F485215
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 902 | 418 | 902 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10291657|Ga0307513_102916572 |
| Length | 103 |
| Sequence | MIKVSVMYPNTPGARFDHDYYRTKHVPLVLARVGPSCKQHSVDKGLSGGGNAPALYAAMCHLHFDSVETFQADFGPHMKEIMADTPNYTDIAPVMQISEVVTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 133 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 134 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 237 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 239 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 249 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 256 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 257 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 265 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 268 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 274 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 275 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 276 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 277 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 278 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 279 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 282 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 283 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 284 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 285 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 288 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 360 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 363 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 364 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 365 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 366 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 367 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 369 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 370 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 371 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 377 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 378 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 379 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 380 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 381 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 384 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 388 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 404 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 405 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 408 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 410 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 411 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 412 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 413 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 414 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 415 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 418 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.87 |
| Nodule | 0 |
| Rhizoplane | 3.22 |
| Rhizosphere | 85.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10078175 | 3300002077 | Bacteria | 604 |
| 2 | JGI25153J46596_10004955 | 3300003215 | Bacteria | 7074 |
| 3 | rootH1_10170689 | 3300003323 | Bacteria | 1767 |
| 4 | Ga0058859_10007278 | 3300004798 | Bacteria | 625 |
| 5 | Ga0065712_10070708 | 3300005290 | Bacteria | 5771 |
| 6 | Ga0065707_10087797 | 3300005295 | Bacteria | 4886 |
| 7 | Ga0065707_10124122 | 3300005295 | Bacteria | 2045 |
| 8 | Ga0070658_11341319 | 3300005327 | Unclassified | 621 |
| 9 | Ga0070676_10006250 | 3300005328 | Bacteria | 6362 |
| 10 | Ga0070676_10213058 | 3300005328 | Bacteria | 1272 |
| 11 | Ga0070676_11301477 | 3300005328 | Bacteria | 555 |
| 12 | Ga0070683_100221580 | 3300005329 | Bacteria | 1798 |
| 13 | Ga0070683_101660997 | 3300005329 | Bacteria | 614 |
| 14 | Ga0070690_100004845 | 3300005330 | Bacteria | 7512 |
| 15 | Ga0070690_100032929 | 3300005330 | Bacteria | 3241 |
| 16 | Ga0070670_100008902 | 3300005331 | Bacteria | 8569 |
| 17 | Ga0070670_100120552 | 3300005331 | Bacteria | 2263 |
| 18 | Ga0070670_100127330 | 3300005331 | Bacteria | 2198 |
| 19 | Ga0070670_100295989 | 3300005331 | Bacteria | 1415 |
| 20 | Ga0070670_100634107 | 3300005331 | Bacteria | 958 |
| 21 | Ga0070670_101188779 | 3300005331 | Bacteria | 697 |
| 22 | Ga0070677_10692932 | 3300005333 | Bacteria | 573 |
| 23 | Ga0070677_10706178 | 3300005333 | Bacteria | 568 |
| 24 | Ga0068869_100048516 | 3300005334 | Bacteria | 3071 |
| 25 | Ga0068869_100072059 | 3300005334 | Unclassified | 2560 |
| 26 | Ga0068869_100592476 | 3300005334 | Bacteria | 936 |
| 27 | Ga0068869_100667532 | 3300005334 | Bacteria | 884 |
| 28 | Ga0070666_10623468 | 3300005335 | Bacteria | 788 |
| 29 | Ga0070680_100089415 | 3300005336 | Bacteria | 2548 |
| 30 | Ga0070680_101560884 | 3300005336 | Bacteria | 572 |
| 31 | Ga0070682_100649080 | 3300005337 | Bacteria | 840 |
| 32 | Ga0068868_100327829 | 3300005338 | Bacteria | 1306 |
| 33 | Ga0068868_100444394 | 3300005338 | Bacteria | 1127 |
| 34 | Ga0068868_100491741 | 3300005338 | Bacteria | 1073 |
| 35 | Ga0068868_100945002 | 3300005338 | Bacteria | 786 |
| 36 | Ga0068868_101221872 | 3300005338 | Bacteria | 696 |
| 37 | Ga0068868_101784677 | 3300005338 | Bacteria | 581 |
| 38 | Ga0070660_100738975 | 3300005339 | Bacteria | 826 |
| 39 | Ga0070689_100002318 | 3300005340 | Bacteria | 12394 |
| 40 | Ga0070687_100001735 | 3300005343 | Bacteria | 7848 |
| 41 | Ga0070687_100132426 | 3300005343 | Bacteria | 1441 |
| 42 | Ga0070687_100379197 | 3300005343 | Bacteria | 921 |
| 43 | Ga0070661_100080340 | 3300005344 | Bacteria | 2407 |
| 44 | Ga0070661_100519668 | 3300005344 | Bacteria | 955 |
| 45 | Ga0070661_100896384 | 3300005344 | Bacteria | 732 |
| 46 | Ga0070661_101672753 | 3300005344 | Bacteria | 539 |
| 47 | Ga0070692_10196058 | 3300005345 | Bacteria | 1180 |
| 48 | Ga0070692_11063170 | 3300005345 | Bacteria | 569 |
| 49 | Ga0070668_100100711 | 3300005347 | Bacteria | 2289 |
| 50 | Ga0070668_100679905 | 3300005347 | Bacteria | 906 |
| 51 | Ga0070669_100032396 | 3300005353 | Bacteria | 3775 |
| 52 | Ga0070669_100137207 | 3300005353 | Bacteria | 1882 |
| 53 | Ga0070669_100190119 | 3300005353 | Bacteria | 1610 |
| 54 | Ga0070675_100592230 | 3300005354 | Bacteria | 1005 |
| 55 | Ga0070675_101159412 | 3300005354 | Unclassified | 711 |
| 56 | Ga0070671_100030098 | 3300005355 | Bacteria | 4480 |
| 57 | Ga0070671_100197809 | 3300005355 | Bacteria | 1704 |
| 58 | Ga0070674_100283453 | 3300005356 | Bacteria | 1314 |
| 59 | Ga0070674_100326027 | 3300005356 | Bacteria | 1233 |
| 60 | Ga0070674_100720985 | 3300005356 | Bacteria | 854 |
| 61 | Ga0070673_100000317 | 3300005364 | Bacteria | 25361 |
| 62 | Ga0070673_100118429 | 3300005364 | Bacteria | 2205 |
| 63 | Ga0070673_100949121 | 3300005364 | Bacteria | 799 |
| 64 | Ga0070673_101171633 | 3300005364 | Bacteria | 719 |
| 65 | Ga0070688_100001119 | 3300005365 | Bacteria | 13408 |
| 66 | Ga0070688_100506878 | 3300005365 | Bacteria | 911 |
| 67 | Ga0070659_100482370 | 3300005366 | Bacteria | 1055 |
| 68 | Ga0070659_100873661 | 3300005366 | Bacteria | 785 |
| 69 | Ga0070667_100122916 | 3300005367 | Bacteria | 2260 |
| 70 | Ga0070667_100192544 | 3300005367 | Bacteria | 1807 |
| 71 | Ga0070667_101388834 | 3300005367 | Bacteria | 659 |
| 72 | Ga0070667_101809994 | 3300005367 | Bacteria | 575 |
| 73 | Ga0070703_10101445 | 3300005406 | Bacteria | 1015 |
| 74 | Ga0070709_10014614 | 3300005434 | Bacteria | 4444 |
| 75 | Ga0070714_100020507 | 3300005435 | Bacteria | 5398 |
| 76 | Ga0070713_100017912 | 3300005436 | Bacteria | 5373 |
| 77 | Ga0070713_100037196 | 3300005436 | Bacteria | 3935 |
| 78 | Ga0070710_10532322 | 3300005437 | Bacteria | 809 |
| 79 | Ga0070701_10007594 | 3300005438 | Bacteria | 4644 |
| 80 | Ga0070701_11353664 | 3300005438 | Unclassified | 510 |
| 81 | Ga0070711_100112338 | 3300005439 | Bacteria | 2002 |
| 82 | Ga0070711_100116643 | 3300005439 | Unclassified | 1968 |
| 83 | Ga0070705_100232057 | 3300005440 | Bacteria | 1284 |
| 84 | Ga0070705_100599646 | 3300005440 | Bacteria | 852 |
| 85 | Ga0070705_100840726 | 3300005440 | Bacteria | 734 |
| 86 | Ga0070700_100567998 | 3300005441 | Bacteria | 884 |
| 87 | Ga0070700_100756833 | 3300005441 | Bacteria | 778 |
| 88 | Ga0070694_100147625 | 3300005444 | Bacteria | 1714 |
| 89 | Ga0070708_100210457 | 3300005445 | Bacteria | 1822 |
| 90 | Ga0070663_100873917 | 3300005455 | Bacteria | 775 |
| 91 | Ga0070678_100031268 | 3300005456 | Bacteria | 3669 |
| 92 | Ga0070678_100278101 | 3300005456 | Bacteria | 1414 |
| 93 | Ga0070678_100337502 | 3300005456 | Bacteria | 1292 |
| 94 | Ga0070678_101527101 | 3300005456 | Bacteria | 626 |
| 95 | Ga0070662_100002863 | 3300005457 | Bacteria | 10699 |
| 96 | Ga0070662_100025780 | 3300005457 | Bacteria | 4064 |
| 97 | Ga0070681_10026906 | 3300005458 | Bacteria | 5783 |
| 98 | Ga0070681_11180454 | 3300005458 | Bacteria | 687 |
| 99 | Ga0068867_100016517 | 3300005459 | Bacteria | 5242 |
| 100 | Ga0068867_100311574 | 3300005459 | Bacteria | 1301 |
| 101 | Ga0068867_100467944 | 3300005459 | Bacteria | 1077 |
| 102 | Ga0070685_10103872 | 3300005466 | Bacteria | 1739 |
| 103 | Ga0070707_100648113 | 3300005468 | Bacteria | 1019 |
| 104 | Ga0070707_101905168 | 3300005468 | Unclassified | 562 |
| 105 | Ga0070698_101734982 | 3300005471 | Unclassified | 577 |
| 106 | Ga0070679_100153455 | 3300005530 | Bacteria | 2279 |
| 107 | Ga0070679_100582983 | 3300005530 | Bacteria | 1062 |
| 108 | Ga0070684_100006100 | 3300005535 | Bacteria | 9284 |
| 109 | Ga0070697_100917531 | 3300005536 | Bacteria | 777 |
| 110 | Ga0068853_100111272 | 3300005539 | Bacteria | 2433 |
| 111 | Ga0068853_100118015 | 3300005539 | Bacteria | 2364 |
| 112 | Ga0068853_100237294 | 3300005539 | Bacteria | 1670 |
| 113 | Ga0068853_100885631 | 3300005539 | Bacteria | 857 |
| 114 | Ga0068853_101548891 | 3300005539 | Bacteria | 642 |
| 115 | Ga0070672_100070580 | 3300005543 | Bacteria | 2776 |
| 116 | Ga0070672_100142954 | 3300005543 | Bacteria | 1975 |
| 117 | Ga0070672_100698845 | 3300005543 | Bacteria | 888 |
| 118 | Ga0070686_100002445 | 3300005544 | Bacteria | 10235 |
| 119 | Ga0070686_100095174 | 3300005544 | Bacteria | 2000 |
| 120 | Ga0070686_100484324 | 3300005544 | Bacteria | 957 |
| 121 | Ga0070686_101804248 | 3300005544 | Bacteria | 521 |
| 122 | Ga0070695_101563217 | 3300005545 | Unclassified | 550 |
| 123 | Ga0070696_100001844 | 3300005546 | Bacteria | 13919 |
| 124 | Ga0070696_100075441 | 3300005546 | Bacteria | 2379 |
| 125 | Ga0070696_100504633 | 3300005546 | Bacteria | 963 |
| 126 | Ga0070696_100612777 | 3300005546 | Unclassified | 879 |
| 127 | Ga0070696_101120139 | 3300005546 | Bacteria | 662 |
| 128 | Ga0070665_100031487 | 3300005548 | Bacteria | 5339 |
| 129 | Ga0070665_100101282 | 3300005548 | Bacteria | 2884 |
| 130 | Ga0070665_100390388 | 3300005548 | Bacteria | 1399 |
| 131 | Ga0070665_100447285 | 3300005548 | Bacteria | 1301 |
| 132 | Ga0070665_100659316 | 3300005548 | Bacteria | 1059 |
| 133 | Ga0070665_100780351 | 3300005548 | Bacteria | 968 |
| 134 | Ga0070665_100790015 | 3300005548 | Bacteria | 962 |
| 135 | Ga0070665_100941862 | 3300005548 | Bacteria | 876 |
| 136 | Ga0070665_101482845 | 3300005548 | Bacteria | 687 |
| 137 | Ga0070704_100359716 | 3300005549 | Unclassified | 1231 |
| 138 | Ga0070704_100403677 | 3300005549 | Bacteria | 1167 |
| 139 | Ga0068855_100407207 | 3300005563 | Bacteria | 1490 |
| 140 | Ga0070664_100008545 | 3300005564 | Bacteria | 8281 |
| 141 | Ga0070664_100016232 | 3300005564 | Bacteria | 6104 |
| 142 | Ga0070664_100474321 | 3300005564 | Bacteria | 1151 |
| 143 | Ga0070664_100963799 | 3300005564 | Unclassified | 801 |
| 144 | Ga0068857_100014969 | 3300005577 | Bacteria | 6766 |
| 145 | Ga0068857_100040174 | 3300005577 | Bacteria | 4148 |
| 146 | Ga0068857_100117239 | 3300005577 | Bacteria | 2396 |
| 147 | Ga0068857_100153872 | 3300005577 | Bacteria | 2085 |
| 148 | Ga0068857_101061684 | 3300005577 | Bacteria | 781 |
| 149 | Ga0068854_100017705 | 3300005578 | Bacteria | 4772 |
| 150 | Ga0068854_100236014 | 3300005578 | Bacteria | 1454 |
| 151 | Ga0068856_100128803 | 3300005614 | Bacteria | 2535 |
| 152 | Ga0070702_100273293 | 3300005615 | Bacteria | 1156 |
| 153 | Ga0070702_100446992 | 3300005615 | Bacteria | 937 |
| 154 | Ga0068852_100032511 | 3300005616 | Bacteria | 4321 |
| 155 | Ga0068852_100098682 | 3300005616 | Bacteria | 2631 |
| 156 | Ga0068852_100827561 | 3300005616 | Bacteria | 941 |
| 157 | Ga0068852_101671631 | 3300005616 | Bacteria | 659 |
| 158 | Ga0068859_100173238 | 3300005617 | Bacteria | 2240 |
| 159 | Ga0068859_100295362 | 3300005617 | Bacteria | 1713 |
| 160 | Ga0068859_100368076 | 3300005617 | Bacteria | 1533 |
| 161 | Ga0068859_100401341 | 3300005617 | Bacteria | 1467 |
| 162 | Ga0068859_101393798 | 3300005617 | Bacteria | 773 |
| 163 | Ga0068864_100002908 | 3300005618 | Bacteria | 14161 |
| 164 | Ga0068864_100050437 | 3300005618 | Bacteria | 3582 |
| 165 | Ga0068864_100115144 | 3300005618 | Bacteria | 2398 |
| 166 | Ga0068864_100524099 | 3300005618 | Bacteria | 1143 |
| 167 | Ga0068866_10043985 | 3300005718 | Bacteria | 2232 |
| 168 | Ga0068866_10602610 | 3300005718 | Bacteria | 742 |
| 169 | Ga0068866_10771041 | 3300005718 | Bacteria | 666 |
| 170 | Ga0068861_100002630 | 3300005719 | Bacteria | 11742 |
| 171 | Ga0068861_100003108 | 3300005719 | Bacteria | 10977 |
| 172 | Ga0068861_100005158 | 3300005719 | Bacteria | 8814 |
| 173 | Ga0068861_101662371 | 3300005719 | Bacteria | 631 |
| 174 | Ga0068861_102071787 | 3300005719 | Bacteria | 568 |
| 175 | Ga0068851_10193840 | 3300005834 | Bacteria | 1131 |
| 176 | Ga0068870_10019848 | 3300005840 | Bacteria | 3265 |
| 177 | Ga0068870_10248240 | 3300005840 | Bacteria | 1102 |
| 178 | Ga0068863_100000209 | 3300005841 | Bacteria | 62481 |
| 179 | Ga0068863_100208951 | 3300005841 | Bacteria | 1879 |
| 180 | Ga0068863_100621586 | 3300005841 | Bacteria | 1070 |
| 181 | Ga0068863_100900125 | 3300005841 | Bacteria | 885 |
| 182 | Ga0068863_101535979 | 3300005841 | Bacteria | 674 |
| 183 | Ga0068863_102398743 | 3300005841 | Bacteria | 537 |
| 184 | Ga0068858_100022830 | 3300005842 | Bacteria | 5835 |
| 185 | Ga0068858_100367161 | 3300005842 | Bacteria | 1380 |
| 186 | Ga0068858_100407605 | 3300005842 | Bacteria | 1307 |
| 187 | Ga0068860_100004201 | 3300005843 | Bacteria | 14760 |
| 188 | Ga0068860_100006195 | 3300005843 | Bacteria | 12029 |
| 189 | Ga0068860_100234346 | 3300005843 | Bacteria | 1784 |
| 190 | Ga0068860_100446568 | 3300005843 | Unclassified | 1285 |
| 191 | Ga0068860_100863446 | 3300005843 | Bacteria | 920 |
| 192 | Ga0068860_101168643 | 3300005843 | Bacteria | 790 |
| 193 | Ga0068860_101617348 | 3300005843 | Bacteria | 670 |
| 194 | Ga0068862_100003257 | 3300005844 | Bacteria | 14041 |
| 195 | Ga0068862_100027941 | 3300005844 | Bacteria | 4751 |
| 196 | Ga0068862_100031016 | 3300005844 | Bacteria | 4508 |
| 197 | Ga0068862_100088646 | 3300005844 | Bacteria | 2692 |
| 198 | Ga0068862_100155300 | 3300005844 | Bacteria | 2039 |
| 199 | Ga0068862_100549435 | 3300005844 | Bacteria | 1103 |
| 200 | Ga0068862_101848142 | 3300005844 | Bacteria | 614 |
| 201 | Ga0068862_102355716 | 3300005844 | Bacteria | 544 |
| 202 | Ga0081455_10643142 | 3300005937 | Bacteria | 684 |
| 203 | Ga0081538_10115786 | 3300005981 | Bacteria | 1302 |
| 204 | Ga0070717_10017129 | 3300006028 | Bacteria | 5630 |
| 205 | Ga0070717_11559210 | 3300006028 | Unclassified | 599 |
| 206 | Ga0075365_10077303 | 3300006038 | Bacteria | 2249 |
| 207 | Ga0075365_10091811 | 3300006038 | Bacteria | 2069 |
| 208 | Ga0075365_10374454 | 3300006038 | Bacteria | 1004 |
| 209 | Ga0075365_10469943 | 3300006038 | Bacteria | 888 |
| 210 | Ga0075365_10563383 | 3300006038 | Bacteria | 806 |
| 211 | Ga0075368_10168323 | 3300006042 | Bacteria | 920 |
| 212 | Ga0075363_100132018 | 3300006048 | Bacteria | 1401 |
| 213 | Ga0075363_100189867 | 3300006048 | Bacteria | 1172 |
| 214 | Ga0075363_100789954 | 3300006048 | Bacteria | 577 |
| 215 | Ga0075363_100822275 | 3300006048 | Bacteria | 566 |
| 216 | Ga0075364_10335443 | 3300006051 | Bacteria | 1030 |
| 217 | Ga0075364_10482137 | 3300006051 | Bacteria | 848 |
| 218 | Ga0070715_10581806 | 3300006163 | Unclassified | 653 |
| 219 | Ga0070716_100198022 | 3300006173 | Bacteria | 1333 |
| 220 | Ga0070716_100559606 | 3300006173 | Bacteria | 854 |
| 221 | Ga0070712_100128934 | 3300006175 | Bacteria | 1915 |
| 222 | Ga0075362_10036702 | 3300006177 | Bacteria | 2145 |
| 223 | Ga0075362_10036902 | 3300006177 | Bacteria | 2140 |
| 224 | Ga0075367_10027825 | 3300006178 | Bacteria | 3220 |
| 225 | Ga0075367_10081052 | 3300006178 | Bacteria | 1964 |
| 226 | Ga0075367_10294902 | 3300006178 | Bacteria | 1020 |
| 227 | Ga0075367_10575263 | 3300006178 | Bacteria | 716 |
| 228 | Ga0075367_10849788 | 3300006178 | Bacteria | 582 |
| 229 | Ga0075369_10209065 | 3300006186 | Bacteria | 902 |
| 230 | Ga0075369_10216384 | 3300006186 | Bacteria | 886 |
| 231 | Ga0075366_10557513 | 3300006195 | Bacteria | 710 |
| 232 | Ga0097621_100323789 | 3300006237 | Bacteria | 1366 |
| 233 | Ga0097621_100646784 | 3300006237 | Bacteria | 970 |
| 234 | Ga0097621_101144361 | 3300006237 | Bacteria | 732 |
| 235 | Ga0075370_10381044 | 3300006353 | Bacteria | 845 |
| 236 | Ga0075370_10466376 | 3300006353 | Bacteria | 760 |
| 237 | Ga0068871_100039747 | 3300006358 | Bacteria | 3766 |
| 238 | Ga0068871_100662407 | 3300006358 | Bacteria | 954 |
| 239 | Ga0068871_100855338 | 3300006358 | Bacteria | 841 |
| 240 | Ga0068871_101642205 | 3300006358 | Bacteria | 609 |
| 241 | Ga0075428_100003563 | 3300006844 | Bacteria | 17047 |
| 242 | Ga0075428_100030049 | 3300006844 | Bacteria | 6010 |
| 243 | Ga0075428_100057015 | 3300006844 | Bacteria | 4277 |
| 244 | Ga0075428_100082305 | 3300006844 | Bacteria | 3512 |
| 245 | Ga0075430_100010470 | 3300006846 | Bacteria | 7853 |
| 246 | Ga0075430_100042080 | 3300006846 | Bacteria | 3864 |
| 247 | Ga0075430_100138634 | 3300006846 | Bacteria | 2026 |
| 248 | Ga0075431_100007733 | 3300006847 | Bacteria | 10708 |
| 249 | Ga0075431_100162361 | 3300006847 | Bacteria | 2297 |
| 250 | Ga0075431_100169172 | 3300006847 | Bacteria | 2246 |
| 251 | Ga0075431_100575651 | 3300006847 | Bacteria | 1112 |
| 252 | Ga0075433_10291462 | 3300006852 | Bacteria | 1445 |
| 253 | Ga0075433_10335340 | 3300006852 | Bacteria | 1337 |
| 254 | Ga0075429_100002556 | 3300006880 | Bacteria | 15332 |
| 255 | Ga0075429_100003351 | 3300006880 | Bacteria | 13655 |
| 256 | Ga0075429_100005811 | 3300006880 | Bacteria | 10643 |
| 257 | Ga0075429_100061828 | 3300006880 | Bacteria | 3263 |
| 258 | Ga0075429_100596375 | 3300006880 | Bacteria | 968 |
| 259 | Ga0068865_100003091 | 3300006881 | Bacteria | 9960 |
| 260 | Ga0068865_100085945 | 3300006881 | Bacteria | 2270 |
| 261 | Ga0068865_100893305 | 3300006881 | Bacteria | 772 |
| 262 | Ga0075436_100046567 | 3300006914 | Bacteria | 2991 |
| 263 | Ga0097620_100173249 | 3300006931 | Bacteria | 2240 |
| 264 | Ga0097620_100295374 | 3300006931 | Bacteria | 1713 |
| 265 | Ga0097620_100368087 | 3300006931 | Bacteria | 1533 |
| 266 | Ga0097620_100401321 | 3300006931 | Bacteria | 1467 |
| 267 | Ga0097620_100995713 | 3300006931 | Bacteria | 920 |
| 268 | Ga0097620_101393835 | 3300006931 | Bacteria | 773 |
| 269 | Ga0075435_100239069 | 3300007076 | Bacteria | 1544 |
| 270 | Ga0075435_100285628 | 3300007076 | Bacteria | 1409 |
| 271 | Ga0099794_10148152 | 3300007265 | Bacteria | 1191 |
| 272 | Ga0105240_10066942 | 3300009093 | Bacteria | 4454 |
| 273 | Ga0105240_10129094 | 3300009093 | Bacteria | 3034 |
| 274 | Ga0105240_10171492 | 3300009093 | Bacteria | 2569 |
| 275 | Ga0105240_10319425 | 3300009093 | Bacteria | 1770 |
| 276 | Ga0105240_11223714 | 3300009093 | Bacteria | 794 |
| 277 | Ga0105240_11461706 | 3300009093 | Bacteria | 717 |
| 278 | Ga0105240_12161646 | 3300009093 | Bacteria | 577 |
| 279 | Ga0111539_10006979 | 3300009094 | Bacteria | 14494 |
| 280 | Ga0111539_10086104 | 3300009094 | Bacteria | 3693 |
| 281 | Ga0111539_10096982 | 3300009094 | Bacteria | 3463 |
| 282 | Ga0111539_10167080 | 3300009094 | Bacteria | 2571 |
| 283 | Ga0111539_10268477 | 3300009094 | Bacteria | 1986 |
| 284 | Ga0105245_10200038 | 3300009098 | Bacteria | 1918 |
| 285 | Ga0105245_10362686 | 3300009098 | Bacteria | 1438 |
| 286 | Ga0105245_10510353 | 3300009098 | Bacteria | 1219 |
| 287 | Ga0105245_12630657 | 3300009098 | Bacteria | 556 |
| 288 | Ga0105247_10032863 | 3300009101 | Bacteria | 3153 |
| 289 | Ga0105247_10437767 | 3300009101 | Bacteria | 940 |
| 290 | Ga0114129_10000190 | 3300009147 | Bacteria | 69084 |
| 291 | Ga0114129_10043388 | 3300009147 | Bacteria | 6327 |
| 292 | Ga0114129_10044795 | 3300009147 | Bacteria | 6223 |
| 293 | Ga0105243_10017116 | 3300009148 | Bacteria | 5482 |
| 294 | Ga0105243_10046246 | 3300009148 | Bacteria | 3423 |
| 295 | Ga0105243_11566660 | 3300009148 | Bacteria | 684 |
| 296 | Ga0105243_12409622 | 3300009148 | Bacteria | 565 |
| 297 | Ga0105243_12646343 | 3300009148 | Bacteria | 542 |
| 298 | Ga0105241_10011183 | 3300009174 | Bacteria | 6583 |
| 299 | Ga0105241_10337158 | 3300009174 | Bacteria | 1305 |
| 300 | Ga0105241_10565549 | 3300009174 | Bacteria | 1023 |
| 301 | Ga0105241_10896366 | 3300009174 | Bacteria | 823 |
| 302 | Ga0105241_11227678 | 3300009174 | Bacteria | 711 |
| 303 | Ga0105241_11236630 | 3300009174 | Bacteria | 709 |
| 304 | Ga0105241_11374575 | 3300009174 | Bacteria | 675 |
| 305 | Ga0105241_11589162 | 3300009174 | Bacteria | 632 |
| 306 | Ga0105241_11966339 | 3300009174 | Bacteria | 575 |
| 307 | Ga0105241_12386144 | 3300009174 | Bacteria | 528 |
| 308 | Ga0105242_10039640 | 3300009176 | Bacteria | 3792 |
| 309 | Ga0105242_10069305 | 3300009176 | Bacteria | 2921 |
| 310 | Ga0105242_10257036 | 3300009176 | Bacteria | 1576 |
| 311 | Ga0105242_11151006 | 3300009176 | Bacteria | 792 |
| 312 | Ga0105248_10001641 | 3300009177 | Bacteria | 24873 |
| 313 | Ga0105248_10284928 | 3300009177 | Bacteria | 1860 |
| 314 | Ga0105248_11568671 | 3300009177 | Bacteria | 746 |
| 315 | Ga0105237_10022435 | 3300009545 | Bacteria | 6476 |
| 316 | Ga0105237_10222058 | 3300009545 | Bacteria | 1889 |
| 317 | Ga0105237_10349554 | 3300009545 | Bacteria | 1483 |
| 318 | Ga0105237_10380643 | 3300009545 | Bacteria | 1416 |
| 319 | Ga0105237_10496501 | 3300009545 | Bacteria | 1227 |
| 320 | Ga0105237_10892310 | 3300009545 | Bacteria | 896 |
| 321 | Ga0105237_12649822 | 3300009545 | Bacteria | 512 |
| 322 | Ga0105238_10110557 | 3300009551 | Bacteria | 2729 |
| 323 | Ga0105238_10137943 | 3300009551 | Bacteria | 2417 |
| 324 | Ga0105238_10182868 | 3300009551 | Bacteria | 2073 |
| 325 | Ga0105238_10404518 | 3300009551 | Bacteria | 1358 |
| 326 | Ga0105238_11620165 | 3300009551 | Bacteria | 677 |
| 327 | Ga0105238_11681949 | 3300009551 | Bacteria | 665 |
| 328 | Ga0105249_10006407 | 3300009553 | Bacteria | 10235 |
| 329 | Ga0105249_10008962 | 3300009553 | Bacteria | 8740 |
| 330 | Ga0105249_10043781 | 3300009553 | Bacteria | 4072 |
| 331 | Ga0105249_10044664 | 3300009553 | Bacteria | 4029 |
| 332 | Ga0099796_10293484 | 3300010159 | Bacteria | 687 |
| 333 | Ga0105239_10004648 | 3300010375 | Bacteria | 16320 |
| 334 | Ga0105239_10349631 | 3300010375 | Bacteria | 1669 |
| 335 | Ga0105239_10492626 | 3300010375 | Bacteria | 1393 |
| 336 | Ga0105239_10568606 | 3300010375 | Bacteria | 1292 |
| 337 | Ga0105239_10651175 | 3300010375 | Bacteria | 1203 |
| 338 | Ga0105239_10931150 | 3300010375 | Bacteria | 998 |
| 339 | Ga0105239_11085294 | 3300010375 | Bacteria | 921 |
| 340 | Ga0105239_11397329 | 3300010375 | Bacteria | 808 |
| 341 | Ga0105246_10070976 | 3300011119 | Bacteria | 2451 |
| 342 | Ga0105246_10144409 | 3300011119 | Bacteria | 1794 |
| 343 | Ga0105246_10547618 | 3300011119 | Bacteria | 991 |
| 344 | Ga0105246_10553993 | 3300011119 | Bacteria | 986 |
| 345 | Ga0105246_12116713 | 3300011119 | Bacteria | 546 |
| 346 | Ga0157369_11075906 | 3300013105 | Bacteria | 822 |
| 347 | Ga0157374_10016443 | 3300013296 | Bacteria | 6504 |
| 348 | Ga0157374_10052960 | 3300013296 | Bacteria | 3782 |
| 349 | Ga0157374_10342113 | 3300013296 | Bacteria | 1485 |
| 350 | Ga0157374_10867361 | 3300013296 | Bacteria | 920 |
| 351 | Ga0157378_10002071 | 3300013297 | Bacteria | 17952 |
| 352 | Ga0157378_11834741 | 3300013297 | Bacteria | 655 |
| 353 | Ga0163162_10050059 | 3300013306 | Bacteria | 4189 |
| 354 | Ga0163162_10056528 | 3300013306 | Bacteria | 3952 |
| 355 | Ga0163162_10100678 | 3300013306 | Bacteria | 2981 |
| 356 | Ga0163162_10179297 | 3300013306 | Bacteria | 2244 |
| 357 | Ga0163162_10561966 | 3300013306 | Bacteria | 1268 |
| 358 | Ga0163162_12222513 | 3300013306 | Bacteria | 630 |
| 359 | Ga0163162_12989558 | 3300013306 | Bacteria | 543 |
| 360 | Ga0157372_11703019 | 3300013307 | Bacteria | 725 |
| 361 | Ga0157375_10025378 | 3300013308 | Bacteria | 5506 |
| 362 | Ga0157375_10185639 | 3300013308 | Bacteria | 2232 |
| 363 | Ga0157375_11108616 | 3300013308 | Bacteria | 927 |
| 364 | Ga0163163_10036850 | 3300014325 | Bacteria | 4753 |
| 365 | Ga0163163_10091453 | 3300014325 | Bacteria | 3057 |
| 366 | Ga0163163_10101945 | 3300014325 | Bacteria | 2893 |
| 367 | Ga0163163_10403616 | 3300014325 | Bacteria | 1425 |
| 368 | Ga0163163_11190762 | 3300014325 | Bacteria | 824 |
| 369 | Ga0163163_12557002 | 3300014325 | Bacteria | 568 |
| 370 | Ga0163163_12689405 | 3300014325 | Bacteria | 555 |
| 371 | Ga0157380_10091197 | 3300014326 | Bacteria | 2515 |
| 372 | Ga0157380_10314326 | 3300014326 | Bacteria | 1449 |
| 373 | Ga0157380_11481259 | 3300014326 | Bacteria | 731 |
| 374 | Ga0157380_11608155 | 3300014326 | Bacteria | 705 |
| 375 | Ga0157380_12466707 | 3300014326 | Bacteria | 586 |
| 376 | Ga0157377_10114695 | 3300014745 | Bacteria | 1624 |
| 377 | Ga0157377_11483003 | 3300014745 | Bacteria | 538 |
| 378 | Ga0157379_10854697 | 3300014968 | Bacteria | 861 |
| 379 | Ga0157376_10024119 | 3300014969 | Bacteria | 4771 |
| 380 | Ga0157376_10207021 | 3300014969 | Bacteria | 1809 |
| 381 | Ga0157376_10764025 | 3300014969 | Bacteria | 977 |
| 382 | Ga0157376_10843013 | 3300014969 | Bacteria | 932 |
| 383 | Ga0157376_11952922 | 3300014969 | Bacteria | 624 |
| 384 | Ga0163161_10520032 | 3300017792 | Bacteria | 972 |
| 385 | Ga0163161_10863978 | 3300017792 | Bacteria | 764 |
| 386 | Ga0213872_10003293 | 3300021361 | Bacteria | 9011 |
| 387 | Ga0213874_10194768 | 3300021377 | Unclassified | 726 |
| 388 | Ga0207425_1053565 | 3300025245 | Bacteria | 730 |
| 389 | Ga0209129_1030275 | 3300025258 | Bacteria | 907 |
| 390 | Ga0209758_1001140 | 3300025297 | Bacteria | 34073 |
| 391 | Ga0207656_10073397 | 3300025321 | Bacteria | 1525 |
| 392 | Ga0207682_10057209 | 3300025893 | Bacteria | 1625 |
| 393 | Ga0207692_10352849 | 3300025898 | Bacteria | 907 |
| 394 | Ga0207642_10022482 | 3300025899 | Bacteria | 2502 |
| 395 | Ga0207642_10033949 | 3300025899 | Bacteria | 2164 |
| 396 | Ga0207642_10040147 | 3300025899 | Bacteria | 2040 |
| 397 | Ga0207710_10027246 | 3300025900 | Bacteria | 2473 |
| 398 | Ga0207710_10135298 | 3300025900 | Bacteria | 1186 |
| 399 | Ga0207710_10637799 | 3300025900 | Bacteria | 557 |
| 400 | Ga0207688_10317166 | 3300025901 | Bacteria | 956 |
| 401 | Ga0207688_10331588 | 3300025901 | Bacteria | 935 |
| 402 | Ga0207688_10398430 | 3300025901 | Bacteria | 853 |
| 403 | Ga0207688_10992972 | 3300025901 | Bacteria | 531 |
| 404 | Ga0207680_10197579 | 3300025903 | Bacteria | 1369 |
| 405 | Ga0207647_10353229 | 3300025904 | Bacteria | 832 |
| 406 | Ga0207699_11416195 | 3300025906 | Unclassified | 514 |
| 407 | Ga0207645_10005536 | 3300025907 | Bacteria | 9141 |
| 408 | Ga0207645_10097880 | 3300025907 | Bacteria | 1891 |
| 409 | Ga0207645_10129302 | 3300025907 | Bacteria | 1643 |
| 410 | Ga0207643_10004975 | 3300025908 | Bacteria | 7111 |
| 411 | Ga0207643_10043790 | 3300025908 | Bacteria | 2526 |
| 412 | Ga0207705_10079520 | 3300025909 | Bacteria | 2388 |
| 413 | Ga0207707_10014510 | 3300025912 | Bacteria | 6860 |
| 414 | Ga0207695_10390788 | 3300025913 | Bacteria | 1276 |
| 415 | Ga0207695_10484489 | 3300025913 | Bacteria | 1119 |
| 416 | Ga0207671_10037840 | 3300025914 | Bacteria | 3577 |
| 417 | Ga0207671_10092271 | 3300025914 | Bacteria | 2283 |
| 418 | Ga0207671_10298619 | 3300025914 | Bacteria | 1272 |
| 419 | Ga0207671_10334291 | 3300025914 | Bacteria | 1200 |
| 420 | Ga0207671_10507995 | 3300025914 | Bacteria | 961 |
| 421 | Ga0207671_10536744 | 3300025914 | Bacteria | 932 |
| 422 | Ga0207671_11541164 | 3300025914 | Bacteria | 512 |
| 423 | Ga0207693_10106838 | 3300025915 | Bacteria | 2196 |
| 424 | Ga0207663_10911491 | 3300025916 | Unclassified | 703 |
| 425 | Ga0207660_10021907 | 3300025917 | Bacteria | 4302 |
| 426 | Ga0207660_11020511 | 3300025917 | Bacteria | 675 |
| 427 | Ga0207662_10006753 | 3300025918 | Bacteria | 6206 |
| 428 | Ga0207662_10027055 | 3300025918 | Bacteria | 3311 |
| 429 | Ga0207657_10611922 | 3300025919 | Bacteria | 850 |
| 430 | Ga0207649_10379711 | 3300025920 | Bacteria | 1053 |
| 431 | Ga0207649_10479764 | 3300025920 | Bacteria | 943 |
| 432 | Ga0207652_10122145 | 3300025921 | Bacteria | 2318 |
| 433 | Ga0207652_10657776 | 3300025921 | Bacteria | 937 |
| 434 | Ga0207652_11845057 | 3300025921 | Bacteria | 510 |
| 435 | Ga0207646_10751061 | 3300025922 | Bacteria | 870 |
| 436 | Ga0207681_10027647 | 3300025923 | Bacteria | 3669 |
| 437 | Ga0207681_10046892 | 3300025923 | Bacteria | 2908 |
| 438 | Ga0207681_10072030 | 3300025923 | Bacteria | 2412 |
| 439 | Ga0207681_10778058 | 3300025923 | Bacteria | 799 |
| 440 | Ga0207694_10187604 | 3300025924 | Bacteria | 1679 |
| 441 | Ga0207694_10201244 | 3300025924 | Bacteria | 1620 |
| 442 | Ga0207694_10258752 | 3300025924 | Bacteria | 1425 |
| 443 | Ga0207694_10804681 | 3300025924 | Bacteria | 794 |
| 444 | Ga0207694_11030138 | 3300025924 | Bacteria | 697 |
| 445 | Ga0207650_10012000 | 3300025925 | Bacteria | 5973 |
| 446 | Ga0207650_10032210 | 3300025925 | Bacteria | 3792 |
| 447 | Ga0207650_10073807 | 3300025925 | Bacteria | 2570 |
| 448 | Ga0207650_10078116 | 3300025925 | Bacteria | 2503 |
| 449 | Ga0207650_10330608 | 3300025925 | Bacteria | 1250 |
| 450 | Ga0207650_10588159 | 3300025925 | Bacteria | 935 |
| 451 | Ga0207650_10698509 | 3300025925 | Bacteria | 857 |
| 452 | Ga0207650_11358069 | 3300025925 | Bacteria | 605 |
| 453 | Ga0207659_10419440 | 3300025926 | Bacteria | 1122 |
| 454 | Ga0207687_10337985 | 3300025927 | Bacteria | 1223 |
| 455 | Ga0207687_10922442 | 3300025927 | Bacteria | 748 |
| 456 | Ga0207687_11056798 | 3300025927 | Bacteria | 697 |
| 457 | Ga0207700_10047179 | 3300025928 | Bacteria | 3191 |
| 458 | Ga0207664_10024200 | 3300025929 | Bacteria | 4562 |
| 459 | Ga0207644_10017849 | 3300025931 | Bacteria | 4799 |
| 460 | Ga0207690_10985449 | 3300025932 | Bacteria | 701 |
| 461 | Ga0207706_10001958 | 3300025933 | Bacteria | 20196 |
| 462 | Ga0207706_10019028 | 3300025933 | Bacteria | 6178 |
| 463 | Ga0207706_10305936 | 3300025933 | Bacteria | 1384 |
| 464 | Ga0207686_10192762 | 3300025934 | Bacteria | 1454 |
| 465 | Ga0207686_10961472 | 3300025934 | Bacteria | 692 |
| 466 | Ga0207709_10058920 | 3300025935 | Bacteria | 2388 |
| 467 | Ga0207670_10890042 | 3300025936 | Bacteria | 745 |
| 468 | Ga0207669_10106591 | 3300025937 | Bacteria | 1867 |
| 469 | Ga0207669_10710684 | 3300025937 | Bacteria | 827 |
| 470 | Ga0207669_10983605 | 3300025937 | Bacteria | 708 |
| 471 | Ga0207704_10007178 | 3300025938 | Bacteria | 5245 |
| 472 | Ga0207704_10204329 | 3300025938 | Bacteria | 1448 |
| 473 | Ga0207665_10005554 | 3300025939 | Bacteria | 8410 |
| 474 | Ga0207665_10336428 | 3300025939 | Bacteria | 1136 |
| 475 | Ga0207691_10076321 | 3300025940 | Bacteria | 3020 |
| 476 | Ga0207691_10083409 | 3300025940 | Bacteria | 2869 |
| 477 | Ga0207691_10611832 | 3300025940 | Bacteria | 922 |
| 478 | Ga0207691_10894955 | 3300025940 | Bacteria | 743 |
| 479 | Ga0207711_10053812 | 3300025941 | Bacteria | 3452 |
| 480 | Ga0207711_10471911 | 3300025941 | Bacteria | 1169 |
| 481 | Ga0207711_10679359 | 3300025941 | Bacteria | 960 |
| 482 | Ga0207689_10004545 | 3300025942 | Bacteria | 12559 |
| 483 | Ga0207689_10033646 | 3300025942 | Bacteria | 4258 |
| 484 | Ga0207689_10085901 | 3300025942 | Unclassified | 2586 |
| 485 | Ga0207689_10429384 | 3300025942 | Bacteria | 1103 |
| 486 | Ga0207689_10489486 | 3300025942 | Bacteria | 1030 |
| 487 | Ga0207689_10906656 | 3300025942 | Bacteria | 744 |
| 488 | Ga0207689_11313035 | 3300025942 | Bacteria | 608 |
| 489 | Ga0207661_10967268 | 3300025944 | Bacteria | 784 |
| 490 | Ga0207679_10014101 | 3300025945 | Bacteria | 5245 |
| 491 | Ga0207679_10027742 | 3300025945 | Bacteria | 3920 |
| 492 | Ga0207679_10406656 | 3300025945 | Bacteria | 1198 |
| 493 | Ga0207679_10959356 | 3300025945 | Bacteria | 783 |
| 494 | Ga0207667_10268859 | 3300025949 | Bacteria | 1743 |
| 495 | Ga0207651_10149145 | 3300025960 | Bacteria | 1818 |
| 496 | Ga0207712_10012759 | 3300025961 | Bacteria | 5371 |
| 497 | Ga0207712_10324269 | 3300025961 | Bacteria | 1272 |
| 498 | Ga0207712_10437150 | 3300025961 | Bacteria | 1107 |
| 499 | Ga0207668_10195352 | 3300025972 | Bacteria | 1607 |
| 500 | Ga0207668_10746790 | 3300025972 | Bacteria | 863 |
| 501 | Ga0207668_10823305 | 3300025972 | Bacteria | 823 |
| 502 | Ga0207668_11376149 | 3300025972 | Bacteria | 636 |
| 503 | Ga0207640_10034004 | 3300025981 | Bacteria | 3177 |
| 504 | Ga0207640_11374650 | 3300025981 | Bacteria | 632 |
| 505 | Ga0207640_11987127 | 3300025981 | Bacteria | 527 |
| 506 | Ga0207658_10131514 | 3300025986 | Bacteria | 2011 |
| 507 | Ga0207658_10336016 | 3300025986 | Bacteria | 1312 |
| 508 | Ga0207677_10115026 | 3300026023 | Bacteria | 2012 |
| 509 | Ga0207677_10145675 | 3300026023 | Bacteria | 1820 |
| 510 | Ga0207677_10222458 | 3300026023 | Bacteria | 1515 |
| 511 | Ga0207677_10266038 | 3300026023 | Bacteria | 1400 |
| 512 | Ga0207677_10316149 | 3300026023 | Bacteria | 1296 |
| 513 | Ga0207677_10941541 | 3300026023 | Bacteria | 781 |
| 514 | Ga0207677_12042850 | 3300026023 | Bacteria | 533 |
| 515 | Ga0207703_10007019 | 3300026035 | Bacteria | 8960 |
| 516 | Ga0207703_10030057 | 3300026035 | Bacteria | 4291 |
| 517 | Ga0207703_10082021 | 3300026035 | Bacteria | 2690 |
| 518 | Ga0207703_11127699 | 3300026035 | Bacteria | 754 |
| 519 | Ga0207639_10149650 | 3300026041 | Bacteria | 1954 |
| 520 | Ga0207639_10179667 | 3300026041 | Bacteria | 1799 |
| 521 | Ga0207639_10705694 | 3300026041 | Bacteria | 936 |
| 522 | Ga0207639_10778829 | 3300026041 | Bacteria | 891 |
| 523 | Ga0207678_10096695 | 3300026067 | Bacteria | 2524 |
| 524 | Ga0207678_11159704 | 3300026067 | Bacteria | 684 |
| 525 | Ga0207678_11867935 | 3300026067 | Bacteria | 525 |
| 526 | Ga0207708_10207224 | 3300026075 | Bacteria | 1566 |
| 527 | Ga0207708_10415548 | 3300026075 | Bacteria | 1115 |
| 528 | Ga0207702_10103204 | 3300026078 | Bacteria | 2521 |
| 529 | Ga0207641_10164548 | 3300026088 | Bacteria | 2019 |
| 530 | Ga0207641_10249101 | 3300026088 | Bacteria | 1658 |
| 531 | Ga0207641_10644546 | 3300026088 | Bacteria | 1040 |
| 532 | Ga0207641_11148261 | 3300026088 | Bacteria | 776 |
| 533 | Ga0207641_11341846 | 3300026088 | Bacteria | 716 |
| 534 | Ga0207641_12037479 | 3300026088 | Bacteria | 575 |
| 535 | Ga0207648_10000432 | 3300026089 | Bacteria | 46265 |
| 536 | Ga0207648_10023486 | 3300026089 | Bacteria | 5523 |
| 537 | Ga0207648_10369553 | 3300026089 | Bacteria | 1295 |
| 538 | Ga0207648_10573319 | 3300026089 | Bacteria | 1038 |
| 539 | Ga0207648_12020357 | 3300026089 | Bacteria | 538 |
| 540 | Ga0207676_10046399 | 3300026095 | Bacteria | 3362 |
| 541 | Ga0207676_10115994 | 3300026095 | Bacteria | 2249 |
| 542 | Ga0207676_10250913 | 3300026095 | Bacteria | 1593 |
| 543 | Ga0207676_10283029 | 3300026095 | Bacteria | 1506 |
| 544 | Ga0207676_10413278 | 3300026095 | Bacteria | 1264 |
| 545 | Ga0207676_11876739 | 3300026095 | Bacteria | 598 |
| 546 | Ga0207674_10047879 | 3300026116 | Bacteria | 4380 |
| 547 | Ga0207674_10058004 | 3300026116 | Bacteria | 3924 |
| 548 | Ga0207674_10132716 | 3300026116 | Bacteria | 2453 |
| 549 | Ga0207674_10294773 | 3300026116 | Bacteria | 1571 |
| 550 | Ga0207674_10330443 | 3300026116 | Bacteria | 1474 |
| 551 | Ga0207674_10745138 | 3300026116 | Bacteria | 945 |
| 552 | Ga0207674_11131998 | 3300026116 | Bacteria | 752 |
| 553 | Ga0207675_100001061 | 3300026118 | Bacteria | 27272 |
| 554 | Ga0207675_100005869 | 3300026118 | Bacteria | 11724 |
| 555 | Ga0207675_100012122 | 3300026118 | Bacteria | 8054 |
| 556 | Ga0207675_100118514 | 3300026118 | Bacteria | 2503 |
| 557 | Ga0207675_100317199 | 3300026118 | Bacteria | 1521 |
| 558 | Ga0207675_100577216 | 3300026118 | Bacteria | 1126 |
| 559 | Ga0207675_101290544 | 3300026118 | Bacteria | 750 |
| 560 | Ga0207683_10032553 | 3300026121 | Bacteria | 4529 |
| 561 | Ga0207683_10049686 | 3300026121 | Bacteria | 3673 |
| 562 | Ga0207683_10091800 | 3300026121 | Bacteria | 2705 |
| 563 | Ga0207683_10254244 | 3300026121 | Bacteria | 1604 |
| 564 | Ga0207683_10330256 | 3300026121 | Bacteria | 1398 |
| 565 | Ga0207683_10791864 | 3300026121 | Bacteria | 880 |
| 566 | Ga0207683_11970816 | 3300026121 | Bacteria | 532 |
| 567 | Ga0207698_10092126 | 3300026142 | Bacteria | 2483 |
| 568 | Ga0207698_10623127 | 3300026142 | Bacteria | 1066 |
| 569 | Ga0207698_10807692 | 3300026142 | Bacteria | 940 |
| 570 | Ga0207698_12703072 | 3300026142 | Bacteria | 505 |
| 571 | Ga0209981_1081966 | 3300027378 | Bacteria | 503 |
| 572 | Ga0209179_1032041 | 3300027512 | Bacteria | 1082 |
| 573 | Ga0209588_1003812 | 3300027671 | Bacteria | 4206 |
| 574 | Ga0209588_1123605 | 3300027671 | Bacteria | 827 |
| 575 | Ga0209813_10137154 | 3300027866 | Bacteria | 865 |
| 576 | Ga0207428_10000488 | 3300027907 | Bacteria | 47436 |
| 577 | Ga0207428_10006456 | 3300027907 | Bacteria | 10830 |
| 578 | Ga0207428_10086949 | 3300027907 | Bacteria | 2432 |
| 579 | Ga0207428_10252419 | 3300027907 | Bacteria | 1315 |
| 580 | Ga0207428_10364837 | 3300027907 | Bacteria | 1061 |
| 581 | Ga0268266_10006491 | 3300028379 | Bacteria | 10706 |
| 582 | Ga0268266_10015202 | 3300028379 | Bacteria | 6609 |
| 583 | Ga0268266_10053579 | 3300028379 | Bacteria | 3466 |
| 584 | Ga0268266_10139264 | 3300028379 | Bacteria | 2177 |
| 585 | Ga0268266_10270874 | 3300028379 | Bacteria | 1576 |
| 586 | Ga0268266_10391515 | 3300028379 | Bacteria | 1312 |
| 587 | Ga0268266_10919199 | 3300028379 | Bacteria | 846 |
| 588 | Ga0268266_11594596 | 3300028379 | Bacteria | 628 |
| 589 | Ga0268266_11724832 | 3300028379 | Bacteria | 601 |
| 590 | Ga0268266_11819507 | 3300028379 | Bacteria | 583 |
| 591 | Ga0268265_10003020 | 3300028380 | Bacteria | 12279 |
| 592 | Ga0268265_10030478 | 3300028380 | Bacteria | 3885 |
| 593 | Ga0268265_10111601 | 3300028380 | Bacteria | 2233 |
| 594 | Ga0268265_10118729 | 3300028380 | Bacteria | 2175 |
| 595 | Ga0268265_10132270 | 3300028380 | Bacteria | 2075 |
| 596 | Ga0268265_10897386 | 3300028380 | Bacteria | 870 |
| 597 | Ga0268264_10032350 | 3300028381 | Bacteria | 4291 |
| 598 | Ga0268264_10392360 | 3300028381 | Bacteria | 1332 |
| 599 | Ga0268264_10635797 | 3300028381 | Unclassified | 1055 |
| 600 | Ga0268264_11444434 | 3300028381 | Bacteria | 698 |
| 601 | Ga0265334_10036290 | 3300028573 | Bacteria | 1947 |
| 602 | Ga0265334_10103029 | 3300028573 | Bacteria | 1031 |
| 603 | Ga0307517_10064623 | 3300028786 | Bacteria | 3399 |
| 604 | Ga0307515_10058169 | 3300028794 | Bacteria | 5574 |
| 605 | Ga0307515_10685122 | 3300028794 | Bacteria | 640 |
| 606 | Ga0265338_10008007 | 3300028800 | Bacteria | 12937 |
| 607 | Ga0265332_10014006 | 3300031238 | Bacteria | 3549 |
| 608 | Ga0265320_10001360 | 3300031240 | Bacteria | 17822 |
| 609 | Ga0265320_10019444 | 3300031240 | Bacteria | 3714 |
| 610 | Ga0265339_10001746 | 3300031249 | Bacteria | 16003 |
| 611 | Ga0265339_10140729 | 3300031249 | Bacteria | 1227 |
| 612 | Ga0265331_10219177 | 3300031250 | Bacteria | 855 |
| 613 | Ga0307513_10280185 | 3300031456 | Bacteria | 1445 |
| 614 | Ga0307513_10291657 | 3300031456 | Bacteria | 1403 |
| 615 | Ga0307509_10899079 | 3300031507 | Bacteria | 550 |
| 616 | Ga0307408_100382177 | 3300031548 | Bacteria | 1204 |
| 617 | Ga0307408_100514829 | 3300031548 | Bacteria | 1050 |
| 618 | Ga0307408_100819413 | 3300031548 | Bacteria | 846 |
| 619 | Ga0307408_100925122 | 3300031548 | Bacteria | 799 |
| 620 | Ga0307508_10018485 | 3300031616 | Bacteria | 6335 |
| 621 | Ga0307514_10112879 | 3300031649 | Bacteria | 1920 |
| 622 | Ga0265314_10005944 | 3300031711 | Bacteria | 10905 |
| 623 | Ga0307516_10002339 | 3300031730 | Bacteria | 25478 |
| 624 | Ga0307516_10056562 | 3300031730 | Unclassified | 3825 |
| 625 | Ga0307516_10563554 | 3300031730 | Bacteria | 793 |
| 626 | Ga0307516_10894284 | 3300031730 | Bacteria | 554 |
| 627 | Ga0307405_10575747 | 3300031731 | Bacteria | 915 |
| 628 | Ga0307405_10629642 | 3300031731 | Bacteria | 879 |
| 629 | Ga0307413_10136072 | 3300031824 | Bacteria | 1690 |
| 630 | Ga0307406_10276104 | 3300031901 | Bacteria | 1279 |
| 631 | Ga0307406_11305768 | 3300031901 | Bacteria | 633 |
| 632 | Ga0307412_10324612 | 3300031911 | Bacteria | 1226 |
| 633 | Ga0307412_10426790 | 3300031911 | Bacteria | 1086 |
| 634 | Ga0307412_10572230 | 3300031911 | Bacteria | 952 |
| 635 | Ga0307416_100231067 | 3300032002 | Bacteria | 1783 |
| 636 | Ga0307416_100930614 | 3300032002 | Bacteria | 970 |
| 637 | Ga0307416_101314481 | 3300032002 | Bacteria | 829 |
| 638 | Ga0307415_100144839 | 3300032126 | Bacteria | 1820 |
| 639 | Ga0307415_100438602 | 3300032126 | Bacteria | 1126 |
| 640 | Ga0307415_101399229 | 3300032126 | Bacteria | 666 |
| 641 | Ga0307415_102011422 | 3300032126 | Bacteria | 563 |
| 642 | Ga0316585_10250683 | 3300032137 | Bacteria | 587 |
| 643 | Ga0307510_10000003 | 3300033180 | Bacteria | 756654 |
| 644 | Ga0307510_10044313 | 3300033180 | Bacteria | 4820 |
| 645 | Ga0307510_10079078 | 3300033180 | Bacteria | 3210 |
| 646 | Ga0307510_10437551 | 3300033180 | Bacteria | 749 |
| 647 | Ga0373930_0099159 | 3300034816 | Bacteria | 691 |
| 648 | Ga0373948_0095558 | 3300034817 | Bacteria | 694 |
| 649 | Ga0373958_0006070 | 3300034819 | Bacteria | 1866 |
| 650 | Ga0373959_0077933 | 3300034820 | Bacteria | 759 |
| 651 | Ga0373938_0018205 | 3300034957 | Bacteria | 1391 |
| 652 | Ga0373926_0338748 | 3300035083 | Bacteria | 590 |
| 653 | Ga0373928_0032388 | 3300035084 | Bacteria | 1165 |
| 654 | Ga0373929_0018417 | 3300035085 | Bacteria | 1387 |
| 655 | Ga0373934_0494830 | 3300035086 | Bacteria | 514 |
| 656 | Ga0373940_0018758 | 3300035088 | Bacteria | 1739 |
| 657 | Ga0373949_0000363 | 3300035090 | Bacteria | 16040 |
| 658 | Ga0373923_0010330 | 3300035111 | Bacteria | 3394 |
| 659 | Ga0373936_0005826 | 3300035113 | Bacteria | 4640 |
| 660 | Ga0373936_0007502 | 3300035113 | Bacteria | 4102 |
| 661 | Ga0373936_0422933 | 3300035113 | Bacteria | 613 |
| 662 | Ga0373936_0495698 | 3300035113 | Bacteria | 568 |
| 663 | Ga0373939_0002559 | 3300035114 | Bacteria | 4276 |
| 664 | Ga0373941_0003464 | 3300035115 | Bacteria | 3575 |
| 665 | Ga0373945_0390621 | 3300035116 | Bacteria | 608 |
| 666 | Ga0373956_0102116 | 3300035119 | Bacteria | 1331 |
| 667 | Ga0373956_0528165 | 3300035119 | Bacteria | 563 |
| 668 | Ga0373957_0452451 | 3300035120 | Bacteria | 556 |
| 669 | Ga0373943_0062876 | 3300035170 | Bacteria | 1859 |
| 670 | Ga0373946_0022789 | 3300035171 | Bacteria | 2441 |
| 671 | Ga0373955_0059558 | 3300035172 | Bacteria | 2103 |
| 672 | Ga0373962_0031214 | 3300035242 | Bacteria | 1461 |
| 673 | Ga0373931_0233356 | 3300035691 | Bacteria | 1112 |
| 674 | Ga0373931_0266228 | 3300035691 | Bacteria | 1048 |
| 675 | Ga0373935_0009132 | 3300035692 | Bacteria | 5933 |
| 676 | Ga0373927_0021742 | 3300035695 | Bacteria | 4204 |
| 677 | Ga0373933_0110429 | 3300035724 | Bacteria | 1715 |
| 678 | Ga0373947_0012031 | 3300035725 | Bacteria | 4956 |
| 679 | Ga0373947_0747442 | 3300035725 | Bacteria | 667 |
| 680 | Ga0373937_0026247 | 3300036401 | Bacteria | 5264 |
| 681 | Ga0373937_0049344 | 3300036401 | Bacteria | 3855 |
| 682 | Ga0373937_0724448 | 3300036401 | Unclassified | 942 |
| 683 | Ga0316582_0617732 | 3300036647 | Unclassified | 746 |
| 684 | Ga0373925_0002595 | 3300037068 | Bacteria | 14366 |
| 685 | Ga0373925_0122685 | 3300037068 | Bacteria | 2018 |
| 686 | Ga0373925_1748264 | 3300037068 | Bacteria | 507 |
| 687 | Ga0395899_0096381 | 3300037312 | Bacteria | 2139 |
| 688 | Ga0395900_0005356 | 3300037418 | Bacteria | 13446 |
| 689 | Ga0395898_0024771 | 3300037466 | Bacteria | 6050 |
| 690 | Ga0316581_0063173 | 3300037588 | Bacteria | 1137 |
| 691 | Ga0436364_0195188 | 3300037853 | Bacteria | 981 |
| 692 | Ga0436364_0548762 | 3300037853 | Bacteria | 1859 |
| 693 | Ga0395901_0030126 | 3300038443 | Bacteria | 5589 |
| 694 | Ga0436363_0358913 | 3300039450 | Bacteria | 4800 |
| 695 | Ga0436363_0643674 | 3300039450 | Bacteria | 521 |
| 696 | Ga0436363_1313640 | 3300039450 | Bacteria | 1073 |
| 697 | Ga0451789_1264309 | 3300041443 | Bacteria | 740 |
| 698 | Ga0451791_0375005 | 3300041451 | Bacteria | 728 |
| 699 | Ga0451795_0385379 | 3300041456 | Bacteria | 650 |
| 700 | Ga0451800_0948311 | 3300041459 | Bacteria | 1067 |
| 701 | Ga0451807_1959945 | 3300041486 | Bacteria | 1322 |
| 702 | Ga0451837_1392969 | 3300041494 | Bacteria | 577 |
| 703 | Ga0451843_1228507 | 3300041509 | Bacteria | 540 |
| 704 | Ga0439445_0221988 | 3300042004 | Bacteria | 561 |
| 705 | Ga0439450_079960 | 3300042008 | Bacteria | 812 |
| 706 | Ga0439455_0108498 | 3300042012 | Bacteria | 771 |
| 707 | Ga0439463_080894 | 3300042016 | Bacteria | 835 |
| 708 | Ga0450898_138334 | 3300042134 | Bacteria | 528 |
| 709 | Ga0451577_0720641 | 3300042876 | Bacteria | 903 |
| 710 | Ga0451577_1359605 | 3300042876 | Bacteria | 631 |
| 711 | Ga0466972_0198093 | 3300044658 | Bacteria | 941 |
| 712 | Ga0466965_0116046 | 3300044683 | Bacteria | 1379 |
| 713 | Ga0466966_0640214 | 3300044684 | Bacteria | 640 |
| 714 | Ga0453684_0011849 | 3300044712 | Bacteria | 14526 |
| 715 | Ga0466960_0110049 | 3300044901 | Bacteria | 1430 |
| 716 | Ga0451576_0069529 | 3300045051 | Bacteria | 3664 |
| 717 | Ga0451576_0102078 | 3300045051 | Bacteria | 2983 |
| 718 | Ga0451576_0183919 | 3300045051 | Bacteria | 2182 |
| 719 | Ga0451576_0200295 | 3300045051 | Bacteria | 2085 |
| 720 | Ga0451576_0831166 | 3300045051 | Bacteria | 970 |
| 721 | Ga0451576_1106872 | 3300045051 | Bacteria | 829 |
| 722 | Ga0466958_0869728 | 3300045836 | Unclassified | 588 |
| 723 | Ga0495603_0004320 | 3300046455 | Bacteria | 8476 |
| 724 | Ga0495603_0149309 | 3300046455 | Bacteria | 1358 |
| 725 | Ga0495603_0477827 | 3300046455 | Bacteria | 714 |
| 726 | Ga0495629_0008693 | 3300046459 | Bacteria | 7475 |
| 727 | Ga0495651_0257749 | 3300046462 | Bacteria | 1188 |
| 728 | Ga0495653_0392990 | 3300046463 | Bacteria | 883 |
| 729 | Ga0495650_0006812 | 3300046471 | Bacteria | 7045 |
| 730 | Ga0495580_0373740 | 3300046472 | Bacteria | 963 |
| 731 | Ga0495582_0381248 | 3300046473 | Bacteria | 812 |
| 732 | Ga0495639_0005290 | 3300046475 | Bacteria | 5553 |
| 733 | Ga0495662_0002831 | 3300046476 | Bacteria | 8772 |
| 734 | Ga0495664_0124050 | 3300046477 | Bacteria | 1562 |
| 735 | Ga0495664_0863097 | 3300046477 | Bacteria | 530 |
| 736 | Ga0495584_0012037 | 3300046491 | Bacteria | 4423 |
| 737 | Ga0495594_0004642 | 3300046499 | Bacteria | 7076 |
| 738 | Ga0495618_0341962 | 3300046514 | Bacteria | 923 |
| 739 | Ga0495628_0075786 | 3300046516 | Bacteria | 2619 |
| 740 | Ga0495630_0120953 | 3300046517 | Bacteria | 1986 |
| 741 | Ga0495631_0230968 | 3300046518 | Bacteria | 789 |
| 742 | Ga0495643_0151729 | 3300046522 | Bacteria | 1147 |
| 743 | Ga0495648_0157081 | 3300046524 | Bacteria | 1180 |
| 744 | Ga0495663_0001798 | 3300046525 | Bacteria | 6633 |
| 745 | Ga0495666_0026030 | 3300046526 | Bacteria | 2887 |
| 746 | Ga0495652_0110824 | 3300046529 | Bacteria | 2207 |
| 747 | Ga0495652_0877735 | 3300046529 | Bacteria | 593 |
| 748 | Ga0495665_0040106 | 3300046531 | Bacteria | 2493 |
| 749 | Ga0495640_0013286 | 3300046533 | Bacteria | 6261 |
| 750 | Ga0495609_0454163 | 3300046538 | Bacteria | 509 |
| 751 | Ga0495621_0418449 | 3300046539 | Bacteria | 570 |
| 752 | Ga0495597_0012386 | 3300046542 | Bacteria | 4115 |
| 753 | Ga0495622_0027653 | 3300046557 | Bacteria | 2647 |
| 754 | Ga0495622_0264880 | 3300046557 | Bacteria | 754 |
| 755 | Ga0495633_0432210 | 3300046558 | Bacteria | 595 |
| 756 | Ga0495667_0022396 | 3300046559 | Bacteria | 4256 |
| 757 | Ga0495656_0019194 | 3300046615 | Bacteria | 2637 |
| 758 | Ga0495634_0003738 | 3300046642 | Bacteria | 12123 |
| 759 | Ga0495625_0109517 | 3300046660 | Bacteria | 1889 |
| 760 | Ga0495635_0106186 | 3300046663 | Bacteria | 1918 |
| 761 | Ga0495657_0445850 | 3300046675 | Bacteria | 758 |
| 762 | Ga0495599_0401040 | 3300046678 | Bacteria | 817 |
| 763 | Ga0495646_0030611 | 3300046680 | Bacteria | 3360 |
| 764 | Ga0495658_0003784 | 3300046683 | Bacteria | 7489 |
| 765 | Ga0495658_0771612 | 3300046683 | Bacteria | 615 |
| 766 | Ga0495669_0207793 | 3300046684 | Bacteria | 937 |
| 767 | Ga0495613_0007099 | 3300046689 | Bacteria | 8338 |
| 768 | Ga0495624_0010071 | 3300046690 | Bacteria | 6523 |
| 769 | Ga0495671_0636991 | 3300046692 | Bacteria | 507 |
| 770 | Ga0495600_0019190 | 3300046809 | Bacteria | 4364 |
| 771 | Ga0495581_0009065 | 3300047315 | Bacteria | 5755 |
| 772 | Ga0495636_0304774 | 3300047318 | Bacteria | 746 |
| 773 | Ga0495674_0000458 | 3300047319 | Bacteria | 36828 |
| 774 | Ga0495672_0154080 | 3300047320 | Bacteria | 1189 |
| 775 | Ga0495676_0104327 | 3300047321 | Bacteria | 2092 |
| 776 | Ga0495676_0515205 | 3300047321 | Bacteria | 784 |
| 777 | Ga0495680_0265905 | 3300047322 | Bacteria | 1212 |
| 778 | Ga0495687_000454 | 3300047443 | Bacteria | 50500 |
| 779 | Ga0495675_0705539 | 3300047444 | Bacteria | 565 |
| 780 | Ga0495685_231901 | 3300047447 | Bacteria | 588 |
| 781 | Ga0495684_0130956 | 3300047471 | Bacteria | 1884 |
| 782 | Ga0495686_0003031 | 3300047472 | Bacteria | 14902 |
| 783 | Ga0495593_0006332 | 3300047673 | Bacteria | 6945 |
| 784 | Ga0495602_0754154 | 3300048088 | Bacteria | 657 |
| 785 | Ga0495602_0825171 | 3300048088 | Bacteria | 621 |
| 786 | Ga0495626_0436193 | 3300048091 | Bacteria | 504 |
| 787 | Ga0496101_0595709 | 3300048904 | Unclassified | 874 |
| 788 | Ga0496102_0058118 | 3300048905 | Bacteria | 3533 |
| 789 | Ga0496102_0331724 | 3300048905 | Bacteria | 1433 |
| 790 | Ga0496103_0326736 | 3300048906 | Bacteria | 986 |
| 791 | Ga0496104_0029652 | 3300048907 | Bacteria | 5076 |
| 792 | Ga0496104_0761613 | 3300048907 | Bacteria | 875 |
| 793 | Ga0496104_0788326 | 3300048907 | Bacteria | 857 |
| 794 | Ga0496105_0771752 | 3300048908 | Bacteria | 733 |
| 795 | Ga0496106_0651112 | 3300048909 | Bacteria | 842 |
| 796 | Ga0496106_1205256 | 3300048909 | Bacteria | 590 |
| 797 | Ga0496106_1492006 | 3300048909 | Bacteria | 520 |
| 798 | Ga0496107_0149590 | 3300048910 | Bacteria | 1727 |
| 799 | Ga0496108_1339466 | 3300048911 | Bacteria | 601 |
| 800 | Ga0496108_1781354 | 3300048911 | Bacteria | 505 |
| 801 | Ga0496109_0842128 | 3300048912 | Bacteria | 855 |
| 802 | Ga0496110_1039755 | 3300048913 | Bacteria | 727 |
| 803 | Ga0496111_0441284 | 3300048914 | Bacteria | 961 |
| 804 | Ga0496111_1298763 | 3300048914 | Bacteria | 513 |
| 805 | Ga0496112_0104538 | 3300048915 | Bacteria | 2802 |
| 806 | Ga0496112_0387130 | 3300048915 | Bacteria | 1339 |
| 807 | Ga0496113_0246439 | 3300048916 | Bacteria | 1426 |
| 808 | Ga0496114_0197286 | 3300048917 | Bacteria | 1762 |
| 809 | Ga0496114_0278202 | 3300048917 | Bacteria | 1475 |
| 810 | Ga0496115_0022861 | 3300048918 | Bacteria | 4849 |
| 811 | Ga0496116_0048712 | 3300048919 | Bacteria | 2841 |
| 812 | Ga0496117_0000186 | 3300048920 | Bacteria | 127231 |
| 813 | Ga0496118_0000003 | 3300048921 | Bacteria | 773148 |
| 814 | Ga0496119_0000260 | 3300048922 | Bacteria | 74908 |
| 815 | Ga0496119_0004656 | 3300048922 | Bacteria | 13528 |
| 816 | Ga0496120_0000165 | 3300048923 | Bacteria | 111625 |
| 817 | Ga0496121_0031038 | 3300048924 | Bacteria | 4893 |
| 818 | Ga0496125_0048807 | 3300048928 | Bacteria | 3525 |
| 819 | Ga0496125_0181348 | 3300048928 | Bacteria | 1402 |
| 820 | Ga0496126_0067376 | 3300048929 | Bacteria | 3198 |
| 821 | Ga0495682_0306830 | 3300049460 | Bacteria | 560 |
| 822 | Ga0501294_005142 | 3300049517 | Bacteria | 1237 |
| 823 | Ga0501294_033658 | 3300049517 | Bacteria | 609 |
| 824 | Ga0501298_153835 | 3300049521 | Bacteria | 564 |
| 825 | Ga0501298_163521 | 3300049521 | Bacteria | 551 |
| 826 | Ga0501299_184142 | 3300049522 | Bacteria | 547 |
| 827 | Ga0501301_007524 | 3300049524 | Bacteria | 841 |
| 828 | Ga0501039_0791990 | 3300049575 | Bacteria | 740 |
| 829 | Ga0501068_0159133 | 3300049584 | Bacteria | 1423 |
| 830 | Ga0501071_0535482 | 3300049587 | Bacteria | 899 |
| 831 | Ga0501077_0021965 | 3300049593 | Bacteria | 4041 |
| 832 | Ga0501077_0750508 | 3300049593 | Bacteria | 627 |
| 833 | Ga0501222_014548 | 3300049662 | Bacteria | 1038 |
| 834 | Ga0501249_116985 | 3300049679 | Bacteria | 648 |
| 835 | Ga0501253_015394 | 3300049683 | Bacteria | 1256 |
| 836 | Ga0501257_018973 | 3300049686 | Bacteria | 1607 |
| 837 | Ga0501262_017818 | 3300049759 | Bacteria | 950 |
| 838 | Ga0501283_027278 | 3300049779 | Bacteria | 943 |
| 839 | Ga0501035_1560274 | 3300049822 | Bacteria | 502 |
| 840 | nmdc:mga03683_80241_c1 | 3300050489 | Bacteria | 1408 |
| 841 | nmdc:mga03n38_187246_c1 | 3300050490 | Bacteria | 1064 |
| 842 | nmdc:mga00v17_989833_c1 | 3300050491 | Bacteria | 530 |
| 843 | nmdc:mga0yw44_1204446_c1 | 3300050492 | Bacteria | 511 |
| 844 | nmdc:mga0yw44_245071_c1 | 3300050492 | Bacteria | 1192 |
| 845 | nmdc:mga0yw44_619129_c1 | 3300050492 | Bacteria | 736 |
| 846 | nmdc:mga0k408_13787_c1 | 3300050493 | Bacteria | 4440 |
| 847 | nmdc:mga0k408_430042_c1 | 3300050493 | Bacteria | 785 |
| 848 | nmdc:mga0k408_689959_c1 | 3300050493 | Bacteria | 599 |
| 849 | nmdc:mga04h51_145001_c1 | 3300050495 | Bacteria | 903 |
| 850 | nmdc:mga07m45_253237_c1 | 3300050496 | Bacteria | 1024 |
| 851 | nmdc:mga07m45_60390_c1 | 3300050496 | Bacteria | 1958 |
| 852 | nmdc:mga05p37_3871_c1 | 3300050507 | Bacteria | 17506 |
| 853 | nmdc:mga05p37_456_c1 | 3300050507 | Bacteria | 44536 |
| 854 | nmdc:mga09592_250996_c1 | 3300050508 | Bacteria | 1534 |
| 855 | nmdc:mga09592_270908_c1 | 3300050508 | Bacteria | 1473 |
| 856 | nmdc:mga09592_31068_c1 | 3300050508 | Bacteria | 4449 |
| 857 | nmdc:mga09592_6064_c1 | 3300050508 | Bacteria | 9854 |
| 858 | nmdc:mga0qj67_1177_c1 | 3300050509 | Bacteria | 18131 |
| 859 | nmdc:mga0qj67_1546254_c1 | 3300050509 | Bacteria | 510 |
| 860 | nmdc:mga0qj67_15748_c1 | 3300050509 | Bacteria | 5727 |
| 861 | nmdc:mga0qj67_346216_c1 | 3300050509 | Bacteria | 1202 |
| 862 | nmdc:mga06r32_1668_c1 | 3300050510 | Bacteria | 20034 |
| 863 | nmdc:mga06r32_5109_c1 | 3300050510 | Bacteria | 11804 |
| 864 | nmdc:mga06r32_635938_c1 | 3300050510 | Bacteria | 1036 |
| 865 | nmdc:mga06r32_9857_c1 | 3300050510 | Bacteria | 8621 |
| 866 | nmdc:mga08y16_107607_c1 | 3300050511 | Bacteria | 2903 |
| 867 | nmdc:mga08y16_15611_c1 | 3300050511 | Bacteria | 7986 |
| 868 | nmdc:mga08y16_4744_c1 | 3300050511 | Bacteria | 14171 |
| 869 | nmdc:mga08y16_62253_c1 | 3300050511 | Bacteria | 3896 |
| 870 | nmdc:mga08y16_8343_c1 | 3300050511 | Bacteria | 10839 |
| 871 | nmdc:mga08y16_8995_c1 | 3300050511 | Bacteria | 10489 |
| 872 | nmdc:mga0rr50_158068_c1 | 3300050513 | Bacteria | 1837 |
| 873 | nmdc:mga0rr50_422969_c1 | 3300050513 | Bacteria | 1127 |
| 874 | nmdc:mga08x19_42166_c1 | 3300050514 | Bacteria | 2908 |
| 875 | nmdc:mga0a205_305996_c1 | 3300050515 | Bacteria | 1462 |
| 876 | nmdc:mga0sz30_404072_c1 | 3300050516 | Bacteria | 612 |
| 877 | Ga0500610_0264541 | 3300053079 | Bacteria | 783 |
| 878 | Ga0495655_0118333 | 3300053083 | Bacteria | 804 |
| 879 | Ga0495595_0007151 | 3300053084 | Bacteria | 4561 |
| 880 | Ga0495619_0028832 | 3300053085 | Bacteria | 3582 |
| 881 | Ga0495619_0048491 | 3300053085 | Bacteria | 2799 |
| 882 | Ga0495619_0830978 | 3300053085 | Bacteria | 624 |
| 883 | Ga0495619_0935011 | 3300053085 | Bacteria | 582 |
| 884 | Ga0500583_0063396 | 3300053092 | Bacteria | 1751 |
| 885 | Ga0500583_0327299 | 3300053092 | Bacteria | 746 |
| 886 | Ga0500651_0102863 | 3300053093 | Bacteria | 1750 |
| 887 | Ga0500566_0123529 | 3300053094 | Unclassified | 1393 |
| 888 | Ga0500641_0043180 | 3300053096 | Bacteria | 1829 |
| 889 | Ga0500558_210611 | 3300053106 | Bacteria | 669 |
| 890 | Ga0500594_0072550 | 3300053118 | Bacteria | 1015 |
| 891 | Ga0500595_021628 | 3300053119 | Bacteria | 2292 |
| 892 | Ga0500597_118444 | 3300053120 | Bacteria | 1148 |
| 893 | Ga0500614_008882 | 3300053123 | Bacteria | 2137 |
| 894 | Ga0500628_072889 | 3300053129 | Bacteria | 864 |
| 895 | Ga0500588_0006957 | 3300053146 | Bacteria | 2590 |
| 896 | Ga0500588_0270202 | 3300053146 | Bacteria | 641 |
| 897 | Ga0500589_037001 | 3300053147 | Bacteria | 2278 |
| 898 | Ga0500604_0015642 | 3300053151 | Bacteria | 2081 |
| 899 | Ga0500638_112449 | 3300053162 | Bacteria | 1256 |
| 900 | Ga0500638_195041 | 3300053162 | Bacteria | 862 |
| 901 | Ga0500637_0055021 | 3300053178 | Bacteria | 2272 |
| 902 | Ga0500576_248229 | 3300053725 | Bacteria | 556 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047320 | Ga0495672_0154080 | Ga0495672_0154080_747_1046 | 98 |
| 2 | 3300009093 | Ga0105240_12161646 | Ga0105240_121616462 | 99 |
| 3 | 3300005336 | Ga0070680_101560884 | Ga0070680_1015608841 | 102 |
| 4 | 3300005440 | Ga0070705_100232057 | Ga0070705_1002320572 | 102 |
| 5 | 3300005445 | Ga0070708_100210457 | Ga0070708_1002104572 | 102 |
| 6 | 3300005468 | Ga0070707_100648113 | Ga0070707_1006481131 | 102 |
| 7 | 3300005468 | Ga0070707_101905168 | Ga0070707_1019051682 | 102 |
| 8 | 3300005471 | Ga0070698_101734982 | Ga0070698_1017349822 | 102 |
| 9 | 3300005536 | Ga0070697_100917531 | Ga0070697_1009175312 | 102 |
| 10 | 3300005546 | Ga0070696_100075441 | Ga0070696_1000754412 | 102 |
| 11 | 3300005549 | Ga0070704_100403677 | Ga0070704_1004036772 | 102 |
| 12 | 3300025921 | Ga0207652_10657776 | Ga0207652_106577762 | 102 |
| 13 | 3300025922 | Ga0207646_10751061 | Ga0207646_107510612 | 102 |
| 14 | 3300049584 | Ga0501068_0159133 | Ga0501068_0159133_106_414 | 102 |
| 15 | 3300005328 | Ga0070676_11301477 | Ga0070676_113014771 | 103 |
| 16 | 3300005338 | Ga0068868_100327829 | Ga0068868_1003278292 | 103 |
| 17 | 3300005434 | Ga0070709_10014614 | Ga0070709_100146143 | 103 |
| 18 | 3300005435 | Ga0070714_100020507 | Ga0070714_1000205074 | 103 |
| 19 | 3300005436 | Ga0070713_100017912 | Ga0070713_1000179124 | 103 |
| 20 | 3300005436 | Ga0070713_100037196 | Ga0070713_1000371962 | 103 |
| 21 | 3300005437 | Ga0070710_10532322 | Ga0070710_105323222 | 103 |
| 22 | 3300005439 | Ga0070711_100112338 | Ga0070711_1001123382 | 103 |
| 23 | 3300005439 | Ga0070711_100116643 | Ga0070711_1001166432 | 103 |
| 24 | 3300005545 | Ga0070695_101563217 | Ga0070695_1015632171 | 103 |
| 25 | 3300005546 | Ga0070696_100612777 | Ga0070696_1006127771 | 103 |
| 26 | 3300005719 | Ga0068861_102071787 | Ga0068861_1020717871 | 103 |
| 27 | 3300005844 | Ga0068862_102355716 | Ga0068862_1023557162 | 103 |
| 28 | 3300005981 | Ga0081538_10115786 | Ga0081538_101157861 | 103 |
| 29 | 3300006028 | Ga0070717_10017129 | Ga0070717_100171294 | 103 |
| 30 | 3300006028 | Ga0070717_11559210 | Ga0070717_115592102 | 103 |
| 31 | 3300006163 | Ga0070715_10581806 | Ga0070715_105818061 | 103 |
| 32 | 3300006173 | Ga0070716_100198022 | Ga0070716_1001980222 | 103 |
| 33 | 3300006175 | Ga0070712_100128934 | Ga0070712_1001289342 | 103 |
| 34 | 3300006852 | Ga0075433_10291462 | Ga0075433_102914622 | 103 |
| 35 | 3300006914 | Ga0075436_100046567 | Ga0075436_1000465673 | 103 |
| 36 | 3300007076 | Ga0075435_100239069 | Ga0075435_1002390692 | 103 |
| 37 | 3300013307 | Ga0157372_11703019 | Ga0157372_117030192 | 103 |
| 38 | 3300014969 | Ga0157376_10764025 | Ga0157376_107640252 | 103 |
| 39 | 3300021377 | Ga0213874_10194768 | Ga0213874_101947682 | 103 |
| 40 | 3300025898 | Ga0207692_10352849 | Ga0207692_103528491 | 103 |
| 41 | 3300025906 | Ga0207699_11416195 | Ga0207699_114161951 | 103 |
| 42 | 3300025916 | Ga0207663_10911491 | Ga0207663_109114912 | 103 |
| 43 | 3300025928 | Ga0207700_10047179 | Ga0207700_100471792 | 103 |
| 44 | 3300025929 | Ga0207664_10024200 | Ga0207664_100242002 | 103 |
| 45 | 3300025939 | Ga0207665_10005554 | Ga0207665_100055545 | 103 |
| 46 | 3300025942 | Ga0207689_11313035 | Ga0207689_113130352 | 103 |
| 47 | 3300025944 | Ga0207661_10967268 | Ga0207661_109672682 | 103 |
| 48 | 3300026023 | Ga0207677_10316149 | Ga0207677_103161492 | 103 |
| 49 | 3300026118 | Ga0207675_101290544 | Ga0207675_1012905442 | 103 |
| 50 | 3300028786 | Ga0307517_10064623 | Ga0307517_100646234 | 103 |
| 51 | 3300031456 | Ga0307513_10291657 | Ga0307513_102916572 | 103 |
| 52 | 3300031730 | Ga0307516_10056562 | Ga0307516_100565622 | 103 |
| 53 | 3300035090 | Ga0373949_0000363 | Ga0373949_0000363_8336_8647 | 103 |
| 54 | 3300036647 | Ga0316582_0617732 | Ga0316582_0617732_293_604 | 103 |
| 55 | 3300037853 | Ga0436364_0195188 | Ga0436364_0195188_37_348 | 103 |
| 56 | 3300039450 | Ga0436363_0358913 | Ga0436363_0358913_4268_4579 | 103 |
| 57 | 3300045836 | Ga0466958_0869728 | Ga0466958_0869728_183_494 | 103 |
| 58 | 3300048904 | Ga0496101_0595709 | Ga0496101_0595709_411_722 | 103 |
| 59 | 3300048907 | Ga0496104_0761613 | Ga0496104_0761613_41_352 | 103 |
| 60 | 3300049593 | Ga0501077_0021965 | Ga0501077_0021965_1287_1598 | 103 |
| 61 | 3300049593 | Ga0501077_0750508 | Ga0501077_0750508_213_524 | 103 |
| 62 | 3300050513 | nmdc:mga0rr50_158068_c1 | nmdc:mga0rr50_158068_c1_803_1114 | 103 |
| 63 | 3300050513 | nmdc:mga0rr50_422969_c1 | nmdc:mga0rr50_422969_c1_309_620 | 103 |
| 64 | 3300050514 | nmdc:mga08x19_42166_c1 | nmdc:mga08x19_42166_c1_780_1091 | 103 |
| 65 | 3300053094 | Ga0500566_0123529 | Ga0500566_0123529_338_649 | 103 |
| 66 | 3300053123 | Ga0500614_008882 | Ga0500614_008882_518_829 | 103 |
| 67 | 3300053162 | Ga0500638_112449 | Ga0500638_112449_154_465 | 103 |
| 68 | 3300053178 | Ga0500637_0055021 | Ga0500637_0055021_676_987 | 103 |
| 69 | 3300002077 | JGI24744J21845_10078175 | JGI24744J21845_100781751 | 104 |
| 70 | 3300003215 | JGI25153J46596_10004955 | JGI25153J46596_100049556 | 104 |
| 71 | 3300003323 | rootH1_10170689 | rootH1_101706893 | 104 |
| 72 | 3300004798 | Ga0058859_10007278 | Ga0058859_100072782 | 104 |
| 73 | 3300005290 | Ga0065712_10070708 | Ga0065712_100707081 | 104 |
| 74 | 3300005295 | Ga0065707_10087797 | Ga0065707_100877978 | 104 |
| 75 | 3300005295 | Ga0065707_10124122 | Ga0065707_101241224 | 104 |
| 76 | 3300005327 | Ga0070658_11341319 | Ga0070658_113413191 | 104 |
| 77 | 3300005328 | Ga0070676_10006250 | Ga0070676_100062506 | 104 |
| 78 | 3300005328 | Ga0070676_10213058 | Ga0070676_102130581 | 104 |
| 79 | 3300005329 | Ga0070683_100221580 | Ga0070683_1002215801 | 104 |
| 80 | 3300005329 | Ga0070683_101660997 | Ga0070683_1016609971 | 104 |
| 81 | 3300005330 | Ga0070690_100004845 | Ga0070690_1000048452 | 104 |
| 82 | 3300005330 | Ga0070690_100032929 | Ga0070690_1000329293 | 104 |
| 83 | 3300005331 | Ga0070670_100008902 | Ga0070670_1000089026 | 104 |
| 84 | 3300005331 | Ga0070670_100120552 | Ga0070670_1001205522 | 104 |
| 85 | 3300005331 | Ga0070670_100127330 | Ga0070670_1001273302 | 104 |
| 86 | 3300005331 | Ga0070670_100295989 | Ga0070670_1002959892 | 104 |
| 87 | 3300005331 | Ga0070670_100634107 | Ga0070670_1006341072 | 104 |
| 88 | 3300005331 | Ga0070670_101188779 | Ga0070670_1011887791 | 104 |
| 89 | 3300005333 | Ga0070677_10692932 | Ga0070677_106929321 | 104 |
| 90 | 3300005333 | Ga0070677_10706178 | Ga0070677_107061781 | 104 |
| 91 | 3300005334 | Ga0068869_100048516 | Ga0068869_1000485164 | 104 |
| 92 | 3300005334 | Ga0068869_100072059 | Ga0068869_1000720592 | 104 |
| 93 | 3300005334 | Ga0068869_100592476 | Ga0068869_1005924762 | 104 |
| 94 | 3300005334 | Ga0068869_100667532 | Ga0068869_1006675321 | 104 |
| 95 | 3300005335 | Ga0070666_10623468 | Ga0070666_106234682 | 104 |
| 96 | 3300005336 | Ga0070680_100089415 | Ga0070680_1000894151 | 104 |
| 97 | 3300005337 | Ga0070682_100649080 | Ga0070682_1006490802 | 104 |
| 98 | 3300005338 | Ga0068868_100444394 | Ga0068868_1004443942 | 104 |
| 99 | 3300005338 | Ga0068868_100491741 | Ga0068868_1004917412 | 104 |
| 100 | 3300005338 | Ga0068868_100945002 | Ga0068868_1009450022 | 104 |
| 101 | 3300005338 | Ga0068868_101221872 | Ga0068868_1012218721 | 104 |
| 102 | 3300005338 | Ga0068868_101784677 | Ga0068868_1017846772 | 104 |
| 103 | 3300005339 | Ga0070660_100738975 | Ga0070660_1007389751 | 104 |
| 104 | 3300005340 | Ga0070689_100002318 | Ga0070689_10000231810 | 104 |
| 105 | 3300005343 | Ga0070687_100001735 | Ga0070687_1000017353 | 104 |
| 106 | 3300005343 | Ga0070687_100132426 | Ga0070687_1001324262 | 104 |
| 107 | 3300005343 | Ga0070687_100379197 | Ga0070687_1003791972 | 104 |
| 108 | 3300005344 | Ga0070661_100080340 | Ga0070661_1000803404 | 104 |
| 109 | 3300005344 | Ga0070661_100519668 | Ga0070661_1005196681 | 104 |
| 110 | 3300005344 | Ga0070661_100896384 | Ga0070661_1008963841 | 104 |
| 111 | 3300005344 | Ga0070661_101672753 | Ga0070661_1016727531 | 104 |
| 112 | 3300005345 | Ga0070692_10196058 | Ga0070692_101960582 | 104 |
| 113 | 3300005345 | Ga0070692_11063170 | Ga0070692_110631701 | 104 |
| 114 | 3300005347 | Ga0070668_100100711 | Ga0070668_1001007113 | 104 |
| 115 | 3300005347 | Ga0070668_100679905 | Ga0070668_1006799052 | 104 |
| 116 | 3300005353 | Ga0070669_100032396 | Ga0070669_1000323965 | 104 |
| 117 | 3300005353 | Ga0070669_100137207 | Ga0070669_1001372072 | 104 |
| 118 | 3300005353 | Ga0070669_100190119 | Ga0070669_1001901192 | 104 |
| 119 | 3300005354 | Ga0070675_100592230 | Ga0070675_1005922301 | 104 |
| 120 | 3300005354 | Ga0070675_101159412 | Ga0070675_1011594122 | 104 |
| 121 | 3300005355 | Ga0070671_100030098 | Ga0070671_1000300983 | 104 |
| 122 | 3300005355 | Ga0070671_100197809 | Ga0070671_1001978093 | 104 |
| 123 | 3300005356 | Ga0070674_100283453 | Ga0070674_1002834532 | 104 |
| 124 | 3300005356 | Ga0070674_100326027 | Ga0070674_1003260272 | 104 |
| 125 | 3300005356 | Ga0070674_100720985 | Ga0070674_1007209852 | 104 |
| 126 | 3300005364 | Ga0070673_100000317 | Ga0070673_10000031725 | 104 |
| 127 | 3300005364 | Ga0070673_100118429 | Ga0070673_1001184293 | 104 |
| 128 | 3300005364 | Ga0070673_100949121 | Ga0070673_1009491211 | 104 |
| 129 | 3300005364 | Ga0070673_101171633 | Ga0070673_1011716332 | 104 |
| 130 | 3300005365 | Ga0070688_100001119 | Ga0070688_1000011194 | 104 |
| 131 | 3300005365 | Ga0070688_100506878 | Ga0070688_1005068782 | 104 |
| 132 | 3300005366 | Ga0070659_100482370 | Ga0070659_1004823702 | 104 |
| 133 | 3300005366 | Ga0070659_100873661 | Ga0070659_1008736612 | 104 |
| 134 | 3300005367 | Ga0070667_100122916 | Ga0070667_1001229164 | 104 |
| 135 | 3300005367 | Ga0070667_100192544 | Ga0070667_1001925442 | 104 |
| 136 | 3300005367 | Ga0070667_101388834 | Ga0070667_1013888341 | 104 |
| 137 | 3300005367 | Ga0070667_101809994 | Ga0070667_1018099942 | 104 |
| 138 | 3300005406 | Ga0070703_10101445 | Ga0070703_101014452 | 104 |
| 139 | 3300005438 | Ga0070701_10007594 | Ga0070701_100075945 | 104 |
| 140 | 3300005438 | Ga0070701_11353664 | Ga0070701_113536641 | 104 |
| 141 | 3300005440 | Ga0070705_100599646 | Ga0070705_1005996461 | 104 |
| 142 | 3300005440 | Ga0070705_100840726 | Ga0070705_1008407261 | 104 |
| 143 | 3300005441 | Ga0070700_100567998 | Ga0070700_1005679982 | 104 |
| 144 | 3300005441 | Ga0070700_100756833 | Ga0070700_1007568332 | 104 |
| 145 | 3300005444 | Ga0070694_100147625 | Ga0070694_1001476251 | 104 |
| 146 | 3300005455 | Ga0070663_100873917 | Ga0070663_1008739171 | 104 |
| 147 | 3300005456 | Ga0070678_100031268 | Ga0070678_1000312685 | 104 |
| 148 | 3300005456 | Ga0070678_100278101 | Ga0070678_1002781013 | 104 |
| 149 | 3300005456 | Ga0070678_100337502 | Ga0070678_1003375022 | 104 |
| 150 | 3300005456 | Ga0070678_101527101 | Ga0070678_1015271011 | 104 |
| 151 | 3300005457 | Ga0070662_100002863 | Ga0070662_1000028638 | 104 |
| 152 | 3300005457 | Ga0070662_100025780 | Ga0070662_1000257802 | 104 |
| 153 | 3300005458 | Ga0070681_10026906 | Ga0070681_100269067 | 104 |
| 154 | 3300005458 | Ga0070681_11180454 | Ga0070681_111804541 | 104 |
| 155 | 3300005459 | Ga0068867_100016517 | Ga0068867_1000165172 | 104 |
| 156 | 3300005459 | Ga0068867_100311574 | Ga0068867_1003115742 | 104 |
| 157 | 3300005459 | Ga0068867_100467944 | Ga0068867_1004679442 | 104 |
| 158 | 3300005466 | Ga0070685_10103872 | Ga0070685_101038721 | 104 |
| 159 | 3300005530 | Ga0070679_100153455 | Ga0070679_1001534555 | 104 |
| 160 | 3300005530 | Ga0070679_100582983 | Ga0070679_1005829832 | 104 |
| 161 | 3300005535 | Ga0070684_100006100 | Ga0070684_1000061005 | 104 |
| 162 | 3300005539 | Ga0068853_100111272 | Ga0068853_1001112721 | 104 |
| 163 | 3300005539 | Ga0068853_100118015 | Ga0068853_1001180154 | 104 |
| 164 | 3300005539 | Ga0068853_100237294 | Ga0068853_1002372943 | 104 |
| 165 | 3300005539 | Ga0068853_100885631 | Ga0068853_1008856311 | 104 |
| 166 | 3300005539 | Ga0068853_101548891 | Ga0068853_1015488912 | 104 |
| 167 | 3300005543 | Ga0070672_100070580 | Ga0070672_1000705802 | 104 |
| 168 | 3300005543 | Ga0070672_100142954 | Ga0070672_1001429543 | 104 |
| 169 | 3300005543 | Ga0070672_100698845 | Ga0070672_1006988452 | 104 |
| 170 | 3300005544 | Ga0070686_100002445 | Ga0070686_1000024452 | 104 |
| 171 | 3300005544 | Ga0070686_100095174 | Ga0070686_1000951742 | 104 |
| 172 | 3300005544 | Ga0070686_100484324 | Ga0070686_1004843242 | 104 |
| 173 | 3300005544 | Ga0070686_101804248 | Ga0070686_1018042481 | 104 |
| 174 | 3300005546 | Ga0070696_100001844 | Ga0070696_1000018445 | 104 |
| 175 | 3300005546 | Ga0070696_100504633 | Ga0070696_1005046332 | 104 |
| 176 | 3300005546 | Ga0070696_101120139 | Ga0070696_1011201391 | 104 |
| 177 | 3300005548 | Ga0070665_100031487 | Ga0070665_1000314873 | 104 |
| 178 | 3300005548 | Ga0070665_100101282 | Ga0070665_1001012823 | 104 |
| 179 | 3300005548 | Ga0070665_100390388 | Ga0070665_1003903882 | 104 |
| 180 | 3300005548 | Ga0070665_100447285 | Ga0070665_1004472852 | 104 |
| 181 | 3300005548 | Ga0070665_100659316 | Ga0070665_1006593162 | 104 |
| 182 | 3300005548 | Ga0070665_100780351 | Ga0070665_1007803512 | 104 |
| 183 | 3300005548 | Ga0070665_100790015 | Ga0070665_1007900151 | 104 |
| 184 | 3300005548 | Ga0070665_100941862 | Ga0070665_1009418622 | 104 |
| 185 | 3300005548 | Ga0070665_101482845 | Ga0070665_1014828452 | 104 |
| 186 | 3300005549 | Ga0070704_100359716 | Ga0070704_1003597162 | 104 |
| 187 | 3300005563 | Ga0068855_100407207 | Ga0068855_1004072071 | 104 |
| 188 | 3300005564 | Ga0070664_100008545 | Ga0070664_1000085454 | 104 |
| 189 | 3300005564 | Ga0070664_100016232 | Ga0070664_1000162322 | 104 |
| 190 | 3300005564 | Ga0070664_100474321 | Ga0070664_1004743212 | 104 |
| 191 | 3300005564 | Ga0070664_100963799 | Ga0070664_1009637992 | 104 |
| 192 | 3300005577 | Ga0068857_100014969 | Ga0068857_1000149694 | 104 |
| 193 | 3300005577 | Ga0068857_100040174 | Ga0068857_1000401745 | 104 |
| 194 | 3300005577 | Ga0068857_100117239 | Ga0068857_1001172392 | 104 |
| 195 | 3300005577 | Ga0068857_100153872 | Ga0068857_1001538724 | 104 |
| 196 | 3300005577 | Ga0068857_101061684 | Ga0068857_1010616842 | 104 |
| 197 | 3300005578 | Ga0068854_100017705 | Ga0068854_1000177055 | 104 |
| 198 | 3300005578 | Ga0068854_100236014 | Ga0068854_1002360141 | 104 |
| 199 | 3300005614 | Ga0068856_100128803 | Ga0068856_1001288033 | 104 |
| 200 | 3300005615 | Ga0070702_100273293 | Ga0070702_1002732932 | 104 |
| 201 | 3300005615 | Ga0070702_100446992 | Ga0070702_1004469921 | 104 |
| 202 | 3300005616 | Ga0068852_100032511 | Ga0068852_1000325112 | 104 |
| 203 | 3300005616 | Ga0068852_100098682 | Ga0068852_1000986822 | 104 |
| 204 | 3300005616 | Ga0068852_100827561 | Ga0068852_1008275612 | 104 |
| 205 | 3300005616 | Ga0068852_101671631 | Ga0068852_1016716311 | 104 |
| 206 | 3300005617 | Ga0068859_100173238 | Ga0068859_1001732383 | 104 |
| 207 | 3300005617 | Ga0068859_100295362 | Ga0068859_1002953622 | 104 |
| 208 | 3300005617 | Ga0068859_100368076 | Ga0068859_1003680763 | 104 |
| 209 | 3300005617 | Ga0068859_100401341 | Ga0068859_1004013412 | 104 |
| 210 | 3300005617 | Ga0068859_101393798 | Ga0068859_1013937982 | 104 |
| 211 | 3300005618 | Ga0068864_100002908 | Ga0068864_10000290815 | 104 |
| 212 | 3300005618 | Ga0068864_100050437 | Ga0068864_1000504373 | 104 |
| 213 | 3300005618 | Ga0068864_100115144 | Ga0068864_1001151445 | 104 |
| 214 | 3300005618 | Ga0068864_100524099 | Ga0068864_1005240991 | 104 |
| 215 | 3300005718 | Ga0068866_10043985 | Ga0068866_100439852 | 104 |
| 216 | 3300005718 | Ga0068866_10602610 | Ga0068866_106026101 | 104 |
| 217 | 3300005718 | Ga0068866_10771041 | Ga0068866_107710412 | 104 |
| 218 | 3300005719 | Ga0068861_100002630 | Ga0068861_10000263011 | 104 |
| 219 | 3300005719 | Ga0068861_100003108 | Ga0068861_10000310811 | 104 |
| 220 | 3300005719 | Ga0068861_100005158 | Ga0068861_1000051588 | 104 |
| 221 | 3300005719 | Ga0068861_101662371 | Ga0068861_1016623712 | 104 |
| 222 | 3300005834 | Ga0068851_10193840 | Ga0068851_101938402 | 104 |
| 223 | 3300005840 | Ga0068870_10019848 | Ga0068870_100198482 | 104 |
| 224 | 3300005840 | Ga0068870_10248240 | Ga0068870_102482402 | 104 |
| 225 | 3300005841 | Ga0068863_100000209 | Ga0068863_10000020933 | 104 |
| 226 | 3300005841 | Ga0068863_100208951 | Ga0068863_1002089513 | 104 |
| 227 | 3300005841 | Ga0068863_100621586 | Ga0068863_1006215862 | 104 |
| 228 | 3300005841 | Ga0068863_100900125 | Ga0068863_1009001252 | 104 |
| 229 | 3300005841 | Ga0068863_101535979 | Ga0068863_1015359791 | 104 |
| 230 | 3300005841 | Ga0068863_102398743 | Ga0068863_1023987432 | 104 |
| 231 | 3300005842 | Ga0068858_100022830 | Ga0068858_1000228308 | 104 |
| 232 | 3300005842 | Ga0068858_100367161 | Ga0068858_1003671612 | 104 |
| 233 | 3300005842 | Ga0068858_100407605 | Ga0068858_1004076052 | 104 |
| 234 | 3300005843 | Ga0068860_100004201 | Ga0068860_1000042018 | 104 |
| 235 | 3300005843 | Ga0068860_100006195 | Ga0068860_1000061954 | 104 |
| 236 | 3300005843 | Ga0068860_100234346 | Ga0068860_1002343461 | 104 |
| 237 | 3300005843 | Ga0068860_100446568 | Ga0068860_1004465682 | 104 |
| 238 | 3300005843 | Ga0068860_100863446 | Ga0068860_1008634462 | 104 |
| 239 | 3300005843 | Ga0068860_101168643 | Ga0068860_1011686432 | 104 |
| 240 | 3300005843 | Ga0068860_101617348 | Ga0068860_1016173481 | 104 |
| 241 | 3300005844 | Ga0068862_100003257 | Ga0068862_1000032576 | 104 |
| 242 | 3300005844 | Ga0068862_100027941 | Ga0068862_1000279412 | 104 |
| 243 | 3300005844 | Ga0068862_100031016 | Ga0068862_1000310164 | 104 |
| 244 | 3300005844 | Ga0068862_100088646 | Ga0068862_1000886464 | 104 |
| 245 | 3300005844 | Ga0068862_100155300 | Ga0068862_1001553004 | 104 |
| 246 | 3300005844 | Ga0068862_100549435 | Ga0068862_1005494352 | 104 |
| 247 | 3300005844 | Ga0068862_101848142 | Ga0068862_1018481422 | 104 |
| 248 | 3300005937 | Ga0081455_10643142 | Ga0081455_106431422 | 104 |
| 249 | 3300006038 | Ga0075365_10077303 | Ga0075365_100773032 | 104 |
| 250 | 3300006038 | Ga0075365_10091811 | Ga0075365_100918113 | 104 |
| 251 | 3300006038 | Ga0075365_10374454 | Ga0075365_103744541 | 104 |
| 252 | 3300006038 | Ga0075365_10469943 | Ga0075365_104699432 | 104 |
| 253 | 3300006038 | Ga0075365_10563383 | Ga0075365_105633832 | 104 |
| 254 | 3300006042 | Ga0075368_10168323 | Ga0075368_101683232 | 104 |
| 255 | 3300006048 | Ga0075363_100132018 | Ga0075363_1001320182 | 104 |
| 256 | 3300006048 | Ga0075363_100189867 | Ga0075363_1001898673 | 104 |
| 257 | 3300006048 | Ga0075363_100789954 | Ga0075363_1007899542 | 104 |
| 258 | 3300006048 | Ga0075363_100822275 | Ga0075363_1008222751 | 104 |
| 259 | 3300006051 | Ga0075364_10335443 | Ga0075364_103354431 | 104 |
| 260 | 3300006051 | Ga0075364_10482137 | Ga0075364_104821371 | 104 |
| 261 | 3300006173 | Ga0070716_100559606 | Ga0070716_1005596061 | 104 |
| 262 | 3300006177 | Ga0075362_10036702 | Ga0075362_100367024 | 104 |
| 263 | 3300006177 | Ga0075362_10036902 | Ga0075362_100369022 | 104 |
| 264 | 3300006178 | Ga0075367_10027825 | Ga0075367_100278254 | 104 |
| 265 | 3300006178 | Ga0075367_10081052 | Ga0075367_100810522 | 104 |
| 266 | 3300006178 | Ga0075367_10294902 | Ga0075367_102949022 | 104 |
| 267 | 3300006178 | Ga0075367_10575263 | Ga0075367_105752632 | 104 |
| 268 | 3300006178 | Ga0075367_10849788 | Ga0075367_108497882 | 104 |
| 269 | 3300006186 | Ga0075369_10209065 | Ga0075369_102090652 | 104 |
| 270 | 3300006186 | Ga0075369_10216384 | Ga0075369_102163841 | 104 |
| 271 | 3300006195 | Ga0075366_10557513 | Ga0075366_105575131 | 104 |
| 272 | 3300006237 | Ga0097621_100323789 | Ga0097621_1003237892 | 104 |
| 273 | 3300006237 | Ga0097621_100646784 | Ga0097621_1006467842 | 104 |
| 274 | 3300006237 | Ga0097621_101144361 | Ga0097621_1011443612 | 104 |
| 275 | 3300006353 | Ga0075370_10381044 | Ga0075370_103810442 | 104 |
| 276 | 3300006353 | Ga0075370_10466376 | Ga0075370_104663761 | 104 |
| 277 | 3300006358 | Ga0068871_100039747 | Ga0068871_1000397475 | 104 |
| 278 | 3300006358 | Ga0068871_100662407 | Ga0068871_1006624073 | 104 |
| 279 | 3300006358 | Ga0068871_100855338 | Ga0068871_1008553381 | 104 |
| 280 | 3300006358 | Ga0068871_101642205 | Ga0068871_1016422052 | 104 |
| 281 | 3300006844 | Ga0075428_100003563 | Ga0075428_10000356312 | 104 |
| 282 | 3300006844 | Ga0075428_100030049 | Ga0075428_1000300492 | 104 |
| 283 | 3300006844 | Ga0075428_100057015 | Ga0075428_1000570156 | 104 |
| 284 | 3300006844 | Ga0075428_100082305 | Ga0075428_1000823052 | 104 |
| 285 | 3300006846 | Ga0075430_100010470 | Ga0075430_1000104706 | 104 |
| 286 | 3300006846 | Ga0075430_100042080 | Ga0075430_1000420802 | 104 |
| 287 | 3300006846 | Ga0075430_100138634 | Ga0075430_1001386343 | 104 |
| 288 | 3300006847 | Ga0075431_100007733 | Ga0075431_1000077332 | 104 |
| 289 | 3300006847 | Ga0075431_100162361 | Ga0075431_1001623612 | 104 |
| 290 | 3300006847 | Ga0075431_100169172 | Ga0075431_1001691722 | 104 |
| 291 | 3300006847 | Ga0075431_100575651 | Ga0075431_1005756511 | 104 |
| 292 | 3300006852 | Ga0075433_10335340 | Ga0075433_103353402 | 104 |
| 293 | 3300006880 | Ga0075429_100002556 | Ga0075429_1000025567 | 104 |
| 294 | 3300006880 | Ga0075429_100003351 | Ga0075429_1000033518 | 104 |
| 295 | 3300006880 | Ga0075429_100005811 | Ga0075429_10000581112 | 104 |
| 296 | 3300006880 | Ga0075429_100061828 | Ga0075429_1000618282 | 104 |
| 297 | 3300006880 | Ga0075429_100596375 | Ga0075429_1005963752 | 104 |
| 298 | 3300006881 | Ga0068865_100003091 | Ga0068865_10000309110 | 104 |
| 299 | 3300006881 | Ga0068865_100085945 | Ga0068865_1000859451 | 104 |
| 300 | 3300006881 | Ga0068865_100893305 | Ga0068865_1008933052 | 104 |
| 301 | 3300006931 | Ga0097620_100173249 | Ga0097620_1001732493 | 104 |
| 302 | 3300006931 | Ga0097620_100295374 | Ga0097620_1002953742 | 104 |
| 303 | 3300006931 | Ga0097620_100368087 | Ga0097620_1003680871 | 104 |
| 304 | 3300006931 | Ga0097620_100401321 | Ga0097620_1004013212 | 104 |
| 305 | 3300006931 | Ga0097620_100995713 | Ga0097620_1009957132 | 104 |
| 306 | 3300006931 | Ga0097620_101393835 | Ga0097620_1013938352 | 104 |
| 307 | 3300007076 | Ga0075435_100285628 | Ga0075435_1002856281 | 104 |
| 308 | 3300007265 | Ga0099794_10148152 | Ga0099794_101481522 | 104 |
| 309 | 3300009093 | Ga0105240_10066942 | Ga0105240_100669422 | 104 |
| 310 | 3300009093 | Ga0105240_10129094 | Ga0105240_101290942 | 104 |
| 311 | 3300009093 | Ga0105240_10171492 | Ga0105240_101714923 | 104 |
| 312 | 3300009093 | Ga0105240_10319425 | Ga0105240_103194253 | 104 |
| 313 | 3300009093 | Ga0105240_11223714 | Ga0105240_112237141 | 104 |
| 314 | 3300009093 | Ga0105240_11461706 | Ga0105240_114617062 | 104 |
| 315 | 3300009094 | Ga0111539_10006979 | Ga0111539_1000697912 | 104 |
| 316 | 3300009094 | Ga0111539_10086104 | Ga0111539_100861044 | 104 |
| 317 | 3300009094 | Ga0111539_10096982 | Ga0111539_100969823 | 104 |
| 318 | 3300009094 | Ga0111539_10167080 | Ga0111539_101670805 | 104 |
| 319 | 3300009094 | Ga0111539_10268477 | Ga0111539_102684772 | 104 |
| 320 | 3300009098 | Ga0105245_10200038 | Ga0105245_102000382 | 104 |
| 321 | 3300009098 | Ga0105245_10362686 | Ga0105245_103626862 | 104 |
| 322 | 3300009098 | Ga0105245_10510353 | Ga0105245_105103531 | 104 |
| 323 | 3300009098 | Ga0105245_12630657 | Ga0105245_126306571 | 104 |
| 324 | 3300009101 | Ga0105247_10032863 | Ga0105247_100328633 | 104 |
| 325 | 3300009101 | Ga0105247_10437767 | Ga0105247_104377672 | 104 |
| 326 | 3300009147 | Ga0114129_10000190 | Ga0114129_1000019072 | 104 |
| 327 | 3300009147 | Ga0114129_10043388 | Ga0114129_100433882 | 104 |
| 328 | 3300009147 | Ga0114129_10044795 | Ga0114129_100447955 | 104 |
| 329 | 3300009148 | Ga0105243_10017116 | Ga0105243_100171165 | 104 |
| 330 | 3300009148 | Ga0105243_10046246 | Ga0105243_100462462 | 104 |
| 331 | 3300009148 | Ga0105243_11566660 | Ga0105243_115666601 | 104 |
| 332 | 3300009148 | Ga0105243_12409622 | Ga0105243_124096221 | 104 |
| 333 | 3300009148 | Ga0105243_12646343 | Ga0105243_126463431 | 104 |
| 334 | 3300009174 | Ga0105241_10011183 | Ga0105241_100111835 | 104 |
| 335 | 3300009174 | Ga0105241_10337158 | Ga0105241_103371583 | 104 |
| 336 | 3300009174 | Ga0105241_10565549 | Ga0105241_105655492 | 104 |
| 337 | 3300009174 | Ga0105241_10896366 | Ga0105241_108963662 | 104 |
| 338 | 3300009174 | Ga0105241_11227678 | Ga0105241_112276781 | 104 |
| 339 | 3300009174 | Ga0105241_11236630 | Ga0105241_112366301 | 104 |
| 340 | 3300009174 | Ga0105241_11374575 | Ga0105241_113745751 | 104 |
| 341 | 3300009174 | Ga0105241_11589162 | Ga0105241_115891621 | 104 |
| 342 | 3300009174 | Ga0105241_11966339 | Ga0105241_119663391 | 104 |
| 343 | 3300009174 | Ga0105241_12386144 | Ga0105241_123861442 | 104 |
| 344 | 3300009176 | Ga0105242_10039640 | Ga0105242_100396404 | 104 |
| 345 | 3300009176 | Ga0105242_10069305 | Ga0105242_100693054 | 104 |
| 346 | 3300009176 | Ga0105242_10257036 | Ga0105242_102570361 | 104 |
| 347 | 3300009176 | Ga0105242_11151006 | Ga0105242_111510061 | 104 |
| 348 | 3300009177 | Ga0105248_10001641 | Ga0105248_100016413 | 104 |
| 349 | 3300009177 | Ga0105248_10284928 | Ga0105248_102849282 | 104 |
| 350 | 3300009177 | Ga0105248_11568671 | Ga0105248_115686711 | 104 |
| 351 | 3300009545 | Ga0105237_10022435 | Ga0105237_100224356 | 104 |
| 352 | 3300009545 | Ga0105237_10222058 | Ga0105237_102220582 | 104 |
| 353 | 3300009545 | Ga0105237_10349554 | Ga0105237_103495542 | 104 |
| 354 | 3300009545 | Ga0105237_10380643 | Ga0105237_103806432 | 104 |
| 355 | 3300009545 | Ga0105237_10496501 | Ga0105237_104965012 | 104 |
| 356 | 3300009545 | Ga0105237_10892310 | Ga0105237_108923102 | 104 |
| 357 | 3300009545 | Ga0105237_12649822 | Ga0105237_126498221 | 104 |
| 358 | 3300009551 | Ga0105238_10110557 | Ga0105238_101105572 | 104 |
| 359 | 3300009551 | Ga0105238_10137943 | Ga0105238_101379432 | 104 |
| 360 | 3300009551 | Ga0105238_10182868 | Ga0105238_101828682 | 104 |
| 361 | 3300009551 | Ga0105238_10404518 | Ga0105238_104045182 | 104 |
| 362 | 3300009551 | Ga0105238_11620165 | Ga0105238_116201652 | 104 |
| 363 | 3300009551 | Ga0105238_11681949 | Ga0105238_116819491 | 104 |
| 364 | 3300009553 | Ga0105249_10006407 | Ga0105249_100064072 | 104 |
| 365 | 3300009553 | Ga0105249_10008962 | Ga0105249_100089629 | 104 |
| 366 | 3300009553 | Ga0105249_10043781 | Ga0105249_100437816 | 104 |
| 367 | 3300009553 | Ga0105249_10044664 | Ga0105249_100446641 | 104 |
| 368 | 3300010159 | Ga0099796_10293484 | Ga0099796_102934842 | 104 |
| 369 | 3300010375 | Ga0105239_10004648 | Ga0105239_100046489 | 104 |
| 370 | 3300010375 | Ga0105239_10349631 | Ga0105239_103496312 | 104 |
| 371 | 3300010375 | Ga0105239_10492626 | Ga0105239_104926262 | 104 |
| 372 | 3300010375 | Ga0105239_10568606 | Ga0105239_105686062 | 104 |
| 373 | 3300010375 | Ga0105239_10651175 | Ga0105239_106511752 | 104 |
| 374 | 3300010375 | Ga0105239_10931150 | Ga0105239_109311501 | 104 |
| 375 | 3300010375 | Ga0105239_11085294 | Ga0105239_110852942 | 104 |
| 376 | 3300010375 | Ga0105239_11397329 | Ga0105239_113973292 | 104 |
| 377 | 3300011119 | Ga0105246_10070976 | Ga0105246_100709762 | 104 |
| 378 | 3300011119 | Ga0105246_10144409 | Ga0105246_101444092 | 104 |
| 379 | 3300011119 | Ga0105246_10547618 | Ga0105246_105476181 | 104 |
| 380 | 3300011119 | Ga0105246_10553993 | Ga0105246_105539932 | 104 |
| 381 | 3300011119 | Ga0105246_12116713 | Ga0105246_121167131 | 104 |
| 382 | 3300013105 | Ga0157369_11075906 | Ga0157369_110759062 | 104 |
| 383 | 3300013296 | Ga0157374_10016443 | Ga0157374_100164432 | 104 |
| 384 | 3300013296 | Ga0157374_10052960 | Ga0157374_100529604 | 104 |
| 385 | 3300013296 | Ga0157374_10342113 | Ga0157374_103421132 | 104 |
| 386 | 3300013296 | Ga0157374_10867361 | Ga0157374_108673612 | 104 |
| 387 | 3300013297 | Ga0157378_10002071 | Ga0157378_1000207113 | 104 |
| 388 | 3300013297 | Ga0157378_11834741 | Ga0157378_118347412 | 104 |
| 389 | 3300013306 | Ga0163162_10050059 | Ga0163162_100500592 | 104 |
| 390 | 3300013306 | Ga0163162_10056528 | Ga0163162_100565282 | 104 |
| 391 | 3300013306 | Ga0163162_10100678 | Ga0163162_101006782 | 104 |
| 392 | 3300013306 | Ga0163162_10179297 | Ga0163162_101792972 | 104 |
| 393 | 3300013306 | Ga0163162_10561966 | Ga0163162_105619662 | 104 |
| 394 | 3300013306 | Ga0163162_12222513 | Ga0163162_122225131 | 104 |
| 395 | 3300013306 | Ga0163162_12989558 | Ga0163162_129895581 | 104 |
| 396 | 3300013308 | Ga0157375_10025378 | Ga0157375_100253782 | 104 |
| 397 | 3300013308 | Ga0157375_10185639 | Ga0157375_101856393 | 104 |
| 398 | 3300013308 | Ga0157375_11108616 | Ga0157375_111086161 | 104 |
| 399 | 3300014325 | Ga0163163_10036850 | Ga0163163_100368502 | 104 |
| 400 | 3300014325 | Ga0163163_10091453 | Ga0163163_100914533 | 104 |
| 401 | 3300014325 | Ga0163163_10101945 | Ga0163163_101019452 | 104 |
| 402 | 3300014325 | Ga0163163_10403616 | Ga0163163_104036162 | 104 |
| 403 | 3300014325 | Ga0163163_11190762 | Ga0163163_111907622 | 104 |
| 404 | 3300014325 | Ga0163163_12557002 | Ga0163163_125570021 | 104 |
| 405 | 3300014325 | Ga0163163_12689405 | Ga0163163_126894052 | 104 |
| 406 | 3300014326 | Ga0157380_10091197 | Ga0157380_100911974 | 104 |
| 407 | 3300014326 | Ga0157380_10314326 | Ga0157380_103143262 | 104 |
| 408 | 3300014326 | Ga0157380_11481259 | Ga0157380_114812592 | 104 |
| 409 | 3300014326 | Ga0157380_11608155 | Ga0157380_116081551 | 104 |
| 410 | 3300014326 | Ga0157380_12466707 | Ga0157380_124667072 | 104 |
| 411 | 3300014745 | Ga0157377_10114695 | Ga0157377_101146952 | 104 |
| 412 | 3300014745 | Ga0157377_11483003 | Ga0157377_114830031 | 104 |
| 413 | 3300014968 | Ga0157379_10854697 | Ga0157379_108546972 | 104 |
| 414 | 3300014969 | Ga0157376_10024119 | Ga0157376_100241191 | 104 |
| 415 | 3300014969 | Ga0157376_10207021 | Ga0157376_102070213 | 104 |
| 416 | 3300014969 | Ga0157376_10843013 | Ga0157376_108430132 | 104 |
| 417 | 3300014969 | Ga0157376_11952922 | Ga0157376_119529222 | 104 |
| 418 | 3300017792 | Ga0163161_10520032 | Ga0163161_105200322 | 104 |
| 419 | 3300017792 | Ga0163161_10863978 | Ga0163161_108639782 | 104 |
| 420 | 3300021361 | Ga0213872_10003293 | Ga0213872_100032939 | 104 |
| 421 | 3300025245 | Ga0207425_1053565 | Ga0207425_10535652 | 104 |
| 422 | 3300025258 | Ga0209129_1030275 | Ga0209129_10302752 | 104 |
| 423 | 3300025297 | Ga0209758_1001140 | Ga0209758_100114013 | 104 |
| 424 | 3300025321 | Ga0207656_10073397 | Ga0207656_100733972 | 104 |
| 425 | 3300025893 | Ga0207682_10057209 | Ga0207682_100572093 | 104 |
| 426 | 3300025899 | Ga0207642_10022482 | Ga0207642_100224822 | 104 |
| 427 | 3300025899 | Ga0207642_10033949 | Ga0207642_100339492 | 104 |
| 428 | 3300025899 | Ga0207642_10040147 | Ga0207642_100401472 | 104 |
| 429 | 3300025900 | Ga0207710_10027246 | Ga0207710_100272462 | 104 |
| 430 | 3300025900 | Ga0207710_10135298 | Ga0207710_101352982 | 104 |
| 431 | 3300025900 | Ga0207710_10637799 | Ga0207710_106377991 | 104 |
| 432 | 3300025901 | Ga0207688_10317166 | Ga0207688_103171662 | 104 |
| 433 | 3300025901 | Ga0207688_10331588 | Ga0207688_103315881 | 104 |
| 434 | 3300025901 | Ga0207688_10398430 | Ga0207688_103984302 | 104 |
| 435 | 3300025901 | Ga0207688_10992972 | Ga0207688_109929722 | 104 |
| 436 | 3300025903 | Ga0207680_10197579 | Ga0207680_101975792 | 104 |
| 437 | 3300025904 | Ga0207647_10353229 | Ga0207647_103532291 | 104 |
| 438 | 3300025907 | Ga0207645_10005536 | Ga0207645_100055363 | 104 |
| 439 | 3300025907 | Ga0207645_10097880 | Ga0207645_100978803 | 104 |
| 440 | 3300025907 | Ga0207645_10129302 | Ga0207645_101293023 | 104 |
| 441 | 3300025908 | Ga0207643_10004975 | Ga0207643_100049756 | 104 |
| 442 | 3300025908 | Ga0207643_10043790 | Ga0207643_100437904 | 104 |
| 443 | 3300025909 | Ga0207705_10079520 | Ga0207705_100795202 | 104 |
| 444 | 3300025912 | Ga0207707_10014510 | Ga0207707_100145107 | 104 |
| 445 | 3300025913 | Ga0207695_10390788 | Ga0207695_103907882 | 104 |
| 446 | 3300025913 | Ga0207695_10484489 | Ga0207695_104844891 | 104 |
| 447 | 3300025914 | Ga0207671_10037840 | Ga0207671_100378405 | 104 |
| 448 | 3300025914 | Ga0207671_10092271 | Ga0207671_100922713 | 104 |
| 449 | 3300025914 | Ga0207671_10298619 | Ga0207671_102986192 | 104 |
| 450 | 3300025914 | Ga0207671_10334291 | Ga0207671_103342912 | 104 |
| 451 | 3300025914 | Ga0207671_10507995 | Ga0207671_105079951 | 104 |
| 452 | 3300025914 | Ga0207671_10536744 | Ga0207671_105367442 | 104 |
| 453 | 3300025914 | Ga0207671_11541164 | Ga0207671_115411641 | 104 |
| 454 | 3300025915 | Ga0207693_10106838 | Ga0207693_101068383 | 104 |
| 455 | 3300025917 | Ga0207660_10021907 | Ga0207660_100219075 | 104 |
| 456 | 3300025917 | Ga0207660_11020511 | Ga0207660_110205111 | 104 |
| 457 | 3300025918 | Ga0207662_10006753 | Ga0207662_100067532 | 104 |
| 458 | 3300025918 | Ga0207662_10027055 | Ga0207662_100270553 | 104 |
| 459 | 3300025919 | Ga0207657_10611922 | Ga0207657_106119222 | 104 |
| 460 | 3300025920 | Ga0207649_10379711 | Ga0207649_103797112 | 104 |
| 461 | 3300025920 | Ga0207649_10479764 | Ga0207649_104797642 | 104 |
| 462 | 3300025921 | Ga0207652_10122145 | Ga0207652_101221452 | 104 |
| 463 | 3300025921 | Ga0207652_11845057 | Ga0207652_118450572 | 104 |
| 464 | 3300025923 | Ga0207681_10027647 | Ga0207681_100276475 | 104 |
| 465 | 3300025923 | Ga0207681_10046892 | Ga0207681_100468922 | 104 |
| 466 | 3300025923 | Ga0207681_10072030 | Ga0207681_100720302 | 104 |
| 467 | 3300025923 | Ga0207681_10778058 | Ga0207681_107780582 | 104 |
| 468 | 3300025924 | Ga0207694_10187604 | Ga0207694_101876042 | 104 |
| 469 | 3300025924 | Ga0207694_10201244 | Ga0207694_102012442 | 104 |
| 470 | 3300025924 | Ga0207694_10258752 | Ga0207694_102587522 | 104 |
| 471 | 3300025924 | Ga0207694_10804681 | Ga0207694_108046811 | 104 |
| 472 | 3300025924 | Ga0207694_11030138 | Ga0207694_110301382 | 104 |
| 473 | 3300025925 | Ga0207650_10012000 | Ga0207650_100120002 | 104 |
| 474 | 3300025925 | Ga0207650_10032210 | Ga0207650_100322102 | 104 |
| 475 | 3300025925 | Ga0207650_10073807 | Ga0207650_100738072 | 104 |
| 476 | 3300025925 | Ga0207650_10078116 | Ga0207650_100781162 | 104 |
| 477 | 3300025925 | Ga0207650_10330608 | Ga0207650_103306082 | 104 |
| 478 | 3300025925 | Ga0207650_10588159 | Ga0207650_105881592 | 104 |
| 479 | 3300025925 | Ga0207650_10698509 | Ga0207650_106985091 | 104 |
| 480 | 3300025925 | Ga0207650_11358069 | Ga0207650_113580691 | 104 |
| 481 | 3300025926 | Ga0207659_10419440 | Ga0207659_104194402 | 104 |
| 482 | 3300025927 | Ga0207687_10337985 | Ga0207687_103379851 | 104 |
| 483 | 3300025927 | Ga0207687_10922442 | Ga0207687_109224421 | 104 |
| 484 | 3300025927 | Ga0207687_11056798 | Ga0207687_110567982 | 104 |
| 485 | 3300025931 | Ga0207644_10017849 | Ga0207644_100178494 | 104 |
| 486 | 3300025932 | Ga0207690_10985449 | Ga0207690_109854492 | 104 |
| 487 | 3300025933 | Ga0207706_10001958 | Ga0207706_1000195813 | 104 |
| 488 | 3300025933 | Ga0207706_10019028 | Ga0207706_100190285 | 104 |
| 489 | 3300025933 | Ga0207706_10305936 | Ga0207706_103059363 | 104 |
| 490 | 3300025934 | Ga0207686_10192762 | Ga0207686_101927622 | 104 |
| 491 | 3300025934 | Ga0207686_10961472 | Ga0207686_109614722 | 104 |
| 492 | 3300025935 | Ga0207709_10058920 | Ga0207709_100589202 | 104 |
| 493 | 3300025936 | Ga0207670_10890042 | Ga0207670_108900422 | 104 |
| 494 | 3300025937 | Ga0207669_10106591 | Ga0207669_101065913 | 104 |
| 495 | 3300025937 | Ga0207669_10710684 | Ga0207669_107106842 | 104 |
| 496 | 3300025937 | Ga0207669_10983605 | Ga0207669_109836052 | 104 |
| 497 | 3300025938 | Ga0207704_10007178 | Ga0207704_100071786 | 104 |
| 498 | 3300025938 | Ga0207704_10204329 | Ga0207704_102043292 | 104 |
| 499 | 3300025939 | Ga0207665_10336428 | Ga0207665_103364282 | 104 |
| 500 | 3300025940 | Ga0207691_10076321 | Ga0207691_100763214 | 104 |
| 501 | 3300025940 | Ga0207691_10083409 | Ga0207691_100834092 | 104 |
| 502 | 3300025940 | Ga0207691_10611832 | Ga0207691_106118321 | 104 |
| 503 | 3300025940 | Ga0207691_10894955 | Ga0207691_108949552 | 104 |
| 504 | 3300025941 | Ga0207711_10053812 | Ga0207711_100538122 | 104 |
| 505 | 3300025941 | Ga0207711_10471911 | Ga0207711_104719111 | 104 |
| 506 | 3300025941 | Ga0207711_10679359 | Ga0207711_106793591 | 104 |
| 507 | 3300025942 | Ga0207689_10004545 | Ga0207689_100045452 | 104 |
| 508 | 3300025942 | Ga0207689_10033646 | Ga0207689_100336463 | 104 |
| 509 | 3300025942 | Ga0207689_10085901 | Ga0207689_100859014 | 104 |
| 510 | 3300025942 | Ga0207689_10429384 | Ga0207689_104293842 | 104 |
| 511 | 3300025942 | Ga0207689_10489486 | Ga0207689_104894862 | 104 |
| 512 | 3300025942 | Ga0207689_10906656 | Ga0207689_109066562 | 104 |
| 513 | 3300025945 | Ga0207679_10014101 | Ga0207679_100141013 | 104 |
| 514 | 3300025945 | Ga0207679_10027742 | Ga0207679_100277421 | 104 |
| 515 | 3300025945 | Ga0207679_10406656 | Ga0207679_104066562 | 104 |
| 516 | 3300025945 | Ga0207679_10959356 | Ga0207679_109593561 | 104 |
| 517 | 3300025949 | Ga0207667_10268859 | Ga0207667_102688592 | 104 |
| 518 | 3300025960 | Ga0207651_10149145 | Ga0207651_101491452 | 104 |
| 519 | 3300025961 | Ga0207712_10012759 | Ga0207712_100127595 | 104 |
| 520 | 3300025961 | Ga0207712_10324269 | Ga0207712_103242692 | 104 |
| 521 | 3300025961 | Ga0207712_10437150 | Ga0207712_104371501 | 104 |
| 522 | 3300025972 | Ga0207668_10195352 | Ga0207668_101953523 | 104 |
| 523 | 3300025972 | Ga0207668_10746790 | Ga0207668_107467902 | 104 |
| 524 | 3300025972 | Ga0207668_10823305 | Ga0207668_108233052 | 104 |
| 525 | 3300025972 | Ga0207668_11376149 | Ga0207668_113761492 | 104 |
| 526 | 3300025981 | Ga0207640_10034004 | Ga0207640_100340043 | 104 |
| 527 | 3300025981 | Ga0207640_11374650 | Ga0207640_113746501 | 104 |
| 528 | 3300025981 | Ga0207640_11987127 | Ga0207640_119871271 | 104 |
| 529 | 3300025986 | Ga0207658_10131514 | Ga0207658_101315144 | 104 |
| 530 | 3300025986 | Ga0207658_10336016 | Ga0207658_103360161 | 104 |
| 531 | 3300026023 | Ga0207677_10115026 | Ga0207677_101150263 | 104 |
| 532 | 3300026023 | Ga0207677_10145675 | Ga0207677_101456751 | 104 |
| 533 | 3300026023 | Ga0207677_10222458 | Ga0207677_102224582 | 104 |
| 534 | 3300026023 | Ga0207677_10266038 | Ga0207677_102660383 | 104 |
| 535 | 3300026023 | Ga0207677_10941541 | Ga0207677_109415412 | 104 |
| 536 | 3300026023 | Ga0207677_12042850 | Ga0207677_120428501 | 104 |
| 537 | 3300026035 | Ga0207703_10007019 | Ga0207703_100070194 | 104 |
| 538 | 3300026035 | Ga0207703_10030057 | Ga0207703_100300574 | 104 |
| 539 | 3300026035 | Ga0207703_10082021 | Ga0207703_100820212 | 104 |
| 540 | 3300026035 | Ga0207703_11127699 | Ga0207703_111276992 | 104 |
| 541 | 3300026041 | Ga0207639_10149650 | Ga0207639_101496501 | 104 |
| 542 | 3300026041 | Ga0207639_10179667 | Ga0207639_101796673 | 104 |
| 543 | 3300026041 | Ga0207639_10705694 | Ga0207639_107056941 | 104 |
| 544 | 3300026041 | Ga0207639_10778829 | Ga0207639_107788291 | 104 |
| 545 | 3300026067 | Ga0207678_10096695 | Ga0207678_100966952 | 104 |
| 546 | 3300026067 | Ga0207678_11159704 | Ga0207678_111597042 | 104 |
| 547 | 3300026067 | Ga0207678_11867935 | Ga0207678_118679351 | 104 |
| 548 | 3300026075 | Ga0207708_10207224 | Ga0207708_102072242 | 104 |
| 549 | 3300026075 | Ga0207708_10415548 | Ga0207708_104155482 | 104 |
| 550 | 3300026078 | Ga0207702_10103204 | Ga0207702_101032042 | 104 |
| 551 | 3300026088 | Ga0207641_10164548 | Ga0207641_101645482 | 104 |
| 552 | 3300026088 | Ga0207641_10249101 | Ga0207641_102491012 | 104 |
| 553 | 3300026088 | Ga0207641_10644546 | Ga0207641_106445461 | 104 |
| 554 | 3300026088 | Ga0207641_11148261 | Ga0207641_111482612 | 104 |
| 555 | 3300026088 | Ga0207641_11341846 | Ga0207641_113418461 | 104 |
| 556 | 3300026088 | Ga0207641_12037479 | Ga0207641_120374791 | 104 |
| 557 | 3300026089 | Ga0207648_10000432 | Ga0207648_100004326 | 104 |
| 558 | 3300026089 | Ga0207648_10023486 | Ga0207648_100234866 | 104 |
| 559 | 3300026089 | Ga0207648_10369553 | Ga0207648_103695532 | 104 |
| 560 | 3300026089 | Ga0207648_10573319 | Ga0207648_105733192 | 104 |
| 561 | 3300026089 | Ga0207648_12020357 | Ga0207648_120203572 | 104 |
| 562 | 3300026095 | Ga0207676_10046399 | Ga0207676_100463992 | 104 |
| 563 | 3300026095 | Ga0207676_10115994 | Ga0207676_101159942 | 104 |
| 564 | 3300026095 | Ga0207676_10250913 | Ga0207676_102509132 | 104 |
| 565 | 3300026095 | Ga0207676_10283029 | Ga0207676_102830292 | 104 |
| 566 | 3300026095 | Ga0207676_10413278 | Ga0207676_104132782 | 104 |
| 567 | 3300026095 | Ga0207676_11876739 | Ga0207676_118767392 | 104 |
| 568 | 3300026116 | Ga0207674_10047879 | Ga0207674_100478795 | 104 |
| 569 | 3300026116 | Ga0207674_10058004 | Ga0207674_100580045 | 104 |
| 570 | 3300026116 | Ga0207674_10132716 | Ga0207674_101327162 | 104 |
| 571 | 3300026116 | Ga0207674_10294773 | Ga0207674_102947732 | 104 |
| 572 | 3300026116 | Ga0207674_10330443 | Ga0207674_103304432 | 104 |
| 573 | 3300026116 | Ga0207674_10745138 | Ga0207674_107451382 | 104 |
| 574 | 3300026116 | Ga0207674_11131998 | Ga0207674_111319981 | 104 |
| 575 | 3300026118 | Ga0207675_100001061 | Ga0207675_10000106122 | 104 |
| 576 | 3300026118 | Ga0207675_100005869 | Ga0207675_1000058696 | 104 |
| 577 | 3300026118 | Ga0207675_100012122 | Ga0207675_1000121228 | 104 |
| 578 | 3300026118 | Ga0207675_100118514 | Ga0207675_1001185143 | 104 |
| 579 | 3300026118 | Ga0207675_100317199 | Ga0207675_1003171993 | 104 |
| 580 | 3300026118 | Ga0207675_100577216 | Ga0207675_1005772162 | 104 |
| 581 | 3300026121 | Ga0207683_10032553 | Ga0207683_100325532 | 104 |
| 582 | 3300026121 | Ga0207683_10049686 | Ga0207683_100496865 | 104 |
| 583 | 3300026121 | Ga0207683_10091800 | Ga0207683_100918002 | 104 |
| 584 | 3300026121 | Ga0207683_10254244 | Ga0207683_102542441 | 104 |
| 585 | 3300026121 | Ga0207683_10330256 | Ga0207683_103302562 | 104 |
| 586 | 3300026121 | Ga0207683_10791864 | Ga0207683_107918642 | 104 |
| 587 | 3300026121 | Ga0207683_11970816 | Ga0207683_119708162 | 104 |
| 588 | 3300026142 | Ga0207698_10092126 | Ga0207698_100921262 | 104 |
| 589 | 3300026142 | Ga0207698_10623127 | Ga0207698_106231272 | 104 |
| 590 | 3300026142 | Ga0207698_10807692 | Ga0207698_108076922 | 104 |
| 591 | 3300026142 | Ga0207698_12703072 | Ga0207698_127030722 | 104 |
| 592 | 3300027378 | Ga0209981_1081966 | Ga0209981_10819661 | 104 |
| 593 | 3300027512 | Ga0209179_1032041 | Ga0209179_10320412 | 104 |
| 594 | 3300027671 | Ga0209588_1003812 | Ga0209588_10038121 | 104 |
| 595 | 3300027671 | Ga0209588_1123605 | Ga0209588_11236052 | 104 |
| 596 | 3300027866 | Ga0209813_10137154 | Ga0209813_101371542 | 104 |
| 597 | 3300027907 | Ga0207428_10000488 | Ga0207428_1000048848 | 104 |
| 598 | 3300027907 | Ga0207428_10006456 | Ga0207428_100064567 | 104 |
| 599 | 3300027907 | Ga0207428_10086949 | Ga0207428_100869494 | 104 |
| 600 | 3300027907 | Ga0207428_10252419 | Ga0207428_102524192 | 104 |
| 601 | 3300027907 | Ga0207428_10364837 | Ga0207428_103648372 | 104 |
| 602 | 3300028379 | Ga0268266_10006491 | Ga0268266_100064918 | 104 |
| 603 | 3300028379 | Ga0268266_10015202 | Ga0268266_100152026 | 104 |
| 604 | 3300028379 | Ga0268266_10053579 | Ga0268266_100535792 | 104 |
| 605 | 3300028379 | Ga0268266_10139264 | Ga0268266_101392642 | 104 |
| 606 | 3300028379 | Ga0268266_10270874 | Ga0268266_102708741 | 104 |
| 607 | 3300028379 | Ga0268266_10391515 | Ga0268266_103915152 | 104 |
| 608 | 3300028379 | Ga0268266_10919199 | Ga0268266_109191992 | 104 |
| 609 | 3300028379 | Ga0268266_11594596 | Ga0268266_115945962 | 104 |
| 610 | 3300028379 | Ga0268266_11724832 | Ga0268266_117248321 | 104 |
| 611 | 3300028379 | Ga0268266_11819507 | Ga0268266_118195071 | 104 |
| 612 | 3300028380 | Ga0268265_10003020 | Ga0268265_100030209 | 104 |
| 613 | 3300028380 | Ga0268265_10030478 | Ga0268265_100304786 | 104 |
| 614 | 3300028380 | Ga0268265_10111601 | Ga0268265_101116012 | 104 |
| 615 | 3300028380 | Ga0268265_10118729 | Ga0268265_101187292 | 104 |
| 616 | 3300028380 | Ga0268265_10132270 | Ga0268265_101322702 | 104 |
| 617 | 3300028380 | Ga0268265_10897386 | Ga0268265_108973862 | 104 |
| 618 | 3300028381 | Ga0268264_10032350 | Ga0268264_100323507 | 104 |
| 619 | 3300028381 | Ga0268264_10392360 | Ga0268264_103923602 | 104 |
| 620 | 3300028381 | Ga0268264_10635797 | Ga0268264_106357972 | 104 |
| 621 | 3300028381 | Ga0268264_11444434 | Ga0268264_114444341 | 104 |
| 622 | 3300028573 | Ga0265334_10036290 | Ga0265334_100362902 | 104 |
| 623 | 3300028573 | Ga0265334_10103029 | Ga0265334_101030292 | 104 |
| 624 | 3300028794 | Ga0307515_10058169 | Ga0307515_100581693 | 104 |
| 625 | 3300028794 | Ga0307515_10685122 | Ga0307515_106851221 | 104 |
| 626 | 3300028800 | Ga0265338_10008007 | Ga0265338_100080073 | 104 |
| 627 | 3300031238 | Ga0265332_10014006 | Ga0265332_100140062 | 104 |
| 628 | 3300031240 | Ga0265320_10001360 | Ga0265320_100013608 | 104 |
| 629 | 3300031240 | Ga0265320_10019444 | Ga0265320_100194441 | 104 |
| 630 | 3300031249 | Ga0265339_10001746 | Ga0265339_1000174612 | 104 |
| 631 | 3300031249 | Ga0265339_10140729 | Ga0265339_101407291 | 104 |
| 632 | 3300031250 | Ga0265331_10219177 | Ga0265331_102191771 | 104 |
| 633 | 3300031456 | Ga0307513_10280185 | Ga0307513_102801852 | 104 |
| 634 | 3300031507 | Ga0307509_10899079 | Ga0307509_108990792 | 104 |
| 635 | 3300031548 | Ga0307408_100382177 | Ga0307408_1003821772 | 104 |
| 636 | 3300031548 | Ga0307408_100514829 | Ga0307408_1005148291 | 104 |
| 637 | 3300031548 | Ga0307408_100819413 | Ga0307408_1008194131 | 104 |
| 638 | 3300031548 | Ga0307408_100925122 | Ga0307408_1009251222 | 104 |
| 639 | 3300031616 | Ga0307508_10018485 | Ga0307508_100184852 | 104 |
| 640 | 3300031649 | Ga0307514_10112879 | Ga0307514_101128793 | 104 |
| 641 | 3300031711 | Ga0265314_10005944 | Ga0265314_100059446 | 104 |
| 642 | 3300031730 | Ga0307516_10002339 | Ga0307516_1000233919 | 104 |
| 643 | 3300031730 | Ga0307516_10563554 | Ga0307516_105635541 | 104 |
| 644 | 3300031730 | Ga0307516_10894284 | Ga0307516_108942841 | 104 |
| 645 | 3300031731 | Ga0307405_10575747 | Ga0307405_105757472 | 104 |
| 646 | 3300031731 | Ga0307405_10629642 | Ga0307405_106296422 | 104 |
| 647 | 3300031824 | Ga0307413_10136072 | Ga0307413_101360722 | 104 |
| 648 | 3300031901 | Ga0307406_10276104 | Ga0307406_102761042 | 104 |
| 649 | 3300031901 | Ga0307406_11305768 | Ga0307406_113057681 | 104 |
| 650 | 3300031911 | Ga0307412_10324612 | Ga0307412_103246122 | 104 |
| 651 | 3300031911 | Ga0307412_10426790 | Ga0307412_104267902 | 104 |
| 652 | 3300031911 | Ga0307412_10572230 | Ga0307412_105722302 | 104 |
| 653 | 3300032002 | Ga0307416_100231067 | Ga0307416_1002310675 | 104 |
| 654 | 3300032002 | Ga0307416_100930614 | Ga0307416_1009306142 | 104 |
| 655 | 3300032002 | Ga0307416_101314481 | Ga0307416_1013144811 | 104 |
| 656 | 3300032126 | Ga0307415_100144839 | Ga0307415_1001448392 | 104 |
| 657 | 3300032126 | Ga0307415_100438602 | Ga0307415_1004386021 | 104 |
| 658 | 3300032126 | Ga0307415_101399229 | Ga0307415_1013992291 | 104 |
| 659 | 3300032126 | Ga0307415_102011422 | Ga0307415_1020114222 | 104 |
| 660 | 3300032137 | Ga0316585_10250683 | Ga0316585_102506831 | 104 |
| 661 | 3300033180 | Ga0307510_10000003 | Ga0307510_10000003346 | 104 |
| 662 | 3300033180 | Ga0307510_10044313 | Ga0307510_100443132 | 104 |
| 663 | 3300033180 | Ga0307510_10079078 | Ga0307510_100790782 | 104 |
| 664 | 3300033180 | Ga0307510_10437551 | Ga0307510_104375511 | 104 |
| 665 | 3300034816 | Ga0373930_0099159 | Ga0373930_0099159_355_681 | 104 |
| 666 | 3300034817 | Ga0373948_0095558 | Ga0373948_0095558_103_429 | 104 |
| 667 | 3300034819 | Ga0373958_0006070 | Ga0373958_0006070_182_508 | 104 |
| 668 | 3300034820 | Ga0373959_0077933 | Ga0373959_0077933_246_572 | 104 |
| 669 | 3300034957 | Ga0373938_0018205 | Ga0373938_0018205_542_868 | 104 |
| 670 | 3300035083 | Ga0373926_0338748 | Ga0373926_0338748_114_434 | 104 |
| 671 | 3300035084 | Ga0373928_0032388 | Ga0373928_0032388_360_686 | 104 |
| 672 | 3300035085 | Ga0373929_0018417 | Ga0373929_0018417_1032_1358 | 104 |
| 673 | 3300035086 | Ga0373934_0494830 | Ga0373934_0494830_41_355 | 104 |
| 674 | 3300035088 | Ga0373940_0018758 | Ga0373940_0018758_366_692 | 104 |
| 675 | 3300035111 | Ga0373923_0010330 | Ga0373923_0010330_2813_3127 | 104 |
| 676 | 3300035113 | Ga0373936_0005826 | Ga0373936_0005826_1956_2276 | 104 |
| 677 | 3300035113 | Ga0373936_0007502 | Ga0373936_0007502_3766_4080 | 104 |
| 678 | 3300035113 | Ga0373936_0422933 | Ga0373936_0422933_28_348 | 104 |
| 679 | 3300035113 | Ga0373936_0495698 | Ga0373936_0495698_66_386 | 104 |
| 680 | 3300035114 | Ga0373939_0002559 | Ga0373939_0002559_875_1201 | 104 |
| 681 | 3300035115 | Ga0373941_0003464 | Ga0373941_0003464_535_861 | 104 |
| 682 | 3300035116 | Ga0373945_0390621 | Ga0373945_0390621_66_380 | 104 |
| 683 | 3300035119 | Ga0373956_0102116 | Ga0373956_0102116_115_429 | 104 |
| 684 | 3300035119 | Ga0373956_0528165 | Ga0373956_0528165_88_408 | 104 |
| 685 | 3300035120 | Ga0373957_0452451 | Ga0373957_0452451_184_504 | 104 |
| 686 | 3300035170 | Ga0373943_0062876 | Ga0373943_0062876_1324_1638 | 104 |
| 687 | 3300035171 | Ga0373946_0022789 | Ga0373946_0022789_1787_2101 | 104 |
| 688 | 3300035172 | Ga0373955_0059558 | Ga0373955_0059558_322_636 | 104 |
| 689 | 3300035242 | Ga0373962_0031214 | Ga0373962_0031214_720_1046 | 104 |
| 690 | 3300035691 | Ga0373931_0233356 | Ga0373931_0233356_441_767 | 104 |
| 691 | 3300035691 | Ga0373931_0266228 | Ga0373931_0266228_24_344 | 104 |
| 692 | 3300035692 | Ga0373935_0009132 | Ga0373935_0009132_3727_4041 | 104 |
| 693 | 3300035695 | Ga0373927_0021742 | Ga0373927_0021742_1393_1707 | 104 |
| 694 | 3300035724 | Ga0373933_0110429 | Ga0373933_0110429_352_666 | 104 |
| 695 | 3300035725 | Ga0373947_0012031 | Ga0373947_0012031_171_485 | 104 |
| 696 | 3300035725 | Ga0373947_0747442 | Ga0373947_0747442_248_562 | 104 |
| 697 | 3300036401 | Ga0373937_0026247 | Ga0373937_0026247_353_667 | 104 |
| 698 | 3300036401 | Ga0373937_0049344 | Ga0373937_0049344_690_1007 | 104 |
| 699 | 3300036401 | Ga0373937_0724448 | Ga0373937_0724448_87_401 | 104 |
| 700 | 3300037068 | Ga0373925_0002595 | Ga0373925_0002595_11953_12267 | 104 |
| 701 | 3300037068 | Ga0373925_0122685 | Ga0373925_0122685_307_621 | 104 |
| 702 | 3300037068 | Ga0373925_1748264 | Ga0373925_1748264_51_365 | 104 |
| 703 | 3300037312 | Ga0395899_0096381 | Ga0395899_0096381_457_774 | 104 |
| 704 | 3300037418 | Ga0395900_0005356 | Ga0395900_0005356_9515_9832 | 104 |
| 705 | 3300037466 | Ga0395898_0024771 | Ga0395898_0024771_3848_4165 | 104 |
| 706 | 3300037588 | Ga0316581_0063173 | Ga0316581_0063173_199_528 | 104 |
| 707 | 3300037853 | Ga0436364_0548762 | Ga0436364_0548762_986_1306 | 104 |
| 708 | 3300038443 | Ga0395901_0030126 | Ga0395901_0030126_680_997 | 104 |
| 709 | 3300039450 | Ga0436363_0643674 | Ga0436363_0643674_96_419 | 104 |
| 710 | 3300039450 | Ga0436363_1313640 | Ga0436363_1313640_605_922 | 104 |
| 711 | 3300041443 | Ga0451789_1264309 | Ga0451789_1264309_272_586 | 104 |
| 712 | 3300041451 | Ga0451791_0375005 | Ga0451791_0375005_311_625 | 104 |
| 713 | 3300041456 | Ga0451795_0385379 | Ga0451795_0385379_125_439 | 104 |
| 714 | 3300041459 | Ga0451800_0948311 | Ga0451800_0948311_736_1056 | 104 |
| 715 | 3300041486 | Ga0451807_1959945 | Ga0451807_1959945_83_403 | 104 |
| 716 | 3300041494 | Ga0451837_1392969 | Ga0451837_1392969_105_422 | 104 |
| 717 | 3300041509 | Ga0451843_1228507 | Ga0451843_1228507_30_350 | 104 |
| 718 | 3300042004 | Ga0439445_0221988 | Ga0439445_0221988_164_529 | 104 |
| 719 | 3300042008 | Ga0439450_079960 | Ga0439450_079960_59_379 | 104 |
| 720 | 3300042012 | Ga0439455_0108498 | Ga0439455_0108498_125_445 | 104 |
| 721 | 3300042016 | Ga0439463_080894 | Ga0439463_080894_101_421 | 104 |
| 722 | 3300042134 | Ga0450898_138334 | Ga0450898_138334_95_478 | 104 |
| 723 | 3300042876 | Ga0451577_0720641 | Ga0451577_0720641_487_813 | 104 |
| 724 | 3300042876 | Ga0451577_1359605 | Ga0451577_1359605_23_340 | 104 |
| 725 | 3300044658 | Ga0466972_0198093 | Ga0466972_0198093_370_684 | 104 |
| 726 | 3300044683 | Ga0466965_0116046 | Ga0466965_0116046_406_720 | 104 |
| 727 | 3300044684 | Ga0466966_0640214 | Ga0466966_0640214_96_413 | 104 |
| 728 | 3300044712 | Ga0453684_0011849 | Ga0453684_0011849_1196_1510 | 104 |
| 729 | 3300044901 | Ga0466960_0110049 | Ga0466960_0110049_803_1117 | 104 |
| 730 | 3300045051 | Ga0451576_0069529 | Ga0451576_0069529_678_998 | 104 |
| 731 | 3300045051 | Ga0451576_0102078 | Ga0451576_0102078_2051_2377 | 104 |
| 732 | 3300045051 | Ga0451576_0183919 | Ga0451576_0183919_129_449 | 104 |
| 733 | 3300045051 | Ga0451576_0200295 | Ga0451576_0200295_1319_1645 | 104 |
| 734 | 3300045051 | Ga0451576_0831166 | Ga0451576_0831166_231_545 | 104 |
| 735 | 3300045051 | Ga0451576_1106872 | Ga0451576_1106872_356_673 | 104 |
| 736 | 3300046455 | Ga0495603_0004320 | Ga0495603_0004320_6573_6887 | 104 |
| 737 | 3300046455 | Ga0495603_0149309 | Ga0495603_0149309_477_791 | 104 |
| 738 | 3300046455 | Ga0495603_0477827 | Ga0495603_0477827_267_581 | 104 |
| 739 | 3300046459 | Ga0495629_0008693 | Ga0495629_0008693_313_627 | 104 |
| 740 | 3300046462 | Ga0495651_0257749 | Ga0495651_0257749_157_471 | 104 |
| 741 | 3300046463 | Ga0495653_0392990 | Ga0495653_0392990_190_504 | 104 |
| 742 | 3300046471 | Ga0495650_0006812 | Ga0495650_0006812_2819_3133 | 104 |
| 743 | 3300046472 | Ga0495580_0373740 | Ga0495580_0373740_158_472 | 104 |
| 744 | 3300046473 | Ga0495582_0381248 | Ga0495582_0381248_451_765 | 104 |
| 745 | 3300046475 | Ga0495639_0005290 | Ga0495639_0005290_353_667 | 104 |
| 746 | 3300046476 | Ga0495662_0002831 | Ga0495662_0002831_7651_7965 | 104 |
| 747 | 3300046477 | Ga0495664_0124050 | Ga0495664_0124050_916_1230 | 104 |
| 748 | 3300046477 | Ga0495664_0863097 | Ga0495664_0863097_95_424 | 104 |
| 749 | 3300046491 | Ga0495584_0012037 | Ga0495584_0012037_2431_2745 | 104 |
| 750 | 3300046499 | Ga0495594_0004642 | Ga0495594_0004642_2619_2933 | 104 |
| 751 | 3300046514 | Ga0495618_0341962 | Ga0495618_0341962_109_423 | 104 |
| 752 | 3300046516 | Ga0495628_0075786 | Ga0495628_0075786_258_572 | 104 |
| 753 | 3300046517 | Ga0495630_0120953 | Ga0495630_0120953_29_343 | 104 |
| 754 | 3300046518 | Ga0495631_0230968 | Ga0495631_0230968_315_629 | 104 |
| 755 | 3300046522 | Ga0495643_0151729 | Ga0495643_0151729_494_808 | 104 |
| 756 | 3300046524 | Ga0495648_0157081 | Ga0495648_0157081_272_595 | 104 |
| 757 | 3300046525 | Ga0495663_0001798 | Ga0495663_0001798_1418_1732 | 104 |
| 758 | 3300046526 | Ga0495666_0026030 | Ga0495666_0026030_301_615 | 104 |
| 759 | 3300046529 | Ga0495652_0110824 | Ga0495652_0110824_1730_2044 | 104 |
| 760 | 3300046529 | Ga0495652_0877735 | Ga0495652_0877735_233_547 | 104 |
| 761 | 3300046531 | Ga0495665_0040106 | Ga0495665_0040106_1194_1508 | 104 |
| 762 | 3300046533 | Ga0495640_0013286 | Ga0495640_0013286_5439_5753 | 104 |
| 763 | 3300046538 | Ga0495609_0454163 | Ga0495609_0454163_155_469 | 104 |
| 764 | 3300046539 | Ga0495621_0418449 | Ga0495621_0418449_183_497 | 104 |
| 765 | 3300046542 | Ga0495597_0012386 | Ga0495597_0012386_636_950 | 104 |
| 766 | 3300046557 | Ga0495622_0027653 | Ga0495622_0027653_2110_2424 | 104 |
| 767 | 3300046557 | Ga0495622_0264880 | Ga0495622_0264880_275_589 | 104 |
| 768 | 3300046558 | Ga0495633_0432210 | Ga0495633_0432210_247_573 | 104 |
| 769 | 3300046559 | Ga0495667_0022396 | Ga0495667_0022396_237_551 | 104 |
| 770 | 3300046615 | Ga0495656_0019194 | Ga0495656_0019194_2080_2394 | 104 |
| 771 | 3300046642 | Ga0495634_0003738 | Ga0495634_0003738_476_790 | 104 |
| 772 | 3300046660 | Ga0495625_0109517 | Ga0495625_0109517_809_1123 | 104 |
| 773 | 3300046663 | Ga0495635_0106186 | Ga0495635_0106186_314_628 | 104 |
| 774 | 3300046675 | Ga0495657_0445850 | Ga0495657_0445850_262_576 | 104 |
| 775 | 3300046678 | Ga0495599_0401040 | Ga0495599_0401040_214_528 | 104 |
| 776 | 3300046680 | Ga0495646_0030611 | Ga0495646_0030611_2914_3228 | 104 |
| 777 | 3300046683 | Ga0495658_0003784 | Ga0495658_0003784_6823_7137 | 104 |
| 778 | 3300046683 | Ga0495658_0771612 | Ga0495658_0771612_155_475 | 104 |
| 779 | 3300046684 | Ga0495669_0207793 | Ga0495669_0207793_88_408 | 104 |
| 780 | 3300046689 | Ga0495613_0007099 | Ga0495613_0007099_339_653 | 104 |
| 781 | 3300046690 | Ga0495624_0010071 | Ga0495624_0010071_3794_4108 | 104 |
| 782 | 3300046692 | Ga0495671_0636991 | Ga0495671_0636991_98_412 | 104 |
| 783 | 3300046809 | Ga0495600_0019190 | Ga0495600_0019190_1581_1895 | 104 |
| 784 | 3300047315 | Ga0495581_0009065 | Ga0495581_0009065_4022_4336 | 104 |
| 785 | 3300047318 | Ga0495636_0304774 | Ga0495636_0304774_98_412 | 104 |
| 786 | 3300047319 | Ga0495674_0000458 | Ga0495674_0000458_643_957 | 104 |
| 787 | 3300047321 | Ga0495676_0104327 | Ga0495676_0104327_1571_1885 | 104 |
| 788 | 3300047321 | Ga0495676_0515205 | Ga0495676_0515205_149_463 | 104 |
| 789 | 3300047322 | Ga0495680_0265905 | Ga0495680_0265905_75_389 | 104 |
| 790 | 3300047443 | Ga0495687_000454 | Ga0495687_000454_29308_29622 | 104 |
| 791 | 3300047444 | Ga0495675_0705539 | Ga0495675_0705539_10_330 | 104 |
| 792 | 3300047447 | Ga0495685_231901 | Ga0495685_231901_83_397 | 104 |
| 793 | 3300047471 | Ga0495684_0130956 | Ga0495684_0130956_1086_1400 | 104 |
| 794 | 3300047472 | Ga0495686_0003031 | Ga0495686_0003031_13705_14022 | 104 |
| 795 | 3300047673 | Ga0495593_0006332 | Ga0495593_0006332_353_667 | 104 |
| 796 | 3300048088 | Ga0495602_0754154 | Ga0495602_0754154_53_373 | 104 |
| 797 | 3300048088 | Ga0495602_0825171 | Ga0495602_0825171_172_486 | 104 |
| 798 | 3300048091 | Ga0495626_0436193 | Ga0495626_0436193_169_483 | 104 |
| 799 | 3300048905 | Ga0496102_0058118 | Ga0496102_0058118_1250_1573 | 104 |
| 800 | 3300048905 | Ga0496102_0331724 | Ga0496102_0331724_37_378 | 104 |
| 801 | 3300048906 | Ga0496103_0326736 | Ga0496103_0326736_585_908 | 104 |
| 802 | 3300048907 | Ga0496104_0029652 | Ga0496104_0029652_2337_2657 | 104 |
| 803 | 3300048907 | Ga0496104_0788326 | Ga0496104_0788326_139_462 | 104 |
| 804 | 3300048908 | Ga0496105_0771752 | Ga0496105_0771752_274_594 | 104 |
| 805 | 3300048909 | Ga0496106_0651112 | Ga0496106_0651112_436_783 | 104 |
| 806 | 3300048909 | Ga0496106_1205256 | Ga0496106_1205256_96_416 | 104 |
| 807 | 3300048909 | Ga0496106_1492006 | Ga0496106_1492006_62_385 | 104 |
| 808 | 3300048910 | Ga0496107_0149590 | Ga0496107_0149590_1188_1511 | 104 |
| 809 | 3300048911 | Ga0496108_1339466 | Ga0496108_1339466_244_561 | 104 |
| 810 | 3300048911 | Ga0496108_1781354 | Ga0496108_1781354_132_452 | 104 |
| 811 | 3300048912 | Ga0496109_0842128 | Ga0496109_0842128_506_826 | 104 |
| 812 | 3300048913 | Ga0496110_1039755 | Ga0496110_1039755_325_642 | 104 |
| 813 | 3300048914 | Ga0496111_0441284 | Ga0496111_0441284_152_472 | 104 |
| 814 | 3300048914 | Ga0496111_1298763 | Ga0496111_1298763_10_330 | 104 |
| 815 | 3300048915 | Ga0496112_0104538 | Ga0496112_0104538_207_527 | 104 |
| 816 | 3300048915 | Ga0496112_0387130 | Ga0496112_0387130_891_1211 | 104 |
| 817 | 3300048916 | Ga0496113_0246439 | Ga0496113_0246439_1040_1360 | 104 |
| 818 | 3300048917 | Ga0496114_0197286 | Ga0496114_0197286_418_738 | 104 |
| 819 | 3300048917 | Ga0496114_0278202 | Ga0496114_0278202_606_929 | 104 |
| 820 | 3300048918 | Ga0496115_0022861 | Ga0496115_0022861_4221_4541 | 104 |
| 821 | 3300048919 | Ga0496116_0048712 | Ga0496116_0048712_1818_2141 | 104 |
| 822 | 3300048920 | Ga0496117_0000186 | Ga0496117_0000186_81784_82107 | 104 |
| 823 | 3300048921 | Ga0496118_0000003 | Ga0496118_0000003_274375_274698 | 104 |
| 824 | 3300048922 | Ga0496119_0000260 | Ga0496119_0000260_3113_3436 | 104 |
| 825 | 3300048922 | Ga0496119_0004656 | Ga0496119_0004656_5658_5981 | 104 |
| 826 | 3300048923 | Ga0496120_0000165 | Ga0496120_0000165_17260_17583 | 104 |
| 827 | 3300048924 | Ga0496121_0031038 | Ga0496121_0031038_1918_2241 | 104 |
| 828 | 3300048928 | Ga0496125_0048807 | Ga0496125_0048807_204_527 | 104 |
| 829 | 3300048928 | Ga0496125_0181348 | Ga0496125_0181348_721_1044 | 104 |
| 830 | 3300048929 | Ga0496126_0067376 | Ga0496126_0067376_1441_1764 | 104 |
| 831 | 3300049460 | Ga0495682_0306830 | Ga0495682_0306830_67_381 | 104 |
| 832 | 3300049517 | Ga0501294_005142 | Ga0501294_005142_541_855 | 104 |
| 833 | 3300049517 | Ga0501294_033658 | Ga0501294_033658_152_472 | 104 |
| 834 | 3300049521 | Ga0501298_153835 | Ga0501298_153835_40_360 | 104 |
| 835 | 3300049521 | Ga0501298_163521 | Ga0501298_163521_146_466 | 104 |
| 836 | 3300049522 | Ga0501299_184142 | Ga0501299_184142_168_482 | 104 |
| 837 | 3300049524 | Ga0501301_007524 | Ga0501301_007524_342_656 | 104 |
| 838 | 3300049575 | Ga0501039_0791990 | Ga0501039_0791990_37_351 | 104 |
| 839 | 3300049587 | Ga0501071_0535482 | Ga0501071_0535482_307_651 | 104 |
| 840 | 3300049662 | Ga0501222_014548 | Ga0501222_014548_693_1007 | 104 |
| 841 | 3300049679 | Ga0501249_116985 | Ga0501249_116985_276_596 | 104 |
| 842 | 3300049683 | Ga0501253_015394 | Ga0501253_015394_253_573 | 104 |
| 843 | 3300049686 | Ga0501257_018973 | Ga0501257_018973_859_1173 | 104 |
| 844 | 3300049759 | Ga0501262_017818 | Ga0501262_017818_96_410 | 104 |
| 845 | 3300049779 | Ga0501283_027278 | Ga0501283_027278_553_873 | 104 |
| 846 | 3300049822 | Ga0501035_1560274 | Ga0501035_1560274_91_405 | 104 |
| 847 | 3300050489 | nmdc:mga03683_80241_c1 | nmdc:mga03683_80241_c1_975_1289 | 104 |
| 848 | 3300050490 | nmdc:mga03n38_187246_c1 | nmdc:mga03n38_187246_c1_531_845 | 104 |
| 849 | 3300050491 | nmdc:mga00v17_989833_c1 | nmdc:mga00v17_989833_c1_196_510 | 104 |
| 850 | 3300050492 | nmdc:mga0yw44_1204446_c1 | nmdc:mga0yw44_1204446_c1_74_388 | 104 |
| 851 | 3300050492 | nmdc:mga0yw44_245071_c1 | nmdc:mga0yw44_245071_c1_22_339 | 104 |
| 852 | 3300050492 | nmdc:mga0yw44_619129_c1 | nmdc:mga0yw44_619129_c1_64_381 | 104 |
| 853 | 3300050493 | nmdc:mga0k408_13787_c1 | nmdc:mga0k408_13787_c1_1963_2277 | 104 |
| 854 | 3300050493 | nmdc:mga0k408_430042_c1 | nmdc:mga0k408_430042_c1_196_510 | 104 |
| 855 | 3300050493 | nmdc:mga0k408_689959_c1 | nmdc:mga0k408_689959_c1_243_557 | 104 |
| 856 | 3300050495 | nmdc:mga04h51_145001_c1 | nmdc:mga04h51_145001_c1_387_701 | 104 |
| 857 | 3300050496 | nmdc:mga07m45_253237_c1 | nmdc:mga07m45_253237_c1_430_750 | 104 |
| 858 | 3300050496 | nmdc:mga07m45_60390_c1 | nmdc:mga07m45_60390_c1_412_726 | 104 |
| 859 | 3300050507 | nmdc:mga05p37_3871_c1 | nmdc:mga05p37_3871_c1_12532_12852 | 104 |
| 860 | 3300050507 | nmdc:mga05p37_456_c1 | nmdc:mga05p37_456_c1_36472_36798 | 104 |
| 861 | 3300050508 | nmdc:mga09592_250996_c1 | nmdc:mga09592_250996_c1_54_374 | 104 |
| 862 | 3300050508 | nmdc:mga09592_270908_c1 | nmdc:mga09592_270908_c1_302_622 | 104 |
| 863 | 3300050508 | nmdc:mga09592_31068_c1 | nmdc:mga09592_31068_c1_1896_2216 | 104 |
| 864 | 3300050508 | nmdc:mga09592_6064_c1 | nmdc:mga09592_6064_c1_5870_6196 | 104 |
| 865 | 3300050509 | nmdc:mga0qj67_1177_c1 | nmdc:mga0qj67_1177_c1_16326_16688 | 104 |
| 866 | 3300050509 | nmdc:mga0qj67_1546254_c1 | nmdc:mga0qj67_1546254_c1_32_352 | 104 |
| 867 | 3300050509 | nmdc:mga0qj67_15748_c1 | nmdc:mga0qj67_15748_c1_5208_5528 | 104 |
| 868 | 3300050509 | nmdc:mga0qj67_346216_c1 | nmdc:mga0qj67_346216_c1_655_975 | 104 |
| 869 | 3300050510 | nmdc:mga06r32_1668_c1 | nmdc:mga06r32_1668_c1_15742_16104 | 104 |
| 870 | 3300050510 | nmdc:mga06r32_5109_c1 | nmdc:mga06r32_5109_c1_2986_3306 | 104 |
| 871 | 3300050510 | nmdc:mga06r32_635938_c1 | nmdc:mga06r32_635938_c1_26_346 | 104 |
| 872 | 3300050510 | nmdc:mga06r32_9857_c1 | nmdc:mga06r32_9857_c1_3483_3803 | 104 |
| 873 | 3300050511 | nmdc:mga08y16_107607_c1 | nmdc:mga08y16_107607_c1_1725_2045 | 104 |
| 874 | 3300050511 | nmdc:mga08y16_15611_c1 | nmdc:mga08y16_15611_c1_6174_6494 | 104 |
| 875 | 3300050511 | nmdc:mga08y16_4744_c1 | nmdc:mga08y16_4744_c1_10314_10640 | 104 |
| 876 | 3300050511 | nmdc:mga08y16_62253_c1 | nmdc:mga08y16_62253_c1_1550_1870 | 104 |
| 877 | 3300050511 | nmdc:mga08y16_8343_c1 | nmdc:mga08y16_8343_c1_28_348 | 104 |
| 878 | 3300050511 | nmdc:mga08y16_8995_c1 | nmdc:mga08y16_8995_c1_1470_1790 | 104 |
| 879 | 3300050515 | nmdc:mga0a205_305996_c1 | nmdc:mga0a205_305996_c1_104_421 | 104 |
| 880 | 3300050516 | nmdc:mga0sz30_404072_c1 | nmdc:mga0sz30_404072_c1_72_386 | 104 |
| 881 | 3300053079 | Ga0500610_0264541 | Ga0500610_0264541_243_557 | 104 |
| 882 | 3300053083 | Ga0495655_0118333 | Ga0495655_0118333_93_410 | 104 |
| 883 | 3300053084 | Ga0495595_0007151 | Ga0495595_0007151_2018_2332 | 104 |
| 884 | 3300053085 | Ga0495619_0028832 | Ga0495619_0028832_1491_1805 | 104 |
| 885 | 3300053085 | Ga0495619_0048491 | Ga0495619_0048491_2227_2541 | 104 |
| 886 | 3300053085 | Ga0495619_0830978 | Ga0495619_0830978_150_470 | 104 |
| 887 | 3300053085 | Ga0495619_0935011 | Ga0495619_0935011_203_517 | 104 |
| 888 | 3300053092 | Ga0500583_0063396 | Ga0500583_0063396_505_819 | 104 |
| 889 | 3300053092 | Ga0500583_0327299 | Ga0500583_0327299_55_369 | 104 |
| 890 | 3300053093 | Ga0500651_0102863 | Ga0500651_0102863_41_355 | 104 |
| 891 | 3300053096 | Ga0500641_0043180 | Ga0500641_0043180_1371_1685 | 104 |
| 892 | 3300053106 | Ga0500558_210611 | Ga0500558_210611_225_548 | 104 |
| 893 | 3300053118 | Ga0500594_0072550 | Ga0500594_0072550_472_786 | 104 |
| 894 | 3300053119 | Ga0500595_021628 | Ga0500595_021628_65_379 | 104 |
| 895 | 3300053120 | Ga0500597_118444 | Ga0500597_118444_539_853 | 104 |
| 896 | 3300053129 | Ga0500628_072889 | Ga0500628_072889_72_389 | 104 |
| 897 | 3300053146 | Ga0500588_0006957 | Ga0500588_0006957_2055_2369 | 104 |
| 898 | 3300053146 | Ga0500588_0270202 | Ga0500588_0270202_230_544 | 104 |
| 899 | 3300053147 | Ga0500589_037001 | Ga0500589_037001_676_990 | 104 |
| 900 | 3300053151 | Ga0500604_0015642 | Ga0500604_0015642_871_1185 | 104 |
| 901 | 3300053162 | Ga0500638_195041 | Ga0500638_195041_200_514 | 104 |
| 902 | 3300053725 | Ga0500576_248229 | Ga0500576_248229_121_444 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bf4-assembly1.cif.gz_B | crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 a resolution | 0.9782 | 2 | 103 |
| 3bf4-assembly1.cif.gz_B | crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 a resolution | 0.9508 | 2 | 103 |
| 2ftr-assembly1.cif.gz_B | crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution | 0.7676 | 1 | 102 |
| 2ftr-assembly1.cif.gz_B | crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution | 0.7543 | 1 | 102 |
| 1si9-assembly1.cif.gz_A | boiling stable protein isolated from populus tremula | 0.7328 | 2 | 99 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bf4B01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9637 | 3 | 100 | 3.30.70.100 |
| 3bf4B01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.944 | 3 | 100 | 3.30.70.100 |
| 2pgcA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7237 | 2 | 102 | 3.30.70.100 |
| af_A0A1D6PLI0_180_283_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7232 | 2 | 102 | 3.30.70.100 |
| af_Q55CR9_1_97_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.721 | 2 | 102 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G8BRD0-F1-model_v4 | EthD family reductase | 0.9919 | 1 | 102 |
GO:0016491
|
| AF-F0BK37-F1-model_v4 | EthD domain-containing protein | 0.9917 | 2 | 104 |
GO:0016491
|
| AF-A0A2S7D7B8-F1-model_v4 | EthD family reductase | 0.9915 | 1 | 104 |
GO:0016491
|
| AF-A6E9T8-F1-model_v4 | Ethyl tert-butyl ether degradation EthD | 0.9914 | 1 | 103 |
GO:0016491
|
| AF-A0A0H2X9Q8-F1-model_v4 | EthD domain-containing protein | 0.9909 | 2 | 104 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar