria | 1736 |
| 806 | Ga0501076_0262445 | 3300049592 | Bacteria | 1414 |
| 807 | Ga0501077_0011334 | 3300049593 | Bacteria | 5567 |
| 808 | Ga0501079_0000409 | 3300049741 | Bacteria | 27753 |
| 809 | Ga0501079_0024305 | 3300049741 | Bacteria | 4648 |
| 810 | Ga0501080_0001925 | 3300049742 | Bacteria | 17909 |
| 811 | Ga0501080_0009893 | 3300049742 | Bacteria | 8711 |
| 812 | Ga0501080_0046132 | 3300049742 | Bacteria | 4059 |
| 813 | Ga0501080_0074874 | 3300049742 | Bacteria | 3149 |
| 814 | Ga0501080_0359287 | 3300049742 | Bacteria | 1314 |
| 815 | Ga0501081_0043403 | 3300049743 | Bacteria | 3084 |
| 816 | Ga0501081_0118542 | 3300049743 | Bacteria | 1883 |
| 817 | Ga0501081_0455839 | 3300049743 | Bacteria | 950 |
| 818 | Ga0501083_0042504 | 3300049744 | Bacteria | 3081 |
| 819 | Ga0501083_0072856 | 3300049744 | Bacteria | 2283 |
| 820 | Ga0501035_0004045 | 3300049822 | Bacteria | 13969 |
| 821 | Ga0501035_0229904 | 3300049822 | Bacteria | 1581 |
| 822 | Ga0501035_0260700 | 3300049822 | Bacteria | 1469 |
| 823 | Ga0501035_0481412 | 3300049822 | Bacteria | 1024 |
| 824 | Ga0501044_0026816 | 3300049823 | Bacteria | 6097 |
| 825 | Ga0501044_0276632 | 3300049823 | Bacteria | 1613 |
| 826 | Ga0501044_0327585 | 3300049823 | Bacteria | 1455 |
| 827 | Ga0501044_0680853 | 3300049823 | Bacteria | 915 |
| 828 | Ga0501044_0843494 | 3300049823 | Bacteria | 793 |
| 829 | Ga0501045_0028267 | 3300049824 | Bacteria | 4044 |
| 830 | Ga0501045_0153892 | 3300049824 | Bacteria | 1711 |
| 831 | Ga0501045_0375107 | 3300049824 | Bacteria | 1059 |
| 832 | nmdc:mga0k408_89680_c1 | 3300050493 | Bacteria | 1806 |
| 833 | nmdc:mga07m45_18214_c1 | 3300050496 | Bacteria | 3786 |
| 834 | nmdc:mga05p37_152636_c1 | 3300050507 | Bacteria | 2824 |
| 835 | nmdc:mga05p37_64725_c1 | 3300050507 | Bacteria | 4499 |
| 836 | nmdc:mga09592_1604_c1 | 3300050508 | Bacteria | 18237 |
| 837 | nmdc:mga06r32_22585_c1 | 3300050510 | Bacteria | 5817 |
| 838 | nmdc:mga06r32_385591_c1 | 3300050510 | Bacteria | 1384 |
| 839 | nmdc:mga06r32_47678_c1 | 3300050510 | Bacteria | 4093 |
| 840 | nmdc:mga06r32_70366_c1 | 3300050510 | Bacteria | 3383 |
| 841 | nmdc:mga08y16_1047436_c1 | 3300050511 | Bacteria | 793 |
| 842 | nmdc:mga08y16_179773_c1 | 3300050511 | Bacteria | 2196 |
| 843 | nmdc:mga08y16_221722_c1 | 3300050511 | Bacteria | 1957 |
| 844 | nmdc:mga08y16_35512_c1 | 3300050511 | Bacteria | 5234 |
| 845 | nmdc:mga08y16_66445_c1 | 3300050511 | Bacteria | 3763 |
| 846 | nmdc:mga08y16_7789_c1 | 3300050511 | Bacteria | 11219 |
| 847 | nmdc:mga08y16_85208_c1 | 3300050511 | Bacteria | 3293 |
| 848 | nmdc:mga0n895_184680_c1 | 3300050512 | Bacteria | 2116 |
| 849 | nmdc:mga0n895_576056_c1 | 3300050512 | Bacteria | 1130 |
| 850 | nmdc:mga0rr50_17410_c1 | 3300050513 | Bacteria | 4798 |
| 851 | nmdc:mga08x19_41_c1 | 3300050514 | Bacteria | 151756 |
| 852 | nmdc:mga0a205_106301_c1 | 3300050515 | Bacteria | 2704 |
| 853 | nmdc:mga0a205_562005_c1 | 3300050515 | Bacteria | 995 |
| 854 | Ga0495601_0038735 | 3300053077 | Bacteria | 2981 |
| 855 | Ga0495655_0006625 | 3300053083 | Bacteria | 2116 |
| 856 | Ga0495655_0019246 | 3300053083 | Bacteria | 1513 |
| 857 | Ga0495595_0005795 | 3300053084 | Bacteria | 5003 |
| 858 | Ga0500643_036151 | 3300053087 | Bacteria | 1476 |
| 859 | Ga0500593_075640 | 3300053117 | Bacteria | 1452 |
| 860 | Ga0500652_000367 | 3300053131 | Bacteria | 16232 |
| 861 | Ga0500604_0051425 | 3300053151 | Bacteria | 1272 |
| 862 | Ga0500616_0013871 | 3300053153 | Bacteria | 4652 |
| 863 | Ga0500622_0128587 | 3300053156 | Bacteria | 1220 |
| 864 | Ga0500624_000107 | 3300053157 | Bacteria | 39921 |
| 865 | Ga0500627_0084901 | 3300053158 | Bacteria | 1413 |
| 866 | Ga0501084_0001149 | 3300054114 | Bacteria | 20616 |
| 867 | Ga0501084_0016162 | 3300054114 | Bacteria | 6196 |
| 868 | Ga0501084_0033449 | 3300054114 | Bacteria | 4301 |
| 869 | Ga0501084_0059726 | 3300054114 | Bacteria | 3192 |
| 870 | Ga0501084_0066359 | 3300054114 | Bacteria | 3019 |
| 871 | Ga0501084_0166775 | 3300054114 | Bacteria | 1858 |
| 872 | Ga0501082_0021799 | 3300060353 | Bacteria | 5523 |
| 873 | Ga0501082_0085401 | 3300060353 | Bacteria | 2722 |
| 874 | Ga0501082_0093687 | 3300060353 | Bacteria | 2595 |
| 875 | Ga0501082_0120977 | 3300060353 | Bacteria | 2269 |
| 876 | Ga0501082_0165516 | 3300060353 | Bacteria | 1921 |
| 877 | Ga0530510_0086459 | 3300061734 | Bacteria | 2284 |
| 878 | Ga0530510_0089986 | 3300061734 | Bacteria | 2238 |
| 879 | Ga0530510_0350108 | 3300061734 | Bacteria | 1109 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025933 | Ga0207706_10583701 | Ga0207706_105837012 | 197 |
| 2 | 3300037418 | Ga0395900_0000066 | Ga0395900_0000066_121236_121925 | 211 |
| 3 | 3300037466 | Ga0395898_0000225 | Ga0395898_0000225_71373_72062 | 211 |
| 4 | 3300044842 | Ga0466957_0438750 | Ga0466957_0438750_26_694 | 218 |
| 5 | 3300005340 | Ga0070689_100151980 | Ga0070689_1001519801 | 224 |
| 6 | 3300005367 | Ga0070667_100169664 | Ga0070667_1001696642 | 224 |
| 7 | 3300005456 | Ga0070678_100104255 | Ga0070678_1001042552 | 224 |
| 8 | 3300005718 | Ga0068866_10079080 | Ga0068866_100790802 | 224 |
| 9 | 3300005719 | Ga0068861_100063454 | Ga0068861_1000634543 | 224 |
| 10 | 3300005841 | Ga0068863_100297872 | Ga0068863_1002978721 | 224 |
| 11 | 3300005842 | Ga0068858_100078766 | Ga0068858_1000787662 | 224 |
| 12 | 3300005843 | Ga0068860_100160721 | Ga0068860_1001607212 | 224 |
| 13 | 3300005844 | Ga0068862_100052142 | Ga0068862_1000521422 | 224 |
| 14 | 3300006237 | Ga0097621_100189565 | Ga0097621_1001895652 | 224 |
| 15 | 3300009148 | Ga0105243_10030666 | Ga0105243_100306662 | 224 |
| 16 | 3300009553 | Ga0105249_10262130 | Ga0105249_102621302 | 224 |
| 17 | 3300011119 | Ga0105246_10140328 | Ga0105246_101403282 | 224 |
| 18 | 3300013297 | Ga0157378_10182150 | Ga0157378_101821502 | 224 |
| 19 | 3300014325 | Ga0163163_10384228 | Ga0163163_103842282 | 224 |
| 20 | 3300017792 | Ga0163161_10007187 | Ga0163161_100071875 | 224 |
| 21 | 3300025937 | Ga0207669_10271535 | Ga0207669_102715352 | 224 |
| 22 | 3300025940 | Ga0207691_10216569 | Ga0207691_102165691 | 224 |
| 23 | 3300025981 | Ga0207640_10189216 | Ga0207640_101892162 | 224 |
| 24 | 3300025986 | Ga0207658_10117160 | Ga0207658_101171602 | 224 |
| 25 | 3300026035 | Ga0207703_10083120 | Ga0207703_100831202 | 224 |
| 26 | 3300026067 | Ga0207678_10071670 | Ga0207678_100716702 | 224 |
| 27 | 3300026088 | Ga0207641_10261841 | Ga0207641_102618412 | 224 |
| 28 | 3300026089 | Ga0207648_10043435 | Ga0207648_100434354 | 224 |
| 29 | 3300026118 | Ga0207675_100685424 | Ga0207675_1006854242 | 224 |
| 30 | 3300026121 | Ga0207683_10170094 | Ga0207683_101700942 | 224 |
| 31 | 3300028380 | Ga0268265_10081927 | Ga0268265_100819273 | 224 |
| 32 | 3300048904 | Ga0496101_0488644 | Ga0496101_0488644_110_889 | 224 |
| 33 | 3300039437 | Ga0436365_1837679 | Ga0436365_1837679_630_1406 | 229 |
| 34 | 3300005546 | Ga0070696_100318465 | Ga0070696_1003184652 | 230 |
| 35 | 3300009176 | Ga0105242_10022142 | Ga0105242_100221422 | 230 |
| 36 | 3300014325 | Ga0163163_10178962 | Ga0163163_101789622 | 230 |
| 37 | 3300014968 | Ga0157379_10354966 | Ga0157379_103549662 | 230 |
| 38 | 3300025934 | Ga0207686_10052075 | Ga0207686_100520753 | 230 |
| 39 | 3300049574 | Ga0501038_0560672 | Ga0501038_0560672_61_765 | 230 |
| 40 | 3300054114 | Ga0501084_0001149 | Ga0501084_0001149_14835_15539 | 230 |
| 41 | 3300049590 | Ga0501074_0039299 | Ga0501074_0039299_77_784 | 231 |
| 42 | 3300049591 | Ga0501075_0329907 | Ga0501075_0329907_411_1118 | 231 |
| 43 | 3300049743 | Ga0501081_0455839 | Ga0501081_0455839_11_718 | 231 |
| 44 | 3300021384 | Ga0213876_10000409 | Ga0213876_100004096 | 233 |
| 45 | 3300039437 | Ga0436365_1234622 | Ga0436365_1234622_27087_27821 | 233 |
| 46 | 3300049823 | Ga0501044_0680853 | Ga0501044_0680853_184_900 | 234 |
| 47 | 3300005336 | Ga0070680_100000765 | Ga0070680_10000076510 | 235 |
| 48 | 3300009101 | Ga0105247_10005372 | Ga0105247_100053727 | 235 |
| 49 | 3300010375 | Ga0105239_10000221 | Ga0105239_1000022128 | 235 |
| 50 | 3300013105 | Ga0157369_10003800 | Ga0157369_100038007 | 235 |
| 51 | 3300021377 | Ga0213874_10008240 | Ga0213874_100082402 | 235 |
| 52 | 3300028573 | Ga0265334_10004071 | Ga0265334_100040712 | 235 |
| 53 | 3300028800 | Ga0265338_10000378 | Ga0265338_1000037811 | 235 |
| 54 | 3300031238 | Ga0265332_10026240 | Ga0265332_100262402 | 235 |
| 55 | 3300031241 | Ga0265325_10000003 | Ga0265325_10000003357 | 235 |
| 56 | 3300031250 | Ga0265331_10006363 | Ga0265331_100063634 | 235 |
| 57 | 3300031595 | Ga0265313_10002518 | Ga0265313_1000251810 | 235 |
| 58 | 3300031711 | Ga0265314_10023184 | Ga0265314_100231844 | 235 |
| 59 | 3300031712 | Ga0265342_10069700 | Ga0265342_100697002 | 235 |
| 60 | 3300039450 | Ga0436363_0930623 | Ga0436363_0930623_1197_1919 | 235 |
| 61 | iso_pu_bacteria | 2925326138 | 2925331851 | 235 |
| 62 | 3300002067 | JGI24735J21928_10007894 | JGI24735J21928_100078944 | 237 |
| 63 | 3300003320 | rootH2_10021524 | rootH2_100215242 | 237 |
| 64 | 3300009177 | Ga0105248_10082500 | Ga0105248_100825001 | 237 |
| 65 | 3300016635 | Ga0183361_10006 | Ga0183361_10006302 | 237 |
| 66 | 3300025941 | Ga0207711_10022514 | Ga0207711_100225141 | 237 |
| 67 | 3300039453 | Ga0436362_0250120 | Ga0436362_0250120_366_1088 | 237 |
| 68 | 3300042007 | Ga0439449_0018538 | Ga0439449_0018538_283_1011 | 237 |
| 69 | 3300042015 | Ga0439462_0008948 | Ga0439462_0008948_1698_2426 | 237 |
| 70 | 3300046524 | Ga0495648_0135133 | Ga0495648_0135133_57_785 | 237 |
| 71 | 3300047320 | Ga0495672_0115438 | Ga0495672_0115438_596_1324 | 237 |
| 72 | 3300048909 | Ga0496106_0000023 | Ga0496106_0000023_145576_146298 | 237 |
| 73 | 3300048922 | Ga0496119_0188909 | Ga0496119_0188909_109_831 | 237 |
| 74 | 3300048924 | Ga0496121_0005179 | Ga0496121_0005179_11140_11862 | 237 |
| 75 | 3300048927 | Ga0496124_0301108 | Ga0496124_0301108_194_916 | 237 |
| 76 | 3300048929 | Ga0496126_0001279 | Ga0496126_0001279_25116_25838 | 237 |
| 77 | 3300049460 | Ga0495682_0148234 | Ga0495682_0148234_108_821 | 237 |
| 78 | 3300049823 | Ga0501044_0843494 | Ga0501044_0843494_22_744 | 237 |
| 79 | 3300005295 | Ga0065707_10352757 | Ga0065707_103527571 | 238 |
| 80 | 3300005340 | Ga0070689_100513560 | Ga0070689_1005135602 | 238 |
| 81 | 3300005344 | Ga0070661_100018400 | Ga0070661_1000184004 | 238 |
| 82 | 3300005345 | Ga0070692_10061066 | Ga0070692_100610662 | 238 |
| 83 | 3300005458 | Ga0070681_10013519 | Ga0070681_100135193 | 238 |
| 84 | 3300005471 | Ga0070698_100027820 | Ga0070698_1000278204 | 238 |
| 85 | 3300005471 | Ga0070698_100359061 | Ga0070698_1003590612 | 238 |
| 86 | 3300005530 | Ga0070679_100024967 | Ga0070679_1000249674 | 238 |
| 87 | 3300005539 | Ga0068853_100020387 | Ga0068853_1000203872 | 238 |
| 88 | 3300005546 | Ga0070696_100206639 | Ga0070696_1002066392 | 238 |
| 89 | 3300005577 | Ga0068857_100181140 | Ga0068857_1001811402 | 238 |
| 90 | 3300005577 | Ga0068857_100415561 | Ga0068857_1004155612 | 238 |
| 91 | 3300005617 | Ga0068859_100003484 | Ga0068859_10000348410 | 238 |
| 92 | 3300006353 | Ga0075370_10187156 | Ga0075370_101871562 | 238 |
| 93 | 3300006844 | Ga0075428_100015161 | Ga0075428_1000151614 | 238 |
| 94 | 3300006847 | Ga0075431_100001142 | Ga0075431_1000011429 | 238 |
| 95 | 3300006847 | Ga0075431_100365845 | Ga0075431_1003658452 | 238 |
| 96 | 3300006880 | Ga0075429_100009251 | Ga0075429_1000092514 | 238 |
| 97 | 3300006931 | Ga0097620_100003484 | Ga0097620_1000034848 | 238 |
| 98 | 3300009094 | Ga0111539_10103915 | Ga0111539_101039153 | 238 |
| 99 | 3300009094 | Ga0111539_10414638 | Ga0111539_104146382 | 238 |
| 100 | 3300009147 | Ga0114129_10014638 | Ga0114129_1001463810 | 238 |
| 101 | 3300009553 | Ga0105249_10025863 | Ga0105249_100258633 | 238 |
| 102 | 3300013100 | Ga0157373_10026360 | Ga0157373_100263603 | 238 |
| 103 | 3300013104 | Ga0157370_10085148 | Ga0157370_100851482 | 238 |
| 104 | 3300013307 | Ga0157372_10363157 | Ga0157372_103631572 | 238 |
| 105 | 3300025912 | Ga0207707_10012865 | Ga0207707_100128654 | 238 |
| 106 | 3300025918 | Ga0207662_10155932 | Ga0207662_101559322 | 238 |
| 107 | 3300025920 | Ga0207649_10007415 | Ga0207649_100074154 | 238 |
| 108 | 3300025921 | Ga0207652_10064848 | Ga0207652_100648482 | 238 |
| 109 | 3300025961 | Ga0207712_10088983 | Ga0207712_100889832 | 238 |
| 110 | 3300026041 | Ga0207639_10006696 | Ga0207639_100066967 | 238 |
| 111 | 3300026116 | Ga0207674_10063465 | Ga0207674_100634653 | 238 |
| 112 | 3300042876 | Ga0451577_0015015 | Ga0451577_0015015_5039_5764 | 238 |
| 113 | 3300044656 | Ga0466969_0008588 | Ga0466969_0008588_3888_4619 | 238 |
| 114 | 3300044684 | Ga0466966_0149525 | Ga0466966_0149525_484_1215 | 238 |
| 115 | 3300044693 | Ga0466961_0014578 | Ga0466961_0014578_2244_2975 | 238 |
| 116 | 3300045051 | Ga0451576_0008894 | Ga0451576_0008894_8955_9692 | 238 |
| 117 | 3300046539 | Ga0495621_0003815 | Ga0495621_0003815_1035_1760 | 238 |
| 118 | 3300049583 | Ga0501067_0016101 | Ga0501067_0016101_544_1269 | 238 |
| 119 | 3300049586 | Ga0501070_0016381 | Ga0501070_0016381_686_1411 | 238 |
| 120 | 3300049588 | Ga0501072_0130881 | Ga0501072_0130881_440_1165 | 238 |
| 121 | 3300049589 | Ga0501073_0003871 | Ga0501073_0003871_6773_7498 | 238 |
| 122 | 3300049742 | Ga0501080_0001925 | Ga0501080_0001925_16497_17222 | 238 |
| 123 | 3300050496 | nmdc:mga07m45_18214_c1 | nmdc:mga07m45_18214_c1_250_975 | 238 |
| 124 | 3300050507 | nmdc:mga05p37_64725_c1 | nmdc:mga05p37_64725_c1_1561_2298 | 238 |
| 125 | 3300050508 | nmdc:mga09592_1604_c1 | nmdc:mga09592_1604_c1_11853_12590 | 238 |
| 126 | 3300050510 | nmdc:mga06r32_22585_c1 | nmdc:mga06r32_22585_c1_4799_5536 | 238 |
| 127 | 3300050510 | nmdc:mga06r32_70366_c1 | nmdc:mga06r32_70366_c1_532_1257 | 238 |
| 128 | 3300050511 | nmdc:mga08y16_179773_c1 | nmdc:mga08y16_179773_c1_824_1549 | 238 |
| 129 | 3300050511 | nmdc:mga08y16_85208_c1 | nmdc:mga08y16_85208_c1_1220_1945 | 238 |
| 130 | 3300050515 | nmdc:mga0a205_562005_c1 | nmdc:mga0a205_562005_c1_52_789 | 238 |
| 131 | iso_pu_bacteria | 2671180694 | 2673822840 | 238 |
| 132 | iso_pu_bacteria | 2864997549 | 2865000652 | 238 |
| 133 | iso_pu_bacteria | 2889295896 | 2889297904 | 238 |
| 134 | iso_pu_bacteria | 2980125574 | 2980126488 | 238 |
| 135 | iso_pu_bacteria | 2980182181 | 2980183501 | 238 |
| 136 | iso_pu_bacteria | 2981284811 | 2981286384 | 238 |
| 137 | iso_pu_bacteria | 2981289755 | 2981291334 | 238 |
| 138 | iso_pu_bacteria | 2981980479 | 2981982029 | 238 |
| 139 | iso_pu_bacteria | 2981985349 | 2981986928 | 238 |
| 140 | iso_pu_bacteria | 8057733483 | 8057733636 | 238 |
| 141 | 3300005564 | Ga0070664_100038470 | Ga0070664_1000384702 | 239 |
| 142 | 3300005327 | Ga0070658_10107484 | Ga0070658_101074842 | 240 |
| 143 | 3300005344 | Ga0070661_100000694 | Ga0070661_10000069413 | 240 |
| 144 | 3300005543 | Ga0070672_100395483 | Ga0070672_1003954832 | 240 |
| 145 | 3300005564 | Ga0070664_100263764 | Ga0070664_1002637642 | 240 |
| 146 | 3300005841 | Ga0068863_100199480 | Ga0068863_1001994802 | 240 |
| 147 | 3300009093 | Ga0105240_10213361 | Ga0105240_102133612 | 240 |
| 148 | 3300013105 | Ga0157369_10107813 | Ga0157369_101078132 | 240 |
| 149 | 3300025917 | Ga0207660_10033667 | Ga0207660_100336671 | 240 |
| 150 | 3300025919 | Ga0207657_10328816 | Ga0207657_103288162 | 240 |
| 151 | 3300025920 | Ga0207649_10000112 | Ga0207649_1000011213 | 240 |
| 152 | 3300025986 | Ga0207658_10709209 | Ga0207658_107092092 | 240 |
| 153 | 3300031250 | Ga0265331_10000003 | Ga0265331_10000003394 | 240 |
| 154 | 3300031250 | Ga0265331_10000699 | Ga0265331_1000069917 | 240 |
| 155 | 3300031251 | Ga0265327_10000150 | Ga0265327_1000015061 | 240 |
| 156 | 3300031711 | Ga0265314_10009671 | Ga0265314_100096715 | 240 |
| 157 | 3300031711 | Ga0265314_10145783 | Ga0265314_101457832 | 240 |
| 158 | 3300031711 | Ga0265314_10215336 | Ga0265314_102153362 | 240 |
| 159 | 3300039437 | Ga0436365_1222514 | Ga0436365_1222514_397_1188 | 240 |
| 160 | 3300039447 | Ga0436361_0288663 | Ga0436361_0288663_2115_2843 | 240 |
| 161 | 3300044656 | Ga0466969_0000878 | Ga0466969_0000878_5992_6804 | 240 |
| 162 | 3300049568 | Ga0501031_0136768 | Ga0501031_0136768_602_1327 | 240 |
| 163 | 3300049569 | Ga0501032_0112362 | Ga0501032_0112362_809_1546 | 240 |
| 164 | 3300049569 | Ga0501032_0147504 | Ga0501032_0147504_630_1358 | 240 |
| 165 | 3300049571 | Ga0501034_0055432 | Ga0501034_0055432_1990_2727 | 240 |
| 166 | 3300049571 | Ga0501034_0078229 | Ga0501034_0078229_2202_2930 | 240 |
| 167 | 3300049573 | Ga0501037_0054569 | Ga0501037_0054569_2014_2751 | 240 |
| 168 | 3300049575 | Ga0501039_0445032 | Ga0501039_0445032_91_819 | 240 |
| 169 | 3300049579 | Ga0501043_0135711 | Ga0501043_0135711_192_920 | 240 |
| 170 | 3300049581 | Ga0501047_0012180 | Ga0501047_0012180_2775_3512 | 240 |
| 171 | 3300049582 | Ga0501048_0029946 | Ga0501048_0029946_3077_3814 | 240 |
| 172 | 3300049583 | Ga0501067_0002177 | Ga0501067_0002177_1055_1792 | 240 |
| 173 | 3300049584 | Ga0501068_0021442 | Ga0501068_0021442_1999_2727 | 240 |
| 174 | 3300049585 | Ga0501069_0016812 | Ga0501069_0016812_466_1203 | 240 |
| 175 | 3300049586 | Ga0501070_0008192 | Ga0501070_0008192_6428_7165 | 240 |
| 176 | 3300049586 | Ga0501070_0055650 | Ga0501070_0055650_437_1165 | 240 |
| 177 | 3300049589 | Ga0501073_0003777 | Ga0501073_0003777_3572_4309 | 240 |
| 178 | 3300049590 | Ga0501074_0015640 | Ga0501074_0015640_4081_4818 | 240 |
| 179 | 3300049741 | Ga0501079_0000409 | Ga0501079_0000409_19818_20555 | 240 |
| 180 | 3300049742 | Ga0501080_0009893 | Ga0501080_0009893_3474_4211 | 240 |
| 181 | 3300049742 | Ga0501080_0359287 | Ga0501080_0359287_558_1286 | 240 |
| 182 | 3300049822 | Ga0501035_0004045 | Ga0501035_0004045_10538_11275 | 240 |
| 183 | 3300049822 | Ga0501035_0260700 | Ga0501035_0260700_233_961 | 240 |
| 184 | 3300049823 | Ga0501044_0026816 | Ga0501044_0026816_1991_2728 | 240 |
| 185 | 3300054114 | Ga0501084_0016162 | Ga0501084_0016162_1965_2702 | 240 |
| 186 | 3300005347 | Ga0070668_100008885 | Ga0070668_1000088856 | 241 |
| 187 | 3300009094 | Ga0111539_10000501 | Ga0111539_1000050138 | 241 |
| 188 | 3300009147 | Ga0114129_10053142 | Ga0114129_100531424 | 241 |
| 189 | 3300021361 | Ga0213872_10002733 | Ga0213872_1000273313 | 241 |
| 190 | 3300025229 | Ga0209147_103316 | Ga0209147_1033162 | 241 |
| 191 | 3300036401 | Ga0373937_0269393 | Ga0373937_0269393_91_831 | 241 |
| 192 | 3300039437 | Ga0436365_1846878 | Ga0436365_1846878_1828_2619 | 241 |
| 193 | 3300039447 | Ga0436361_0686387 | Ga0436361_0686387_199_930 | 241 |
| 194 | 3300039447 | Ga0436361_0692813 | Ga0436361_0692813_6714_7445 | 241 |
| 195 | 3300047319 | Ga0495674_0320878 | Ga0495674_0320878_436_1176 | 241 |
| 196 | iso_pu_bacteria | 8054795415 | 8054804021 | 241 |
| 197 | 3300005330 | Ga0070690_100092392 | Ga0070690_1000923922 | 242 |
| 198 | 3300005335 | Ga0070666_10005915 | Ga0070666_100059152 | 242 |
| 199 | 3300005439 | Ga0070711_100255241 | Ga0070711_1002552412 | 242 |
| 200 | 3300035170 | Ga0373943_0089402 | Ga0373943_0089402_291_1034 | 242 |
| 201 | 3300046472 | Ga0495580_0044066 | Ga0495580_0044066_1713_2456 | 242 |
| 202 | 3300046473 | Ga0495582_0009505 | Ga0495582_0009505_723_1466 | 242 |
| 203 | 3300046475 | Ga0495639_0120754 | Ga0495639_0120754_265_1008 | 242 |
| 204 | 3300046517 | Ga0495630_0640460 | Ga0495630_0640460_61_804 | 242 |
| 205 | 3300046683 | Ga0495658_0000939 | Ga0495658_0000939_4400_5143 | 242 |
| 206 | 3300046689 | Ga0495613_0087936 | Ga0495613_0087936_844_1587 | 242 |
| 207 | 3300044684 | Ga0466966_0056181 | Ga0466966_0056181_364_1137 | 243 |
| 208 | 3300049586 | Ga0501070_0509116 | Ga0501070_0509116_63_881 | 243 |
| 209 | 3300050511 | nmdc:mga08y16_35512_c1 | nmdc:mga08y16_35512_c1_1295_2062 | 243 |
| 210 | iso_pu_bacteria | 2671180139 | 2671691915 | 243 |
| 211 | 3300021377 | Ga0213874_10018298 | Ga0213874_100182982 | 244 |
| 212 | 3300021384 | Ga0213876_10214187 | Ga0213876_102141872 | 244 |
| 213 | 3300026095 | Ga0207676_10069316 | Ga0207676_100693162 | 244 |
| 214 | 3300026116 | Ga0207674_10060194 | Ga0207674_100601942 | 244 |
| 215 | 3300039437 | Ga0436365_1105030 | Ga0436365_1105030_114_863 | 244 |
| 216 | 3300039450 | Ga0436363_1243663 | Ga0436363_1243663_705_1454 | 244 |
| 217 | 3300010159 | Ga0099796_10037228 | Ga0099796_100372282 | 245 |
| 218 | 3300013307 | Ga0157372_10022136 | Ga0157372_100221367 | 245 |
| 219 | 3300013307 | Ga0157372_10094572 | Ga0157372_100945723 | 245 |
| 220 | 3300039437 | Ga0436365_0503854 | Ga0436365_0503854_2909_3646 | 245 |
| 221 | 3300039437 | Ga0436365_0507621 | Ga0436365_0507621_52791_53528 | 245 |
| 222 | 3300039438 | Ga0436360_0339219 | Ga0436360_0339219_251_1027 | 245 |
| 223 | 3300042436 | Ga0439435_0000392 | Ga0439435_0000392_1934_2683 | 245 |
| 224 | 3300049581 | Ga0501047_0676146 | Ga0501047_0676146_86_832 | 245 |
| 225 | 3300049589 | Ga0501073_0042263 | Ga0501073_0042263_391_1164 | 245 |
| 226 | 3300050511 | nmdc:mga08y16_66445_c1 | nmdc:mga08y16_66445_c1_2525_3274 | 245 |
| 227 | 3300005467 | Ga0070706_100116209 | Ga0070706_1001162092 | 246 |
| 228 | 3300005467 | Ga0070706_100704209 | Ga0070706_1007042091 | 246 |
| 229 | 3300005471 | Ga0070698_100002001 | Ga0070698_10000200110 | 246 |
| 230 | 3300005518 | Ga0070699_100031429 | Ga0070699_1000314293 | 246 |
| 231 | 3300005518 | Ga0070699_100098175 | Ga0070699_1000981752 | 246 |
| 232 | 3300005536 | Ga0070697_100230417 | Ga0070697_1002304172 | 246 |
| 233 | 3300005614 | Ga0068856_100293509 | Ga0068856_1002935092 | 246 |
| 234 | 3300005981 | Ga0081538_10011188 | Ga0081538_100111888 | 246 |
| 235 | 3300005983 | Ga0081540_1036314 | Ga0081540_10363142 | 246 |
| 236 | 3300009093 | Ga0105240_10349402 | Ga0105240_103494022 | 246 |
| 237 | 3300009147 | Ga0114129_10189296 | Ga0114129_101892962 | 246 |
| 238 | 3300009551 | Ga0105238_10020723 | Ga0105238_100207235 | 246 |
| 239 | 3300013307 | Ga0157372_10042356 | Ga0157372_100423564 | 246 |
| 240 | 3300021361 | Ga0213872_10051545 | Ga0213872_100515452 | 246 |
| 241 | 3300021384 | Ga0213876_10000115 | Ga0213876_1000011576 | 246 |
| 242 | 3300021388 | Ga0213875_10000205 | Ga0213875_1000020521 | 246 |
| 243 | 3300025910 | Ga0207684_10127359 | Ga0207684_101273592 | 246 |
| 244 | 3300025924 | Ga0207694_10039783 | Ga0207694_100397832 | 246 |
| 245 | 3300025934 | Ga0207686_10315874 | Ga0207686_103158742 | 246 |
| 246 | 3300026041 | Ga0207639_10240214 | Ga0207639_102402141 | 246 |
| 247 | 3300026078 | Ga0207702_10316289 | Ga0207702_103162892 | 246 |
| 248 | 3300031250 | Ga0265331_10028837 | Ga0265331_100288373 | 246 |
| 249 | 3300035170 | Ga0373943_0010429 | Ga0373943_0010429_70_825 | 246 |
| 250 | 3300035172 | Ga0373955_0206275 | Ga0373955_0206275_322_1080 | 246 |
| 251 | 3300036401 | Ga0373937_0218762 | Ga0373937_0218762_730_1488 | 246 |
| 252 | 3300037853 | Ga0436364_0056243 | Ga0436364_0056243_45567_46343 | 246 |
| 253 | 3300039447 | Ga0436361_0495760 | Ga0436361_0495760_919_1698 | 246 |
| 254 | 3300042007 | Ga0439449_0177297 | Ga0439449_0177297_17_781 | 246 |
| 255 | 3300042012 | Ga0439455_0034480 | Ga0439455_0034480_325_1089 | 246 |
| 256 | 3300048929 | Ga0496126_0254287 | Ga0496126_0254287_52_807 | 246 |
| 257 | 3300049570 | Ga0501033_0186309 | Ga0501033_0186309_683_1435 | 246 |
| 258 | 3300049571 | Ga0501034_0397564 | Ga0501034_0397564_140_949 | 246 |
| 259 | 3300049574 | Ga0501038_0228006 | Ga0501038_0228006_65_820 | 246 |
| 260 | 3300049581 | Ga0501047_0009634 | Ga0501047_0009634_8304_9068 | 246 |
| 261 | 3300049581 | Ga0501047_0100815 | Ga0501047_0100815_920_1729 | 246 |
| 262 | 3300049583 | Ga0501067_0199945 | Ga0501067_0199945_124_888 | 246 |
| 263 | 3300049585 | Ga0501069_0011138 | Ga0501069_0011138_3827_4597 | 246 |
| 264 | 3300049585 | Ga0501069_0130828 | Ga0501069_0130828_103_867 | 246 |
| 265 | 3300049586 | Ga0501070_0080501 | Ga0501070_0080501_1147_1911 | 246 |
| 266 | 3300049586 | Ga0501070_0484876 | Ga0501070_0484876_13_789 | 246 |
| 267 | 3300049590 | Ga0501074_0030037 | Ga0501074_0030037_2955_3719 | 246 |
| 268 | 3300049590 | Ga0501074_0178821 | Ga0501074_0178821_21_773 | 246 |
| 269 | 3300049822 | Ga0501035_0481412 | Ga0501035_0481412_47_799 | 246 |
| 270 | 3300050507 | nmdc:mga05p37_152636_c1 | nmdc:mga05p37_152636_c1_1347_2144 | 246 |
| 271 | 3300053087 | Ga0500643_036151 | Ga0500643_036151_638_1396 | 246 |
| 272 | 3300054114 | Ga0501084_0166775 | Ga0501084_0166775_154_918 | 246 |
| 273 | 3300060353 | Ga0501082_0093687 | Ga0501082_0093687_72_836 | 246 |
| 274 | 3300060353 | Ga0501082_0165516 | Ga0501082_0165516_812_1576 | 246 |
| 275 | iso_pu_bacteria | 2883577096 | 2883579191 | 246 |
| 276 | 3300005367 | Ga0070667_100155382 | Ga0070667_1001553822 | 247 |
| 277 | 3300005436 | Ga0070713_100437131 | Ga0070713_1004371311 | 247 |
| 278 | 3300005563 | Ga0068855_100477661 | Ga0068855_1004776612 | 247 |
| 279 | 3300005842 | Ga0068858_100018569 | Ga0068858_1000185692 | 247 |
| 280 | 3300005843 | Ga0068860_100178732 | Ga0068860_1001787322 | 247 |
| 281 | 3300006175 | Ga0070712_100045294 | Ga0070712_1000452942 | 247 |
| 282 | 3300006237 | Ga0097621_100409465 | Ga0097621_1004094652 | 247 |
| 283 | 3300009174 | Ga0105241_10176527 | Ga0105241_101765272 | 247 |
| 284 | 3300014968 | Ga0157379_10006441 | Ga0157379_100064419 | 247 |
| 285 | 3300021358 | Ga0213873_10000953 | Ga0213873_100009533 | 247 |
| 286 | 3300021377 | Ga0213874_10006983 | Ga0213874_100069831 | 247 |
| 287 | 3300021384 | Ga0213876_10004022 | Ga0213876_100040223 | 247 |
| 288 | 3300021384 | Ga0213876_10099082 | Ga0213876_100990822 | 247 |
| 289 | 3300021388 | Ga0213875_10006582 | Ga0213875_100065824 | 247 |
| 290 | 3300025903 | Ga0207680_10003350 | Ga0207680_100033506 | 247 |
| 291 | 3300025911 | Ga0207654_10268231 | Ga0207654_102682312 | 247 |
| 292 | 3300025939 | Ga0207665_10115385 | Ga0207665_101153852 | 247 |
| 293 | 3300026035 | Ga0207703_10015168 | Ga0207703_100151685 | 247 |
| 294 | 3300028800 | Ga0265338_10010745 | Ga0265338_100107458 | 247 |
| 295 | 3300031238 | Ga0265332_10132127 | Ga0265332_101321272 | 247 |
| 296 | 3300031240 | Ga0265320_10001320 | Ga0265320_100013203 | 247 |
| 297 | 3300031240 | Ga0265320_10100703 | Ga0265320_101007032 | 247 |
| 298 | 3300031241 | Ga0265325_10099231 | Ga0265325_100992312 | 247 |
| 299 | 3300031241 | Ga0265325_10166224 | Ga0265325_101662242 | 247 |
| 300 | 3300031249 | Ga0265339_10036206 | Ga0265339_100362063 | 247 |
| 301 | 3300031595 | Ga0265313_10030601 | Ga0265313_100306014 | 247 |
| 302 | 3300031711 | Ga0265314_10006918 | Ga0265314_100069182 | 247 |
| 303 | 3300031711 | Ga0265314_10217066 | Ga0265314_102170662 | 247 |
| 304 | 3300035170 | Ga0373943_0014259 | Ga0373943_0014259_1521_2300 | 247 |
| 305 | 3300037853 | Ga0436364_0334510 | Ga0436364_0334510_14009_14791 | 247 |
| 306 | 3300039437 | Ga0436365_0747668 | Ga0436365_0747668_3890_4663 | 247 |
| 307 | 3300039437 | Ga0436365_0834196 | Ga0436365_0834196_1714_2496 | 247 |
| 308 | 3300039450 | Ga0436363_0605002 | Ga0436363_0605002_210_983 | 247 |
| 309 | 3300039453 | Ga0436362_0144215 | Ga0436362_0144215_6737_7519 | 247 |
| 310 | 3300046476 | Ga0495662_0031180 | Ga0495662_0031180_257_1036 | 247 |
| 311 | 3300046477 | Ga0495664_0241033 | Ga0495664_0241033_36_815 | 247 |
| 312 | 3300046517 | Ga0495630_0080926 | Ga0495630_0080926_1445_2224 | 247 |
| 313 | 3300046533 | Ga0495640_0072857 | Ga0495640_0072857_1503_2282 | 247 |
| 314 | 3300047319 | Ga0495674_0082897 | Ga0495674_0082897_548_1327 | 247 |
| 315 | 3300048904 | Ga0496101_0224439 | Ga0496101_0224439_644_1420 | 247 |
| 316 | 3300048905 | Ga0496102_0096628 | Ga0496102_0096628_512_1288 | 247 |
| 317 | 3300048908 | Ga0496105_0051384 | Ga0496105_0051384_905_1681 | 247 |
| 318 | 3300048909 | Ga0496106_0268266 | Ga0496106_0268266_568_1344 | 247 |
| 319 | 3300048911 | Ga0496108_0494415 | Ga0496108_0494415_230_1006 | 247 |
| 320 | 3300048912 | Ga0496109_0571873 | Ga0496109_0571873_32_808 | 247 |
| 321 | 3300048913 | Ga0496110_0205934 | Ga0496110_0205934_17_796 | 247 |
| 322 | 3300048929 | Ga0496126_0000782 | Ga0496126_0000782_24590_25342 | 247 |
| 323 | 3300049572 | Ga0501036_0097649 | Ga0501036_0097649_1198_1980 | 247 |
| 324 | 3300049576 | Ga0501040_0340935 | Ga0501040_0340935_237_1004 | 247 |
| 325 | 3300049579 | Ga0501043_0257779 | Ga0501043_0257779_307_1086 | 247 |
| 326 | 3300049580 | Ga0501046_0104840 | Ga0501046_0104840_863_1681 | 247 |
| 327 | 3300049582 | Ga0501048_0206170 | Ga0501048_0206170_373_1155 | 247 |
| 328 | 3300049584 | Ga0501068_0054780 | Ga0501068_0054780_1348_2166 | 247 |
| 329 | 3300049587 | Ga0501071_0034708 | Ga0501071_0034708_834_1652 | 247 |
| 330 | 3300049588 | Ga0501072_0023859 | Ga0501072_0023859_2943_3761 | 247 |
| 331 | 3300049592 | Ga0501076_0177522 | Ga0501076_0177522_340_1107 | 247 |
| 332 | 3300049592 | Ga0501076_0262445 | Ga0501076_0262445_401_1183 | 247 |
| 333 | 3300049743 | Ga0501081_0118542 | Ga0501081_0118542_354_1136 | 247 |
| 334 | 3300049824 | Ga0501045_0153892 | Ga0501045_0153892_833_1615 | 247 |
| 335 | 3300053077 | Ga0495601_0038735 | Ga0495601_0038735_1029_1808 | 247 |
| 336 | 3300053156 | Ga0500622_0128587 | Ga0500622_0128587_118_894 | 247 |
| 337 | 3300054114 | Ga0501084_0033449 | Ga0501084_0033449_1579_2397 | 247 |
| 338 | 3300060353 | Ga0501082_0085401 | Ga0501082_0085401_1050_1832 | 247 |
| 339 | 3300060353 | Ga0501082_0120977 | Ga0501082_0120977_1066_1884 | 247 |
| 340 | iso_pu_bacteria | 2513237087 | 2513593606 | 247 |
| 341 | iso_pu_bacteria | 2842694124 | 2842696362 | 247 |
| 342 | iso_pu_bacteria | 2929199973 | 2929200095 | 247 |
| 343 | iso_pu_bacteria | 8055909800 | 8055915288 | 247 |
| 344 | 3300003203 | JGI25406J46586_10002350 | JGI25406J46586_1000235010 | 248 |
| 345 | 3300003203 | JGI25406J46586_10017460 | JGI25406J46586_100174602 | 248 |
| 346 | 3300005343 | Ga0070687_100050738 | Ga0070687_1000507381 | 248 |
| 347 | 3300005354 | Ga0070675_100046662 | Ga0070675_1000466622 | 248 |
| 348 | 3300005355 | Ga0070671_100604909 | Ga0070671_1006049091 | 248 |
| 349 | 3300005356 | Ga0070674_100026232 | Ga0070674_1000262322 | 248 |
| 350 | 3300005434 | Ga0070709_10001330 | Ga0070709_100013309 | 248 |
| 351 | 3300005434 | Ga0070709_10005045 | Ga0070709_100050456 | 248 |
| 352 | 3300005434 | Ga0070709_10288579 | Ga0070709_102885792 | 248 |
| 353 | 3300005435 | Ga0070714_100144596 | Ga0070714_1001445962 | 248 |
| 354 | 3300005436 | Ga0070713_100000001 | Ga0070713_100000001109 | 248 |
| 355 | 3300005439 | Ga0070711_100012997 | Ga0070711_1000129974 | 248 |
| 356 | 3300005439 | Ga0070711_100084148 | Ga0070711_1000841482 | 248 |
| 357 | 3300005458 | Ga0070681_10544914 | Ga0070681_105449141 | 248 |
| 358 | 3300005539 | Ga0068853_100045111 | Ga0068853_1000451114 | 248 |
| 359 | 3300005543 | Ga0070672_100199351 | Ga0070672_1001993512 | 248 |
| 360 | 3300005547 | Ga0070693_100214111 | Ga0070693_1002141112 | 248 |
| 361 | 3300005548 | Ga0070665_100026167 | Ga0070665_1000261672 | 248 |
| 362 | 3300005577 | Ga0068857_100003709 | Ga0068857_1000037095 | 248 |
| 363 | 3300005578 | Ga0068854_100013354 | Ga0068854_1000133544 | 248 |
| 364 | 3300005614 | Ga0068856_100003275 | Ga0068856_1000032758 | 248 |
| 365 | 3300005614 | Ga0068856_100004362 | Ga0068856_10000436210 | 248 |
| 366 | 3300005618 | Ga0068864_100149266 | Ga0068864_1001492662 | 248 |
| 367 | 3300005841 | Ga0068863_100160466 | Ga0068863_1001604663 | 248 |
| 368 | 3300005842 | Ga0068858_100222740 | Ga0068858_1002227402 | 248 |
| 369 | 3300005937 | Ga0081455_10096167 | Ga0081455_100961672 | 248 |
| 370 | 3300005985 | Ga0081539_10000881 | Ga0081539_100008819 | 248 |
| 371 | 3300005985 | Ga0081539_10002027 | Ga0081539_1000202725 | 248 |
| 372 | 3300006028 | Ga0070717_10025097 | Ga0070717_100250975 | 248 |
| 373 | 3300006038 | Ga0075365_10032574 | Ga0075365_100325744 | 248 |
| 374 | 3300006175 | Ga0070712_100000109 | Ga0070712_1000001097 | 248 |
| 375 | 3300006175 | Ga0070712_100000499 | Ga0070712_1000004997 | 248 |
| 376 | 3300006871 | Ga0075434_100687493 | Ga0075434_1006874932 | 248 |
| 377 | 3300006914 | Ga0075436_100004097 | Ga0075436_1000040976 | 248 |
| 378 | 3300007076 | Ga0075435_100023169 | Ga0075435_1000231692 | 248 |
| 379 | 3300007076 | Ga0075435_100051231 | Ga0075435_1000512312 | 248 |
| 380 | 3300009093 | Ga0105240_10025951 | Ga0105240_100259517 | 248 |
| 381 | 3300009094 | Ga0111539_10307186 | Ga0111539_103071862 | 248 |
| 382 | 3300009094 | Ga0111539_10644185 | Ga0111539_106441852 | 248 |
| 383 | 3300009098 | Ga0105245_10475455 | Ga0105245_104754552 | 248 |
| 384 | 3300009101 | Ga0105247_10025190 | Ga0105247_100251902 | 248 |
| 385 | 3300009174 | Ga0105241_10011564 | Ga0105241_100115642 | 248 |
| 386 | 3300009545 | Ga0105237_10056562 | Ga0105237_100565624 | 248 |
| 387 | 3300009551 | Ga0105238_10006899 | Ga0105238_100068996 | 248 |
| 388 | 3300009551 | Ga0105238_10168921 | Ga0105238_101689211 | 248 |
| 389 | 3300009553 | Ga0105249_10144660 | Ga0105249_101446602 | 248 |
| 390 | 3300010375 | Ga0105239_10539533 | Ga0105239_105395332 | 248 |
| 391 | 3300011119 | Ga0105246_10262350 | Ga0105246_102623502 | 248 |
| 392 | 3300013100 | Ga0157373_10007104 | Ga0157373_100071047 | 248 |
| 393 | 3300013104 | Ga0157370_10003943 | Ga0157370_100039432 | 248 |
| 394 | 3300013105 | Ga0157369_10013165 | Ga0157369_100131653 | 248 |
| 395 | 3300013307 | Ga0157372_10027275 | Ga0157372_100272755 | 248 |
| 396 | 3300013307 | Ga0157372_10208828 | Ga0157372_102088282 | 248 |
| 397 | 3300014325 | Ga0163163_10230666 | Ga0163163_102306662 | 248 |
| 398 | 3300014968 | Ga0157379_10038374 | Ga0157379_100383742 | 248 |
| 399 | 3300014968 | Ga0157379_10083969 | Ga0157379_100839693 | 248 |
| 400 | 3300014968 | Ga0157379_10181307 | Ga0157379_101813072 | 248 |
| 401 | 3300021384 | Ga0213876_10052455 | Ga0213876_100524553 | 248 |
| 402 | 3300021384 | Ga0213876_10082908 | Ga0213876_100829082 | 248 |
| 403 | 3300021388 | Ga0213875_10000074 | Ga0213875_1000007441 | 248 |
| 404 | 3300025893 | Ga0207682_10006656 | Ga0207682_100066565 | 248 |
| 405 | 3300025904 | Ga0207647_10087908 | Ga0207647_100879082 | 248 |
| 406 | 3300025906 | Ga0207699_10000096 | Ga0207699_1000009611 | 248 |
| 407 | 3300025906 | Ga0207699_10020473 | Ga0207699_100204733 | 248 |
| 408 | 3300025908 | Ga0207643_10064544 | Ga0207643_100645442 | 248 |
| 409 | 3300025911 | Ga0207654_10017452 | Ga0207654_100174524 | 248 |
| 410 | 3300025913 | Ga0207695_10494159 | Ga0207695_104941592 | 248 |
| 411 | 3300025915 | Ga0207693_10000094 | Ga0207693_1000009437 | 248 |
| 412 | 3300025915 | Ga0207693_10000372 | Ga0207693_1000037237 | 248 |
| 413 | 3300025916 | Ga0207663_10017715 | Ga0207663_100177154 | 248 |
| 414 | 3300025916 | Ga0207663_10031792 | Ga0207663_100317922 | 248 |
| 415 | 3300025918 | Ga0207662_10102469 | Ga0207662_101024692 | 248 |
| 416 | 3300025923 | Ga0207681_10154716 | Ga0207681_101547162 | 248 |
| 417 | 3300025924 | Ga0207694_10085251 | Ga0207694_100852512 | 248 |
| 418 | 3300025926 | Ga0207659_10176394 | Ga0207659_101763942 | 248 |
| 419 | 3300025928 | Ga0207700_10000015 | Ga0207700_10000015158 | 248 |
| 420 | 3300025929 | Ga0207664_10028677 | Ga0207664_100286774 | 248 |
| 421 | 3300025935 | Ga0207709_10306837 | Ga0207709_103068371 | 248 |
| 422 | 3300025937 | Ga0207669_10152994 | Ga0207669_101529942 | 248 |
| 423 | 3300025940 | Ga0207691_10037600 | Ga0207691_100376001 | 248 |
| 424 | 3300025944 | Ga0207661_10588122 | Ga0207661_105881222 | 248 |
| 425 | 3300025949 | Ga0207667_10055598 | Ga0207667_100555984 | 248 |
| 426 | 3300026041 | Ga0207639_10036256 | Ga0207639_100362562 | 248 |
| 427 | 3300026078 | Ga0207702_10000011 | Ga0207702_10000011153 | 248 |
| 428 | 3300026078 | Ga0207702_10000465 | Ga0207702_1000046526 | 248 |
| 429 | 3300026089 | Ga0207648_10024949 | Ga0207648_100249492 | 248 |
| 430 | 3300026095 | Ga0207676_10045063 | Ga0207676_100450632 | 248 |
| 431 | 3300026116 | Ga0207674_10000002 | Ga0207674_10000002156 | 248 |
| 432 | 3300026118 | Ga0207675_100209857 | Ga0207675_1002098572 | 248 |
| 433 | 3300026121 | Ga0207683_10025989 | Ga0207683_100259894 | 248 |
| 434 | 3300026142 | Ga0207698_10035270 | Ga0207698_100352702 | 248 |
| 435 | 3300028379 | Ga0268266_10009369 | Ga0268266_100093698 | 248 |
| 436 | 3300028800 | Ga0265338_10034019 | Ga0265338_100340194 | 248 |
| 437 | 3300031241 | Ga0265325_10001297 | Ga0265325_100012977 | 248 |
| 438 | 3300031247 | Ga0265340_10041626 | Ga0265340_100416262 | 248 |
| 439 | 3300031247 | Ga0265340_10050965 | Ga0265340_100509652 | 248 |
| 440 | 3300031249 | Ga0265339_10001140 | Ga0265339_1000114013 | 248 |
| 441 | 3300031344 | Ga0265316_10018544 | Ga0265316_100185444 | 248 |
| 442 | 3300031344 | Ga0265316_10035465 | Ga0265316_100354652 | 248 |
| 443 | 3300031344 | Ga0265316_10171365 | Ga0265316_101713652 | 248 |
| 444 | 3300031344 | Ga0265316_10329324 | Ga0265316_103293242 | 248 |
| 445 | 3300031595 | Ga0265313_10001099 | Ga0265313_1000109914 | 248 |
| 446 | 3300031665 | Ga0316575_10024405 | Ga0316575_100244052 | 248 |
| 447 | 3300031711 | Ga0265314_10108482 | Ga0265314_101084822 | 248 |
| 448 | 3300031711 | Ga0265314_10260755 | Ga0265314_102607551 | 248 |
| 449 | 3300031712 | Ga0265342_10009892 | Ga0265342_100098925 | 248 |
| 450 | 3300031712 | Ga0265342_10025719 | Ga0265342_100257193 | 248 |
| 451 | 3300031728 | Ga0316578_10016633 | Ga0316578_100166332 | 248 |
| 452 | 3300035172 | Ga0373955_0068871 | Ga0373955_0068871_343_1107 | 248 |
| 453 | 3300035398 | Ga0316574_0004127 | Ga0316574_0004127_2065_2865 | 248 |
| 454 | 3300035691 | Ga0373931_0068865 | Ga0373931_0068865_552_1316 | 248 |
| 455 | 3300035695 | Ga0373927_0053502 | Ga0373927_0053502_738_1502 | 248 |
| 456 | 3300035695 | Ga0373927_0152571 | Ga0373927_0152571_736_1500 | 248 |
| 457 | 3300035724 | Ga0373933_0007105 | Ga0373933_0007105_141_905 | 248 |
| 458 | 3300036401 | Ga0373937_0004901 | Ga0373937_0004901_5231_5995 | 248 |
| 459 | 3300036401 | Ga0373937_0136411 | Ga0373937_0136411_798_1562 | 248 |
| 460 | 3300036647 | Ga0316582_0015435 | Ga0316582_0015435_814_1614 | 248 |
| 461 | 3300036712 | Ga0316584_0038854 | Ga0316584_0038854_742_1542 | 248 |
| 462 | 3300037853 | Ga0436364_0090740 | Ga0436364_0090740_4321_5100 | 248 |
| 463 | 3300038443 | Ga0395901_0163693 | Ga0395901_0163693_331_1119 | 248 |
| 464 | 3300039437 | Ga0436365_1039466 | Ga0436365_1039466_196_975 | 248 |
| 465 | 3300039437 | Ga0436365_1364317 | Ga0436365_1364317_1092_1871 | 248 |
| 466 | 3300041408 | Ga0439453_0000160 | Ga0439453_0000160_2369_3130 | 248 |
| 467 | 3300042001 | Ga0439441_050560 | Ga0439441_050560_35_796 | 248 |
| 468 | 3300042003 | Ga0439443_000672 | Ga0439443_000672_741_1502 | 248 |
| 469 | 3300046472 | Ga0495580_0015567 | Ga0495580_0015567_2987_3751 | 248 |
| 470 | 3300046615 | Ga0495656_0041985 | Ga0495656_0041985_784_1593 | 248 |
| 471 | 3300047447 | Ga0495685_042723 | Ga0495685_042723_73_840 | 248 |
| 472 | 3300047447 | Ga0495685_078127 | Ga0495685_078127_252_1061 | 248 |
| 473 | 3300048090 | Ga0495615_0004280 | Ga0495615_0004280_1227_2036 | 248 |
| 474 | 3300048905 | Ga0496102_0163209 | Ga0496102_0163209_435_1199 | 248 |
| 475 | 3300048909 | Ga0496106_0258245 | Ga0496106_0258245_486_1250 | 248 |
| 476 | 3300048910 | Ga0496107_0129153 | Ga0496107_0129153_377_1141 | 248 |
| 477 | 3300049576 | Ga0501040_0000178 | Ga0501040_0000178_17451_18233 | 248 |
| 478 | 3300049578 | Ga0501042_0010204 | Ga0501042_0010204_60_842 | 248 |
| 479 | 3300049578 | Ga0501042_0020236 | Ga0501042_0020236_2679_3461 | 248 |
| 480 | 3300049580 | Ga0501046_0419166 | Ga0501046_0419166_98_856 | 248 |
| 481 | 3300049588 | Ga0501072_0018775 | Ga0501072_0018775_476_1234 | 248 |
| 482 | 3300049591 | Ga0501075_0318449 | Ga0501075_0318449_67_825 | 248 |
| 483 | 3300049592 | Ga0501076_0098197 | Ga0501076_0098197_136_894 | 248 |
| 484 | 3300050511 | nmdc:mga08y16_1047436_c1 | nmdc:mga08y16_1047436_c1_17_778 | 248 |
| 485 | 3300050512 | nmdc:mga0n895_576056_c1 | nmdc:mga0n895_576056_c1_157_921 | 248 |
| 486 | 3300050513 | nmdc:mga0rr50_17410_c1 | nmdc:mga0rr50_17410_c1_2758_3522 | 248 |
| 487 | 3300050514 | nmdc:mga08x19_41_c1 | nmdc:mga08x19_41_c1_48710_49474 | 248 |
| 488 | 3300053153 | Ga0500616_0013871 | Ga0500616_0013871_2098_2862 | 248 |
| 489 | 3300053158 | Ga0500627_0084901 | Ga0500627_0084901_610_1371 | 248 |
| 490 | 3300054114 | Ga0501084_0066359 | Ga0501084_0066359_2074_2832 | 248 |
| 491 | 3300005336 | Ga0070680_100219367 | Ga0070680_1002193672 | 249 |
| 492 | 3300005340 | Ga0070689_100056545 | Ga0070689_1000565453 | 249 |
| 493 | 3300005343 | Ga0070687_100062502 | Ga0070687_1000625022 | 249 |
| 494 | 3300005365 | Ga0070688_100342702 | Ga0070688_1003427022 | 249 |
| 495 | 3300005456 | Ga0070678_100771195 | Ga0070678_1007711951 | 249 |
| 496 | 3300005466 | Ga0070685_10225201 | Ga0070685_102252011 | 249 |
| 497 | 3300005530 | Ga0070679_100046195 | Ga0070679_1000461952 | 249 |
| 498 | 3300005530 | Ga0070679_100060704 | Ga0070679_1000607042 | 249 |
| 499 | 3300005545 | Ga0070695_100262542 | Ga0070695_1002625422 | 249 |
| 500 | 3300005843 | Ga0068860_100796095 | Ga0068860_1007960951 | 249 |
| 501 | 3300005981 | Ga0081538_10000527 | Ga0081538_1000052739 | 249 |
| 502 | 3300005983 | Ga0081540_1000726 | Ga0081540_100072613 | 249 |
| 503 | 3300005983 | Ga0081540_1020212 | Ga0081540_10202123 | 249 |
| 504 | 3300006028 | Ga0070717_10150400 | Ga0070717_101504002 | 249 |
| 505 | 3300006847 | Ga0075431_100115431 | Ga0075431_1001154313 | 249 |
| 506 | 3300006852 | Ga0075433_10010430 | Ga0075433_100104302 | 249 |
| 507 | 3300006914 | Ga0075436_100077423 | Ga0075436_1000774232 | 249 |
| 508 | 3300007076 | Ga0075435_100259981 | Ga0075435_1002599812 | 249 |
| 509 | 3300009094 | Ga0111539_10040323 | Ga0111539_100403232 | 249 |
| 510 | 3300014326 | Ga0157380_10245387 | Ga0157380_102453872 | 249 |
| 511 | 3300014326 | Ga0157380_10448235 | Ga0157380_104482352 | 249 |
| 512 | 3300025912 | Ga0207707_10270699 | Ga0207707_102706992 | 249 |
| 513 | 3300025917 | Ga0207660_10199477 | Ga0207660_101994772 | 249 |
| 514 | 3300025921 | Ga0207652_10089883 | Ga0207652_100898834 | 249 |
| 515 | 3300027907 | Ga0207428_10077375 | Ga0207428_100773753 | 249 |
| 516 | 3300028577 | Ga0265318_10029776 | Ga0265318_100297762 | 249 |
| 517 | 3300028800 | Ga0265338_10139074 | Ga0265338_101390742 | 249 |
| 518 | 3300031240 | Ga0265320_10082411 | Ga0265320_100824111 | 249 |
| 519 | 3300031240 | Ga0265320_10175548 | Ga0265320_101755481 | 249 |
| 520 | 3300031241 | Ga0265325_10118973 | Ga0265325_101189732 | 249 |
| 521 | 3300031247 | Ga0265340_10011212 | Ga0265340_100112124 | 249 |
| 522 | 3300031247 | Ga0265340_10024605 | Ga0265340_100246052 | 249 |
| 523 | 3300031247 | Ga0265340_10148477 | Ga0265340_101484772 | 249 |
| 524 | 3300031344 | Ga0265316_10105874 | Ga0265316_101058742 | 249 |
| 525 | 3300031344 | Ga0265316_10150075 | Ga0265316_101500752 | 249 |
| 526 | 3300031344 | Ga0265316_10160787 | Ga0265316_101607872 | 249 |
| 527 | 3300031456 | Ga0307513_10241655 | Ga0307513_102416551 | 249 |
| 528 | 3300031456 | Ga0307513_10279912 | Ga0307513_102799122 | 249 |
| 529 | 3300031711 | Ga0265314_10085876 | Ga0265314_100858762 | 249 |
| 530 | 3300031712 | Ga0265342_10111875 | Ga0265342_101118752 | 249 |
| 531 | 3300032002 | Ga0307416_100627194 | Ga0307416_1006271941 | 249 |
| 532 | 3300032126 | Ga0307415_100365661 | Ga0307415_1003656612 | 249 |
| 533 | 3300035115 | Ga0373941_0036236 | Ga0373941_0036236_277_1119 | 249 |
| 534 | 3300046460 | Ga0495638_0013717 | Ga0495638_0013717_543_1352 | 249 |
| 535 | 3300046460 | Ga0495638_0020278 | Ga0495638_0020278_1876_2643 | 249 |
| 536 | 3300046519 | Ga0495632_0137310 | Ga0495632_0137310_304_1104 | 249 |
| 537 | 3300049570 | Ga0501033_0026669 | Ga0501033_0026669_1002_1889 | 249 |
| 538 | 3300049571 | Ga0501034_0068135 | Ga0501034_0068135_123_977 | 249 |
| 539 | 3300049575 | Ga0501039_0539221 | Ga0501039_0539221_42_839 | 249 |
| 540 | 3300049578 | Ga0501042_0178016 | Ga0501042_0178016_14_787 | 249 |
| 541 | 3300049579 | Ga0501043_0391976 | Ga0501043_0391976_129_971 | 249 |
| 542 | 3300049581 | Ga0501047_0202384 | Ga0501047_0202384_721_1608 | 249 |
| 543 | 3300049581 | Ga0501047_0317529 | Ga0501047_0317529_177_974 | 249 |
| 544 | 3300049582 | Ga0501048_0183665 | Ga0501048_0183665_50_844 | 249 |
| 545 | 3300049588 | Ga0501072_0003589 | Ga0501072_0003589_1508_2308 | 249 |
| 546 | 3300049588 | Ga0501072_0034700 | Ga0501072_0034700_1623_2408 | 249 |
| 547 | 3300049591 | Ga0501075_0092992 | Ga0501075_0092992_592_1377 | 249 |
| 548 | 3300049742 | Ga0501080_0046132 | Ga0501080_0046132_654_1541 | 249 |
| 549 | 3300049742 | Ga0501080_0074874 | Ga0501080_0074874_922_1716 | 249 |
| 550 | 3300049743 | Ga0501081_0043403 | Ga0501081_0043403_1581_2366 | 249 |
| 551 | 3300049822 | Ga0501035_0229904 | Ga0501035_0229904_521_1408 | 249 |
| 552 | 3300049823 | Ga0501044_0276632 | Ga0501044_0276632_266_1153 | 249 |
| 553 | 3300049823 | Ga0501044_0327585 | Ga0501044_0327585_323_1096 | 249 |
| 554 | 3300050510 | nmdc:mga06r32_385591_c1 | nmdc:mga06r32_385591_c1_339_1136 | 249 |
| 555 | 3300050510 | nmdc:mga06r32_47678_c1 | nmdc:mga06r32_47678_c1_1108_1893 | 249 |
| 556 | 3300050511 | nmdc:mga08y16_221722_c1 | nmdc:mga08y16_221722_c1_334_1134 | 249 |
| 557 | 3300050511 | nmdc:mga08y16_7789_c1 | nmdc:mga08y16_7789_c1_1747_2532 | 249 |
| 558 | 3300050515 | nmdc:mga0a205_106301_c1 | nmdc:mga0a205_106301_c1_612_1412 | 249 |
| 559 | 3300053117 | Ga0500593_075640 | Ga0500593_075640_99_881 | 249 |
| 560 | 3300053131 | Ga0500652_000367 | Ga0500652_000367_4619_5395 | 249 |
| 561 | 3300053151 | Ga0500604_0051425 | Ga0500604_0051425_153_953 | 249 |
| 562 | 3300054114 | Ga0501084_0059726 | Ga0501084_0059726_2111_2896 | 249 |
| 563 | 3300060353 | Ga0501082_0021799 | Ga0501082_0021799_4603_5388 | 249 |
| 564 | 3300061734 | Ga0530510_0350108 | Ga0530510_0350108_114_899 | 249 |
| 565 | iso_pu_bacteria | 2599185359 | 2600225873 | 249 |
| 566 | 3300005338 | Ga0068868_100046239 | Ga0068868_1000462391 | 250 |
| 567 | 3300005345 | Ga0070692_10226109 | Ga0070692_102261092 | 250 |
| 568 | 3300005347 | Ga0070668_100146731 | Ga0070668_1001467312 | 250 |
| 569 | 3300005365 | Ga0070688_100232067 | Ga0070688_1002320671 | 250 |
| 570 | 3300005444 | Ga0070694_100139104 | Ga0070694_1001391042 | 250 |
| 571 | 3300005546 | Ga0070696_100072374 | Ga0070696_1000723743 | 250 |
| 572 | 3300005549 | Ga0070704_100377604 | Ga0070704_1003776042 | 250 |
| 573 | 3300005577 | Ga0068857_100116672 | Ga0068857_1001166723 | 250 |
| 574 | 3300005578 | Ga0068854_100045272 | Ga0068854_1000452723 | 250 |
| 575 | 3300005615 | Ga0070702_100063557 | Ga0070702_1000635572 | 250 |
| 576 | 3300006178 | Ga0075367_10036467 | Ga0075367_100364672 | 250 |
| 577 | 3300006195 | Ga0075366_10055843 | Ga0075366_100558432 | 250 |
| 578 | 3300006881 | Ga0068865_100077410 | Ga0068865_1000774102 | 250 |
| 579 | 3300009094 | Ga0111539_10458803 | Ga0111539_104588032 | 250 |
| 580 | 3300009148 | Ga0105243_10598668 | Ga0105243_105986681 | 250 |
| 581 | 3300009545 | Ga0105237_10008094 | Ga0105237_1000809410 | 250 |
| 582 | 3300009545 | Ga0105237_10251446 | Ga0105237_102514462 | 250 |
| 583 | 3300009553 | Ga0105249_10137950 | Ga0105249_101379501 | 250 |
| 584 | 3300013296 | Ga0157374_10391275 | Ga0157374_103912752 | 250 |
| 585 | 3300014968 | Ga0157379_10065537 | Ga0157379_100655373 | 250 |
| 586 | 3300021388 | Ga0213875_10120815 | Ga0213875_101208151 | 250 |
| 587 | 3300025914 | Ga0207671_10004388 | Ga0207671_1000438810 | 250 |
| 588 | 3300025981 | Ga0207640_10048623 | Ga0207640_100486232 | 250 |
| 589 | 3300025986 | Ga0207658_10185552 | Ga0207658_101855522 | 250 |
| 590 | 3300026035 | Ga0207703_10021441 | Ga0207703_100214414 | 250 |
| 591 | 3300026035 | Ga0207703_10412947 | Ga0207703_104129472 | 250 |
| 592 | 3300026116 | Ga0207674_10054075 | Ga0207674_100540754 | 250 |
| 593 | 3300027717 | Ga0209998_10003426 | Ga0209998_100034261 | 250 |
| 594 | 3300031595 | Ga0265313_10167319 | Ga0265313_101673191 | 250 |
| 595 | 3300036401 | Ga0373937_0584210 | Ga0373937_0584210_85_891 | 250 |
| 596 | 3300037068 | Ga0373925_0079599 | Ga0373925_0079599_1640_2443 | 250 |
| 597 | 3300037853 | Ga0436364_0111944 | Ga0436364_0111944_2606_3424 | 250 |
| 598 | 3300037853 | Ga0436364_1001667 | Ga0436364_1001667_1497_2327 | 250 |
| 599 | 3300039437 | Ga0436365_1456072 | Ga0436365_1456072_299_1129 | 250 |
| 600 | 3300046491 | Ga0495584_0018076 | Ga0495584_0018076_2479_3264 | 250 |
| 601 | 3300046523 | Ga0495644_0154709 | Ga0495644_0154709_26_811 | 250 |
| 602 | 3300047318 | Ga0495636_0045156 | Ga0495636_0045156_500_1285 | 250 |
| 603 | 3300047320 | Ga0495672_0061206 | Ga0495672_0061206_942_1718 | 250 |
| 604 | 3300047322 | Ga0495680_0297523 | Ga0495680_0297523_132_938 | 250 |
| 605 | 3300048904 | Ga0496101_0195260 | Ga0496101_0195260_399_1184 | 250 |
| 606 | 3300048905 | Ga0496102_0139782 | Ga0496102_0139782_535_1320 | 250 |
| 607 | 3300048906 | Ga0496103_0048675 | Ga0496103_0048675_1166_1951 | 250 |
| 608 | 3300048910 | Ga0496107_0327157 | Ga0496107_0327157_57_842 | 250 |
| 609 | 3300048911 | Ga0496108_0096466 | Ga0496108_0096466_152_937 | 250 |
| 610 | 3300048912 | Ga0496109_0707682 | Ga0496109_0707682_120_905 | 250 |
| 611 | 3300048913 | Ga0496110_0148154 | Ga0496110_0148154_59_844 | 250 |
| 612 | 3300048916 | Ga0496113_0317301 | Ga0496113_0317301_350_1135 | 250 |
| 613 | 3300048923 | Ga0496120_0021622 | Ga0496120_0021622_2979_3761 | 250 |
| 614 | 3300048925 | Ga0496122_0017867 | Ga0496122_0017867_1298_2062 | 250 |
| 615 | 3300048926 | Ga0496123_0024445 | Ga0496123_0024445_729_1493 | 250 |
| 616 | 3300048926 | Ga0496123_0068760 | Ga0496123_0068760_629_1393 | 250 |
| 617 | 3300048926 | Ga0496123_0069603 | Ga0496123_0069603_759_1523 | 250 |
| 618 | 3300048927 | Ga0496124_0000325 | Ga0496124_0000325_59896_60678 | 250 |
| 619 | 3300048927 | Ga0496124_0014367 | Ga0496124_0014367_3130_3894 | 250 |
| 620 | 3300048927 | Ga0496124_0018025 | Ga0496124_0018025_3049_3813 | 250 |
| 621 | 3300048927 | Ga0496124_0268110 | Ga0496124_0268110_318_1082 | 250 |
| 622 | 3300049572 | Ga0501036_0017141 | Ga0501036_0017141_5179_5997 | 250 |
| 623 | 3300049574 | Ga0501038_0044737 | Ga0501038_0044737_1138_1956 | 250 |
| 624 | 3300049574 | Ga0501038_0106273 | Ga0501038_0106273_1339_2121 | 250 |
| 625 | 3300049576 | Ga0501040_0021923 | Ga0501040_0021923_843_1661 | 250 |
| 626 | 3300049576 | Ga0501040_0207714 | Ga0501040_0207714_508_1290 | 250 |
| 627 | 3300049577 | Ga0501041_0008832 | Ga0501041_0008832_4544_5362 | 250 |
| 628 | 3300049577 | Ga0501041_0101960 | Ga0501041_0101960_63_848 | 250 |
| 629 | 3300049578 | Ga0501042_0041034 | Ga0501042_0041034_113_928 | 250 |
| 630 | 3300049578 | Ga0501042_0055688 | Ga0501042_0055688_1455_2273 | 250 |
| 631 | 3300049578 | Ga0501042_0445641 | Ga0501042_0445641_115_900 | 250 |
| 632 | 3300049582 | Ga0501048_0077188 | Ga0501048_0077188_509_1294 | 250 |
| 633 | 3300049586 | Ga0501070_0294523 | Ga0501070_0294523_72_857 | 250 |
| 634 | 3300049586 | Ga0501070_0388996 | Ga0501070_0388996_295_1113 | 250 |
| 635 | 3300049588 | Ga0501072_0015972 | Ga0501072_0015972_4894_5676 | 250 |
| 636 | 3300049591 | Ga0501075_0015402 | Ga0501075_0015402_3014_3832 | 250 |
| 637 | 3300049593 | Ga0501077_0011334 | Ga0501077_0011334_291_1109 | 250 |
| 638 | 3300049741 | Ga0501079_0024305 | Ga0501079_0024305_2643_3428 | 250 |
| 639 | 3300049744 | Ga0501083_0042504 | Ga0501083_0042504_1767_2552 | 250 |
| 640 | 3300049824 | Ga0501045_0028267 | Ga0501045_0028267_1239_2057 | 250 |
| 641 | 3300049824 | Ga0501045_0375107 | Ga0501045_0375107_188_973 | 250 |
| 642 | 3300050493 | nmdc:mga0k408_89680_c1 | nmdc:mga0k408_89680_c1_25_819 | 250 |
| 643 | 3300050512 | nmdc:mga0n895_184680_c1 | nmdc:mga0n895_184680_c1_1072_1857 | 250 |
| 644 | 3300053083 | Ga0495655_0019246 | Ga0495655_0019246_707_1492 | 250 |
| 645 | 3300061734 | Ga0530510_0086459 | Ga0530510_0086459_499_1284 | 250 |
| 646 | 3300061734 | Ga0530510_0089986 | Ga0530510_0089986_1288_2073 | 250 |
| 647 | iso_pu_bacteria | 2818991466 | 2819716323 | 250 |
| 648 | iso_pu_bacteria | 2879163058 | 2879164045 | 250 |
| 649 | iso_pu_bacteria | 2928526807 | 2928528873 | 250 |
| 650 | iso_pu_bacteria | 2928968154 | 2928970425 | 250 |
| 651 | 2162886007 | SwRhRL2b_contig_1628267 | SwRhRL2b_0706.00003980 | 251 |
| 652 | 3300001978 | JGI24747J21853_1003541 | JGI24747J21853_10035412 | 251 |
| 653 | 3300001990 | JGI24737J22298_10018418 | JGI24737J22298_100184182 | 251 |
| 654 | 3300002067 | JGI24735J21928_10048699 | JGI24735J21928_100486991 | 251 |
| 655 | 3300002070 | JGI24750J21931_1001174 | JGI24750J21931_10011743 | 251 |
| 656 | 3300002075 | JGI24738J21930_10019629 | JGI24738J21930_100196292 | 251 |
| 657 | 3300005289 | Ga0065704_10001326 | Ga0065704_100013266 | 251 |
| 658 | 3300005327 | Ga0070658_10075828 | Ga0070658_100758282 | 251 |
| 659 | 3300005328 | Ga0070676_10015602 | Ga0070676_100156024 | 251 |
| 660 | 3300005330 | Ga0070690_100000374 | Ga0070690_10000037411 | 251 |
| 661 | 3300005331 | Ga0070670_100003963 | Ga0070670_10000396310 | 251 |
| 662 | 3300005335 | Ga0070666_10004674 | Ga0070666_100046746 | 251 |
| 663 | 3300005336 | Ga0070680_100008223 | Ga0070680_1000082236 | 251 |
| 664 | 3300005337 | Ga0070682_100001371 | Ga0070682_10000137112 | 251 |
| 665 | 3300005339 | Ga0070660_100000601 | Ga0070660_10000060115 | 251 |
| 666 | 3300005340 | Ga0070689_100001212 | Ga0070689_1000012125 | 251 |
| 667 | 3300005341 | Ga0070691_10000403 | Ga0070691_1000040311 | 251 |
| 668 | 3300005343 | Ga0070687_100001226 | Ga0070687_1000012268 | 251 |
| 669 | 3300005344 | Ga0070661_100002128 | Ga0070661_1000021285 | 251 |
| 670 | 3300005345 | Ga0070692_10000588 | Ga0070692_100005885 | 251 |
| 671 | 3300005347 | Ga0070668_100000244 | Ga0070668_10000024412 | 251 |
| 672 | 3300005347 | Ga0070668_100534842 | Ga0070668_1005348422 | 251 |
| 673 | 3300005353 | Ga0070669_100003798 | Ga0070669_1000037989 | 251 |
| 674 | 3300005353 | Ga0070669_100341123 | Ga0070669_1003411232 | 251 |
| 675 | 3300005354 | Ga0070675_100001316 | Ga0070675_1000013167 | 251 |
| 676 | 3300005355 | Ga0070671_100001369 | Ga0070671_1000013697 | 251 |
| 677 | 3300005356 | Ga0070674_100002970 | Ga0070674_1000029708 | 251 |
| 678 | 3300005364 | Ga0070673_100000356 | Ga0070673_10000035610 | 251 |
| 679 | 3300005365 | Ga0070688_100001697 | Ga0070688_1000016974 | 251 |
| 680 | 3300005366 | Ga0070659_100001001 | Ga0070659_10000100111 | 251 |
| 681 | 3300005367 | Ga0070667_100002918 | Ga0070667_1000029185 | 251 |
| 682 | 3300005434 | Ga0070709_10000515 | Ga0070709_100005158 | 251 |
| 683 | 3300005435 | Ga0070714_100001611 | Ga0070714_1000016116 | 251 |
| 684 | 3300005436 | Ga0070713_100014697 | Ga0070713_1000146974 | 251 |
| 685 | 3300005437 | Ga0070710_10000792 | Ga0070710_1000079212 | 251 |
| 686 | 3300005438 | Ga0070701_10004797 | Ga0070701_100047972 | 251 |
| 687 | 3300005439 | Ga0070711_100000456 | Ga0070711_10000045611 | 251 |
| 688 | 3300005440 | Ga0070705_100000465 | Ga0070705_10000046511 | 251 |
| 689 | 3300005441 | Ga0070700_100000474 | Ga0070700_1000004747 | 251 |
| 690 | 3300005444 | Ga0070694_100014944 | Ga0070694_1000149442 | 251 |
| 691 | 3300005455 | Ga0070663_100005700 | Ga0070663_1000057002 | 251 |
| 692 | 3300005456 | Ga0070678_100000779 | Ga0070678_1000007798 | 251 |
| 693 | 3300005457 | Ga0070662_100009283 | Ga0070662_1000092834 | 251 |
| 694 | 3300005458 | Ga0070681_10020432 | Ga0070681_100204322 | 251 |
| 695 | 3300005459 | Ga0068867_100088225 | Ga0068867_1000882253 | 251 |
| 696 | 3300005466 | Ga0070685_10026919 | Ga0070685_100269193 | 251 |
| 697 | 3300005535 | Ga0070684_100008442 | Ga0070684_1000084422 | 251 |
| 698 | 3300005536 | Ga0070697_100002257 | Ga0070697_10000225710 | 251 |
| 699 | 3300005539 | Ga0068853_100001967 | Ga0068853_10000196712 | 251 |
| 700 | 3300005543 | Ga0070672_100000593 | Ga0070672_1000005933 | 251 |
| 701 | 3300005544 | Ga0070686_100000944 | Ga0070686_10000094411 | 251 |
| 702 | 3300005545 | Ga0070695_100001660 | Ga0070695_1000016608 | 251 |
| 703 | 3300005546 | Ga0070696_100045582 | Ga0070696_1000455822 | 251 |
| 704 | 3300005547 | Ga0070693_100000655 | Ga0070693_10000065512 | 251 |
| 705 | 3300005548 | Ga0070665_100015319 | Ga0070665_1000153196 | 251 |
| 706 | 3300005548 | Ga0070665_100094013 | Ga0070665_1000940132 | 251 |
| 707 | 3300005549 | Ga0070704_100000439 | Ga0070704_1000004396 | 251 |
| 708 | 3300005563 | Ga0068855_100007707 | Ga0068855_1000077073 | 251 |
| 709 | 3300005564 | Ga0070664_100002755 | Ga0070664_1000027554 | 251 |
| 710 | 3300005564 | Ga0070664_100751667 | Ga0070664_1007516672 | 251 |
| 711 | 3300005578 | Ga0068854_100002052 | Ga0068854_1000020522 | 251 |
| 712 | 3300005614 | Ga0068856_100002475 | Ga0068856_10000247516 | 251 |
| 713 | 3300005615 | Ga0070702_100000613 | Ga0070702_10000061310 | 251 |
| 714 | 3300005616 | Ga0068852_100091581 | Ga0068852_1000915812 | 251 |
| 715 | 3300005617 | Ga0068859_100002629 | Ga0068859_10000262913 | 251 |
| 716 | 3300005617 | Ga0068859_100329241 | Ga0068859_1003292412 | 251 |
| 717 | 3300005618 | Ga0068864_100001166 | Ga0068864_10000116613 | 251 |
| 718 | 3300005718 | Ga0068866_10000608 | Ga0068866_1000060810 | 251 |
| 719 | 3300005719 | Ga0068861_100002476 | Ga0068861_1000024766 | 251 |
| 720 | 3300005841 | Ga0068863_100002189 | Ga0068863_1000021898 | 251 |
| 721 | 3300005842 | Ga0068858_100008733 | Ga0068858_1000087332 | 251 |
| 722 | 3300005843 | Ga0068860_100001510 | Ga0068860_10000151015 | 251 |
| 723 | 3300005844 | Ga0068862_100006358 | Ga0068862_1000063586 | 251 |
| 724 | 3300005937 | Ga0081455_10028476 | Ga0081455_100284762 | 251 |
| 725 | 3300006163 | Ga0070715_10000212 | Ga0070715_100002122 | 251 |
| 726 | 3300006173 | Ga0070716_100002398 | Ga0070716_1000023982 | 251 |
| 727 | 3300006175 | Ga0070712_100001371 | Ga0070712_1000013719 | 251 |
| 728 | 3300006237 | Ga0097621_100035352 | Ga0097621_1000353524 | 251 |
| 729 | 3300006237 | Ga0097621_100618057 | Ga0097621_1006180572 | 251 |
| 730 | 3300006881 | Ga0068865_100003706 | Ga0068865_1000037066 | 251 |
| 731 | 3300006931 | Ga0097620_100002628 | Ga0097620_10000262813 | 251 |
| 732 | 3300006931 | Ga0097620_100329236 | Ga0097620_1003292362 | 251 |
| 733 | 3300009093 | Ga0105240_10013652 | Ga0105240_1001365210 | 251 |
| 734 | 3300009093 | Ga0105240_10841749 | Ga0105240_108417491 | 251 |
| 735 | 3300009101 | Ga0105247_10000949 | Ga0105247_1000094910 | 251 |
| 736 | 3300009148 | Ga0105243_10003755 | Ga0105243_100037558 | 251 |
| 737 | 3300009174 | Ga0105241_10000973 | Ga0105241_1000097310 | 251 |
| 738 | 3300009176 | Ga0105242_10000217 | Ga0105242_1000021710 | 251 |
| 739 | 3300009177 | Ga0105248_10000487 | Ga0105248_100004879 | 251 |
| 740 | 3300009545 | Ga0105237_10000638 | Ga0105237_1000063812 | 251 |
| 741 | 3300009551 | Ga0105238_10009653 | Ga0105238_100096537 | 251 |
| 742 | 3300009553 | Ga0105249_10001683 | Ga0105249_1000168318 | 251 |
| 743 | 3300011119 | Ga0105246_10002121 | Ga0105246_100021215 | 251 |
| 744 | 3300013100 | Ga0157373_10018963 | Ga0157373_100189634 | 251 |
| 745 | 3300013102 | Ga0157371_10012149 | Ga0157371_100121492 | 251 |
| 746 | 3300013105 | Ga0157369_10001385 | Ga0157369_1000138516 | 251 |
| 747 | 3300013296 | Ga0157374_10006058 | Ga0157374_100060583 | 251 |
| 748 | 3300013297 | Ga0157378_10001965 | Ga0157378_100019659 | 251 |
| 749 | 3300013306 | Ga0163162_10000935 | Ga0163162_100009352 | 251 |
| 750 | 3300013307 | Ga0157372_10002028 | Ga0157372_1000202812 | 251 |
| 751 | 3300013308 | Ga0157375_10002243 | Ga0157375_100022438 | 251 |
| 752 | 3300014325 | Ga0163163_10005752 | Ga0163163_100057523 | 251 |
| 753 | 3300014325 | Ga0163163_10185462 | Ga0163163_101854622 | 251 |
| 754 | 3300014745 | Ga0157377_10012188 | Ga0157377_100121884 | 251 |
| 755 | 3300014968 | Ga0157379_10003497 | Ga0157379_100034974 | 251 |
| 756 | 3300014968 | Ga0157379_10096430 | Ga0157379_100964303 | 251 |
| 757 | 3300014969 | Ga0157376_10001063 | Ga0157376_100010637 | 251 |
| 758 | 3300017792 | Ga0163161_10159133 | Ga0163161_101591332 | 251 |
| 759 | 3300025229 | Ga0209147_101859 | Ga0209147_1018597 | 251 |
| 760 | 3300025315 | Ga0207697_10021964 | Ga0207697_100219641 | 251 |
| 761 | 3300025898 | Ga0207692_10006876 | Ga0207692_100068763 | 251 |
| 762 | 3300025899 | Ga0207642_10017008 | Ga0207642_100170083 | 251 |
| 763 | 3300025900 | Ga0207710_10002675 | Ga0207710_100026754 | 251 |
| 764 | 3300025901 | Ga0207688_10000431 | Ga0207688_1000043111 | 251 |
| 765 | 3300025903 | Ga0207680_10018948 | Ga0207680_100189482 | 251 |
| 766 | 3300025904 | Ga0207647_10057873 | Ga0207647_100578732 | 251 |
| 767 | 3300025905 | Ga0207685_10000775 | Ga0207685_100007755 | 251 |
| 768 | 3300025906 | Ga0207699_10002089 | Ga0207699_100020897 | 251 |
| 769 | 3300025906 | Ga0207699_10108246 | Ga0207699_101082462 | 251 |
| 770 | 3300025907 | Ga0207645_10009143 | Ga0207645_100091435 | 251 |
| 771 | 3300025909 | Ga0207705_10088398 | Ga0207705_100883982 | 251 |
| 772 | 3300025911 | Ga0207654_10002198 | Ga0207654_100021982 | 251 |
| 773 | 3300025912 | Ga0207707_10097771 | Ga0207707_100977712 | 251 |
| 774 | 3300025913 | Ga0207695_10052409 | Ga0207695_100524091 | 251 |
| 775 | 3300025914 | Ga0207671_10009191 | Ga0207671_100091914 | 251 |
| 776 | 3300025915 | Ga0207693_10000278 | Ga0207693_1000027835 | 251 |
| 777 | 3300025916 | Ga0207663_10000927 | Ga0207663_100009277 | 251 |
| 778 | 3300025918 | Ga0207662_10002352 | Ga0207662_100023522 | 251 |
| 779 | 3300025919 | Ga0207657_10000047 | Ga0207657_1000004711 | 251 |
| 780 | 3300025920 | Ga0207649_10001651 | Ga0207649_100016516 | 251 |
| 781 | 3300025921 | Ga0207652_10024920 | Ga0207652_100249204 | 251 |
| 782 | 3300025923 | Ga0207681_10019291 | Ga0207681_100192914 | 251 |
| 783 | 3300025924 | Ga0207694_10009551 | Ga0207694_100095513 | 251 |
| 784 | 3300025925 | Ga0207650_10015241 | Ga0207650_100152414 | 251 |
| 785 | 3300025926 | Ga0207659_10004845 | Ga0207659_100048455 | 251 |
| 786 | 3300025927 | Ga0207687_10022268 | Ga0207687_100222682 | 251 |
| 787 | 3300025928 | Ga0207700_10024152 | Ga0207700_100241524 | 251 |
| 788 | 3300025929 | Ga0207664_10002197 | Ga0207664_100021976 | 251 |
| 789 | 3300025931 | Ga0207644_10010820 | Ga0207644_100108203 | 251 |
| 790 | 3300025932 | Ga0207690_10001227 | Ga0207690_100012277 | 251 |
| 791 | 3300025933 | Ga0207706_10000079 | Ga0207706_1000007991 | 251 |
| 792 | 3300025934 | Ga0207686_10008938 | Ga0207686_100089384 | 251 |
| 793 | 3300025935 | Ga0207709_10004350 | Ga0207709_100043503 | 251 |
| 794 | 3300025936 | Ga0207670_10001314 | Ga0207670_100013148 | 251 |
| 795 | 3300025937 | Ga0207669_10025717 | Ga0207669_100257173 | 251 |
| 796 | 3300025938 | Ga0207704_10389730 | Ga0207704_103897302 | 251 |
| 797 | 3300025939 | Ga0207665_10000432 | Ga0207665_1000043217 | 251 |
| 798 | 3300025940 | Ga0207691_10007351 | Ga0207691_100073518 | 251 |
| 799 | 3300025941 | Ga0207711_10027232 | Ga0207711_100272323 | 251 |
| 800 | 3300025944 | Ga0207661_10027569 | Ga0207661_100275693 | 251 |
| 801 | 3300025945 | Ga0207679_10001961 | Ga0207679_100019618 | 251 |
| 802 | 3300025945 | Ga0207679_10519231 | Ga0207679_105192311 | 251 |
| 803 | 3300025949 | Ga0207667_10009433 | Ga0207667_100094335 | 251 |
| 804 | 3300025960 | Ga0207651_10003659 | Ga0207651_100036595 | 251 |
| 805 | 3300025961 | Ga0207712_10004439 | Ga0207712_100044394 | 251 |
| 806 | 3300025972 | Ga0207668_10004917 | Ga0207668_100049175 | 251 |
| 807 | 3300025981 | Ga0207640_10008947 | Ga0207640_100089475 | 251 |
| 808 | 3300025986 | Ga0207658_10004453 | Ga0207658_100044535 | 251 |
| 809 | 3300025986 | Ga0207658_10034047 | Ga0207658_100340472 | 251 |
| 810 | 3300026035 | Ga0207703_10013192 | Ga0207703_100131922 | 251 |
| 811 | 3300026067 | Ga0207678_10000111 | Ga0207678_1000011135 | 251 |
| 812 | 3300026075 | Ga0207708_10004157 | Ga0207708_100041579 | 251 |
| 813 | 3300026078 | Ga0207702_10004141 | Ga0207702_100041415 | 251 |
| 814 | 3300026088 | Ga0207641_10008713 | Ga0207641_100087133 | 251 |
| 815 | 3300026089 | Ga0207648_10015812 | Ga0207648_100158124 | 251 |
| 816 | 3300026095 | Ga0207676_10005911 | Ga0207676_100059115 | 251 |
| 817 | 3300026118 | Ga0207675_100000424 | Ga0207675_10000042410 | 251 |
| 818 | 3300026121 | Ga0207683_10000026 | Ga0207683_1000002699 | 251 |
| 819 | 3300026142 | Ga0207698_10016682 | Ga0207698_100166823 | 251 |
| 820 | 3300028379 | Ga0268266_10008327 | Ga0268266_100083272 | 251 |
| 821 | 3300028380 | Ga0268265_10008336 | Ga0268265_100083364 | 251 |
| 822 | 3300035085 | Ga0373929_0018745 | Ga0373929_0018745_180_971 | 251 |
| 823 | 3300035088 | Ga0373940_0027937 | Ga0373940_0027937_54_845 | 251 |
| 824 | 3300035089 | Ga0373944_0082042 | Ga0373944_0082042_234_1025 | 251 |
| 825 | 3300035090 | Ga0373949_0010516 | Ga0373949_0010516_165_956 | 251 |
| 826 | 3300035112 | Ga0373932_0026197 | Ga0373932_0026197_681_1472 | 251 |
| 827 | 3300035115 | Ga0373941_0010659 | Ga0373941_0010659_649_1440 | 251 |
| 828 | 3300035121 | Ga0373960_0001193 | Ga0373960_0001193_2336_3127 | 251 |
| 829 | 3300035171 | Ga0373946_0012816 | Ga0373946_0012816_228_1019 | 251 |
| 830 | 3300035242 | Ga0373962_0004899 | Ga0373962_0004899_2160_2951 | 251 |
| 831 | 3300035691 | Ga0373931_0013273 | Ga0373931_0013273_1605_2396 | 251 |
| 832 | 3300035692 | Ga0373935_0107237 | Ga0373935_0107237_747_1538 | 251 |
| 833 | 3300036401 | Ga0373937_0095808 | Ga0373937_0095808_1390_2181 | 251 |
| 834 | 3300037068 | Ga0373925_0002314 | Ga0373925_0002314_3517_4308 | 251 |
| 835 | 3300046455 | Ga0495603_0000133 | Ga0495603_0000133_34580_35371 | 251 |
| 836 | 3300046459 | Ga0495629_0060445 | Ga0495629_0060445_1527_2318 | 251 |
| 837 | 3300046461 | Ga0495641_0032986 | Ga0495641_0032986_818_1609 | 251 |
| 838 | 3300046472 | Ga0495580_0000173 | Ga0495580_0000173_18181_18972 | 251 |
| 839 | 3300046473 | Ga0495582_0000518 | Ga0495582_0000518_1499_2290 | 251 |
| 840 | 3300046475 | Ga0495639_0001342 | Ga0495639_0001342_5180_5971 | 251 |
| 841 | 3300046476 | Ga0495662_0130977 | Ga0495662_0130977_234_1025 | 251 |
| 842 | 3300046491 | Ga0495584_0058378 | Ga0495584_0058378_916_1707 | 251 |
| 843 | 3300046499 | Ga0495594_0000755 | Ga0495594_0000755_11104_11895 | 251 |
| 844 | 3300046512 | Ga0495610_0000102 | Ga0495610_0000102_94517_95272 | 251 |
| 845 | 3300046519 | Ga0495632_0000013 | Ga0495632_0000013_21883_22638 | 251 |
| 846 | 3300046520 | Ga0495637_0000229 | Ga0495637_0000229_39507_40262 | 251 |
| 847 | 3300046520 | Ga0495637_0003875 | Ga0495637_0003875_679_1434 | 251 |
| 848 | 3300046522 | Ga0495643_0000010 | Ga0495643_0000010_160458_161213 | 251 |
| 849 | 3300046524 | Ga0495648_0005640 | Ga0495648_0005640_7673_8428 | 251 |
| 850 | 3300046525 | Ga0495663_0000004 | Ga0495663_0000004_129147_129902 | 251 |
| 851 | 3300046531 | Ga0495665_0009595 | Ga0495665_0009595_2190_2981 | 251 |
| 852 | 3300046533 | Ga0495640_0113802 | Ga0495640_0113802_854_1645 | 251 |
| 853 | 3300046557 | Ga0495622_0024401 | Ga0495622_0024401_179_970 | 251 |
| 854 | 3300046558 | Ga0495633_0000092 | Ga0495633_0000092_2721_3476 | 251 |
| 855 | 3300046558 | Ga0495633_0002370 | Ga0495633_0002370_9974_10729 | 251 |
| 856 | 3300046558 | Ga0495633_0009961 | Ga0495633_0009961_2690_3466 | 251 |
| 857 | 3300046642 | Ga0495634_0005211 | Ga0495634_0005211_1139_1930 | 251 |
| 858 | 3300046660 | Ga0495625_0010628 | Ga0495625_0010628_6131_6886 | 251 |
| 859 | 3300046674 | Ga0495588_0001185 | Ga0495588_0001185_1422_2213 | 251 |
| 860 | 3300046681 | Ga0495647_0001112 | Ga0495647_0001112_2479_3270 | 251 |
| 861 | 3300046683 | Ga0495658_0000605 | Ga0495658_0000605_9718_10509 | 251 |
| 862 | 3300046690 | Ga0495624_0109294 | Ga0495624_0109294_325_1116 | 251 |
| 863 | 3300046692 | Ga0495671_0000014 | Ga0495671_0000014_160458_161213 | 251 |
| 864 | 3300047315 | Ga0495581_0004284 | Ga0495581_0004284_5486_6277 | 251 |
| 865 | 3300047321 | Ga0495676_0022592 | Ga0495676_0022592_2590_3381 | 251 |
| 866 | 3300047322 | Ga0495680_0238470 | Ga0495680_0238470_418_1209 | 251 |
| 867 | 3300047470 | Ga0495681_0000104 | Ga0495681_0000104_38718_39473 | 251 |
| 868 | 3300047470 | Ga0495681_0001853 | Ga0495681_0001853_11770_12525 | 251 |
| 869 | 3300047471 | Ga0495684_0326339 | Ga0495684_0326339_85_876 | 251 |
| 870 | 3300047472 | Ga0495686_0014266 | Ga0495686_0014266_1731_2486 | 251 |
| 871 | 3300047673 | Ga0495593_0000542 | Ga0495593_0000542_9435_10226 | 251 |
| 872 | 3300048089 | Ga0495614_0032376 | Ga0495614_0032376_112_903 | 251 |
| 873 | 3300048903 | Ga0496100_0005987 | Ga0496100_0005987_3034_3825 | 251 |
| 874 | 3300048904 | Ga0496101_0003489 | Ga0496101_0003489_5006_5797 | 251 |
| 875 | 3300048905 | Ga0496102_0024330 | Ga0496102_0024330_1395_2186 | 251 |
| 876 | 3300048907 | Ga0496104_0033474 | Ga0496104_0033474_2209_3000 | 251 |
| 877 | 3300048908 | Ga0496105_0029366 | Ga0496105_0029366_3208_3999 | 251 |
| 878 | 3300048909 | Ga0496106_0005954 | Ga0496106_0005954_6006_6797 | 251 |
| 879 | 3300048910 | Ga0496107_0003242 | Ga0496107_0003242_4158_4949 | 251 |
| 880 | 3300048911 | Ga0496108_0001293 | Ga0496108_0001293_17145_17900 | 251 |
| 881 | 3300048911 | Ga0496108_0009953 | Ga0496108_0009953_4012_4803 | 251 |
| 882 | 3300048912 | Ga0496109_0014922 | Ga0496109_0014922_4112_4903 | 251 |
| 883 | 3300048912 | Ga0496109_0025936 | Ga0496109_0025936_1518_2309 | 251 |
| 884 | 3300048913 | Ga0496110_0007501 | Ga0496110_0007501_2209_3000 | 251 |
| 885 | 3300048914 | Ga0496111_0007534 | Ga0496111_0007534_4140_4931 | 251 |
| 886 | 3300048914 | Ga0496111_0139261 | Ga0496111_0139261_692_1483 | 251 |
| 887 | 3300048915 | Ga0496112_0005647 | Ga0496112_0005647_7753_8544 | 251 |
| 888 | 3300048915 | Ga0496112_0049717 | Ga0496112_0049717_3279_4070 | 251 |
| 889 | 3300048916 | Ga0496113_0004308 | Ga0496113_0004308_5717_6508 | 251 |
| 890 | 3300048917 | Ga0496114_0008772 | Ga0496114_0008772_4012_4803 | 251 |
| 891 | 3300048918 | Ga0496115_0030526 | Ga0496115_0030526_252_1043 | 251 |
| 892 | 3300048918 | Ga0496115_0483296 | Ga0496115_0483296_161_952 | 251 |
| 893 | 3300048919 | Ga0496116_0080861 | Ga0496116_0080861_786_1541 | 251 |
| 894 | 3300048924 | Ga0496121_0003339 | Ga0496121_0003339_5179_5934 | 251 |
| 895 | 3300048925 | Ga0496122_0075458 | Ga0496122_0075458_357_1115 | 251 |
| 896 | 3300048926 | Ga0496123_0233305 | Ga0496123_0233305_116_874 | 251 |
| 897 | 3300048928 | Ga0496125_0027815 | Ga0496125_0027815_3467_4222 | 251 |
| 898 | 3300049459 | Ga0495678_008677 | Ga0495678_008677_3846_4601 | 251 |
| 899 | 3300049744 | Ga0501083_0072856 | Ga0501083_0072856_1024_1788 | 251 |
| 900 | 3300053083 | Ga0495655_0006625 | Ga0495655_0006625_1053_1844 | 251 |
| 901 | 3300053084 | Ga0495595_0005795 | Ga0495595_0005795_537_1328 | 251 |
| 902 | 3300053157 | Ga0500624_000107 | Ga0500624_000107_35292_36056 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bkb-assembly1.cif.gz_B | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) | 0.8216 | 4 | 245 |
| 5odq-assembly1.cif.gz_B | heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. | 0.8097 | 4 | 245 |
| 7bkb-assembly1.cif.gz_B | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) | 0.7918 | 4 | 245 |
| 1oe6-assembly1.cif.gz_A | xenopus smug1, an anti-mutator uracil-dna glycosylase | 0.7831 | 185 | 233 |
| 5odq-assembly1.cif.gz_B | heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. | 0.7806 | 4 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77252_132_217_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9656 | 135 | 218 | 3.40.30.10 |
| af_P77252_3_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9574 | 6 | 81 | 3.40.30.10 |
| af_P77252_132_217_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9334 | 135 | 218 | 3.40.30.10 |
| af_P52074_170_256_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9233 | 6 | 81 | 3.40.30.10 |
| af_P0A996_163_249_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9057 | 6 | 81 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351T825-F1-model_v4 | Fe-S oxidoreductase | 0.9991 | 4 | 117 |
GO:0005829
GO:0016491 |
| AF-A0A196MA39-F1-model_v4 | Fe-S oxidoreductase | 0.997 | 1 | 251 |
GO:0005829
GO:0016491 |
| AF-A0A175R7C8-F1-model_v4 | Fe-S oxidoreductase | 0.9932 | 4 | 250 |
GO:0005829
GO:0016491 |
| AF-A0A6I6IXL7-F1-model_v4 | (Fe-S)-binding protein | 0.9919 | 3 | 251 |
GO:0005829
GO:0016491 |
| AF-A0A2E9Y258-F1-model_v4 | Fe-S oxidoreductase | 0.9908 | 2 | 250 |
GO:0005829
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar