F485228

General Info

Members Datasets Scaffolds Average Seq Length
902 417 879 255

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0202384|Ga0501047_0202384_721_1608
Length 295
Sequence MDAPQSAPRQPRVGLFVTCLVDLIRPSIGFAAVKLVEDAGCTVEVPPQSCCGQPAFNSGDRATTRAIAEQVITTFAPYDYVVAPSGSCAGMLKTHYPELFAGDADWTERVRAFCAKTYELVSFLTDVMKVKAVAAQFDGTVTYHDSCSGLRELGIRAQPRRLLGSVAGLTLKEMTDADVCCGFGGTFCVKYPDISNAIVGKKTECIAAAGADTLLAGDLGCLMNMAGKLQREGRAVRARHIAEVLAGMSDTPAIGEAKTHPVHSRASGNPAATQQVFRSADSGSPLTRGRTAVNR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
5 2671180694 Paenibacillus sp. A3 Isolate Unclassified
6 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
7 2842694124 Methylopila sp. R-72369 Isolate Unclassified
8 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
9 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
10 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
11 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
12 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
13 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
14 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
15 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
16 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
17 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
18 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
19 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
20 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
21 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
22 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
225 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
237 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
243 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
244 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
245 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
246 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
247 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
273 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
274 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
275 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
276 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
277 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
278 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
299 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
302 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
303 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
304 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
305 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
306 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
317 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
325 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
330 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
349 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
350 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
351 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
352 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
353 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
357 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
405 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
406 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
407 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
408 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
409 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
410 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
411 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
412 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
415 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
416 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
417 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 0
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0.22
Rhizoplane 4.55
Rhizosphere 85.92
Stem 0
Stem Tuber 0
Unclassified 7.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1628267 2162886007 Bacteria 5198
2 JGI24747J21853_1003541 3300001978 Unclassified 1354
3 JGI24737J22298_10018418 3300001990 Bacteria 2241
4 JGI24735J21928_10007894 3300002067 Bacteria 3458
5 JGI24735J21928_10048699 3300002067 Unclassified 1226
6 JGI24750J21931_1001174 3300002070 Bacteria 3346
7 JGI24738J21930_10019629 3300002075 Unclassified 1408
8 JGI25406J46586_10002350 3300003203 Bacteria 8942
9 JGI25406J46586_10017460 3300003203 Bacteria 2966
10 rootH2_10021524 3300003320 Bacteria 1781
11 Ga0065704_10001326 3300005289 Bacteria 14211
12 Ga0065707_10352757 3300005295 Bacteria 916
13 Ga0070658_10075828 3300005327 Bacteria 2759
14 Ga0070658_10107484 3300005327 Bacteria 2309
15 Ga0070676_10015602 3300005328 Bacteria 4193
16 Ga0070690_100000374 3300005330 Bacteria 22867
17 Ga0070690_100092392 3300005330 Unclassified 1995
18 Ga0070670_100003963 3300005331 Bacteria 12358
19 Ga0070666_10004674 3300005335 Bacteria 8361
20 Ga0070666_10005915 3300005335 Bacteria 7513
21 Ga0070680_100000765 3300005336 Bacteria 22520
22 Ga0070680_100008223 3300005336 Bacteria 7976
23 Ga0070680_100219367 3300005336 Bacteria 1605
24 Ga0070682_100001371 3300005337 Bacteria 13761
25 Ga0068868_100046239 3300005338 Bacteria 3407
26 Ga0070660_100000601 3300005339 Bacteria 24041
27 Ga0070689_100001212 3300005340 Bacteria 16341
28 Ga0070689_100056545 3300005340 Bacteria 3042
29 Ga0070689_100151980 3300005340 Bacteria 1867
30 Ga0070689_100513560 3300005340 Bacteria 1028
31 Ga0070691_10000403 3300005341 Bacteria 15716
32 Ga0070687_100001226 3300005343 Bacteria 8889
33 Ga0070687_100050738 3300005343 Bacteria 2144
34 Ga0070687_100062502 3300005343 Bacteria 1972
35 Ga0070661_100000694 3300005344 Bacteria 24691
36 Ga0070661_100002128 3300005344 Bacteria 13642
37 Ga0070661_100018400 3300005344 Bacteria 4967
38 Ga0070692_10000588 3300005345 Bacteria 11410
39 Ga0070692_10061066 3300005345 Bacteria 1986
40 Ga0070692_10226109 3300005345 Bacteria 1108
41 Ga0070668_100000244 3300005347 Bacteria 35854
42 Ga0070668_100008885 3300005347 Bacteria 7461
43 Ga0070668_100146731 3300005347 Bacteria 1905
44 Ga0070668_100534842 3300005347 Bacteria 1018
45 Ga0070669_100003798 3300005353 Bacteria 10910
46 Ga0070669_100341123 3300005353 Bacteria 1214
47 Ga0070675_100001316 3300005354 Bacteria 18150
48 Ga0070675_100046662 3300005354 Bacteria 3548
49 Ga0070671_100001369 3300005355 Bacteria 18273
50 Ga0070671_100604909 3300005355 Bacteria 947
51 Ga0070674_100002970 3300005356 Bacteria 9417
52 Ga0070674_100026232 3300005356 Bacteria 3803
53 Ga0070673_100000356 3300005364 Bacteria 24037
54 Ga0070688_100001697 3300005365 Bacteria 11003
55 Ga0070688_100232067 3300005365 Bacteria 1306
56 Ga0070688_100342702 3300005365 Bacteria 1092
57 Ga0070659_100001001 3300005366 Bacteria 20737
58 Ga0070667_100002918 3300005367 Bacteria 14694
59 Ga0070667_100155382 3300005367 Bacteria 2012
60 Ga0070667_100169664 3300005367 Unclassified 1926
61 Ga0070709_10000515 3300005434 Bacteria 22848
62 Ga0070709_10001330 3300005434 Bacteria 13469
63 Ga0070709_10005045 3300005434 Bacteria 7139
64 Ga0070709_10288579 3300005434 Unclassified 1195
65 Ga0070714_100001611 3300005435 Bacteria 16397
66 Ga0070714_100144596 3300005435 Bacteria 2138
67 Ga0070713_100000001 3300005436 Bacteria 257984
68 Ga0070713_100014697 3300005436 Bacteria 5823
69 Ga0070713_100437131 3300005436 Bacteria 1227
70 Ga0070710_10000792 3300005437 Bacteria 15161
71 Ga0070701_10004797 3300005438 Bacteria 5527
72 Ga0070711_100000456 3300005439 Bacteria 21377
73 Ga0070711_100012997 3300005439 Bacteria 5218
74 Ga0070711_100084148 3300005439 Bacteria 2275
75 Ga0070711_100255241 3300005439 Unclassified 1377
76 Ga0070705_100000465 3300005440 Bacteria 23331
77 Ga0070700_100000474 3300005441 Bacteria 20131
78 Ga0070694_100014944 3300005444 Bacteria 4864
79 Ga0070694_100139104 3300005444 Bacteria 1762
80 Ga0070663_100005700 3300005455 Bacteria 7422
81 Ga0070678_100000779 3300005456 Bacteria 15981
82 Ga0070678_100104255 3300005456 Bacteria 2205
83 Ga0070678_100771195 3300005456 Bacteria 871
84 Ga0070662_100009283 3300005457 Bacteria 6429
85 Ga0070681_10013519 3300005458 Bacteria 8116
86 Ga0070681_10020432 3300005458 Bacteria 6637
87 Ga0070681_10544914 3300005458 Bacteria 1074
88 Ga0068867_100088225 3300005459 Bacteria 2350
89 Ga0070685_10026919 3300005466 Bacteria 3174
90 Ga0070685_10225201 3300005466 Bacteria 1231
91 Ga0070706_100116209 3300005467 Bacteria 2492
92 Ga0070706_100704209 3300005467 Bacteria 937
93 Ga0070698_100002001 3300005471 Bacteria 22625
94 Ga0070698_100027820 3300005471 Bacteria 5875
95 Ga0070698_100359061 3300005471 Bacteria 1388
96 Ga0070699_100031429 3300005518 Bacteria 4584
97 Ga0070699_100098175 3300005518 Bacteria 2566
98 Ga0070679_100024967 3300005530 Bacteria 5858
99 Ga0070679_100046195 3300005530 Bacteria 4340
100 Ga0070679_100060704 3300005530 Bacteria 3768
101 Ga0070684_100008442 3300005535 Bacteria 8052
102 Ga0070697_100002257 3300005536 Bacteria 14782
103 Ga0070697_100230417 3300005536 Bacteria 1580
104 Ga0068853_100001967 3300005539 Bacteria 15139
105 Ga0068853_100020387 3300005539 Bacteria 5513
106 Ga0068853_100045111 3300005539 Bacteria 3775
107 Ga0070672_100000593 3300005543 Bacteria 21257
108 Ga0070672_100199351 3300005543 Bacteria 1673
109 Ga0070672_100395483 3300005543 Bacteria 1184
110 Ga0070686_100000944 3300005544 Bacteria 16747
111 Ga0070695_100001660 3300005545 Bacteria 12514
112 Ga0070695_100262542 3300005545 Bacteria 1262
113 Ga0070696_100045582 3300005546 Bacteria 3038
114 Ga0070696_100072374 3300005546 Bacteria 2428
115 Ga0070696_100206639 3300005546 Bacteria 1468
116 Ga0070696_100318465 3300005546 Bacteria 1196
117 Ga0070693_100000655 3300005547 Bacteria 15269
118 Ga0070693_100214111 3300005547 Bacteria 1259
119 Ga0070665_100015319 3300005548 Bacteria 7698
120 Ga0070665_100026167 3300005548 Bacteria 5874
121 Ga0070665_100094013 3300005548 Unclassified 3003
122 Ga0070704_100000439 3300005549 Bacteria 19514
123 Ga0070704_100377604 3300005549 Bacteria 1203
124 Ga0068855_100007707 3300005563 Bacteria 13002
125 Ga0068855_100477661 3300005563 Bacteria 1357
126 Ga0070664_100002755 3300005564 Bacteria 14186
127 Ga0070664_100038470 3300005564 Bacteria 4027
128 Ga0070664_100263764 3300005564 Bacteria 1550
129 Ga0070664_100751667 3300005564 Bacteria 910
130 Ga0068857_100003709 3300005577 Bacteria 12814
131 Ga0068857_100116672 3300005577 Bacteria 2402
132 Ga0068857_100181140 3300005577 Bacteria 1917
133 Ga0068857_100415561 3300005577 Bacteria 1253
134 Ga0068854_100002052 3300005578 Bacteria 12335
135 Ga0068854_100013354 3300005578 Bacteria 5388
136 Ga0068854_100045272 3300005578 Bacteria 3128
137 Ga0068856_100002475 3300005614 Bacteria 19007
138 Ga0068856_100003275 3300005614 Bacteria 16459
139 Ga0068856_100004362 3300005614 Bacteria 14097
140 Ga0068856_100293509 3300005614 Bacteria 1643
141 Ga0070702_100000613 3300005615 Bacteria 13135
142 Ga0070702_100063557 3300005615 Bacteria 2156
143 Ga0068852_100091581 3300005616 Unclassified 2721
144 Ga0068859_100002629 3300005617 Bacteria 18276
145 Ga0068859_100003484 3300005617 Bacteria 16020
146 Ga0068859_100329241 3300005617 Bacteria 1622
147 Ga0068864_100001166 3300005618 Bacteria 21843
148 Ga0068864_100149266 3300005618 Bacteria 2116
149 Ga0068866_10000608 3300005718 Bacteria 16359
150 Ga0068866_10079080 3300005718 Bacteria 1761
151 Ga0068861_100002476 3300005719 Bacteria 12034
152 Ga0068861_100063454 3300005719 Bacteria 2840
153 Ga0068863_100002189 3300005841 Bacteria 19391
154 Ga0068863_100160466 3300005841 Bacteria 2154
155 Ga0068863_100199480 3300005841 Bacteria 1924
156 Ga0068863_100297872 3300005841 Bacteria 1564
157 Ga0068858_100008733 3300005842 Bacteria 9730
158 Ga0068858_100018569 3300005842 Bacteria 6512
159 Ga0068858_100078766 3300005842 Bacteria 3062
160 Ga0068858_100222740 3300005842 Bacteria 1787
161 Ga0068860_100001510 3300005843 Bacteria 25075
162 Ga0068860_100160721 3300005843 Bacteria 2166
163 Ga0068860_100178732 3300005843 Bacteria 2051
164 Ga0068860_100796095 3300005843 Bacteria 958
165 Ga0068862_100006358 3300005844 Bacteria 9823
166 Ga0068862_100052142 3300005844 Bacteria 3499
167 Ga0081455_10028476 3300005937 Bacteria 5104
168 Ga0081455_10096167 3300005937 Bacteria 2389
169 Ga0081538_10000527 3300005981 Bacteria 42416
170 Ga0081538_10011188 3300005981 Bacteria 7289
171 Ga0081540_1000726 3300005983 Bacteria 30344
172 Ga0081540_1020212 3300005983 Bacteria 4014
173 Ga0081540_1036314 3300005983 Bacteria 2629
174 Ga0081539_10000881 3300005985 Bacteria 57379
175 Ga0081539_10002027 3300005985 Bacteria 30522
176 Ga0070717_10025097 3300006028 Bacteria 4735
177 Ga0070717_10150400 3300006028 Bacteria 2013
178 Ga0075365_10032574 3300006038 Bacteria 3352
179 Ga0070715_10000212 3300006163 Bacteria 13730
180 Ga0070716_100002398 3300006173 Bacteria 8629
181 Ga0070712_100000109 3300006175 Bacteria 42842
182 Ga0070712_100000499 3300006175 Bacteria 22474
183 Ga0070712_100001371 3300006175 Bacteria 14772
184 Ga0070712_100045294 3300006175 Bacteria 3037
185 Ga0075367_10036467 3300006178 Bacteria 2852
186 Ga0075366_10055843 3300006195 Bacteria 2345
187 Ga0097621_100035352 3300006237 Bacteria 3992
188 Ga0097621_100189565 3300006237 Bacteria 1780
189 Ga0097621_100409465 3300006237 Bacteria 1215
190 Ga0097621_100618057 3300006237 Bacteria 992
191 Ga0075370_10187156 3300006353 Bacteria 1219
192 Ga0075428_100015161 3300006844 Bacteria 8548
193 Ga0075431_100001142 3300006847 Bacteria 23867
194 Ga0075431_100115431 3300006847 Bacteria 2772
195 Ga0075431_100365845 3300006847 Bacteria 1448
196 Ga0075433_10010430 3300006852 Bacteria 7457
197 Ga0075434_100687493 3300006871 Bacteria 1041
198 Ga0075429_100009251 3300006880 Bacteria 8551
199 Ga0068865_100003706 3300006881 Bacteria 9180
200 Ga0068865_100077410 3300006881 Bacteria 2377
201 Ga0075436_100004097 3300006914 Bacteria 9996
202 Ga0075436_100077423 3300006914 Bacteria 2303
203 Ga0097620_100002628 3300006931 Bacteria 18276
204 Ga0097620_100003484 3300006931 Bacteria 16020
205 Ga0097620_100329236 3300006931 Bacteria 1622
206 Ga0075435_100023169 3300007076 Bacteria 4798
207 Ga0075435_100051231 3300007076 Bacteria 3325
208 Ga0075435_100259981 3300007076 Bacteria 1479
209 Ga0105240_10013652 3300009093 Bacteria 11140
210 Ga0105240_10025951 3300009093 Bacteria 7695
211 Ga0105240_10213361 3300009093 Bacteria 2254
212 Ga0105240_10349402 3300009093 Bacteria 1678
213 Ga0105240_10841749 3300009093 Bacteria 991
214 Ga0111539_10000501 3300009094 Bacteria 49848
215 Ga0111539_10040323 3300009094 Bacteria 5623
216 Ga0111539_10103915 3300009094 Bacteria 3333
217 Ga0111539_10307186 3300009094 Bacteria 1846
218 Ga0111539_10414638 3300009094 Bacteria 1569
219 Ga0111539_10458803 3300009094 Bacteria 1484
220 Ga0111539_10644185 3300009094 Bacteria 1234
221 Ga0105245_10475455 3300009098 Bacteria 1262
222 Ga0105247_10000949 3300009101 Bacteria 21875
223 Ga0105247_10005372 3300009101 Bacteria 8074
224 Ga0105247_10025190 3300009101 Bacteria 3589
225 Ga0114129_10014638 3300009147 Bacteria 11176
226 Ga0114129_10053142 3300009147 Bacteria 5682
227 Ga0114129_10189296 3300009147 Bacteria 2795
228 Ga0105243_10003755 3300009148 Bacteria 12171
229 Ga0105243_10030666 3300009148 Bacteria 4142
230 Ga0105243_10598668 3300009148 Bacteria 1061
231 Ga0105241_10000973 3300009174 Bacteria 21702
232 Ga0105241_10011564 3300009174 Bacteria 6472
233 Ga0105241_10176527 3300009174 Bacteria 1769
234 Ga0105242_10000217 3300009176 Bacteria 45033
235 Ga0105242_10022142 3300009176 Bacteria 4993
236 Ga0105248_10000487 3300009177 Bacteria 45265
237 Ga0105248_10082500 3300009177 Bacteria 3615
238 Ga0105237_10000638 3300009545 Bacteria 48948
239 Ga0105237_10008094 3300009545 Bacteria 11423
240 Ga0105237_10056562 3300009545 Bacteria 3926
241 Ga0105237_10251446 3300009545 Bacteria 1769
242 Ga0105238_10006899 3300009551 Bacteria 11340
243 Ga0105238_10009653 3300009551 Bacteria 9659
244 Ga0105238_10020723 3300009551 Bacteria 6696
245 Ga0105238_10168921 3300009551 Bacteria 2163
246 Ga0105249_10001683 3300009553 Bacteria 19395
247 Ga0105249_10025863 3300009553 Bacteria 5287
248 Ga0105249_10137950 3300009553 Bacteria 2336
249 Ga0105249_10144660 3300009553 Bacteria 2283
250 Ga0105249_10262130 3300009553 Bacteria 1718
251 Ga0099796_10037228 3300010159 Bacteria 1625
252 Ga0105239_10000221 3300010375 Bacteria 83919
253 Ga0105239_10539533 3300010375 Bacteria 1328
254 Ga0105246_10002121 3300011119 Bacteria 11963
255 Ga0105246_10140328 3300011119 Bacteria 1816
256 Ga0105246_10262350 3300011119 Bacteria 1377
257 Ga0157373_10007104 3300013100 Bacteria 8348
258 Ga0157373_10018963 3300013100 Bacteria 5008
259 Ga0157373_10026360 3300013100 Bacteria 4198
260 Ga0157371_10012149 3300013102 Bacteria 6596
261 Ga0157370_10003943 3300013104 Bacteria 17267
262 Ga0157370_10085148 3300013104 Bacteria 2969
263 Ga0157369_10001385 3300013105 Bacteria 29863
264 Ga0157369_10003800 3300013105 Bacteria 17944
265 Ga0157369_10013165 3300013105 Bacteria 9360
266 Ga0157369_10107813 3300013105 Bacteria 2963
267 Ga0157374_10006058 3300013296 Bacteria 10235
268 Ga0157374_10391275 3300013296 Bacteria 1386
269 Ga0157378_10001965 3300013297 Bacteria 18425
270 Ga0157378_10182150 3300013297 Bacteria 1977
271 Ga0163162_10000935 3300013306 Bacteria 27140
272 Ga0157372_10002028 3300013307 Bacteria 22018
273 Ga0157372_10022136 3300013307 Bacteria 6876
274 Ga0157372_10027275 3300013307 Bacteria 6218
275 Ga0157372_10042356 3300013307 Bacteria 5036
276 Ga0157372_10094572 3300013307 Bacteria 3403
277 Ga0157372_10208828 3300013307 Bacteria 2262
278 Ga0157372_10363157 3300013307 Bacteria 1687
279 Ga0157375_10002243 3300013308 Bacteria 16710
280 Ga0163163_10005752 3300014325 Bacteria 10764
281 Ga0163163_10178962 3300014325 Bacteria 2168
282 Ga0163163_10185462 3300014325 Bacteria 2128
283 Ga0163163_10230666 3300014325 Bacteria 1900
284 Ga0163163_10384228 3300014325 Unclassified 1461
285 Ga0157380_10245387 3300014326 Bacteria 1617
286 Ga0157380_10448235 3300014326 Bacteria 1239
287 Ga0157377_10012188 3300014745 Bacteria 4316
288 Ga0157379_10003497 3300014968 Bacteria 13312
289 Ga0157379_10006441 3300014968 Bacteria 10116
290 Ga0157379_10038374 3300014968 Bacteria 4275
291 Ga0157379_10065537 3300014968 Bacteria 3247
292 Ga0157379_10083969 3300014968 Bacteria 2854
293 Ga0157379_10096430 3300014968 Bacteria 2654
294 Ga0157379_10181307 3300014968 Bacteria 1902
295 Ga0157379_10354966 3300014968 Bacteria 1343
296 Ga0157376_10001063 3300014969 Bacteria 17989
297 Ga0183361_10006 3300016635 Bacteria 368532
298 Ga0163161_10007187 3300017792 Bacteria 7695
299 Ga0163161_10159133 3300017792 Bacteria 1721
300 Ga0213873_10000953 3300021358 Bacteria 4685
301 Ga0213872_10002733 3300021361 Bacteria 10128
302 Ga0213872_10051545 3300021361 Bacteria 1868
303 Ga0213874_10006983 3300021377 Bacteria 2693
304 Ga0213874_10008240 3300021377 Bacteria 2535
305 Ga0213874_10018298 3300021377 Bacteria 1891
306 Ga0213876_10000115 3300021384 Bacteria 87113
307 Ga0213876_10000409 3300021384 Bacteria 36093
308 Ga0213876_10004022 3300021384 Bacteria 8269
309 Ga0213876_10052455 3300021384 Bacteria 2156
310 Ga0213876_10082908 3300021384 Bacteria 1696
311 Ga0213876_10099082 3300021384 Bacteria 1545
312 Ga0213876_10214187 3300021384 Bacteria 1024
313 Ga0213875_10000074 3300021388 Bacteria 118349
314 Ga0213875_10000205 3300021388 Bacteria 60682
315 Ga0213875_10006582 3300021388 Bacteria 6079
316 Ga0213875_10120815 3300021388 Bacteria 1224
317 Ga0209147_101859 3300025229 Bacteria 6456
318 Ga0209147_103316 3300025229 Bacteria 3208
319 Ga0207697_10021964 3300025315 Bacteria 2614
320 Ga0207682_10006656 3300025893 Bacteria 4644
321 Ga0207692_10006876 3300025898 Bacteria 4633
322 Ga0207642_10017008 3300025899 Unclassified 2755
323 Ga0207710_10002675 3300025900 Bacteria 8183
324 Ga0207688_10000431 3300025901 Bacteria 19793
325 Ga0207680_10003350 3300025903 Bacteria 7550
326 Ga0207680_10018948 3300025903 Bacteria 3672
327 Ga0207647_10057873 3300025904 Bacteria 2375
328 Ga0207647_10087908 3300025904 Bacteria 1856
329 Ga0207685_10000775 3300025905 Bacteria 5865
330 Ga0207699_10000096 3300025906 Bacteria 63442
331 Ga0207699_10002089 3300025906 Bacteria 9436
332 Ga0207699_10020473 3300025906 Bacteria 3547
333 Ga0207699_10108246 3300025906 Bacteria 1777
334 Ga0207645_10009143 3300025907 Bacteria 6871
335 Ga0207643_10064544 3300025908 Bacteria 2095
336 Ga0207705_10088398 3300025909 Unclassified 2267
337 Ga0207684_10127359 3300025910 Bacteria 2185
338 Ga0207654_10002198 3300025911 Bacteria 9990
339 Ga0207654_10017452 3300025911 Bacteria 3752
340 Ga0207654_10268231 3300025911 Bacteria 1150
341 Ga0207707_10012865 3300025912 Bacteria 7282
342 Ga0207707_10097771 3300025912 Unclassified 2566
343 Ga0207707_10270699 3300025912 Bacteria 1472
344 Ga0207695_10052409 3300025913 Bacteria 4275
345 Ga0207695_10494159 3300025913 Bacteria 1106
346 Ga0207671_10004388 3300025914 Bacteria 13522
347 Ga0207671_10009191 3300025914 Bacteria 8290
348 Ga0207693_10000094 3300025915 Bacteria 79297
349 Ga0207693_10000278 3300025915 Bacteria 47482
350 Ga0207693_10000372 3300025915 Bacteria 41220
351 Ga0207663_10000927 3300025916 Bacteria 13405
352 Ga0207663_10017715 3300025916 Bacteria 3977
353 Ga0207663_10031792 3300025916 Bacteria 3127
354 Ga0207660_10033667 3300025917 Bacteria 3547
355 Ga0207660_10199477 3300025917 Bacteria 1562
356 Ga0207662_10002352 3300025918 Bacteria 9475
357 Ga0207662_10102469 3300025918 Bacteria 1775
358 Ga0207662_10155932 3300025918 Bacteria 1455
359 Ga0207657_10000047 3300025919 Bacteria 111686
360 Ga0207657_10328816 3300025919 Bacteria 1207
361 Ga0207649_10000112 3300025920 Bacteria 68472
362 Ga0207649_10001651 3300025920 Bacteria 12925
363 Ga0207649_10007415 3300025920 Bacteria 5965
364 Ga0207652_10024920 3300025921 Bacteria 4967
365 Ga0207652_10064848 3300025921 Bacteria 3161
366 Ga0207652_10089883 3300025921 Bacteria 2697
367 Ga0207681_10019291 3300025923 Bacteria 4307
368 Ga0207681_10154716 3300025923 Bacteria 1722
369 Ga0207694_10009551 3300025924 Bacteria 7317
370 Ga0207694_10039783 3300025924 Bacteria 3619
371 Ga0207694_10085251 3300025924 Bacteria 2486
372 Ga0207650_10015241 3300025925 Bacteria 5350
373 Ga0207659_10004845 3300025926 Bacteria 8154
374 Ga0207659_10176394 3300025926 Bacteria 1690
375 Ga0207687_10022268 3300025927 Bacteria 4215
376 Ga0207700_10000015 3300025928 Bacteria 224772
377 Ga0207700_10024152 3300025928 Bacteria 4203
378 Ga0207664_10002197 3300025929 Bacteria 12849
379 Ga0207664_10028677 3300025929 Bacteria 4233
380 Ga0207644_10010820 3300025931 Bacteria 6022
381 Ga0207690_10001227 3300025932 Bacteria 16187
382 Ga0207706_10000079 3300025933 Bacteria 100592
383 Ga0207706_10583701 3300025933 Unclassified 961
384 Ga0207686_10008938 3300025934 Bacteria 5420
385 Ga0207686_10052075 3300025934 Bacteria 2553
386 Ga0207686_10315874 3300025934 Bacteria 1165
387 Ga0207709_10004350 3300025935 Bacteria 8199
388 Ga0207709_10306837 3300025935 Bacteria 1182
389 Ga0207670_10001314 3300025936 Bacteria 13111
390 Ga0207669_10025717 3300025937 Unclassified 3187
391 Ga0207669_10152994 3300025937 Bacteria 1618
392 Ga0207669_10271535 3300025937 Unclassified 1274
393 Ga0207704_10389730 3300025938 Unclassified 1096
394 Ga0207665_10000432 3300025939 Bacteria 28864
395 Ga0207665_10115385 3300025939 Bacteria 1892
396 Ga0207691_10007351 3300025940 Bacteria 10620
397 Ga0207691_10037600 3300025940 Bacteria 4482
398 Ga0207691_10216569 3300025940 Bacteria 1662
399 Ga0207711_10022514 3300025941 Bacteria 5270
400 Ga0207711_10027232 3300025941 Bacteria 4801
401 Ga0207661_10027569 3300025944 Bacteria 4340
402 Ga0207661_10588122 3300025944 Bacteria 1021
403 Ga0207679_10001961 3300025945 Bacteria 12762
404 Ga0207679_10519231 3300025945 Bacteria 1065
405 Ga0207667_10009433 3300025949 Bacteria 11495
406 Ga0207667_10055598 3300025949 Bacteria 4160
407 Ga0207651_10003659 3300025960 Bacteria 7586
408 Ga0207712_10004439 3300025961 Bacteria 8861
409 Ga0207712_10088983 3300025961 Bacteria 2269
410 Ga0207668_10004917 3300025972 Bacteria 7860
411 Ga0207640_10008947 3300025981 Bacteria 5580
412 Ga0207640_10048623 3300025981 Bacteria 2743
413 Ga0207640_10189216 3300025981 Unclassified 1550
414 Ga0207658_10004453 3300025986 Bacteria 9739
415 Ga0207658_10034047 3300025986 Bacteria 3638
416 Ga0207658_10117160 3300025986 Unclassified 2117
417 Ga0207658_10185552 3300025986 Bacteria 1725
418 Ga0207658_10709209 3300025986 Bacteria 910
419 Ga0207703_10013192 3300026035 Bacteria 6436
420 Ga0207703_10015168 3300026035 Bacteria 6014
421 Ga0207703_10021441 3300026035 Bacteria 5058
422 Ga0207703_10083120 3300026035 Bacteria 2674
423 Ga0207703_10412947 3300026035 Bacteria 1255
424 Ga0207639_10006696 3300026041 Bacteria 7837
425 Ga0207639_10036256 3300026041 Bacteria 3653
426 Ga0207639_10240214 3300026041 Bacteria 1574
427 Ga0207678_10000111 3300026067 Bacteria 67188
428 Ga0207678_10071670 3300026067 Bacteria 2971
429 Ga0207708_10004157 3300026075 Bacteria 10648
430 Ga0207702_10000011 3300026078 Bacteria 284514
431 Ga0207702_10000465 3300026078 Bacteria 45960
432 Ga0207702_10004141 3300026078 Bacteria 12999
433 Ga0207702_10316289 3300026078 Bacteria 1486
434 Ga0207641_10008713 3300026088 Bacteria 8379
435 Ga0207641_10261841 3300026088 Bacteria 1620
436 Ga0207648_10015812 3300026089 Bacteria 6918
437 Ga0207648_10024949 3300026089 Bacteria 5329
438 Ga0207648_10043435 3300026089 Bacteria 3946
439 Ga0207676_10005911 3300026095 Bacteria 8645
440 Ga0207676_10045063 3300026095 Bacteria 3406
441 Ga0207676_10069316 3300026095 Bacteria 2823
442 Ga0207674_10000002 3300026116 Bacteria 279738
443 Ga0207674_10054075 3300026116 Bacteria 4089
444 Ga0207674_10060194 3300026116 Bacteria 3841
445 Ga0207674_10063465 3300026116 Bacteria 3729
446 Ga0207675_100000424 3300026118 Bacteria 40885
447 Ga0207675_100209857 3300026118 Bacteria 1873
448 Ga0207675_100685424 3300026118 Unclassified 1033
449 Ga0207683_10000026 3300026121 Bacteria 111890
450 Ga0207683_10025989 3300026121 Bacteria 5055
451 Ga0207683_10170094 3300026121 Bacteria 1973
452 Ga0207698_10016682 3300026142 Bacteria 4961
453 Ga0207698_10035270 3300026142 Bacteria 3657
454 Ga0209998_10003426 3300027717 Bacteria 3469
455 Ga0207428_10077375 3300027907 Bacteria 2604
456 Ga0268266_10008327 3300028379 Bacteria 9233
457 Ga0268266_10009369 3300028379 Bacteria 8630
458 Ga0268265_10008336 3300028380 Bacteria 6999
459 Ga0268265_10081927 3300028380 Bacteria 2550
460 Ga0265334_10004071 3300028573 Bacteria 6560
461 Ga0265318_10029776 3300028577 Bacteria 2127
462 Ga0265338_10000378 3300028800 Bacteria 79834
463 Ga0265338_10010745 3300028800 Bacteria 10684
464 Ga0265338_10034019 3300028800 Bacteria 4936
465 Ga0265338_10139074 3300028800 Bacteria 1904
466 Ga0265332_10026240 3300031238 Bacteria 2555
467 Ga0265332_10132127 3300031238 Bacteria 1047
468 Ga0265320_10001320 3300031240 Bacteria 18140
469 Ga0265320_10082411 3300031240 Bacteria 1500
470 Ga0265320_10100703 3300031240 Bacteria 1331
471 Ga0265320_10175548 3300031240 Bacteria 961
472 Ga0265325_10000003 3300031241 Bacteria 370490
473 Ga0265325_10001297 3300031241 Bacteria 17699
474 Ga0265325_10099231 3300031241 Bacteria 1427
475 Ga0265325_10118973 3300031241 Bacteria 1275
476 Ga0265325_10166224 3300031241 Bacteria 1035
477 Ga0265340_10011212 3300031247 Bacteria 4773
478 Ga0265340_10024605 3300031247 Bacteria 3056
479 Ga0265340_10041626 3300031247 Bacteria 2257
480 Ga0265340_10050965 3300031247 Bacteria 2006
481 Ga0265340_10148477 3300031247 Bacteria 1069
482 Ga0265339_10001140 3300031249 Bacteria 20068
483 Ga0265339_10036206 3300031249 Bacteria 2764
484 Ga0265331_10000003 3300031250 Bacteria 499358
485 Ga0265331_10000699 3300031250 Bacteria 28634
486 Ga0265331_10006363 3300031250 Bacteria 6990
487 Ga0265331_10028837 3300031250 Bacteria 2774
488 Ga0265327_10000150 3300031251 Bacteria 150039
489 Ga0265316_10018544 3300031344 Bacteria 5976
490 Ga0265316_10035465 3300031344 Bacteria 4043
491 Ga0265316_10105874 3300031344 Bacteria 2134
492 Ga0265316_10150075 3300031344 Bacteria 1746
493 Ga0265316_10160787 3300031344 Bacteria 1679
494 Ga0265316_10171365 3300031344 Bacteria 1619
495 Ga0265316_10329324 3300031344 Bacteria 1108
496 Ga0307513_10241655 3300031456 Bacteria 1610
497 Ga0307513_10279912 3300031456 Bacteria 1446
498 Ga0265313_10001099 3300031595 Bacteria 25965
499 Ga0265313_10002518 3300031595 Bacteria 15753
500 Ga0265313_10030601 3300031595 Bacteria 2769
501 Ga0265313_10167319 3300031595 Bacteria 931
502 Ga0316575_10024405 3300031665 Bacteria 2341
503 Ga0265314_10006918 3300031711 Bacteria 9933
504 Ga0265314_10009671 3300031711 Bacteria 8117
505 Ga0265314_10023184 3300031711 Bacteria 4739
506 Ga0265314_10085876 3300031711 Bacteria 2062
507 Ga0265314_10108482 3300031711 Unclassified 1769
508 Ga0265314_10145783 3300031711 Bacteria 1458
509 Ga0265314_10215336 3300031711 Unclassified 1125
510 Ga0265314_10217066 3300031711 Bacteria 1119
511 Ga0265314_10260755 3300031711 Bacteria 990
512 Ga0265342_10009892 3300031712 Bacteria 6670
513 Ga0265342_10025719 3300031712 Bacteria 3695
514 Ga0265342_10069700 3300031712 Bacteria 2053
515 Ga0265342_10111875 3300031712 Bacteria 1545
516 Ga0316578_10016633 3300031728 Bacteria 3985
517 Ga0307416_100627194 3300032002 Bacteria 1158
518 Ga0307415_100365661 3300032126 Bacteria 1220
519 Ga0373929_0018745 3300035085 Unclassified 1378
520 Ga0373940_0027937 3300035088 Unclassified 1486
521 Ga0373944_0082042 3300035089 Bacteria 1066
522 Ga0373949_0010516 3300035090 Unclassified 2029
523 Ga0373932_0026197 3300035112 Unclassified 1585
524 Ga0373941_0010659 3300035115 Bacteria 2355
525 Ga0373941_0036236 3300035115 Bacteria 1499
526 Ga0373960_0001193 3300035121 Bacteria 5678
527 Ga0373943_0010429 3300035170 Bacteria 4162
528 Ga0373943_0014259 3300035170 Bacteria 3596
529 Ga0373943_0089402 3300035170 Bacteria 1593
530 Ga0373946_0012816 3300035171 Bacteria 3144
531 Ga0373955_0068871 3300035172 Bacteria 1973
532 Ga0373955_0206275 3300035172 Bacteria 1171
533 Ga0373962_0004899 3300035242 Bacteria 3237
534 Ga0316574_0004127 3300035398 Bacteria 7561
535 Ga0373931_0013273 3300035691 Bacteria 4009
536 Ga0373931_0068865 3300035691 Bacteria 1927
537 Ga0373935_0107237 3300035692 Bacteria 1849
538 Ga0373927_0053502 3300035695 Bacteria 2612
539 Ga0373927_0152571 3300035695 Bacteria 1513
540 Ga0373933_0007105 3300035724 Bacteria 6096
541 Ga0373937_0004901 3300036401 Bacteria 11380
542 Ga0373937_0095808 3300036401 Bacteria 2752
543 Ga0373937_0136411 3300036401 Bacteria 2294
544 Ga0373937_0218762 3300036401 Bacteria 1793
545 Ga0373937_0269393 3300036401 Bacteria 1607
546 Ga0373937_0584210 3300036401 Bacteria 1061
547 Ga0316582_0015435 3300036647 Bacteria 4369
548 Ga0316584_0038854 3300036712 Bacteria 3541
549 Ga0373925_0002314 3300037068 Bacteria 15327
550 Ga0373925_0079599 3300037068 Bacteria 2490
551 Ga0395900_0000066 3300037418 Bacteria 194825
552 Ga0395898_0000225 3300037466 Bacteria 144962
553 Ga0436364_0056243 3300037853 Bacteria 52545
554 Ga0436364_0090740 3300037853 Bacteria 19290
555 Ga0436364_0111944 3300037853 Bacteria 3844
556 Ga0436364_0334510 3300037853 Bacteria 15151
557 Ga0436364_1001667 3300037853 Bacteria 2454
558 Ga0395901_0163693 3300038443 Bacteria 2336
559 Ga0436365_0503854 3300039437 Bacteria 5430
560 Ga0436365_0507621 3300039437 Bacteria 122643
561 Ga0436365_0747668 3300039437 Bacteria 5486
562 Ga0436365_0834196 3300039437 Bacteria 8304
563 Ga0436365_1039466 3300039437 Bacteria 1084
564 Ga0436365_1105030 3300039437 Bacteria 1531
565 Ga0436365_1222514 3300039437 Bacteria 1683
566 Ga0436365_1234622 3300039437 Bacteria 117941
567 Ga0436365_1364317 3300039437 Bacteria 7467
568 Ga0436365_1456072 3300039437 Bacteria 1824
569 Ga0436365_1837679 3300039437 Bacteria 2173
570 Ga0436365_1846878 3300039437 Bacteria 3242
571 Ga0436360_0339219 3300039438 Bacteria 1117
572 Ga0436361_0288663 3300039447 Bacteria 28800
573 Ga0436361_0495760 3300039447 Bacteria 2255
574 Ga0436361_0686387 3300039447 Bacteria 1792
575 Ga0436361_0692813 3300039447 Bacteria 11618
576 Ga0436363_0605002 3300039450 Bacteria 1001
577 Ga0436363_0930623 3300039450 Bacteria 5017
578 Ga0436363_1243663 3300039450 Bacteria 2050
579 Ga0436362_0144215 3300039453 Bacteria 8467
580 Ga0436362_0250120 3300039453 Bacteria 1621
581 Ga0439453_0000160 3300041408 Bacteria 6117
582 Ga0439441_050560 3300042001 Bacteria 855
583 Ga0439443_000672 3300042003 Bacteria 3269
584 Ga0439449_0018538 3300042007 Bacteria 2612
585 Ga0439449_0177297 3300042007 Bacteria 797
586 Ga0439455_0034480 3300042012 Bacteria 1274
587 Ga0439462_0008948 3300042015 Bacteria 2533
588 Ga0439435_0000392 3300042436 Bacteria 6774
589 Ga0451577_0015015 3300042876 Bacteria 7206
590 Ga0466969_0000878 3300044656 Bacteria 16294
591 Ga0466969_0008588 3300044656 Bacteria 5418
592 Ga0466966_0056181 3300044684 Bacteria 2491
593 Ga0466966_0149525 3300044684 Bacteria 1425
594 Ga0466961_0014578 3300044693 Bacteria 5050
595 Ga0466957_0438750 3300044842 Bacteria 898
596 Ga0451576_0008894 3300045051 Bacteria 11715
597 Ga0495603_0000133 3300046455 Bacteria 36636
598 Ga0495629_0060445 3300046459 Bacteria 2648
599 Ga0495638_0013717 3300046460 Bacteria 5506
600 Ga0495638_0020278 3300046460 Bacteria 4392
601 Ga0495641_0032986 3300046461 Bacteria 2461
602 Ga0495580_0000173 3300046472 Bacteria 47996
603 Ga0495580_0015567 3300046472 Bacteria 5732
604 Ga0495580_0044066 3300046472 Bacteria 3174
605 Ga0495582_0000518 3300046473 Bacteria 21209
606 Ga0495582_0009505 3300046473 Bacteria 5357
607 Ga0495639_0001342 3300046475 Bacteria 11041
608 Ga0495639_0120754 3300046475 Unclassified 1250
609 Ga0495662_0031180 3300046476 Bacteria 2575
610 Ga0495662_0130977 3300046476 Bacteria 1233
611 Ga0495664_0241033 3300046477 Bacteria 1094
612 Ga0495584_0018076 3300046491 Bacteria 3584
613 Ga0495584_0058378 3300046491 Bacteria 1941
614 Ga0495594_0000755 3300046499 Bacteria 16602
615 Ga0495610_0000102 3300046512 Bacteria 98985
616 Ga0495630_0080926 3300046517 Bacteria 2451
617 Ga0495630_0640460 3300046517 Unclassified 814
618 Ga0495632_0000013 3300046519 Bacteria 247879
619 Ga0495632_0137310 3300046519 Bacteria 1136
620 Ga0495637_0000229 3300046520 Bacteria 43471
621 Ga0495637_0003875 3300046520 Bacteria 7853
622 Ga0495643_0000010 3300046522 Bacteria 341431
623 Ga0495644_0154709 3300046523 Bacteria 878
624 Ga0495648_0005640 3300046524 Bacteria 10360
625 Ga0495648_0135133 3300046524 Bacteria 1305
626 Ga0495663_0000004 3300046525 Bacteria 355166
627 Ga0495665_0009595 3300046531 Bacteria 5244
628 Ga0495640_0072857 3300046533 Bacteria 2300
629 Ga0495640_0113802 3300046533 Bacteria 1765
630 Ga0495621_0003815 3300046539 Bacteria 4185
631 Ga0495622_0024401 3300046557 Bacteria 2823
632 Ga0495633_0000092 3300046558 Bacteria 121446
633 Ga0495633_0002370 3300046558 Bacteria 13352
634 Ga0495633_0009961 3300046558 Bacteria 5217
635 Ga0495656_0041985 3300046615 Bacteria 1914
636 Ga0495634_0005211 3300046642 Bacteria 10044
637 Ga0495625_0010628 3300046660 Bacteria 7595
638 Ga0495588_0001185 3300046674 Bacteria 11237
639 Ga0495647_0001112 3300046681 Bacteria 8215
640 Ga0495658_0000605 3300046683 Bacteria 19637
641 Ga0495658_0000939 3300046683 Bacteria 15508
642 Ga0495613_0087936 3300046689 Bacteria 2252
643 Ga0495624_0109294 3300046690 Bacteria 1701
644 Ga0495671_0000014 3300046692 Bacteria 341431
645 Ga0495581_0004284 3300047315 Bacteria 8234
646 Ga0495636_0045156 3300047318 Bacteria 1836
647 Ga0495674_0082897 3300047319 Bacteria 2749
648 Ga0495674_0320878 3300047319 Bacteria 1262
649 Ga0495672_0061206 3300047320 Bacteria 2171
650 Ga0495672_0115438 3300047320 Bacteria 1435
651 Ga0495676_0022592 3300047321 Bacteria 5471
652 Ga0495680_0238470 3300047322 Bacteria 1292
653 Ga0495680_0297523 3300047322 Bacteria 1134
654 Ga0495685_042723 3300047447 Bacteria 1547
655 Ga0495685_078127 3300047447 Bacteria 1104
656 Ga0495681_0000104 3300047470 Bacteria 74261
657 Ga0495681_0001853 3300047470 Bacteria 15548
658 Ga0495684_0326339 3300047471 Bacteria 1096
659 Ga0495686_0014266 3300047472 Bacteria 5474
660 Ga0495593_0000542 3300047673 Bacteria 21364
661 Ga0495614_0032376 3300048089 Bacteria 2250
662 Ga0495615_0004280 3300048090 Bacteria 2478
663 Ga0496100_0005987 3300048903 Bacteria 6596
664 Ga0496101_0003489 3300048904 Bacteria 9808
665 Ga0496101_0195260 3300048904 Bacteria 1563
666 Ga0496101_0224439 3300048904 Bacteria 1459
667 Ga0496101_0488644 3300048904 Unclassified 972
668 Ga0496102_0024330 3300048905 Bacteria 5383
669 Ga0496102_0096628 3300048905 Bacteria 2739
670 Ga0496102_0139782 3300048905 Bacteria 2270
671 Ga0496102_0163209 3300048905 Bacteria 2096
672 Ga0496103_0048675 3300048906 Bacteria 2620
673 Ga0496104_0033474 3300048907 Bacteria 4787
674 Ga0496105_0029366 3300048908 Bacteria 4500
675 Ga0496105_0051384 3300048908 Bacteria 3406
676 Ga0496106_0000023 3300048909 Bacteria 165457
677 Ga0496106_0005954 3300048909 Bacteria 9005
678 Ga0496106_0258245 3300048909 Bacteria 1394
679 Ga0496106_0268266 3300048909 Bacteria 1366
680 Ga0496107_0003242 3300048910 Bacteria 10826
681 Ga0496107_0129153 3300048910 Bacteria 1865
682 Ga0496107_0327157 3300048910 Bacteria 1140
683 Ga0496108_0001293 3300048911 Bacteria 19659
684 Ga0496108_0009953 3300048911 Bacteria 7708
685 Ga0496108_0096466 3300048911 Bacteria 2519
686 Ga0496108_0494415 3300048911 Bacteria 1068
687 Ga0496109_0014922 3300048912 Bacteria 6762
688 Ga0496109_0025936 3300048912 Bacteria 5223
689 Ga0496109_0571873 3300048912 Bacteria 1065
690 Ga0496109_0707682 3300048912 Bacteria 945
691 Ga0496110_0007501 3300048913 Bacteria 8716
692 Ga0496110_0148154 3300048913 Bacteria 2124
693 Ga0496110_0205934 3300048913 Bacteria 1788
694 Ga0496111_0007534 3300048914 Bacteria 7139
695 Ga0496111_0139261 3300048914 Bacteria 1798
696 Ga0496112_0005647 3300048915 Bacteria 10859
697 Ga0496112_0049717 3300048915 Bacteria 4109
698 Ga0496113_0004308 3300048916 Bacteria 8716
699 Ga0496113_0317301 3300048916 Bacteria 1249
700 Ga0496114_0008772 3300048917 Bacteria 8010
701 Ga0496115_0030526 3300048918 Bacteria 4240
702 Ga0496115_0483296 3300048918 Bacteria 997
703 Ga0496116_0080861 3300048919 Bacteria 2017
704 Ga0496119_0188909 3300048922 Bacteria 1075
705 Ga0496120_0021622 3300048923 Bacteria 4063
706 Ga0496121_0003339 3300048924 Bacteria 23035
707 Ga0496121_0005179 3300048924 Bacteria 16904
708 Ga0496122_0017867 3300048925 Bacteria 6592
709 Ga0496122_0075458 3300048925 Bacteria 2378
710 Ga0496123_0024445 3300048926 Bacteria 4591
711 Ga0496123_0068760 3300048926 Bacteria 2228
712 Ga0496123_0069603 3300048926 Bacteria 2208
713 Ga0496123_0233305 3300048926 Bacteria 919
714 Ga0496124_0000325 3300048927 Bacteria 88310
715 Ga0496124_0014367 3300048927 Bacteria 7656
716 Ga0496124_0018025 3300048927 Bacteria 6630
717 Ga0496124_0268110 3300048927 Bacteria 1252
718 Ga0496124_0301108 3300048927 Bacteria 1158
719 Ga0496125_0027815 3300048928 Bacteria 5117
720 Ga0496126_0000782 3300048929 Bacteria 57324
721 Ga0496126_0001279 3300048929 Bacteria 40379
722 Ga0496126_0254287 3300048929 Bacteria 1463
723 Ga0495678_008677 3300049459 Bacteria 5106
724 Ga0495682_0148234 3300049460 Bacteria 837
725 Ga0501031_0136768 3300049568 Bacteria 1601
726 Ga0501032_0112362 3300049569 Bacteria 1802
727 Ga0501032_0147504 3300049569 Bacteria 1548
728 Ga0501033_0026669 3300049570 Bacteria 4347
729 Ga0501033_0186309 3300049570 Bacteria 1487
730 Ga0501034_0055432 3300049571 Bacteria 3989
731 Ga0501034_0068135 3300049571 Bacteria 3570
732 Ga0501034_0078229 3300049571 Bacteria 3312
733 Ga0501034_0397564 3300049571 Bacteria 1301
734 Ga0501036_0017141 3300049572 Bacteria 6054
735 Ga0501036_0097649 3300049572 Bacteria 2483
736 Ga0501037_0054569 3300049573 Bacteria 2923
737 Ga0501038_0044737 3300049574 Bacteria 3845
738 Ga0501038_0106273 3300049574 Bacteria 2330
739 Ga0501038_0228006 3300049574 Bacteria 1484
740 Ga0501038_0560672 3300049574 Bacteria 868
741 Ga0501039_0445032 3300049575 Bacteria 1017
742 Ga0501039_0539221 3300049575 Bacteria 916
743 Ga0501040_0000178 3300049576 Bacteria 36163
744 Ga0501040_0021923 3300049576 Bacteria 4271
745 Ga0501040_0207714 3300049576 Bacteria 1391
746 Ga0501040_0340935 3300049576 Bacteria 1073
747 Ga0501041_0008832 3300049577 Bacteria 5929
748 Ga0501041_0101960 3300049577 Bacteria 1777
749 Ga0501042_0010204 3300049578 Bacteria 6285
750 Ga0501042_0020236 3300049578 Bacteria 4630
751 Ga0501042_0041034 3300049578 Bacteria 3290
752 Ga0501042_0055688 3300049578 Bacteria 2822
753 Ga0501042_0178016 3300049578 Bacteria 1534
754 Ga0501042_0445641 3300049578 Bacteria 939
755 Ga0501043_0135711 3300049579 Bacteria 1927
756 Ga0501043_0257779 3300049579 Bacteria 1342
757 Ga0501043_0391976 3300049579 Bacteria 1050
758 Ga0501046_0104840 3300049580 Bacteria 2166
759 Ga0501046_0419166 3300049580 Bacteria 965
760 Ga0501047_0009634 3300049581 Bacteria 9131
761 Ga0501047_0012180 3300049581 Bacteria 8140
762 Ga0501047_0100815 3300049581 Bacteria 2767
763 Ga0501047_0202384 3300049581 Bacteria 1846
764 Ga0501047_0317529 3300049581 Bacteria 1398
765 Ga0501047_0676146 3300049581 Bacteria 850
766 Ga0501048_0029946 3300049582 Bacteria 3943
767 Ga0501048_0077188 3300049582 Bacteria 2351
768 Ga0501048_0183665 3300049582 Bacteria 1483
769 Ga0501048_0206170 3300049582 Bacteria 1394
770 Ga0501067_0002177 3300049583 Bacteria 10804
771 Ga0501067_0016101 3300049583 Bacteria 4135
772 Ga0501067_0199945 3300049583 Bacteria 1113
773 Ga0501068_0021442 3300049584 Bacteria 3773
774 Ga0501068_0054780 3300049584 Bacteria 2416
775 Ga0501069_0011138 3300049585 Bacteria 4772
776 Ga0501069_0016812 3300049585 Bacteria 3930
777 Ga0501069_0130828 3300049585 Bacteria 1437
778 Ga0501070_0008192 3300049586 Bacteria 8838
779 Ga0501070_0016381 3300049586 Bacteria 6226
780 Ga0501070_0055650 3300049586 Bacteria 3279
781 Ga0501070_0080501 3300049586 Bacteria 2695
782 Ga0501070_0294523 3300049586 Bacteria 1323
783 Ga0501070_0388996 3300049586 Bacteria 1129
784 Ga0501070_0484876 3300049586 Bacteria 994
785 Ga0501070_0509116 3300049586 Unclassified 967
786 Ga0501071_0034708 3300049587 Bacteria 3591
787 Ga0501072_0003589 3300049588 Bacteria 11679
788 Ga0501072_0015972 3300049588 Bacteria 5756
789 Ga0501072_0018775 3300049588 Bacteria 5333
790 Ga0501072_0023859 3300049588 Bacteria 4752
791 Ga0501072_0034700 3300049588 Bacteria 3953
792 Ga0501072_0130881 3300049588 Bacteria 2000
793 Ga0501073_0003777 3300049589 Bacteria 11381
794 Ga0501073_0003871 3300049589 Bacteria 11242
795 Ga0501073_0042263 3300049589 Bacteria 3218
796 Ga0501074_0015640 3300049590 Bacteria 5515
797 Ga0501074_0030037 3300049590 Bacteria 3938
798 Ga0501074_0039299 3300049590 Bacteria 3427
799 Ga0501074_0178821 3300049590 Bacteria 1514
800 Ga0501075_0015402 3300049591 Bacteria 5487
801 Ga0501075_0092992 3300049591 Bacteria 2289
802 Ga0501075_0318449 3300049591 Bacteria 1185
803 Ga0501075_0329907 3300049591 Bacteria 1163
804 Ga0501076_0098197 3300049592 Bacteria 2359
805 Ga0501076_0177522 3300049592 Bacteria 1736
806 Ga0501076_0262445 3300049592 Bacteria 1414
807 Ga0501077_0011334 3300049593 Bacteria 5567
808 Ga0501079_0000409 3300049741 Bacteria 27753
809 Ga0501079_0024305 3300049741 Bacteria 4648
810 Ga0501080_0001925 3300049742 Bacteria 17909
811 Ga0501080_0009893 3300049742 Bacteria 8711
812 Ga0501080_0046132 3300049742 Bacteria 4059
813 Ga0501080_0074874 3300049742 Bacteria 3149
814 Ga0501080_0359287 3300049742 Bacteria 1314
815 Ga0501081_0043403 3300049743 Bacteria 3084
816 Ga0501081_0118542 3300049743 Bacteria 1883
817 Ga0501081_0455839 3300049743 Bacteria 950
818 Ga0501083_0042504 3300049744 Bacteria 3081
819 Ga0501083_0072856 3300049744 Bacteria 2283
820 Ga0501035_0004045 3300049822 Bacteria 13969
821 Ga0501035_0229904 3300049822 Bacteria 1581
822 Ga0501035_0260700 3300049822 Bacteria 1469
823 Ga0501035_0481412 3300049822 Bacteria 1024
824 Ga0501044_0026816 3300049823 Bacteria 6097
825 Ga0501044_0276632 3300049823 Bacteria 1613
826 Ga0501044_0327585 3300049823 Bacteria 1455
827 Ga0501044_0680853 3300049823 Bacteria 915
828 Ga0501044_0843494 3300049823 Bacteria 793
829 Ga0501045_0028267 3300049824 Bacteria 4044
830 Ga0501045_0153892 3300049824 Bacteria 1711
831 Ga0501045_0375107 3300049824 Bacteria 1059
832 nmdc:mga0k408_89680_c1 3300050493 Bacteria 1806
833 nmdc:mga07m45_18214_c1 3300050496 Bacteria 3786
834 nmdc:mga05p37_152636_c1 3300050507 Bacteria 2824
835 nmdc:mga05p37_64725_c1 3300050507 Bacteria 4499
836 nmdc:mga09592_1604_c1 3300050508 Bacteria 18237
837 nmdc:mga06r32_22585_c1 3300050510 Bacteria 5817
838 nmdc:mga06r32_385591_c1 3300050510 Bacteria 1384
839 nmdc:mga06r32_47678_c1 3300050510 Bacteria 4093
840 nmdc:mga06r32_70366_c1 3300050510 Bacteria 3383
841 nmdc:mga08y16_1047436_c1 3300050511 Bacteria 793
842 nmdc:mga08y16_179773_c1 3300050511 Bacteria 2196
843 nmdc:mga08y16_221722_c1 3300050511 Bacteria 1957
844 nmdc:mga08y16_35512_c1 3300050511 Bacteria 5234
845 nmdc:mga08y16_66445_c1 3300050511 Bacteria 3763
846 nmdc:mga08y16_7789_c1 3300050511 Bacteria 11219
847 nmdc:mga08y16_85208_c1 3300050511 Bacteria 3293
848 nmdc:mga0n895_184680_c1 3300050512 Bacteria 2116
849 nmdc:mga0n895_576056_c1 3300050512 Bacteria 1130
850 nmdc:mga0rr50_17410_c1 3300050513 Bacteria 4798
851 nmdc:mga08x19_41_c1 3300050514 Bacteria 151756
852 nmdc:mga0a205_106301_c1 3300050515 Bacteria 2704
853 nmdc:mga0a205_562005_c1 3300050515 Bacteria 995
854 Ga0495601_0038735 3300053077 Bacteria 2981
855 Ga0495655_0006625 3300053083 Bacteria 2116
856 Ga0495655_0019246 3300053083 Bacteria 1513
857 Ga0495595_0005795 3300053084 Bacteria 5003
858 Ga0500643_036151 3300053087 Bacteria 1476
859 Ga0500593_075640 3300053117 Bacteria 1452
860 Ga0500652_000367 3300053131 Bacteria 16232
861 Ga0500604_0051425 3300053151 Bacteria 1272
862 Ga0500616_0013871 3300053153 Bacteria 4652
863 Ga0500622_0128587 3300053156 Bacteria 1220
864 Ga0500624_000107 3300053157 Bacteria 39921
865 Ga0500627_0084901 3300053158 Bacteria 1413
866 Ga0501084_0001149 3300054114 Bacteria 20616
867 Ga0501084_0016162 3300054114 Bacteria 6196
868 Ga0501084_0033449 3300054114 Bacteria 4301
869 Ga0501084_0059726 3300054114 Bacteria 3192
870 Ga0501084_0066359 3300054114 Bacteria 3019
871 Ga0501084_0166775 3300054114 Bacteria 1858
872 Ga0501082_0021799 3300060353 Bacteria 5523
873 Ga0501082_0085401 3300060353 Bacteria 2722
874 Ga0501082_0093687 3300060353 Bacteria 2595
875 Ga0501082_0120977 3300060353 Bacteria 2269
876 Ga0501082_0165516 3300060353 Bacteria 1921
877 Ga0530510_0086459 3300061734 Bacteria 2284
878 Ga0530510_0089986 3300061734 Bacteria 2238
879 Ga0530510_0350108 3300061734 Bacteria 1109

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10583701 Ga0207706_105837012 197
2 3300037418 Ga0395900_0000066 Ga0395900_0000066_121236_121925 211
3 3300037466 Ga0395898_0000225 Ga0395898_0000225_71373_72062 211
4 3300044842 Ga0466957_0438750 Ga0466957_0438750_26_694 218
5 3300005340 Ga0070689_100151980 Ga0070689_1001519801 224
6 3300005367 Ga0070667_100169664 Ga0070667_1001696642 224
7 3300005456 Ga0070678_100104255 Ga0070678_1001042552 224
8 3300005718 Ga0068866_10079080 Ga0068866_100790802 224
9 3300005719 Ga0068861_100063454 Ga0068861_1000634543 224
10 3300005841 Ga0068863_100297872 Ga0068863_1002978721 224
11 3300005842 Ga0068858_100078766 Ga0068858_1000787662 224
12 3300005843 Ga0068860_100160721 Ga0068860_1001607212 224
13 3300005844 Ga0068862_100052142 Ga0068862_1000521422 224
14 3300006237 Ga0097621_100189565 Ga0097621_1001895652 224
15 3300009148 Ga0105243_10030666 Ga0105243_100306662 224
16 3300009553 Ga0105249_10262130 Ga0105249_102621302 224
17 3300011119 Ga0105246_10140328 Ga0105246_101403282 224
18 3300013297 Ga0157378_10182150 Ga0157378_101821502 224
19 3300014325 Ga0163163_10384228 Ga0163163_103842282 224
20 3300017792 Ga0163161_10007187 Ga0163161_100071875 224
21 3300025937 Ga0207669_10271535 Ga0207669_102715352 224
22 3300025940 Ga0207691_10216569 Ga0207691_102165691 224
23 3300025981 Ga0207640_10189216 Ga0207640_101892162 224
24 3300025986 Ga0207658_10117160 Ga0207658_101171602 224
25 3300026035 Ga0207703_10083120 Ga0207703_100831202 224
26 3300026067 Ga0207678_10071670 Ga0207678_100716702 224
27 3300026088 Ga0207641_10261841 Ga0207641_102618412 224
28 3300026089 Ga0207648_10043435 Ga0207648_100434354 224
29 3300026118 Ga0207675_100685424 Ga0207675_1006854242 224
30 3300026121 Ga0207683_10170094 Ga0207683_101700942 224
31 3300028380 Ga0268265_10081927 Ga0268265_100819273 224
32 3300048904 Ga0496101_0488644 Ga0496101_0488644_110_889 224
33 3300039437 Ga0436365_1837679 Ga0436365_1837679_630_1406 229
34 3300005546 Ga0070696_100318465 Ga0070696_1003184652 230
35 3300009176 Ga0105242_10022142 Ga0105242_100221422 230
36 3300014325 Ga0163163_10178962 Ga0163163_101789622 230
37 3300014968 Ga0157379_10354966 Ga0157379_103549662 230
38 3300025934 Ga0207686_10052075 Ga0207686_100520753 230
39 3300049574 Ga0501038_0560672 Ga0501038_0560672_61_765 230
40 3300054114 Ga0501084_0001149 Ga0501084_0001149_14835_15539 230
41 3300049590 Ga0501074_0039299 Ga0501074_0039299_77_784 231
42 3300049591 Ga0501075_0329907 Ga0501075_0329907_411_1118 231
43 3300049743 Ga0501081_0455839 Ga0501081_0455839_11_718 231
44 3300021384 Ga0213876_10000409 Ga0213876_100004096 233
45 3300039437 Ga0436365_1234622 Ga0436365_1234622_27087_27821 233
46 3300049823 Ga0501044_0680853 Ga0501044_0680853_184_900 234
47 3300005336 Ga0070680_100000765 Ga0070680_10000076510 235
48 3300009101 Ga0105247_10005372 Ga0105247_100053727 235
49 3300010375 Ga0105239_10000221 Ga0105239_1000022128 235
50 3300013105 Ga0157369_10003800 Ga0157369_100038007 235
51 3300021377 Ga0213874_10008240 Ga0213874_100082402 235
52 3300028573 Ga0265334_10004071 Ga0265334_100040712 235
53 3300028800 Ga0265338_10000378 Ga0265338_1000037811 235
54 3300031238 Ga0265332_10026240 Ga0265332_100262402 235
55 3300031241 Ga0265325_10000003 Ga0265325_10000003357 235
56 3300031250 Ga0265331_10006363 Ga0265331_100063634 235
57 3300031595 Ga0265313_10002518 Ga0265313_1000251810 235
58 3300031711 Ga0265314_10023184 Ga0265314_100231844 235
59 3300031712 Ga0265342_10069700 Ga0265342_100697002 235
60 3300039450 Ga0436363_0930623 Ga0436363_0930623_1197_1919 235
61 iso_pu_bacteria 2925326138 2925331851 235
62 3300002067 JGI24735J21928_10007894 JGI24735J21928_100078944 237
63 3300003320 rootH2_10021524 rootH2_100215242 237
64 3300009177 Ga0105248_10082500 Ga0105248_100825001 237
65 3300016635 Ga0183361_10006 Ga0183361_10006302 237
66 3300025941 Ga0207711_10022514 Ga0207711_100225141 237
67 3300039453 Ga0436362_0250120 Ga0436362_0250120_366_1088 237
68 3300042007 Ga0439449_0018538 Ga0439449_0018538_283_1011 237
69 3300042015 Ga0439462_0008948 Ga0439462_0008948_1698_2426 237
70 3300046524 Ga0495648_0135133 Ga0495648_0135133_57_785 237
71 3300047320 Ga0495672_0115438 Ga0495672_0115438_596_1324 237
72 3300048909 Ga0496106_0000023 Ga0496106_0000023_145576_146298 237
73 3300048922 Ga0496119_0188909 Ga0496119_0188909_109_831 237
74 3300048924 Ga0496121_0005179 Ga0496121_0005179_11140_11862 237
75 3300048927 Ga0496124_0301108 Ga0496124_0301108_194_916 237
76 3300048929 Ga0496126_0001279 Ga0496126_0001279_25116_25838 237
77 3300049460 Ga0495682_0148234 Ga0495682_0148234_108_821 237
78 3300049823 Ga0501044_0843494 Ga0501044_0843494_22_744 237
79 3300005295 Ga0065707_10352757 Ga0065707_103527571 238
80 3300005340 Ga0070689_100513560 Ga0070689_1005135602 238
81 3300005344 Ga0070661_100018400 Ga0070661_1000184004 238
82 3300005345 Ga0070692_10061066 Ga0070692_100610662 238
83 3300005458 Ga0070681_10013519 Ga0070681_100135193 238
84 3300005471 Ga0070698_100027820 Ga0070698_1000278204 238
85 3300005471 Ga0070698_100359061 Ga0070698_1003590612 238
86 3300005530 Ga0070679_100024967 Ga0070679_1000249674 238
87 3300005539 Ga0068853_100020387 Ga0068853_1000203872 238
88 3300005546 Ga0070696_100206639 Ga0070696_1002066392 238
89 3300005577 Ga0068857_100181140 Ga0068857_1001811402 238
90 3300005577 Ga0068857_100415561 Ga0068857_1004155612 238
91 3300005617 Ga0068859_100003484 Ga0068859_10000348410 238
92 3300006353 Ga0075370_10187156 Ga0075370_101871562 238
93 3300006844 Ga0075428_100015161 Ga0075428_1000151614 238
94 3300006847 Ga0075431_100001142 Ga0075431_1000011429 238
95 3300006847 Ga0075431_100365845 Ga0075431_1003658452 238
96 3300006880 Ga0075429_100009251 Ga0075429_1000092514 238
97 3300006931 Ga0097620_100003484 Ga0097620_1000034848 238
98 3300009094 Ga0111539_10103915 Ga0111539_101039153 238
99 3300009094 Ga0111539_10414638 Ga0111539_104146382 238
100 3300009147 Ga0114129_10014638 Ga0114129_1001463810 238
101 3300009553 Ga0105249_10025863 Ga0105249_100258633 238
102 3300013100 Ga0157373_10026360 Ga0157373_100263603 238
103 3300013104 Ga0157370_10085148 Ga0157370_100851482 238
104 3300013307 Ga0157372_10363157 Ga0157372_103631572 238
105 3300025912 Ga0207707_10012865 Ga0207707_100128654 238
106 3300025918 Ga0207662_10155932 Ga0207662_101559322 238
107 3300025920 Ga0207649_10007415 Ga0207649_100074154 238
108 3300025921 Ga0207652_10064848 Ga0207652_100648482 238
109 3300025961 Ga0207712_10088983 Ga0207712_100889832 238
110 3300026041 Ga0207639_10006696 Ga0207639_100066967 238
111 3300026116 Ga0207674_10063465 Ga0207674_100634653 238
112 3300042876 Ga0451577_0015015 Ga0451577_0015015_5039_5764 238
113 3300044656 Ga0466969_0008588 Ga0466969_0008588_3888_4619 238
114 3300044684 Ga0466966_0149525 Ga0466966_0149525_484_1215 238
115 3300044693 Ga0466961_0014578 Ga0466961_0014578_2244_2975 238
116 3300045051 Ga0451576_0008894 Ga0451576_0008894_8955_9692 238
117 3300046539 Ga0495621_0003815 Ga0495621_0003815_1035_1760 238
118 3300049583 Ga0501067_0016101 Ga0501067_0016101_544_1269 238
119 3300049586 Ga0501070_0016381 Ga0501070_0016381_686_1411 238
120 3300049588 Ga0501072_0130881 Ga0501072_0130881_440_1165 238
121 3300049589 Ga0501073_0003871 Ga0501073_0003871_6773_7498 238
122 3300049742 Ga0501080_0001925 Ga0501080_0001925_16497_17222 238
123 3300050496 nmdc:mga07m45_18214_c1 nmdc:mga07m45_18214_c1_250_975 238
124 3300050507 nmdc:mga05p37_64725_c1 nmdc:mga05p37_64725_c1_1561_2298 238
125 3300050508 nmdc:mga09592_1604_c1 nmdc:mga09592_1604_c1_11853_12590 238
126 3300050510 nmdc:mga06r32_22585_c1 nmdc:mga06r32_22585_c1_4799_5536 238
127 3300050510 nmdc:mga06r32_70366_c1 nmdc:mga06r32_70366_c1_532_1257 238
128 3300050511 nmdc:mga08y16_179773_c1 nmdc:mga08y16_179773_c1_824_1549 238
129 3300050511 nmdc:mga08y16_85208_c1 nmdc:mga08y16_85208_c1_1220_1945 238
130 3300050515 nmdc:mga0a205_562005_c1 nmdc:mga0a205_562005_c1_52_789 238
131 iso_pu_bacteria 2671180694 2673822840 238
132 iso_pu_bacteria 2864997549 2865000652 238
133 iso_pu_bacteria 2889295896 2889297904 238
134 iso_pu_bacteria 2980125574 2980126488 238
135 iso_pu_bacteria 2980182181 2980183501 238
136 iso_pu_bacteria 2981284811 2981286384 238
137 iso_pu_bacteria 2981289755 2981291334 238
138 iso_pu_bacteria 2981980479 2981982029 238
139 iso_pu_bacteria 2981985349 2981986928 238
140 iso_pu_bacteria 8057733483 8057733636 238
141 3300005564 Ga0070664_100038470 Ga0070664_1000384702 239
142 3300005327 Ga0070658_10107484 Ga0070658_101074842 240
143 3300005344 Ga0070661_100000694 Ga0070661_10000069413 240
144 3300005543 Ga0070672_100395483 Ga0070672_1003954832 240
145 3300005564 Ga0070664_100263764 Ga0070664_1002637642 240
146 3300005841 Ga0068863_100199480 Ga0068863_1001994802 240
147 3300009093 Ga0105240_10213361 Ga0105240_102133612 240
148 3300013105 Ga0157369_10107813 Ga0157369_101078132 240
149 3300025917 Ga0207660_10033667 Ga0207660_100336671 240
150 3300025919 Ga0207657_10328816 Ga0207657_103288162 240
151 3300025920 Ga0207649_10000112 Ga0207649_1000011213 240
152 3300025986 Ga0207658_10709209 Ga0207658_107092092 240
153 3300031250 Ga0265331_10000003 Ga0265331_10000003394 240
154 3300031250 Ga0265331_10000699 Ga0265331_1000069917 240
155 3300031251 Ga0265327_10000150 Ga0265327_1000015061 240
156 3300031711 Ga0265314_10009671 Ga0265314_100096715 240
157 3300031711 Ga0265314_10145783 Ga0265314_101457832 240
158 3300031711 Ga0265314_10215336 Ga0265314_102153362 240
159 3300039437 Ga0436365_1222514 Ga0436365_1222514_397_1188 240
160 3300039447 Ga0436361_0288663 Ga0436361_0288663_2115_2843 240
161 3300044656 Ga0466969_0000878 Ga0466969_0000878_5992_6804 240
162 3300049568 Ga0501031_0136768 Ga0501031_0136768_602_1327 240
163 3300049569 Ga0501032_0112362 Ga0501032_0112362_809_1546 240
164 3300049569 Ga0501032_0147504 Ga0501032_0147504_630_1358 240
165 3300049571 Ga0501034_0055432 Ga0501034_0055432_1990_2727 240
166 3300049571 Ga0501034_0078229 Ga0501034_0078229_2202_2930 240
167 3300049573 Ga0501037_0054569 Ga0501037_0054569_2014_2751 240
168 3300049575 Ga0501039_0445032 Ga0501039_0445032_91_819 240
169 3300049579 Ga0501043_0135711 Ga0501043_0135711_192_920 240
170 3300049581 Ga0501047_0012180 Ga0501047_0012180_2775_3512 240
171 3300049582 Ga0501048_0029946 Ga0501048_0029946_3077_3814 240
172 3300049583 Ga0501067_0002177 Ga0501067_0002177_1055_1792 240
173 3300049584 Ga0501068_0021442 Ga0501068_0021442_1999_2727 240
174 3300049585 Ga0501069_0016812 Ga0501069_0016812_466_1203 240
175 3300049586 Ga0501070_0008192 Ga0501070_0008192_6428_7165 240
176 3300049586 Ga0501070_0055650 Ga0501070_0055650_437_1165 240
177 3300049589 Ga0501073_0003777 Ga0501073_0003777_3572_4309 240
178 3300049590 Ga0501074_0015640 Ga0501074_0015640_4081_4818 240
179 3300049741 Ga0501079_0000409 Ga0501079_0000409_19818_20555 240
180 3300049742 Ga0501080_0009893 Ga0501080_0009893_3474_4211 240
181 3300049742 Ga0501080_0359287 Ga0501080_0359287_558_1286 240
182 3300049822 Ga0501035_0004045 Ga0501035_0004045_10538_11275 240
183 3300049822 Ga0501035_0260700 Ga0501035_0260700_233_961 240
184 3300049823 Ga0501044_0026816 Ga0501044_0026816_1991_2728 240
185 3300054114 Ga0501084_0016162 Ga0501084_0016162_1965_2702 240
186 3300005347 Ga0070668_100008885 Ga0070668_1000088856 241
187 3300009094 Ga0111539_10000501 Ga0111539_1000050138 241
188 3300009147 Ga0114129_10053142 Ga0114129_100531424 241
189 3300021361 Ga0213872_10002733 Ga0213872_1000273313 241
190 3300025229 Ga0209147_103316 Ga0209147_1033162 241
191 3300036401 Ga0373937_0269393 Ga0373937_0269393_91_831 241
192 3300039437 Ga0436365_1846878 Ga0436365_1846878_1828_2619 241
193 3300039447 Ga0436361_0686387 Ga0436361_0686387_199_930 241
194 3300039447 Ga0436361_0692813 Ga0436361_0692813_6714_7445 241
195 3300047319 Ga0495674_0320878 Ga0495674_0320878_436_1176 241
196 iso_pu_bacteria 8054795415 8054804021 241
197 3300005330 Ga0070690_100092392 Ga0070690_1000923922 242
198 3300005335 Ga0070666_10005915 Ga0070666_100059152 242
199 3300005439 Ga0070711_100255241 Ga0070711_1002552412 242
200 3300035170 Ga0373943_0089402 Ga0373943_0089402_291_1034 242
201 3300046472 Ga0495580_0044066 Ga0495580_0044066_1713_2456 242
202 3300046473 Ga0495582_0009505 Ga0495582_0009505_723_1466 242
203 3300046475 Ga0495639_0120754 Ga0495639_0120754_265_1008 242
204 3300046517 Ga0495630_0640460 Ga0495630_0640460_61_804 242
205 3300046683 Ga0495658_0000939 Ga0495658_0000939_4400_5143 242
206 3300046689 Ga0495613_0087936 Ga0495613_0087936_844_1587 242
207 3300044684 Ga0466966_0056181 Ga0466966_0056181_364_1137 243
208 3300049586 Ga0501070_0509116 Ga0501070_0509116_63_881 243
209 3300050511 nmdc:mga08y16_35512_c1 nmdc:mga08y16_35512_c1_1295_2062 243
210 iso_pu_bacteria 2671180139 2671691915 243
211 3300021377 Ga0213874_10018298 Ga0213874_100182982 244
212 3300021384 Ga0213876_10214187 Ga0213876_102141872 244
213 3300026095 Ga0207676_10069316 Ga0207676_100693162 244
214 3300026116 Ga0207674_10060194 Ga0207674_100601942 244
215 3300039437 Ga0436365_1105030 Ga0436365_1105030_114_863 244
216 3300039450 Ga0436363_1243663 Ga0436363_1243663_705_1454 244
217 3300010159 Ga0099796_10037228 Ga0099796_100372282 245
218 3300013307 Ga0157372_10022136 Ga0157372_100221367 245
219 3300013307 Ga0157372_10094572 Ga0157372_100945723 245
220 3300039437 Ga0436365_0503854 Ga0436365_0503854_2909_3646 245
221 3300039437 Ga0436365_0507621 Ga0436365_0507621_52791_53528 245
222 3300039438 Ga0436360_0339219 Ga0436360_0339219_251_1027 245
223 3300042436 Ga0439435_0000392 Ga0439435_0000392_1934_2683 245
224 3300049581 Ga0501047_0676146 Ga0501047_0676146_86_832 245
225 3300049589 Ga0501073_0042263 Ga0501073_0042263_391_1164 245
226 3300050511 nmdc:mga08y16_66445_c1 nmdc:mga08y16_66445_c1_2525_3274 245
227 3300005467 Ga0070706_100116209 Ga0070706_1001162092 246
228 3300005467 Ga0070706_100704209 Ga0070706_1007042091 246
229 3300005471 Ga0070698_100002001 Ga0070698_10000200110 246
230 3300005518 Ga0070699_100031429 Ga0070699_1000314293 246
231 3300005518 Ga0070699_100098175 Ga0070699_1000981752 246
232 3300005536 Ga0070697_100230417 Ga0070697_1002304172 246
233 3300005614 Ga0068856_100293509 Ga0068856_1002935092 246
234 3300005981 Ga0081538_10011188 Ga0081538_100111888 246
235 3300005983 Ga0081540_1036314 Ga0081540_10363142 246
236 3300009093 Ga0105240_10349402 Ga0105240_103494022 246
237 3300009147 Ga0114129_10189296 Ga0114129_101892962 246
238 3300009551 Ga0105238_10020723 Ga0105238_100207235 246
239 3300013307 Ga0157372_10042356 Ga0157372_100423564 246
240 3300021361 Ga0213872_10051545 Ga0213872_100515452 246
241 3300021384 Ga0213876_10000115 Ga0213876_1000011576 246
242 3300021388 Ga0213875_10000205 Ga0213875_1000020521 246
243 3300025910 Ga0207684_10127359 Ga0207684_101273592 246
244 3300025924 Ga0207694_10039783 Ga0207694_100397832 246
245 3300025934 Ga0207686_10315874 Ga0207686_103158742 246
246 3300026041 Ga0207639_10240214 Ga0207639_102402141 246
247 3300026078 Ga0207702_10316289 Ga0207702_103162892 246
248 3300031250 Ga0265331_10028837 Ga0265331_100288373 246
249 3300035170 Ga0373943_0010429 Ga0373943_0010429_70_825 246
250 3300035172 Ga0373955_0206275 Ga0373955_0206275_322_1080 246
251 3300036401 Ga0373937_0218762 Ga0373937_0218762_730_1488 246
252 3300037853 Ga0436364_0056243 Ga0436364_0056243_45567_46343 246
253 3300039447 Ga0436361_0495760 Ga0436361_0495760_919_1698 246
254 3300042007 Ga0439449_0177297 Ga0439449_0177297_17_781 246
255 3300042012 Ga0439455_0034480 Ga0439455_0034480_325_1089 246
256 3300048929 Ga0496126_0254287 Ga0496126_0254287_52_807 246
257 3300049570 Ga0501033_0186309 Ga0501033_0186309_683_1435 246
258 3300049571 Ga0501034_0397564 Ga0501034_0397564_140_949 246
259 3300049574 Ga0501038_0228006 Ga0501038_0228006_65_820 246
260 3300049581 Ga0501047_0009634 Ga0501047_0009634_8304_9068 246
261 3300049581 Ga0501047_0100815 Ga0501047_0100815_920_1729 246
262 3300049583 Ga0501067_0199945 Ga0501067_0199945_124_888 246
263 3300049585 Ga0501069_0011138 Ga0501069_0011138_3827_4597 246
264 3300049585 Ga0501069_0130828 Ga0501069_0130828_103_867 246
265 3300049586 Ga0501070_0080501 Ga0501070_0080501_1147_1911 246
266 3300049586 Ga0501070_0484876 Ga0501070_0484876_13_789 246
267 3300049590 Ga0501074_0030037 Ga0501074_0030037_2955_3719 246
268 3300049590 Ga0501074_0178821 Ga0501074_0178821_21_773 246
269 3300049822 Ga0501035_0481412 Ga0501035_0481412_47_799 246
270 3300050507 nmdc:mga05p37_152636_c1 nmdc:mga05p37_152636_c1_1347_2144 246
271 3300053087 Ga0500643_036151 Ga0500643_036151_638_1396 246
272 3300054114 Ga0501084_0166775 Ga0501084_0166775_154_918 246
273 3300060353 Ga0501082_0093687 Ga0501082_0093687_72_836 246
274 3300060353 Ga0501082_0165516 Ga0501082_0165516_812_1576 246
275 iso_pu_bacteria 2883577096 2883579191 246
276 3300005367 Ga0070667_100155382 Ga0070667_1001553822 247
277 3300005436 Ga0070713_100437131 Ga0070713_1004371311 247
278 3300005563 Ga0068855_100477661 Ga0068855_1004776612 247
279 3300005842 Ga0068858_100018569 Ga0068858_1000185692 247
280 3300005843 Ga0068860_100178732 Ga0068860_1001787322 247
281 3300006175 Ga0070712_100045294 Ga0070712_1000452942 247
282 3300006237 Ga0097621_100409465 Ga0097621_1004094652 247
283 3300009174 Ga0105241_10176527 Ga0105241_101765272 247
284 3300014968 Ga0157379_10006441 Ga0157379_100064419 247
285 3300021358 Ga0213873_10000953 Ga0213873_100009533 247
286 3300021377 Ga0213874_10006983 Ga0213874_100069831 247
287 3300021384 Ga0213876_10004022 Ga0213876_100040223 247
288 3300021384 Ga0213876_10099082 Ga0213876_100990822 247
289 3300021388 Ga0213875_10006582 Ga0213875_100065824 247
290 3300025903 Ga0207680_10003350 Ga0207680_100033506 247
291 3300025911 Ga0207654_10268231 Ga0207654_102682312 247
292 3300025939 Ga0207665_10115385 Ga0207665_101153852 247
293 3300026035 Ga0207703_10015168 Ga0207703_100151685 247
294 3300028800 Ga0265338_10010745 Ga0265338_100107458 247
295 3300031238 Ga0265332_10132127 Ga0265332_101321272 247
296 3300031240 Ga0265320_10001320 Ga0265320_100013203 247
297 3300031240 Ga0265320_10100703 Ga0265320_101007032 247
298 3300031241 Ga0265325_10099231 Ga0265325_100992312 247
299 3300031241 Ga0265325_10166224 Ga0265325_101662242 247
300 3300031249 Ga0265339_10036206 Ga0265339_100362063 247
301 3300031595 Ga0265313_10030601 Ga0265313_100306014 247
302 3300031711 Ga0265314_10006918 Ga0265314_100069182 247
303 3300031711 Ga0265314_10217066 Ga0265314_102170662 247
304 3300035170 Ga0373943_0014259 Ga0373943_0014259_1521_2300 247
305 3300037853 Ga0436364_0334510 Ga0436364_0334510_14009_14791 247
306 3300039437 Ga0436365_0747668 Ga0436365_0747668_3890_4663 247
307 3300039437 Ga0436365_0834196 Ga0436365_0834196_1714_2496 247
308 3300039450 Ga0436363_0605002 Ga0436363_0605002_210_983 247
309 3300039453 Ga0436362_0144215 Ga0436362_0144215_6737_7519 247
310 3300046476 Ga0495662_0031180 Ga0495662_0031180_257_1036 247
311 3300046477 Ga0495664_0241033 Ga0495664_0241033_36_815 247
312 3300046517 Ga0495630_0080926 Ga0495630_0080926_1445_2224 247
313 3300046533 Ga0495640_0072857 Ga0495640_0072857_1503_2282 247
314 3300047319 Ga0495674_0082897 Ga0495674_0082897_548_1327 247
315 3300048904 Ga0496101_0224439 Ga0496101_0224439_644_1420 247
316 3300048905 Ga0496102_0096628 Ga0496102_0096628_512_1288 247
317 3300048908 Ga0496105_0051384 Ga0496105_0051384_905_1681 247
318 3300048909 Ga0496106_0268266 Ga0496106_0268266_568_1344 247
319 3300048911 Ga0496108_0494415 Ga0496108_0494415_230_1006 247
320 3300048912 Ga0496109_0571873 Ga0496109_0571873_32_808 247
321 3300048913 Ga0496110_0205934 Ga0496110_0205934_17_796 247
322 3300048929 Ga0496126_0000782 Ga0496126_0000782_24590_25342 247
323 3300049572 Ga0501036_0097649 Ga0501036_0097649_1198_1980 247
324 3300049576 Ga0501040_0340935 Ga0501040_0340935_237_1004 247
325 3300049579 Ga0501043_0257779 Ga0501043_0257779_307_1086 247
326 3300049580 Ga0501046_0104840 Ga0501046_0104840_863_1681 247
327 3300049582 Ga0501048_0206170 Ga0501048_0206170_373_1155 247
328 3300049584 Ga0501068_0054780 Ga0501068_0054780_1348_2166 247
329 3300049587 Ga0501071_0034708 Ga0501071_0034708_834_1652 247
330 3300049588 Ga0501072_0023859 Ga0501072_0023859_2943_3761 247
331 3300049592 Ga0501076_0177522 Ga0501076_0177522_340_1107 247
332 3300049592 Ga0501076_0262445 Ga0501076_0262445_401_1183 247
333 3300049743 Ga0501081_0118542 Ga0501081_0118542_354_1136 247
334 3300049824 Ga0501045_0153892 Ga0501045_0153892_833_1615 247
335 3300053077 Ga0495601_0038735 Ga0495601_0038735_1029_1808 247
336 3300053156 Ga0500622_0128587 Ga0500622_0128587_118_894 247
337 3300054114 Ga0501084_0033449 Ga0501084_0033449_1579_2397 247
338 3300060353 Ga0501082_0085401 Ga0501082_0085401_1050_1832 247
339 3300060353 Ga0501082_0120977 Ga0501082_0120977_1066_1884 247
340 iso_pu_bacteria 2513237087 2513593606 247
341 iso_pu_bacteria 2842694124 2842696362 247
342 iso_pu_bacteria 2929199973 2929200095 247
343 iso_pu_bacteria 8055909800 8055915288 247
344 3300003203 JGI25406J46586_10002350 JGI25406J46586_1000235010 248
345 3300003203 JGI25406J46586_10017460 JGI25406J46586_100174602 248
346 3300005343 Ga0070687_100050738 Ga0070687_1000507381 248
347 3300005354 Ga0070675_100046662 Ga0070675_1000466622 248
348 3300005355 Ga0070671_100604909 Ga0070671_1006049091 248
349 3300005356 Ga0070674_100026232 Ga0070674_1000262322 248
350 3300005434 Ga0070709_10001330 Ga0070709_100013309 248
351 3300005434 Ga0070709_10005045 Ga0070709_100050456 248
352 3300005434 Ga0070709_10288579 Ga0070709_102885792 248
353 3300005435 Ga0070714_100144596 Ga0070714_1001445962 248
354 3300005436 Ga0070713_100000001 Ga0070713_100000001109 248
355 3300005439 Ga0070711_100012997 Ga0070711_1000129974 248
356 3300005439 Ga0070711_100084148 Ga0070711_1000841482 248
357 3300005458 Ga0070681_10544914 Ga0070681_105449141 248
358 3300005539 Ga0068853_100045111 Ga0068853_1000451114 248
359 3300005543 Ga0070672_100199351 Ga0070672_1001993512 248
360 3300005547 Ga0070693_100214111 Ga0070693_1002141112 248
361 3300005548 Ga0070665_100026167 Ga0070665_1000261672 248
362 3300005577 Ga0068857_100003709 Ga0068857_1000037095 248
363 3300005578 Ga0068854_100013354 Ga0068854_1000133544 248
364 3300005614 Ga0068856_100003275 Ga0068856_1000032758 248
365 3300005614 Ga0068856_100004362 Ga0068856_10000436210 248
366 3300005618 Ga0068864_100149266 Ga0068864_1001492662 248
367 3300005841 Ga0068863_100160466 Ga0068863_1001604663 248
368 3300005842 Ga0068858_100222740 Ga0068858_1002227402 248
369 3300005937 Ga0081455_10096167 Ga0081455_100961672 248
370 3300005985 Ga0081539_10000881 Ga0081539_100008819 248
371 3300005985 Ga0081539_10002027 Ga0081539_1000202725 248
372 3300006028 Ga0070717_10025097 Ga0070717_100250975 248
373 3300006038 Ga0075365_10032574 Ga0075365_100325744 248
374 3300006175 Ga0070712_100000109 Ga0070712_1000001097 248
375 3300006175 Ga0070712_100000499 Ga0070712_1000004997 248
376 3300006871 Ga0075434_100687493 Ga0075434_1006874932 248
377 3300006914 Ga0075436_100004097 Ga0075436_1000040976 248
378 3300007076 Ga0075435_100023169 Ga0075435_1000231692 248
379 3300007076 Ga0075435_100051231 Ga0075435_1000512312 248
380 3300009093 Ga0105240_10025951 Ga0105240_100259517 248
381 3300009094 Ga0111539_10307186 Ga0111539_103071862 248
382 3300009094 Ga0111539_10644185 Ga0111539_106441852 248
383 3300009098 Ga0105245_10475455 Ga0105245_104754552 248
384 3300009101 Ga0105247_10025190 Ga0105247_100251902 248
385 3300009174 Ga0105241_10011564 Ga0105241_100115642 248
386 3300009545 Ga0105237_10056562 Ga0105237_100565624 248
387 3300009551 Ga0105238_10006899 Ga0105238_100068996 248
388 3300009551 Ga0105238_10168921 Ga0105238_101689211 248
389 3300009553 Ga0105249_10144660 Ga0105249_101446602 248
390 3300010375 Ga0105239_10539533 Ga0105239_105395332 248
391 3300011119 Ga0105246_10262350 Ga0105246_102623502 248
392 3300013100 Ga0157373_10007104 Ga0157373_100071047 248
393 3300013104 Ga0157370_10003943 Ga0157370_100039432 248
394 3300013105 Ga0157369_10013165 Ga0157369_100131653 248
395 3300013307 Ga0157372_10027275 Ga0157372_100272755 248
396 3300013307 Ga0157372_10208828 Ga0157372_102088282 248
397 3300014325 Ga0163163_10230666 Ga0163163_102306662 248
398 3300014968 Ga0157379_10038374 Ga0157379_100383742 248
399 3300014968 Ga0157379_10083969 Ga0157379_100839693 248
400 3300014968 Ga0157379_10181307 Ga0157379_101813072 248
401 3300021384 Ga0213876_10052455 Ga0213876_100524553 248
402 3300021384 Ga0213876_10082908 Ga0213876_100829082 248
403 3300021388 Ga0213875_10000074 Ga0213875_1000007441 248
404 3300025893 Ga0207682_10006656 Ga0207682_100066565 248
405 3300025904 Ga0207647_10087908 Ga0207647_100879082 248
406 3300025906 Ga0207699_10000096 Ga0207699_1000009611 248
407 3300025906 Ga0207699_10020473 Ga0207699_100204733 248
408 3300025908 Ga0207643_10064544 Ga0207643_100645442 248
409 3300025911 Ga0207654_10017452 Ga0207654_100174524 248
410 3300025913 Ga0207695_10494159 Ga0207695_104941592 248
411 3300025915 Ga0207693_10000094 Ga0207693_1000009437 248
412 3300025915 Ga0207693_10000372 Ga0207693_1000037237 248
413 3300025916 Ga0207663_10017715 Ga0207663_100177154 248
414 3300025916 Ga0207663_10031792 Ga0207663_100317922 248
415 3300025918 Ga0207662_10102469 Ga0207662_101024692 248
416 3300025923 Ga0207681_10154716 Ga0207681_101547162 248
417 3300025924 Ga0207694_10085251 Ga0207694_100852512 248
418 3300025926 Ga0207659_10176394 Ga0207659_101763942 248
419 3300025928 Ga0207700_10000015 Ga0207700_10000015158 248
420 3300025929 Ga0207664_10028677 Ga0207664_100286774 248
421 3300025935 Ga0207709_10306837 Ga0207709_103068371 248
422 3300025937 Ga0207669_10152994 Ga0207669_101529942 248
423 3300025940 Ga0207691_10037600 Ga0207691_100376001 248
424 3300025944 Ga0207661_10588122 Ga0207661_105881222 248
425 3300025949 Ga0207667_10055598 Ga0207667_100555984 248
426 3300026041 Ga0207639_10036256 Ga0207639_100362562 248
427 3300026078 Ga0207702_10000011 Ga0207702_10000011153 248
428 3300026078 Ga0207702_10000465 Ga0207702_1000046526 248
429 3300026089 Ga0207648_10024949 Ga0207648_100249492 248
430 3300026095 Ga0207676_10045063 Ga0207676_100450632 248
431 3300026116 Ga0207674_10000002 Ga0207674_10000002156 248
432 3300026118 Ga0207675_100209857 Ga0207675_1002098572 248
433 3300026121 Ga0207683_10025989 Ga0207683_100259894 248
434 3300026142 Ga0207698_10035270 Ga0207698_100352702 248
435 3300028379 Ga0268266_10009369 Ga0268266_100093698 248
436 3300028800 Ga0265338_10034019 Ga0265338_100340194 248
437 3300031241 Ga0265325_10001297 Ga0265325_100012977 248
438 3300031247 Ga0265340_10041626 Ga0265340_100416262 248
439 3300031247 Ga0265340_10050965 Ga0265340_100509652 248
440 3300031249 Ga0265339_10001140 Ga0265339_1000114013 248
441 3300031344 Ga0265316_10018544 Ga0265316_100185444 248
442 3300031344 Ga0265316_10035465 Ga0265316_100354652 248
443 3300031344 Ga0265316_10171365 Ga0265316_101713652 248
444 3300031344 Ga0265316_10329324 Ga0265316_103293242 248
445 3300031595 Ga0265313_10001099 Ga0265313_1000109914 248
446 3300031665 Ga0316575_10024405 Ga0316575_100244052 248
447 3300031711 Ga0265314_10108482 Ga0265314_101084822 248
448 3300031711 Ga0265314_10260755 Ga0265314_102607551 248
449 3300031712 Ga0265342_10009892 Ga0265342_100098925 248
450 3300031712 Ga0265342_10025719 Ga0265342_100257193 248
451 3300031728 Ga0316578_10016633 Ga0316578_100166332 248
452 3300035172 Ga0373955_0068871 Ga0373955_0068871_343_1107 248
453 3300035398 Ga0316574_0004127 Ga0316574_0004127_2065_2865 248
454 3300035691 Ga0373931_0068865 Ga0373931_0068865_552_1316 248
455 3300035695 Ga0373927_0053502 Ga0373927_0053502_738_1502 248
456 3300035695 Ga0373927_0152571 Ga0373927_0152571_736_1500 248
457 3300035724 Ga0373933_0007105 Ga0373933_0007105_141_905 248
458 3300036401 Ga0373937_0004901 Ga0373937_0004901_5231_5995 248
459 3300036401 Ga0373937_0136411 Ga0373937_0136411_798_1562 248
460 3300036647 Ga0316582_0015435 Ga0316582_0015435_814_1614 248
461 3300036712 Ga0316584_0038854 Ga0316584_0038854_742_1542 248
462 3300037853 Ga0436364_0090740 Ga0436364_0090740_4321_5100 248
463 3300038443 Ga0395901_0163693 Ga0395901_0163693_331_1119 248
464 3300039437 Ga0436365_1039466 Ga0436365_1039466_196_975 248
465 3300039437 Ga0436365_1364317 Ga0436365_1364317_1092_1871 248
466 3300041408 Ga0439453_0000160 Ga0439453_0000160_2369_3130 248
467 3300042001 Ga0439441_050560 Ga0439441_050560_35_796 248
468 3300042003 Ga0439443_000672 Ga0439443_000672_741_1502 248
469 3300046472 Ga0495580_0015567 Ga0495580_0015567_2987_3751 248
470 3300046615 Ga0495656_0041985 Ga0495656_0041985_784_1593 248
471 3300047447 Ga0495685_042723 Ga0495685_042723_73_840 248
472 3300047447 Ga0495685_078127 Ga0495685_078127_252_1061 248
473 3300048090 Ga0495615_0004280 Ga0495615_0004280_1227_2036 248
474 3300048905 Ga0496102_0163209 Ga0496102_0163209_435_1199 248
475 3300048909 Ga0496106_0258245 Ga0496106_0258245_486_1250 248
476 3300048910 Ga0496107_0129153 Ga0496107_0129153_377_1141 248
477 3300049576 Ga0501040_0000178 Ga0501040_0000178_17451_18233 248
478 3300049578 Ga0501042_0010204 Ga0501042_0010204_60_842 248
479 3300049578 Ga0501042_0020236 Ga0501042_0020236_2679_3461 248
480 3300049580 Ga0501046_0419166 Ga0501046_0419166_98_856 248
481 3300049588 Ga0501072_0018775 Ga0501072_0018775_476_1234 248
482 3300049591 Ga0501075_0318449 Ga0501075_0318449_67_825 248
483 3300049592 Ga0501076_0098197 Ga0501076_0098197_136_894 248
484 3300050511 nmdc:mga08y16_1047436_c1 nmdc:mga08y16_1047436_c1_17_778 248
485 3300050512 nmdc:mga0n895_576056_c1 nmdc:mga0n895_576056_c1_157_921 248
486 3300050513 nmdc:mga0rr50_17410_c1 nmdc:mga0rr50_17410_c1_2758_3522 248
487 3300050514 nmdc:mga08x19_41_c1 nmdc:mga08x19_41_c1_48710_49474 248
488 3300053153 Ga0500616_0013871 Ga0500616_0013871_2098_2862 248
489 3300053158 Ga0500627_0084901 Ga0500627_0084901_610_1371 248
490 3300054114 Ga0501084_0066359 Ga0501084_0066359_2074_2832 248
491 3300005336 Ga0070680_100219367 Ga0070680_1002193672 249
492 3300005340 Ga0070689_100056545 Ga0070689_1000565453 249
493 3300005343 Ga0070687_100062502 Ga0070687_1000625022 249
494 3300005365 Ga0070688_100342702 Ga0070688_1003427022 249
495 3300005456 Ga0070678_100771195 Ga0070678_1007711951 249
496 3300005466 Ga0070685_10225201 Ga0070685_102252011 249
497 3300005530 Ga0070679_100046195 Ga0070679_1000461952 249
498 3300005530 Ga0070679_100060704 Ga0070679_1000607042 249
499 3300005545 Ga0070695_100262542 Ga0070695_1002625422 249
500 3300005843 Ga0068860_100796095 Ga0068860_1007960951 249
501 3300005981 Ga0081538_10000527 Ga0081538_1000052739 249
502 3300005983 Ga0081540_1000726 Ga0081540_100072613 249
503 3300005983 Ga0081540_1020212 Ga0081540_10202123 249
504 3300006028 Ga0070717_10150400 Ga0070717_101504002 249
505 3300006847 Ga0075431_100115431 Ga0075431_1001154313 249
506 3300006852 Ga0075433_10010430 Ga0075433_100104302 249
507 3300006914 Ga0075436_100077423 Ga0075436_1000774232 249
508 3300007076 Ga0075435_100259981 Ga0075435_1002599812 249
509 3300009094 Ga0111539_10040323 Ga0111539_100403232 249
510 3300014326 Ga0157380_10245387 Ga0157380_102453872 249
511 3300014326 Ga0157380_10448235 Ga0157380_104482352 249
512 3300025912 Ga0207707_10270699 Ga0207707_102706992 249
513 3300025917 Ga0207660_10199477 Ga0207660_101994772 249
514 3300025921 Ga0207652_10089883 Ga0207652_100898834 249
515 3300027907 Ga0207428_10077375 Ga0207428_100773753 249
516 3300028577 Ga0265318_10029776 Ga0265318_100297762 249
517 3300028800 Ga0265338_10139074 Ga0265338_101390742 249
518 3300031240 Ga0265320_10082411 Ga0265320_100824111 249
519 3300031240 Ga0265320_10175548 Ga0265320_101755481 249
520 3300031241 Ga0265325_10118973 Ga0265325_101189732 249
521 3300031247 Ga0265340_10011212 Ga0265340_100112124 249
522 3300031247 Ga0265340_10024605 Ga0265340_100246052 249
523 3300031247 Ga0265340_10148477 Ga0265340_101484772 249
524 3300031344 Ga0265316_10105874 Ga0265316_101058742 249
525 3300031344 Ga0265316_10150075 Ga0265316_101500752 249
526 3300031344 Ga0265316_10160787 Ga0265316_101607872 249
527 3300031456 Ga0307513_10241655 Ga0307513_102416551 249
528 3300031456 Ga0307513_10279912 Ga0307513_102799122 249
529 3300031711 Ga0265314_10085876 Ga0265314_100858762 249
530 3300031712 Ga0265342_10111875 Ga0265342_101118752 249
531 3300032002 Ga0307416_100627194 Ga0307416_1006271941 249
532 3300032126 Ga0307415_100365661 Ga0307415_1003656612 249
533 3300035115 Ga0373941_0036236 Ga0373941_0036236_277_1119 249
534 3300046460 Ga0495638_0013717 Ga0495638_0013717_543_1352 249
535 3300046460 Ga0495638_0020278 Ga0495638_0020278_1876_2643 249
536 3300046519 Ga0495632_0137310 Ga0495632_0137310_304_1104 249
537 3300049570 Ga0501033_0026669 Ga0501033_0026669_1002_1889 249
538 3300049571 Ga0501034_0068135 Ga0501034_0068135_123_977 249
539 3300049575 Ga0501039_0539221 Ga0501039_0539221_42_839 249
540 3300049578 Ga0501042_0178016 Ga0501042_0178016_14_787 249
541 3300049579 Ga0501043_0391976 Ga0501043_0391976_129_971 249
542 3300049581 Ga0501047_0202384 Ga0501047_0202384_721_1608 249
543 3300049581 Ga0501047_0317529 Ga0501047_0317529_177_974 249
544 3300049582 Ga0501048_0183665 Ga0501048_0183665_50_844 249
545 3300049588 Ga0501072_0003589 Ga0501072_0003589_1508_2308 249
546 3300049588 Ga0501072_0034700 Ga0501072_0034700_1623_2408 249
547 3300049591 Ga0501075_0092992 Ga0501075_0092992_592_1377 249
548 3300049742 Ga0501080_0046132 Ga0501080_0046132_654_1541 249
549 3300049742 Ga0501080_0074874 Ga0501080_0074874_922_1716 249
550 3300049743 Ga0501081_0043403 Ga0501081_0043403_1581_2366 249
551 3300049822 Ga0501035_0229904 Ga0501035_0229904_521_1408 249
552 3300049823 Ga0501044_0276632 Ga0501044_0276632_266_1153 249
553 3300049823 Ga0501044_0327585 Ga0501044_0327585_323_1096 249
554 3300050510 nmdc:mga06r32_385591_c1 nmdc:mga06r32_385591_c1_339_1136 249
555 3300050510 nmdc:mga06r32_47678_c1 nmdc:mga06r32_47678_c1_1108_1893 249
556 3300050511 nmdc:mga08y16_221722_c1 nmdc:mga08y16_221722_c1_334_1134 249
557 3300050511 nmdc:mga08y16_7789_c1 nmdc:mga08y16_7789_c1_1747_2532 249
558 3300050515 nmdc:mga0a205_106301_c1 nmdc:mga0a205_106301_c1_612_1412 249
559 3300053117 Ga0500593_075640 Ga0500593_075640_99_881 249
560 3300053131 Ga0500652_000367 Ga0500652_000367_4619_5395 249
561 3300053151 Ga0500604_0051425 Ga0500604_0051425_153_953 249
562 3300054114 Ga0501084_0059726 Ga0501084_0059726_2111_2896 249
563 3300060353 Ga0501082_0021799 Ga0501082_0021799_4603_5388 249
564 3300061734 Ga0530510_0350108 Ga0530510_0350108_114_899 249
565 iso_pu_bacteria 2599185359 2600225873 249
566 3300005338 Ga0068868_100046239 Ga0068868_1000462391 250
567 3300005345 Ga0070692_10226109 Ga0070692_102261092 250
568 3300005347 Ga0070668_100146731 Ga0070668_1001467312 250
569 3300005365 Ga0070688_100232067 Ga0070688_1002320671 250
570 3300005444 Ga0070694_100139104 Ga0070694_1001391042 250
571 3300005546 Ga0070696_100072374 Ga0070696_1000723743 250
572 3300005549 Ga0070704_100377604 Ga0070704_1003776042 250
573 3300005577 Ga0068857_100116672 Ga0068857_1001166723 250
574 3300005578 Ga0068854_100045272 Ga0068854_1000452723 250
575 3300005615 Ga0070702_100063557 Ga0070702_1000635572 250
576 3300006178 Ga0075367_10036467 Ga0075367_100364672 250
577 3300006195 Ga0075366_10055843 Ga0075366_100558432 250
578 3300006881 Ga0068865_100077410 Ga0068865_1000774102 250
579 3300009094 Ga0111539_10458803 Ga0111539_104588032 250
580 3300009148 Ga0105243_10598668 Ga0105243_105986681 250
581 3300009545 Ga0105237_10008094 Ga0105237_1000809410 250
582 3300009545 Ga0105237_10251446 Ga0105237_102514462 250
583 3300009553 Ga0105249_10137950 Ga0105249_101379501 250
584 3300013296 Ga0157374_10391275 Ga0157374_103912752 250
585 3300014968 Ga0157379_10065537 Ga0157379_100655373 250
586 3300021388 Ga0213875_10120815 Ga0213875_101208151 250
587 3300025914 Ga0207671_10004388 Ga0207671_1000438810 250
588 3300025981 Ga0207640_10048623 Ga0207640_100486232 250
589 3300025986 Ga0207658_10185552 Ga0207658_101855522 250
590 3300026035 Ga0207703_10021441 Ga0207703_100214414 250
591 3300026035 Ga0207703_10412947 Ga0207703_104129472 250
592 3300026116 Ga0207674_10054075 Ga0207674_100540754 250
593 3300027717 Ga0209998_10003426 Ga0209998_100034261 250
594 3300031595 Ga0265313_10167319 Ga0265313_101673191 250
595 3300036401 Ga0373937_0584210 Ga0373937_0584210_85_891 250
596 3300037068 Ga0373925_0079599 Ga0373925_0079599_1640_2443 250
597 3300037853 Ga0436364_0111944 Ga0436364_0111944_2606_3424 250
598 3300037853 Ga0436364_1001667 Ga0436364_1001667_1497_2327 250
599 3300039437 Ga0436365_1456072 Ga0436365_1456072_299_1129 250
600 3300046491 Ga0495584_0018076 Ga0495584_0018076_2479_3264 250
601 3300046523 Ga0495644_0154709 Ga0495644_0154709_26_811 250
602 3300047318 Ga0495636_0045156 Ga0495636_0045156_500_1285 250
603 3300047320 Ga0495672_0061206 Ga0495672_0061206_942_1718 250
604 3300047322 Ga0495680_0297523 Ga0495680_0297523_132_938 250
605 3300048904 Ga0496101_0195260 Ga0496101_0195260_399_1184 250
606 3300048905 Ga0496102_0139782 Ga0496102_0139782_535_1320 250
607 3300048906 Ga0496103_0048675 Ga0496103_0048675_1166_1951 250
608 3300048910 Ga0496107_0327157 Ga0496107_0327157_57_842 250
609 3300048911 Ga0496108_0096466 Ga0496108_0096466_152_937 250
610 3300048912 Ga0496109_0707682 Ga0496109_0707682_120_905 250
611 3300048913 Ga0496110_0148154 Ga0496110_0148154_59_844 250
612 3300048916 Ga0496113_0317301 Ga0496113_0317301_350_1135 250
613 3300048923 Ga0496120_0021622 Ga0496120_0021622_2979_3761 250
614 3300048925 Ga0496122_0017867 Ga0496122_0017867_1298_2062 250
615 3300048926 Ga0496123_0024445 Ga0496123_0024445_729_1493 250
616 3300048926 Ga0496123_0068760 Ga0496123_0068760_629_1393 250
617 3300048926 Ga0496123_0069603 Ga0496123_0069603_759_1523 250
618 3300048927 Ga0496124_0000325 Ga0496124_0000325_59896_60678 250
619 3300048927 Ga0496124_0014367 Ga0496124_0014367_3130_3894 250
620 3300048927 Ga0496124_0018025 Ga0496124_0018025_3049_3813 250
621 3300048927 Ga0496124_0268110 Ga0496124_0268110_318_1082 250
622 3300049572 Ga0501036_0017141 Ga0501036_0017141_5179_5997 250
623 3300049574 Ga0501038_0044737 Ga0501038_0044737_1138_1956 250
624 3300049574 Ga0501038_0106273 Ga0501038_0106273_1339_2121 250
625 3300049576 Ga0501040_0021923 Ga0501040_0021923_843_1661 250
626 3300049576 Ga0501040_0207714 Ga0501040_0207714_508_1290 250
627 3300049577 Ga0501041_0008832 Ga0501041_0008832_4544_5362 250
628 3300049577 Ga0501041_0101960 Ga0501041_0101960_63_848 250
629 3300049578 Ga0501042_0041034 Ga0501042_0041034_113_928 250
630 3300049578 Ga0501042_0055688 Ga0501042_0055688_1455_2273 250
631 3300049578 Ga0501042_0445641 Ga0501042_0445641_115_900 250
632 3300049582 Ga0501048_0077188 Ga0501048_0077188_509_1294 250
633 3300049586 Ga0501070_0294523 Ga0501070_0294523_72_857 250
634 3300049586 Ga0501070_0388996 Ga0501070_0388996_295_1113 250
635 3300049588 Ga0501072_0015972 Ga0501072_0015972_4894_5676 250
636 3300049591 Ga0501075_0015402 Ga0501075_0015402_3014_3832 250
637 3300049593 Ga0501077_0011334 Ga0501077_0011334_291_1109 250
638 3300049741 Ga0501079_0024305 Ga0501079_0024305_2643_3428 250
639 3300049744 Ga0501083_0042504 Ga0501083_0042504_1767_2552 250
640 3300049824 Ga0501045_0028267 Ga0501045_0028267_1239_2057 250
641 3300049824 Ga0501045_0375107 Ga0501045_0375107_188_973 250
642 3300050493 nmdc:mga0k408_89680_c1 nmdc:mga0k408_89680_c1_25_819 250
643 3300050512 nmdc:mga0n895_184680_c1 nmdc:mga0n895_184680_c1_1072_1857 250
644 3300053083 Ga0495655_0019246 Ga0495655_0019246_707_1492 250
645 3300061734 Ga0530510_0086459 Ga0530510_0086459_499_1284 250
646 3300061734 Ga0530510_0089986 Ga0530510_0089986_1288_2073 250
647 iso_pu_bacteria 2818991466 2819716323 250
648 iso_pu_bacteria 2879163058 2879164045 250
649 iso_pu_bacteria 2928526807 2928528873 250
650 iso_pu_bacteria 2928968154 2928970425 250
651 2162886007 SwRhRL2b_contig_1628267 SwRhRL2b_0706.00003980 251
652 3300001978 JGI24747J21853_1003541 JGI24747J21853_10035412 251
653 3300001990 JGI24737J22298_10018418 JGI24737J22298_100184182 251
654 3300002067 JGI24735J21928_10048699 JGI24735J21928_100486991 251
655 3300002070 JGI24750J21931_1001174 JGI24750J21931_10011743 251
656 3300002075 JGI24738J21930_10019629 JGI24738J21930_100196292 251
657 3300005289 Ga0065704_10001326 Ga0065704_100013266 251
658 3300005327 Ga0070658_10075828 Ga0070658_100758282 251
659 3300005328 Ga0070676_10015602 Ga0070676_100156024 251
660 3300005330 Ga0070690_100000374 Ga0070690_10000037411 251
661 3300005331 Ga0070670_100003963 Ga0070670_10000396310 251
662 3300005335 Ga0070666_10004674 Ga0070666_100046746 251
663 3300005336 Ga0070680_100008223 Ga0070680_1000082236 251
664 3300005337 Ga0070682_100001371 Ga0070682_10000137112 251
665 3300005339 Ga0070660_100000601 Ga0070660_10000060115 251
666 3300005340 Ga0070689_100001212 Ga0070689_1000012125 251
667 3300005341 Ga0070691_10000403 Ga0070691_1000040311 251
668 3300005343 Ga0070687_100001226 Ga0070687_1000012268 251
669 3300005344 Ga0070661_100002128 Ga0070661_1000021285 251
670 3300005345 Ga0070692_10000588 Ga0070692_100005885 251
671 3300005347 Ga0070668_100000244 Ga0070668_10000024412 251
672 3300005347 Ga0070668_100534842 Ga0070668_1005348422 251
673 3300005353 Ga0070669_100003798 Ga0070669_1000037989 251
674 3300005353 Ga0070669_100341123 Ga0070669_1003411232 251
675 3300005354 Ga0070675_100001316 Ga0070675_1000013167 251
676 3300005355 Ga0070671_100001369 Ga0070671_1000013697 251
677 3300005356 Ga0070674_100002970 Ga0070674_1000029708 251
678 3300005364 Ga0070673_100000356 Ga0070673_10000035610 251
679 3300005365 Ga0070688_100001697 Ga0070688_1000016974 251
680 3300005366 Ga0070659_100001001 Ga0070659_10000100111 251
681 3300005367 Ga0070667_100002918 Ga0070667_1000029185 251
682 3300005434 Ga0070709_10000515 Ga0070709_100005158 251
683 3300005435 Ga0070714_100001611 Ga0070714_1000016116 251
684 3300005436 Ga0070713_100014697 Ga0070713_1000146974 251
685 3300005437 Ga0070710_10000792 Ga0070710_1000079212 251
686 3300005438 Ga0070701_10004797 Ga0070701_100047972 251
687 3300005439 Ga0070711_100000456 Ga0070711_10000045611 251
688 3300005440 Ga0070705_100000465 Ga0070705_10000046511 251
689 3300005441 Ga0070700_100000474 Ga0070700_1000004747 251
690 3300005444 Ga0070694_100014944 Ga0070694_1000149442 251
691 3300005455 Ga0070663_100005700 Ga0070663_1000057002 251
692 3300005456 Ga0070678_100000779 Ga0070678_1000007798 251
693 3300005457 Ga0070662_100009283 Ga0070662_1000092834 251
694 3300005458 Ga0070681_10020432 Ga0070681_100204322 251
695 3300005459 Ga0068867_100088225 Ga0068867_1000882253 251
696 3300005466 Ga0070685_10026919 Ga0070685_100269193 251
697 3300005535 Ga0070684_100008442 Ga0070684_1000084422 251
698 3300005536 Ga0070697_100002257 Ga0070697_10000225710 251
699 3300005539 Ga0068853_100001967 Ga0068853_10000196712 251
700 3300005543 Ga0070672_100000593 Ga0070672_1000005933 251
701 3300005544 Ga0070686_100000944 Ga0070686_10000094411 251
702 3300005545 Ga0070695_100001660 Ga0070695_1000016608 251
703 3300005546 Ga0070696_100045582 Ga0070696_1000455822 251
704 3300005547 Ga0070693_100000655 Ga0070693_10000065512 251
705 3300005548 Ga0070665_100015319 Ga0070665_1000153196 251
706 3300005548 Ga0070665_100094013 Ga0070665_1000940132 251
707 3300005549 Ga0070704_100000439 Ga0070704_1000004396 251
708 3300005563 Ga0068855_100007707 Ga0068855_1000077073 251
709 3300005564 Ga0070664_100002755 Ga0070664_1000027554 251
710 3300005564 Ga0070664_100751667 Ga0070664_1007516672 251
711 3300005578 Ga0068854_100002052 Ga0068854_1000020522 251
712 3300005614 Ga0068856_100002475 Ga0068856_10000247516 251
713 3300005615 Ga0070702_100000613 Ga0070702_10000061310 251
714 3300005616 Ga0068852_100091581 Ga0068852_1000915812 251
715 3300005617 Ga0068859_100002629 Ga0068859_10000262913 251
716 3300005617 Ga0068859_100329241 Ga0068859_1003292412 251
717 3300005618 Ga0068864_100001166 Ga0068864_10000116613 251
718 3300005718 Ga0068866_10000608 Ga0068866_1000060810 251
719 3300005719 Ga0068861_100002476 Ga0068861_1000024766 251
720 3300005841 Ga0068863_100002189 Ga0068863_1000021898 251
721 3300005842 Ga0068858_100008733 Ga0068858_1000087332 251
722 3300005843 Ga0068860_100001510 Ga0068860_10000151015 251
723 3300005844 Ga0068862_100006358 Ga0068862_1000063586 251
724 3300005937 Ga0081455_10028476 Ga0081455_100284762 251
725 3300006163 Ga0070715_10000212 Ga0070715_100002122 251
726 3300006173 Ga0070716_100002398 Ga0070716_1000023982 251
727 3300006175 Ga0070712_100001371 Ga0070712_1000013719 251
728 3300006237 Ga0097621_100035352 Ga0097621_1000353524 251
729 3300006237 Ga0097621_100618057 Ga0097621_1006180572 251
730 3300006881 Ga0068865_100003706 Ga0068865_1000037066 251
731 3300006931 Ga0097620_100002628 Ga0097620_10000262813 251
732 3300006931 Ga0097620_100329236 Ga0097620_1003292362 251
733 3300009093 Ga0105240_10013652 Ga0105240_1001365210 251
734 3300009093 Ga0105240_10841749 Ga0105240_108417491 251
735 3300009101 Ga0105247_10000949 Ga0105247_1000094910 251
736 3300009148 Ga0105243_10003755 Ga0105243_100037558 251
737 3300009174 Ga0105241_10000973 Ga0105241_1000097310 251
738 3300009176 Ga0105242_10000217 Ga0105242_1000021710 251
739 3300009177 Ga0105248_10000487 Ga0105248_100004879 251
740 3300009545 Ga0105237_10000638 Ga0105237_1000063812 251
741 3300009551 Ga0105238_10009653 Ga0105238_100096537 251
742 3300009553 Ga0105249_10001683 Ga0105249_1000168318 251
743 3300011119 Ga0105246_10002121 Ga0105246_100021215 251
744 3300013100 Ga0157373_10018963 Ga0157373_100189634 251
745 3300013102 Ga0157371_10012149 Ga0157371_100121492 251
746 3300013105 Ga0157369_10001385 Ga0157369_1000138516 251
747 3300013296 Ga0157374_10006058 Ga0157374_100060583 251
748 3300013297 Ga0157378_10001965 Ga0157378_100019659 251
749 3300013306 Ga0163162_10000935 Ga0163162_100009352 251
750 3300013307 Ga0157372_10002028 Ga0157372_1000202812 251
751 3300013308 Ga0157375_10002243 Ga0157375_100022438 251
752 3300014325 Ga0163163_10005752 Ga0163163_100057523 251
753 3300014325 Ga0163163_10185462 Ga0163163_101854622 251
754 3300014745 Ga0157377_10012188 Ga0157377_100121884 251
755 3300014968 Ga0157379_10003497 Ga0157379_100034974 251
756 3300014968 Ga0157379_10096430 Ga0157379_100964303 251
757 3300014969 Ga0157376_10001063 Ga0157376_100010637 251
758 3300017792 Ga0163161_10159133 Ga0163161_101591332 251
759 3300025229 Ga0209147_101859 Ga0209147_1018597 251
760 3300025315 Ga0207697_10021964 Ga0207697_100219641 251
761 3300025898 Ga0207692_10006876 Ga0207692_100068763 251
762 3300025899 Ga0207642_10017008 Ga0207642_100170083 251
763 3300025900 Ga0207710_10002675 Ga0207710_100026754 251
764 3300025901 Ga0207688_10000431 Ga0207688_1000043111 251
765 3300025903 Ga0207680_10018948 Ga0207680_100189482 251
766 3300025904 Ga0207647_10057873 Ga0207647_100578732 251
767 3300025905 Ga0207685_10000775 Ga0207685_100007755 251
768 3300025906 Ga0207699_10002089 Ga0207699_100020897 251
769 3300025906 Ga0207699_10108246 Ga0207699_101082462 251
770 3300025907 Ga0207645_10009143 Ga0207645_100091435 251
771 3300025909 Ga0207705_10088398 Ga0207705_100883982 251
772 3300025911 Ga0207654_10002198 Ga0207654_100021982 251
773 3300025912 Ga0207707_10097771 Ga0207707_100977712 251
774 3300025913 Ga0207695_10052409 Ga0207695_100524091 251
775 3300025914 Ga0207671_10009191 Ga0207671_100091914 251
776 3300025915 Ga0207693_10000278 Ga0207693_1000027835 251
777 3300025916 Ga0207663_10000927 Ga0207663_100009277 251
778 3300025918 Ga0207662_10002352 Ga0207662_100023522 251
779 3300025919 Ga0207657_10000047 Ga0207657_1000004711 251
780 3300025920 Ga0207649_10001651 Ga0207649_100016516 251
781 3300025921 Ga0207652_10024920 Ga0207652_100249204 251
782 3300025923 Ga0207681_10019291 Ga0207681_100192914 251
783 3300025924 Ga0207694_10009551 Ga0207694_100095513 251
784 3300025925 Ga0207650_10015241 Ga0207650_100152414 251
785 3300025926 Ga0207659_10004845 Ga0207659_100048455 251
786 3300025927 Ga0207687_10022268 Ga0207687_100222682 251
787 3300025928 Ga0207700_10024152 Ga0207700_100241524 251
788 3300025929 Ga0207664_10002197 Ga0207664_100021976 251
789 3300025931 Ga0207644_10010820 Ga0207644_100108203 251
790 3300025932 Ga0207690_10001227 Ga0207690_100012277 251
791 3300025933 Ga0207706_10000079 Ga0207706_1000007991 251
792 3300025934 Ga0207686_10008938 Ga0207686_100089384 251
793 3300025935 Ga0207709_10004350 Ga0207709_100043503 251
794 3300025936 Ga0207670_10001314 Ga0207670_100013148 251
795 3300025937 Ga0207669_10025717 Ga0207669_100257173 251
796 3300025938 Ga0207704_10389730 Ga0207704_103897302 251
797 3300025939 Ga0207665_10000432 Ga0207665_1000043217 251
798 3300025940 Ga0207691_10007351 Ga0207691_100073518 251
799 3300025941 Ga0207711_10027232 Ga0207711_100272323 251
800 3300025944 Ga0207661_10027569 Ga0207661_100275693 251
801 3300025945 Ga0207679_10001961 Ga0207679_100019618 251
802 3300025945 Ga0207679_10519231 Ga0207679_105192311 251
803 3300025949 Ga0207667_10009433 Ga0207667_100094335 251
804 3300025960 Ga0207651_10003659 Ga0207651_100036595 251
805 3300025961 Ga0207712_10004439 Ga0207712_100044394 251
806 3300025972 Ga0207668_10004917 Ga0207668_100049175 251
807 3300025981 Ga0207640_10008947 Ga0207640_100089475 251
808 3300025986 Ga0207658_10004453 Ga0207658_100044535 251
809 3300025986 Ga0207658_10034047 Ga0207658_100340472 251
810 3300026035 Ga0207703_10013192 Ga0207703_100131922 251
811 3300026067 Ga0207678_10000111 Ga0207678_1000011135 251
812 3300026075 Ga0207708_10004157 Ga0207708_100041579 251
813 3300026078 Ga0207702_10004141 Ga0207702_100041415 251
814 3300026088 Ga0207641_10008713 Ga0207641_100087133 251
815 3300026089 Ga0207648_10015812 Ga0207648_100158124 251
816 3300026095 Ga0207676_10005911 Ga0207676_100059115 251
817 3300026118 Ga0207675_100000424 Ga0207675_10000042410 251
818 3300026121 Ga0207683_10000026 Ga0207683_1000002699 251
819 3300026142 Ga0207698_10016682 Ga0207698_100166823 251
820 3300028379 Ga0268266_10008327 Ga0268266_100083272 251
821 3300028380 Ga0268265_10008336 Ga0268265_100083364 251
822 3300035085 Ga0373929_0018745 Ga0373929_0018745_180_971 251
823 3300035088 Ga0373940_0027937 Ga0373940_0027937_54_845 251
824 3300035089 Ga0373944_0082042 Ga0373944_0082042_234_1025 251
825 3300035090 Ga0373949_0010516 Ga0373949_0010516_165_956 251
826 3300035112 Ga0373932_0026197 Ga0373932_0026197_681_1472 251
827 3300035115 Ga0373941_0010659 Ga0373941_0010659_649_1440 251
828 3300035121 Ga0373960_0001193 Ga0373960_0001193_2336_3127 251
829 3300035171 Ga0373946_0012816 Ga0373946_0012816_228_1019 251
830 3300035242 Ga0373962_0004899 Ga0373962_0004899_2160_2951 251
831 3300035691 Ga0373931_0013273 Ga0373931_0013273_1605_2396 251
832 3300035692 Ga0373935_0107237 Ga0373935_0107237_747_1538 251
833 3300036401 Ga0373937_0095808 Ga0373937_0095808_1390_2181 251
834 3300037068 Ga0373925_0002314 Ga0373925_0002314_3517_4308 251
835 3300046455 Ga0495603_0000133 Ga0495603_0000133_34580_35371 251
836 3300046459 Ga0495629_0060445 Ga0495629_0060445_1527_2318 251
837 3300046461 Ga0495641_0032986 Ga0495641_0032986_818_1609 251
838 3300046472 Ga0495580_0000173 Ga0495580_0000173_18181_18972 251
839 3300046473 Ga0495582_0000518 Ga0495582_0000518_1499_2290 251
840 3300046475 Ga0495639_0001342 Ga0495639_0001342_5180_5971 251
841 3300046476 Ga0495662_0130977 Ga0495662_0130977_234_1025 251
842 3300046491 Ga0495584_0058378 Ga0495584_0058378_916_1707 251
843 3300046499 Ga0495594_0000755 Ga0495594_0000755_11104_11895 251
844 3300046512 Ga0495610_0000102 Ga0495610_0000102_94517_95272 251
845 3300046519 Ga0495632_0000013 Ga0495632_0000013_21883_22638 251
846 3300046520 Ga0495637_0000229 Ga0495637_0000229_39507_40262 251
847 3300046520 Ga0495637_0003875 Ga0495637_0003875_679_1434 251
848 3300046522 Ga0495643_0000010 Ga0495643_0000010_160458_161213 251
849 3300046524 Ga0495648_0005640 Ga0495648_0005640_7673_8428 251
850 3300046525 Ga0495663_0000004 Ga0495663_0000004_129147_129902 251
851 3300046531 Ga0495665_0009595 Ga0495665_0009595_2190_2981 251
852 3300046533 Ga0495640_0113802 Ga0495640_0113802_854_1645 251
853 3300046557 Ga0495622_0024401 Ga0495622_0024401_179_970 251
854 3300046558 Ga0495633_0000092 Ga0495633_0000092_2721_3476 251
855 3300046558 Ga0495633_0002370 Ga0495633_0002370_9974_10729 251
856 3300046558 Ga0495633_0009961 Ga0495633_0009961_2690_3466 251
857 3300046642 Ga0495634_0005211 Ga0495634_0005211_1139_1930 251
858 3300046660 Ga0495625_0010628 Ga0495625_0010628_6131_6886 251
859 3300046674 Ga0495588_0001185 Ga0495588_0001185_1422_2213 251
860 3300046681 Ga0495647_0001112 Ga0495647_0001112_2479_3270 251
861 3300046683 Ga0495658_0000605 Ga0495658_0000605_9718_10509 251
862 3300046690 Ga0495624_0109294 Ga0495624_0109294_325_1116 251
863 3300046692 Ga0495671_0000014 Ga0495671_0000014_160458_161213 251
864 3300047315 Ga0495581_0004284 Ga0495581_0004284_5486_6277 251
865 3300047321 Ga0495676_0022592 Ga0495676_0022592_2590_3381 251
866 3300047322 Ga0495680_0238470 Ga0495680_0238470_418_1209 251
867 3300047470 Ga0495681_0000104 Ga0495681_0000104_38718_39473 251
868 3300047470 Ga0495681_0001853 Ga0495681_0001853_11770_12525 251
869 3300047471 Ga0495684_0326339 Ga0495684_0326339_85_876 251
870 3300047472 Ga0495686_0014266 Ga0495686_0014266_1731_2486 251
871 3300047673 Ga0495593_0000542 Ga0495593_0000542_9435_10226 251
872 3300048089 Ga0495614_0032376 Ga0495614_0032376_112_903 251
873 3300048903 Ga0496100_0005987 Ga0496100_0005987_3034_3825 251
874 3300048904 Ga0496101_0003489 Ga0496101_0003489_5006_5797 251
875 3300048905 Ga0496102_0024330 Ga0496102_0024330_1395_2186 251
876 3300048907 Ga0496104_0033474 Ga0496104_0033474_2209_3000 251
877 3300048908 Ga0496105_0029366 Ga0496105_0029366_3208_3999 251
878 3300048909 Ga0496106_0005954 Ga0496106_0005954_6006_6797 251
879 3300048910 Ga0496107_0003242 Ga0496107_0003242_4158_4949 251
880 3300048911 Ga0496108_0001293 Ga0496108_0001293_17145_17900 251
881 3300048911 Ga0496108_0009953 Ga0496108_0009953_4012_4803 251
882 3300048912 Ga0496109_0014922 Ga0496109_0014922_4112_4903 251
883 3300048912 Ga0496109_0025936 Ga0496109_0025936_1518_2309 251
884 3300048913 Ga0496110_0007501 Ga0496110_0007501_2209_3000 251
885 3300048914 Ga0496111_0007534 Ga0496111_0007534_4140_4931 251
886 3300048914 Ga0496111_0139261 Ga0496111_0139261_692_1483 251
887 3300048915 Ga0496112_0005647 Ga0496112_0005647_7753_8544 251
888 3300048915 Ga0496112_0049717 Ga0496112_0049717_3279_4070 251
889 3300048916 Ga0496113_0004308 Ga0496113_0004308_5717_6508 251
890 3300048917 Ga0496114_0008772 Ga0496114_0008772_4012_4803 251
891 3300048918 Ga0496115_0030526 Ga0496115_0030526_252_1043 251
892 3300048918 Ga0496115_0483296 Ga0496115_0483296_161_952 251
893 3300048919 Ga0496116_0080861 Ga0496116_0080861_786_1541 251
894 3300048924 Ga0496121_0003339 Ga0496121_0003339_5179_5934 251
895 3300048925 Ga0496122_0075458 Ga0496122_0075458_357_1115 251
896 3300048926 Ga0496123_0233305 Ga0496123_0233305_116_874 251
897 3300048928 Ga0496125_0027815 Ga0496125_0027815_3467_4222 251
898 3300049459 Ga0495678_008677 Ga0495678_008677_3846_4601 251
899 3300049744 Ga0501083_0072856 Ga0501083_0072856_1024_1788 251
900 3300053083 Ga0495655_0006625 Ga0495655_0006625_1053_1844 251
901 3300053084 Ga0495595_0005795 Ga0495595_0005795_537_1328 251
902 3300053157 Ga0500624_000107 Ga0500624_000107_35292_36056 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

141

226

0.97

PF02754

CCG

Cysteine-rich domain

13

93

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.8216 4 245
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.8097 4 245
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7918 4 245
1oe6-assembly1.cif.gz_A xenopus smug1, an anti-mutator uracil-dna glycosylase 0.7831 185 233
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.7806 4 245
ID Description Score Start End Superfamily
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9656 135 218 3.40.30.10
af_P77252_3_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9574 6 81 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9334 135 218 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9233 6 81 3.40.30.10
af_P0A996_163_249_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9057 6 81 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A351T825-F1-model_v4 Fe-S oxidoreductase 0.9991 4 117 GO:0005829
GO:0016491
AF-A0A196MA39-F1-model_v4 Fe-S oxidoreductase 0.997 1 251 GO:0005829
GO:0016491
AF-A0A175R7C8-F1-model_v4 Fe-S oxidoreductase 0.9932 4 250 GO:0005829
GO:0016491
AF-A0A6I6IXL7-F1-model_v4 (Fe-S)-binding protein 0.9919 3 251 GO:0005829
GO:0016491
AF-A0A2E9Y258-F1-model_v4 Fe-S oxidoreductase 0.9908 2 250 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.25 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map