F485215

General Info

Members Datasets Scaffolds Average Seq Length
902 418 902 105

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10291657|Ga0307513_102916572
Length 103
Sequence MIKVSVMYPNTPGARFDHDYYRTKHVPLVLARVGPSCKQHSVDKGLSGGGNAPALYAAMCHLHFDSVETFQADFGPHMKEIMADTPNYTDIAPVMQISEVVTV

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
209 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
214 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
232 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
233 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
234 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
235 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
236 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
237 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
238 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
239 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
240 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
246 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
256 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
265 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
269 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
270 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
271 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
272 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
273 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
274 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
275 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
276 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
277 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
278 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
279 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
282 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
283 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
299 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
300 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
305 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
306 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
307 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
310 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
311 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
312 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
315 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
316 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
317 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
344 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
363 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
364 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
369 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
370 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
371 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
377 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
378 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
379 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
380 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
381 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
388 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
389 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
400 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
401 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
402 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
403 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
404 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
405 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
406 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
407 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
408 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
409 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
410 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
411 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
412 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
413 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
414 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
415 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
416 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
417 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
418 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.87
Nodule 0
Rhizoplane 3.22
Rhizosphere 85.92
Stem 0
Stem Tuber 0
Unclassified 3.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10078175 3300002077 Bacteria 604
2 JGI25153J46596_10004955 3300003215 Bacteria 7074
3 rootH1_10170689 3300003323 Bacteria 1767
4 Ga0058859_10007278 3300004798 Bacteria 625
5 Ga0065712_10070708 3300005290 Bacteria 5771
6 Ga0065707_10087797 3300005295 Bacteria 4886
7 Ga0065707_10124122 3300005295 Bacteria 2045
8 Ga0070658_11341319 3300005327 Unclassified 621
9 Ga0070676_10006250 3300005328 Bacteria 6362
10 Ga0070676_10213058 3300005328 Bacteria 1272
11 Ga0070676_11301477 3300005328 Bacteria 555
12 Ga0070683_100221580 3300005329 Bacteria 1798
13 Ga0070683_101660997 3300005329 Bacteria 614
14 Ga0070690_100004845 3300005330 Bacteria 7512
15 Ga0070690_100032929 3300005330 Bacteria 3241
16 Ga0070670_100008902 3300005331 Bacteria 8569
17 Ga0070670_100120552 3300005331 Bacteria 2263
18 Ga0070670_100127330 3300005331 Bacteria 2198
19 Ga0070670_100295989 3300005331 Bacteria 1415
20 Ga0070670_100634107 3300005331 Bacteria 958
21 Ga0070670_101188779 3300005331 Bacteria 697
22 Ga0070677_10692932 3300005333 Bacteria 573
23 Ga0070677_10706178 3300005333 Bacteria 568
24 Ga0068869_100048516 3300005334 Bacteria 3071
25 Ga0068869_100072059 3300005334 Unclassified 2560
26 Ga0068869_100592476 3300005334 Bacteria 936
27 Ga0068869_100667532 3300005334 Bacteria 884
28 Ga0070666_10623468 3300005335 Bacteria 788
29 Ga0070680_100089415 3300005336 Bacteria 2548
30 Ga0070680_101560884 3300005336 Bacteria 572
31 Ga0070682_100649080 3300005337 Bacteria 840
32 Ga0068868_100327829 3300005338 Bacteria 1306
33 Ga0068868_100444394 3300005338 Bacteria 1127
34 Ga0068868_100491741 3300005338 Bacteria 1073
35 Ga0068868_100945002 3300005338 Bacteria 786
36 Ga0068868_101221872 3300005338 Bacteria 696
37 Ga0068868_101784677 3300005338 Bacteria 581
38 Ga0070660_100738975 3300005339 Bacteria 826
39 Ga0070689_100002318 3300005340 Bacteria 12394
40 Ga0070687_100001735 3300005343 Bacteria 7848
41 Ga0070687_100132426 3300005343 Bacteria 1441
42 Ga0070687_100379197 3300005343 Bacteria 921
43 Ga0070661_100080340 3300005344 Bacteria 2407
44 Ga0070661_100519668 3300005344 Bacteria 955
45 Ga0070661_100896384 3300005344 Bacteria 732
46 Ga0070661_101672753 3300005344 Bacteria 539
47 Ga0070692_10196058 3300005345 Bacteria 1180
48 Ga0070692_11063170 3300005345 Bacteria 569
49 Ga0070668_100100711 3300005347 Bacteria 2289
50 Ga0070668_100679905 3300005347 Bacteria 906
51 Ga0070669_100032396 3300005353 Bacteria 3775
52 Ga0070669_100137207 3300005353 Bacteria 1882
53 Ga0070669_100190119 3300005353 Bacteria 1610
54 Ga0070675_100592230 3300005354 Bacteria 1005
55 Ga0070675_101159412 3300005354 Unclassified 711
56 Ga0070671_100030098 3300005355 Bacteria 4480
57 Ga0070671_100197809 3300005355 Bacteria 1704
58 Ga0070674_100283453 3300005356 Bacteria 1314
59 Ga0070674_100326027 3300005356 Bacteria 1233
60 Ga0070674_100720985 3300005356 Bacteria 854
61 Ga0070673_100000317 3300005364 Bacteria 25361
62 Ga0070673_100118429 3300005364 Bacteria 2205
63 Ga0070673_100949121 3300005364 Bacteria 799
64 Ga0070673_101171633 3300005364 Bacteria 719
65 Ga0070688_100001119 3300005365 Bacteria 13408
66 Ga0070688_100506878 3300005365 Bacteria 911
67 Ga0070659_100482370 3300005366 Bacteria 1055
68 Ga0070659_100873661 3300005366 Bacteria 785
69 Ga0070667_100122916 3300005367 Bacteria 2260
70 Ga0070667_100192544 3300005367 Bacteria 1807
71 Ga0070667_101388834 3300005367 Bacteria 659
72 Ga0070667_101809994 3300005367 Bacteria 575
73 Ga0070703_10101445 3300005406 Bacteria 1015
74 Ga0070709_10014614 3300005434 Bacteria 4444
75 Ga0070714_100020507 3300005435 Bacteria 5398
76 Ga0070713_100017912 3300005436 Bacteria 5373
77 Ga0070713_100037196 3300005436 Bacteria 3935
78 Ga0070710_10532322 3300005437 Bacteria 809
79 Ga0070701_10007594 3300005438 Bacteria 4644
80 Ga0070701_11353664 3300005438 Unclassified 510
81 Ga0070711_100112338 3300005439 Bacteria 2002
82 Ga0070711_100116643 3300005439 Unclassified 1968
83 Ga0070705_100232057 3300005440 Bacteria 1284
84 Ga0070705_100599646 3300005440 Bacteria 852
85 Ga0070705_100840726 3300005440 Bacteria 734
86 Ga0070700_100567998 3300005441 Bacteria 884
87 Ga0070700_100756833 3300005441 Bacteria 778
88 Ga0070694_100147625 3300005444 Bacteria 1714
89 Ga0070708_100210457 3300005445 Bacteria 1822
90 Ga0070663_100873917 3300005455 Bacteria 775
91 Ga0070678_100031268 3300005456 Bacteria 3669
92 Ga0070678_100278101 3300005456 Bacteria 1414
93 Ga0070678_100337502 3300005456 Bacteria 1292
94 Ga0070678_101527101 3300005456 Bacteria 626
95 Ga0070662_100002863 3300005457 Bacteria 10699
96 Ga0070662_100025780 3300005457 Bacteria 4064
97 Ga0070681_10026906 3300005458 Bacteria 5783
98 Ga0070681_11180454 3300005458 Bacteria 687
99 Ga0068867_100016517 3300005459 Bacteria 5242
100 Ga0068867_100311574 3300005459 Bacteria 1301
101 Ga0068867_100467944 3300005459 Bacteria 1077
102 Ga0070685_10103872 3300005466 Bacteria 1739
103 Ga0070707_100648113 3300005468 Bacteria 1019
104 Ga0070707_101905168 3300005468 Unclassified 562
105 Ga0070698_101734982 3300005471 Unclassified 577
106 Ga0070679_100153455 3300005530 Bacteria 2279
107 Ga0070679_100582983 3300005530 Bacteria 1062
108 Ga0070684_100006100 3300005535 Bacteria 9284
109 Ga0070697_100917531 3300005536 Bacteria 777
110 Ga0068853_100111272 3300005539 Bacteria 2433
111 Ga0068853_100118015 3300005539 Bacteria 2364
112 Ga0068853_100237294 3300005539 Bacteria 1670
113 Ga0068853_100885631 3300005539 Bacteria 857
114 Ga0068853_101548891 3300005539 Bacteria 642
115 Ga0070672_100070580 3300005543 Bacteria 2776
116 Ga0070672_100142954 3300005543 Bacteria 1975
117 Ga0070672_100698845 3300005543 Bacteria 888
118 Ga0070686_100002445 3300005544 Bacteria 10235
119 Ga0070686_100095174 3300005544 Bacteria 2000
120 Ga0070686_100484324 3300005544 Bacteria 957
121 Ga0070686_101804248 3300005544 Bacteria 521
122 Ga0070695_101563217 3300005545 Unclassified 550
123 Ga0070696_100001844 3300005546 Bacteria 13919
124 Ga0070696_100075441 3300005546 Bacteria 2379
125 Ga0070696_100504633 3300005546 Bacteria 963
126 Ga0070696_100612777 3300005546 Unclassified 879
127 Ga0070696_101120139 3300005546 Bacteria 662
128 Ga0070665_100031487 3300005548 Bacteria 5339
129 Ga0070665_100101282 3300005548 Bacteria 2884
130 Ga0070665_100390388 3300005548 Bacteria 1399
131 Ga0070665_100447285 3300005548 Bacteria 1301
132 Ga0070665_100659316 3300005548 Bacteria 1059
133 Ga0070665_100780351 3300005548 Bacteria 968
134 Ga0070665_100790015 3300005548 Bacteria 962
135 Ga0070665_100941862 3300005548 Bacteria 876
136 Ga0070665_101482845 3300005548 Bacteria 687
137 Ga0070704_100359716 3300005549 Unclassified 1231
138 Ga0070704_100403677 3300005549 Bacteria 1167
139 Ga0068855_100407207 3300005563 Bacteria 1490
140 Ga0070664_100008545 3300005564 Bacteria 8281
141 Ga0070664_100016232 3300005564 Bacteria 6104
142 Ga0070664_100474321 3300005564 Bacteria 1151
143 Ga0070664_100963799 3300005564 Unclassified 801
144 Ga0068857_100014969 3300005577 Bacteria 6766
145 Ga0068857_100040174 3300005577 Bacteria 4148
146 Ga0068857_100117239 3300005577 Bacteria 2396
147 Ga0068857_100153872 3300005577 Bacteria 2085
148 Ga0068857_101061684 3300005577 Bacteria 781
149 Ga0068854_100017705 3300005578 Bacteria 4772
150 Ga0068854_100236014 3300005578 Bacteria 1454
151 Ga0068856_100128803 3300005614 Bacteria 2535
152 Ga0070702_100273293 3300005615 Bacteria 1156
153 Ga0070702_100446992 3300005615 Bacteria 937
154 Ga0068852_100032511 3300005616 Bacteria 4321
155 Ga0068852_100098682 3300005616 Bacteria 2631
156 Ga0068852_100827561 3300005616 Bacteria 941
157 Ga0068852_101671631 3300005616 Bacteria 659
158 Ga0068859_100173238 3300005617 Bacteria 2240
159 Ga0068859_100295362 3300005617 Bacteria 1713
160 Ga0068859_100368076 3300005617 Bacteria 1533
161 Ga0068859_100401341 3300005617 Bacteria 1467
162 Ga0068859_101393798 3300005617 Bacteria 773
163 Ga0068864_100002908 3300005618 Bacteria 14161
164 Ga0068864_100050437 3300005618 Bacteria 3582
165 Ga0068864_100115144 3300005618 Bacteria 2398
166 Ga0068864_100524099 3300005618 Bacteria 1143
167 Ga0068866_10043985 3300005718 Bacteria 2232
168 Ga0068866_10602610 3300005718 Bacteria 742
169 Ga0068866_10771041 3300005718 Bacteria 666
170 Ga0068861_100002630 3300005719 Bacteria 11742
171 Ga0068861_100003108 3300005719 Bacteria 10977
172 Ga0068861_100005158 3300005719 Bacteria 8814
173 Ga0068861_101662371 3300005719 Bacteria 631
174 Ga0068861_102071787 3300005719 Bacteria 568
175 Ga0068851_10193840 3300005834 Bacteria 1131
176 Ga0068870_10019848 3300005840 Bacteria 3265
177 Ga0068870_10248240 3300005840 Bacteria 1102
178 Ga0068863_100000209 3300005841 Bacteria 62481
179 Ga0068863_100208951 3300005841 Bacteria 1879
180 Ga0068863_100621586 3300005841 Bacteria 1070
181 Ga0068863_100900125 3300005841 Bacteria 885
182 Ga0068863_101535979 3300005841 Bacteria 674
183 Ga0068863_102398743 3300005841 Bacteria 537
184 Ga0068858_100022830 3300005842 Bacteria 5835
185 Ga0068858_100367161 3300005842 Bacteria 1380
186 Ga0068858_100407605 3300005842 Bacteria 1307
187 Ga0068860_100004201 3300005843 Bacteria 14760
188 Ga0068860_100006195 3300005843 Bacteria 12029
189 Ga0068860_100234346 3300005843 Bacteria 1784
190 Ga0068860_100446568 3300005843 Unclassified 1285
191 Ga0068860_100863446 3300005843 Bacteria 920
192 Ga0068860_101168643 3300005843 Bacteria 790
193 Ga0068860_101617348 3300005843 Bacteria 670
194 Ga0068862_100003257 3300005844 Bacteria 14041
195 Ga0068862_100027941 3300005844 Bacteria 4751
196 Ga0068862_100031016 3300005844 Bacteria 4508
197 Ga0068862_100088646 3300005844 Bacteria 2692
198 Ga0068862_100155300 3300005844 Bacteria 2039
199 Ga0068862_100549435 3300005844 Bacteria 1103
200 Ga0068862_101848142 3300005844 Bacteria 614
201 Ga0068862_102355716 3300005844 Bacteria 544
202 Ga0081455_10643142 3300005937 Bacteria 684
203 Ga0081538_10115786 3300005981 Bacteria 1302
204 Ga0070717_10017129 3300006028 Bacteria 5630
205 Ga0070717_11559210 3300006028 Unclassified 599
206 Ga0075365_10077303 3300006038 Bacteria 2249
207 Ga0075365_10091811 3300006038 Bacteria 2069
208 Ga0075365_10374454 3300006038 Bacteria 1004
209 Ga0075365_10469943 3300006038 Bacteria 888
210 Ga0075365_10563383 3300006038 Bacteria 806
211 Ga0075368_10168323 3300006042 Bacteria 920
212 Ga0075363_100132018 3300006048 Bacteria 1401
213 Ga0075363_100189867 3300006048 Bacteria 1172
214 Ga0075363_100789954 3300006048 Bacteria 577
215 Ga0075363_100822275 3300006048 Bacteria 566
216 Ga0075364_10335443 3300006051 Bacteria 1030
217 Ga0075364_10482137 3300006051 Bacteria 848
218 Ga0070715_10581806 3300006163 Unclassified 653
219 Ga0070716_100198022 3300006173 Bacteria 1333
220 Ga0070716_100559606 3300006173 Bacteria 854
221 Ga0070712_100128934 3300006175 Bacteria 1915
222 Ga0075362_10036702 3300006177 Bacteria 2145
223 Ga0075362_10036902 3300006177 Bacteria 2140
224 Ga0075367_10027825 3300006178 Bacteria 3220
225 Ga0075367_10081052 3300006178 Bacteria 1964
226 Ga0075367_10294902 3300006178 Bacteria 1020
227 Ga0075367_10575263 3300006178 Bacteria 716
228 Ga0075367_10849788 3300006178 Bacteria 582
229 Ga0075369_10209065 3300006186 Bacteria 902
230 Ga0075369_10216384 3300006186 Bacteria 886
231 Ga0075366_10557513 3300006195 Bacteria 710
232 Ga0097621_100323789 3300006237 Bacteria 1366
233 Ga0097621_100646784 3300006237 Bacteria 970
234 Ga0097621_101144361 3300006237 Bacteria 732
235 Ga0075370_10381044 3300006353 Bacteria 845
236 Ga0075370_10466376 3300006353 Bacteria 760
237 Ga0068871_100039747 3300006358 Bacteria 3766
238 Ga0068871_100662407 3300006358 Bacteria 954
239 Ga0068871_100855338 3300006358 Bacteria 841
240 Ga0068871_101642205 3300006358 Bacteria 609
241 Ga0075428_100003563 3300006844 Bacteria 17047
242 Ga0075428_100030049 3300006844 Bacteria 6010
243 Ga0075428_100057015 3300006844 Bacteria 4277
244 Ga0075428_100082305 3300006844 Bacteria 3512
245 Ga0075430_100010470 3300006846 Bacteria 7853
246 Ga0075430_100042080 3300006846 Bacteria 3864
247 Ga0075430_100138634 3300006846 Bacteria 2026
248 Ga0075431_100007733 3300006847 Bacteria 10708
249 Ga0075431_100162361 3300006847 Bacteria 2297
250 Ga0075431_100169172 3300006847 Bacteria 2246
251 Ga0075431_100575651 3300006847 Bacteria 1112
252 Ga0075433_10291462 3300006852 Bacteria 1445
253 Ga0075433_10335340 3300006852 Bacteria 1337
254 Ga0075429_100002556 3300006880 Bacteria 15332
255 Ga0075429_100003351 3300006880 Bacteria 13655
256 Ga0075429_100005811 3300006880 Bacteria 10643
257 Ga0075429_100061828 3300006880 Bacteria 3263
258 Ga0075429_100596375 3300006880 Bacteria 968
259 Ga0068865_100003091 3300006881 Bacteria 9960
260 Ga0068865_100085945 3300006881 Bacteria 2270
261 Ga0068865_100893305 3300006881 Bacteria 772
262 Ga0075436_100046567 3300006914 Bacteria 2991
263 Ga0097620_100173249 3300006931 Bacteria 2240
264 Ga0097620_100295374 3300006931 Bacteria 1713
265 Ga0097620_100368087 3300006931 Bacteria 1533
266 Ga0097620_100401321 3300006931 Bacteria 1467
267 Ga0097620_100995713 3300006931 Bacteria 920
268 Ga0097620_101393835 3300006931 Bacteria 773
269 Ga0075435_100239069 3300007076 Bacteria 1544
270 Ga0075435_100285628 3300007076 Bacteria 1409
271 Ga0099794_10148152 3300007265 Bacteria 1191
272 Ga0105240_10066942 3300009093 Bacteria 4454
273 Ga0105240_10129094 3300009093 Bacteria 3034
274 Ga0105240_10171492 3300009093 Bacteria 2569
275 Ga0105240_10319425 3300009093 Bacteria 1770
276 Ga0105240_11223714 3300009093 Bacteria 794
277 Ga0105240_11461706 3300009093 Bacteria 717
278 Ga0105240_12161646 3300009093 Bacteria 577
279 Ga0111539_10006979 3300009094 Bacteria 14494
280 Ga0111539_10086104 3300009094 Bacteria 3693
281 Ga0111539_10096982 3300009094 Bacteria 3463
282 Ga0111539_10167080 3300009094 Bacteria 2571
283 Ga0111539_10268477 3300009094 Bacteria 1986
284 Ga0105245_10200038 3300009098 Bacteria 1918
285 Ga0105245_10362686 3300009098 Bacteria 1438
286 Ga0105245_10510353 3300009098 Bacteria 1219
287 Ga0105245_12630657 3300009098 Bacteria 556
288 Ga0105247_10032863 3300009101 Bacteria 3153
289 Ga0105247_10437767 3300009101 Bacteria 940
290 Ga0114129_10000190 3300009147 Bacteria 69084
291 Ga0114129_10043388 3300009147 Bacteria 6327
292 Ga0114129_10044795 3300009147 Bacteria 6223
293 Ga0105243_10017116 3300009148 Bacteria 5482
294 Ga0105243_10046246 3300009148 Bacteria 3423
295 Ga0105243_11566660 3300009148 Bacteria 684
296 Ga0105243_12409622 3300009148 Bacteria 565
297 Ga0105243_12646343 3300009148 Bacteria 542
298 Ga0105241_10011183 3300009174 Bacteria 6583
299 Ga0105241_10337158 3300009174 Bacteria 1305
300 Ga0105241_10565549 3300009174 Bacteria 1023
301 Ga0105241_10896366 3300009174 Bacteria 823
302 Ga0105241_11227678 3300009174 Bacteria 711
303 Ga0105241_11236630 3300009174 Bacteria 709
304 Ga0105241_11374575 3300009174 Bacteria 675
305 Ga0105241_11589162 3300009174 Bacteria 632
306 Ga0105241_11966339 3300009174 Bacteria 575
307 Ga0105241_12386144 3300009174 Bacteria 528
308 Ga0105242_10039640 3300009176 Bacteria 3792
309 Ga0105242_10069305 3300009176 Bacteria 2921
310 Ga0105242_10257036 3300009176 Bacteria 1576
311 Ga0105242_11151006 3300009176 Bacteria 792
312 Ga0105248_10001641 3300009177 Bacteria 24873
313 Ga0105248_10284928 3300009177 Bacteria 1860
314 Ga0105248_11568671 3300009177 Bacteria 746
315 Ga0105237_10022435 3300009545 Bacteria 6476
316 Ga0105237_10222058 3300009545 Bacteria 1889
317 Ga0105237_10349554 3300009545 Bacteria 1483
318 Ga0105237_10380643 3300009545 Bacteria 1416
319 Ga0105237_10496501 3300009545 Bacteria 1227
320 Ga0105237_10892310 3300009545 Bacteria 896
321 Ga0105237_12649822 3300009545 Bacteria 512
322 Ga0105238_10110557 3300009551 Bacteria 2729
323 Ga0105238_10137943 3300009551 Bacteria 2417
324 Ga0105238_10182868 3300009551 Bacteria 2073
325 Ga0105238_10404518 3300009551 Bacteria 1358
326 Ga0105238_11620165 3300009551 Bacteria 677
327 Ga0105238_11681949 3300009551 Bacteria 665
328 Ga0105249_10006407 3300009553 Bacteria 10235
329 Ga0105249_10008962 3300009553 Bacteria 8740
330 Ga0105249_10043781 3300009553 Bacteria 4072
331 Ga0105249_10044664 3300009553 Bacteria 4029
332 Ga0099796_10293484 3300010159 Bacteria 687
333 Ga0105239_10004648 3300010375 Bacteria 16320
334 Ga0105239_10349631 3300010375 Bacteria 1669
335 Ga0105239_10492626 3300010375 Bacteria 1393
336 Ga0105239_10568606 3300010375 Bacteria 1292
337 Ga0105239_10651175 3300010375 Bacteria 1203
338 Ga0105239_10931150 3300010375 Bacteria 998
339 Ga0105239_11085294 3300010375 Bacteria 921
340 Ga0105239_11397329 3300010375 Bacteria 808
341 Ga0105246_10070976 3300011119 Bacteria 2451
342 Ga0105246_10144409 3300011119 Bacteria 1794
343 Ga0105246_10547618 3300011119 Bacteria 991
344 Ga0105246_10553993 3300011119 Bacteria 986
345 Ga0105246_12116713 3300011119 Bacteria 546
346 Ga0157369_11075906 3300013105 Bacteria 822
347 Ga0157374_10016443 3300013296 Bacteria 6504
348 Ga0157374_10052960 3300013296 Bacteria 3782
349 Ga0157374_10342113 3300013296 Bacteria 1485
350 Ga0157374_10867361 3300013296 Bacteria 920
351 Ga0157378_10002071 3300013297 Bacteria 17952
352 Ga0157378_11834741 3300013297 Bacteria 655
353 Ga0163162_10050059 3300013306 Bacteria 4189
354 Ga0163162_10056528 3300013306 Bacteria 3952
355 Ga0163162_10100678 3300013306 Bacteria 2981
356 Ga0163162_10179297 3300013306 Bacteria 2244
357 Ga0163162_10561966 3300013306 Bacteria 1268
358 Ga0163162_12222513 3300013306 Bacteria 630
359 Ga0163162_12989558 3300013306 Bacteria 543
360 Ga0157372_11703019 3300013307 Bacteria 725
361 Ga0157375_10025378 3300013308 Bacteria 5506
362 Ga0157375_10185639 3300013308 Bacteria 2232
363 Ga0157375_11108616 3300013308 Bacteria 927
364 Ga0163163_10036850 3300014325 Bacteria 4753
365 Ga0163163_10091453 3300014325 Bacteria 3057
366 Ga0163163_10101945 3300014325 Bacteria 2893
367 Ga0163163_10403616 3300014325 Bacteria 1425
368 Ga0163163_11190762 3300014325 Bacteria 824
369 Ga0163163_12557002 3300014325 Bacteria 568
370 Ga0163163_12689405 3300014325 Bacteria 555
371 Ga0157380_10091197 3300014326 Bacteria 2515
372 Ga0157380_10314326 3300014326 Bacteria 1449
373 Ga0157380_11481259 3300014326 Bacteria 731
374 Ga0157380_11608155 3300014326 Bacteria 705
375 Ga0157380_12466707 3300014326 Bacteria 586
376 Ga0157377_10114695 3300014745 Bacteria 1624
377 Ga0157377_11483003 3300014745 Bacteria 538
378 Ga0157379_10854697 3300014968 Bacteria 861
379 Ga0157376_10024119 3300014969 Bacteria 4771
380 Ga0157376_10207021 3300014969 Bacteria 1809
381 Ga0157376_10764025 3300014969 Bacteria 977
382 Ga0157376_10843013 3300014969 Bacteria 932
383 Ga0157376_11952922 3300014969 Bacteria 624
384 Ga0163161_10520032 3300017792 Bacteria 972
385 Ga0163161_10863978 3300017792 Bacteria 764
386 Ga0213872_10003293 3300021361 Bacteria 9011
387 Ga0213874_10194768 3300021377 Unclassified 726
388 Ga0207425_1053565 3300025245 Bacteria 730
389 Ga0209129_1030275 3300025258 Bacteria 907
390 Ga0209758_1001140 3300025297 Bacteria 34073
391 Ga0207656_10073397 3300025321 Bacteria 1525
392 Ga0207682_10057209 3300025893 Bacteria 1625
393 Ga0207692_10352849 3300025898 Bacteria 907
394 Ga0207642_10022482 3300025899 Bacteria 2502
395 Ga0207642_10033949 3300025899 Bacteria 2164
396 Ga0207642_10040147 3300025899 Bacteria 2040
397 Ga0207710_10027246 3300025900 Bacteria 2473
398 Ga0207710_10135298 3300025900 Bacteria 1186
399 Ga0207710_10637799 3300025900 Bacteria 557
400 Ga0207688_10317166 3300025901 Bacteria 956
401 Ga0207688_10331588 3300025901 Bacteria 935
402 Ga0207688_10398430 3300025901 Bacteria 853
403 Ga0207688_10992972 3300025901 Bacteria 531
404 Ga0207680_10197579 3300025903 Bacteria 1369
405 Ga0207647_10353229 3300025904 Bacteria 832
406 Ga0207699_11416195 3300025906 Unclassified 514
407 Ga0207645_10005536 3300025907 Bacteria 9141
408 Ga0207645_10097880 3300025907 Bacteria 1891
409 Ga0207645_10129302 3300025907 Bacteria 1643
410 Ga0207643_10004975 3300025908 Bacteria 7111
411 Ga0207643_10043790 3300025908 Bacteria 2526
412 Ga0207705_10079520 3300025909 Bacteria 2388
413 Ga0207707_10014510 3300025912 Bacteria 6860
414 Ga0207695_10390788 3300025913 Bacteria 1276
415 Ga0207695_10484489 3300025913 Bacteria 1119
416 Ga0207671_10037840 3300025914 Bacteria 3577
417 Ga0207671_10092271 3300025914 Bacteria 2283
418 Ga0207671_10298619 3300025914 Bacteria 1272
419 Ga0207671_10334291 3300025914 Bacteria 1200
420 Ga0207671_10507995 3300025914 Bacteria 961
421 Ga0207671_10536744 3300025914 Bacteria 932
422 Ga0207671_11541164 3300025914 Bacteria 512
423 Ga0207693_10106838 3300025915 Bacteria 2196
424 Ga0207663_10911491 3300025916 Unclassified 703
425 Ga0207660_10021907 3300025917 Bacteria 4302
426 Ga0207660_11020511 3300025917 Bacteria 675
427 Ga0207662_10006753 3300025918 Bacteria 6206
428 Ga0207662_10027055 3300025918 Bacteria 3311
429 Ga0207657_10611922 3300025919 Bacteria 850
430 Ga0207649_10379711 3300025920 Bacteria 1053
431 Ga0207649_10479764 3300025920 Bacteria 943
432 Ga0207652_10122145 3300025921 Bacteria 2318
433 Ga0207652_10657776 3300025921 Bacteria 937
434 Ga0207652_11845057 3300025921 Bacteria 510
435 Ga0207646_10751061 3300025922 Bacteria 870
436 Ga0207681_10027647 3300025923 Bacteria 3669
437 Ga0207681_10046892 3300025923 Bacteria 2908
438 Ga0207681_10072030 3300025923 Bacteria 2412
439 Ga0207681_10778058 3300025923 Bacteria 799
440 Ga0207694_10187604 3300025924 Bacteria 1679
441 Ga0207694_10201244 3300025924 Bacteria 1620
442 Ga0207694_10258752 3300025924 Bacteria 1425
443 Ga0207694_10804681 3300025924 Bacteria 794
444 Ga0207694_11030138 3300025924 Bacteria 697
445 Ga0207650_10012000 3300025925 Bacteria 5973
446 Ga0207650_10032210 3300025925 Bacteria 3792
447 Ga0207650_10073807 3300025925 Bacteria 2570
448 Ga0207650_10078116 3300025925 Bacteria 2503
449 Ga0207650_10330608 3300025925 Bacteria 1250
450 Ga0207650_10588159 3300025925 Bacteria 935
451 Ga0207650_10698509 3300025925 Bacteria 857
452 Ga0207650_11358069 3300025925 Bacteria 605
453 Ga0207659_10419440 3300025926 Bacteria 1122
454 Ga0207687_10337985 3300025927 Bacteria 1223
455 Ga0207687_10922442 3300025927 Bacteria 748
456 Ga0207687_11056798 3300025927 Bacteria 697
457 Ga0207700_10047179 3300025928 Bacteria 3191
458 Ga0207664_10024200 3300025929 Bacteria 4562
459 Ga0207644_10017849 3300025931 Bacteria 4799
460 Ga0207690_10985449 3300025932 Bacteria 701
461 Ga0207706_10001958 3300025933 Bacteria 20196
462 Ga0207706_10019028 3300025933 Bacteria 6178
463 Ga0207706_10305936 3300025933 Bacteria 1384
464 Ga0207686_10192762 3300025934 Bacteria 1454
465 Ga0207686_10961472 3300025934 Bacteria 692
466 Ga0207709_10058920 3300025935 Bacteria 2388
467 Ga0207670_10890042 3300025936 Bacteria 745
468 Ga0207669_10106591 3300025937 Bacteria 1867
469 Ga0207669_10710684 3300025937 Bacteria 827
470 Ga0207669_10983605 3300025937 Bacteria 708
471 Ga0207704_10007178 3300025938 Bacteria 5245
472 Ga0207704_10204329 3300025938 Bacteria 1448
473 Ga0207665_10005554 3300025939 Bacteria 8410
474 Ga0207665_10336428 3300025939 Bacteria 1136
475 Ga0207691_10076321 3300025940 Bacteria 3020
476 Ga0207691_10083409 3300025940 Bacteria 2869
477 Ga0207691_10611832 3300025940 Bacteria 922
478 Ga0207691_10894955 3300025940 Bacteria 743
479 Ga0207711_10053812 3300025941 Bacteria 3452
480 Ga0207711_10471911 3300025941 Bacteria 1169
481 Ga0207711_10679359 3300025941 Bacteria 960
482 Ga0207689_10004545 3300025942 Bacteria 12559
483 Ga0207689_10033646 3300025942 Bacteria 4258
484 Ga0207689_10085901 3300025942 Unclassified 2586
485 Ga0207689_10429384 3300025942 Bacteria 1103
486 Ga0207689_10489486 3300025942 Bacteria 1030
487 Ga0207689_10906656 3300025942 Bacteria 744
488 Ga0207689_11313035 3300025942 Bacteria 608
489 Ga0207661_10967268 3300025944 Bacteria 784
490 Ga0207679_10014101 3300025945 Bacteria 5245
491 Ga0207679_10027742 3300025945 Bacteria 3920
492 Ga0207679_10406656 3300025945 Bacteria 1198
493 Ga0207679_10959356 3300025945 Bacteria 783
494 Ga0207667_10268859 3300025949 Bacteria 1743
495 Ga0207651_10149145 3300025960 Bacteria 1818
496 Ga0207712_10012759 3300025961 Bacteria 5371
497 Ga0207712_10324269 3300025961 Bacteria 1272
498 Ga0207712_10437150 3300025961 Bacteria 1107
499 Ga0207668_10195352 3300025972 Bacteria 1607
500 Ga0207668_10746790 3300025972 Bacteria 863
501 Ga0207668_10823305 3300025972 Bacteria 823
502 Ga0207668_11376149 3300025972 Bacteria 636
503 Ga0207640_10034004 3300025981 Bacteria 3177
504 Ga0207640_11374650 3300025981 Bacteria 632
505 Ga0207640_11987127 3300025981 Bacteria 527
506 Ga0207658_10131514 3300025986 Bacteria 2011
507 Ga0207658_10336016 3300025986 Bacteria 1312
508 Ga0207677_10115026 3300026023 Bacteria 2012
509 Ga0207677_10145675 3300026023 Bacteria 1820
510 Ga0207677_10222458 3300026023 Bacteria 1515
511 Ga0207677_10266038 3300026023 Bacteria 1400
512 Ga0207677_10316149 3300026023 Bacteria 1296
513 Ga0207677_10941541 3300026023 Bacteria 781
514 Ga0207677_12042850 3300026023 Bacteria 533
515 Ga0207703_10007019 3300026035 Bacteria 8960
516 Ga0207703_10030057 3300026035 Bacteria 4291
517 Ga0207703_10082021 3300026035 Bacteria 2690
518 Ga0207703_11127699 3300026035 Bacteria 754
519 Ga0207639_10149650 3300026041 Bacteria 1954
520 Ga0207639_10179667 3300026041 Bacteria 1799
521 Ga0207639_10705694 3300026041 Bacteria 936
522 Ga0207639_10778829 3300026041 Bacteria 891
523 Ga0207678_10096695 3300026067 Bacteria 2524
524 Ga0207678_11159704 3300026067 Bacteria 684
525 Ga0207678_11867935 3300026067 Bacteria 525
526 Ga0207708_10207224 3300026075 Bacteria 1566
527 Ga0207708_10415548 3300026075 Bacteria 1115
528 Ga0207702_10103204 3300026078 Bacteria 2521
529 Ga0207641_10164548 3300026088 Bacteria 2019
530 Ga0207641_10249101 3300026088 Bacteria 1658
531 Ga0207641_10644546 3300026088 Bacteria 1040
532 Ga0207641_11148261 3300026088 Bacteria 776
533 Ga0207641_11341846 3300026088 Bacteria 716
534 Ga0207641_12037479 3300026088 Bacteria 575
535 Ga0207648_10000432 3300026089 Bacteria 46265
536 Ga0207648_10023486 3300026089 Bacteria 5523
537 Ga0207648_10369553 3300026089 Bacteria 1295
538 Ga0207648_10573319 3300026089 Bacteria 1038
539 Ga0207648_12020357 3300026089 Bacteria 538
540 Ga0207676_10046399 3300026095 Bacteria 3362
541 Ga0207676_10115994 3300026095 Bacteria 2249
542 Ga0207676_10250913 3300026095 Bacteria 1593
543 Ga0207676_10283029 3300026095 Bacteria 1506
544 Ga0207676_10413278 3300026095 Bacteria 1264
545 Ga0207676_11876739 3300026095 Bacteria 598
546 Ga0207674_10047879 3300026116 Bacteria 4380
547 Ga0207674_10058004 3300026116 Bacteria 3924
548 Ga0207674_10132716 3300026116 Bacteria 2453
549 Ga0207674_10294773 3300026116 Bacteria 1571
550 Ga0207674_10330443 3300026116 Bacteria 1474
551 Ga0207674_10745138 3300026116 Bacteria 945
552 Ga0207674_11131998 3300026116 Bacteria 752
553 Ga0207675_100001061 3300026118 Bacteria 27272
554 Ga0207675_100005869 3300026118 Bacteria 11724
555 Ga0207675_100012122 3300026118 Bacteria 8054
556 Ga0207675_100118514 3300026118 Bacteria 2503
557 Ga0207675_100317199 3300026118 Bacteria 1521
558 Ga0207675_100577216 3300026118 Bacteria 1126
559 Ga0207675_101290544 3300026118 Bacteria 750
560 Ga0207683_10032553 3300026121 Bacteria 4529
561 Ga0207683_10049686 3300026121 Bacteria 3673
562 Ga0207683_10091800 3300026121 Bacteria 2705
563 Ga0207683_10254244 3300026121 Bacteria 1604
564 Ga0207683_10330256 3300026121 Bacteria 1398
565 Ga0207683_10791864 3300026121 Bacteria 880
566 Ga0207683_11970816 3300026121 Bacteria 532
567 Ga0207698_10092126 3300026142 Bacteria 2483
568 Ga0207698_10623127 3300026142 Bacteria 1066
569 Ga0207698_10807692 3300026142 Bacteria 940
570 Ga0207698_12703072 3300026142 Bacteria 505
571 Ga0209981_1081966 3300027378 Bacteria 503
572 Ga0209179_1032041 3300027512 Bacteria 1082
573 Ga0209588_1003812 3300027671 Bacteria 4206
574 Ga0209588_1123605 3300027671 Bacteria 827
575 Ga0209813_10137154 3300027866 Bacteria 865
576 Ga0207428_10000488 3300027907 Bacteria 47436
577 Ga0207428_10006456 3300027907 Bacteria 10830
578 Ga0207428_10086949 3300027907 Bacteria 2432
579 Ga0207428_10252419 3300027907 Bacteria 1315
580 Ga0207428_10364837 3300027907 Bacteria 1061
581 Ga0268266_10006491 3300028379 Bacteria 10706
582 Ga0268266_10015202 3300028379 Bacteria 6609
583 Ga0268266_10053579 3300028379 Bacteria 3466
584 Ga0268266_10139264 3300028379 Bacteria 2177
585 Ga0268266_10270874 3300028379 Bacteria 1576
586 Ga0268266_10391515 3300028379 Bacteria 1312
587 Ga0268266_10919199 3300028379 Bacteria 846
588 Ga0268266_11594596 3300028379 Bacteria 628
589 Ga0268266_11724832 3300028379 Bacteria 601
590 Ga0268266_11819507 3300028379 Bacteria 583
591 Ga0268265_10003020 3300028380 Bacteria 12279
592 Ga0268265_10030478 3300028380 Bacteria 3885
593 Ga0268265_10111601 3300028380 Bacteria 2233
594 Ga0268265_10118729 3300028380 Bacteria 2175
595 Ga0268265_10132270 3300028380 Bacteria 2075
596 Ga0268265_10897386 3300028380 Bacteria 870
597 Ga0268264_10032350 3300028381 Bacteria 4291
598 Ga0268264_10392360 3300028381 Bacteria 1332
599 Ga0268264_10635797 3300028381 Unclassified 1055
600 Ga0268264_11444434 3300028381 Bacteria 698
601 Ga0265334_10036290 3300028573 Bacteria 1947
602 Ga0265334_10103029 3300028573 Bacteria 1031
603 Ga0307517_10064623 3300028786 Bacteria 3399
604 Ga0307515_10058169 3300028794 Bacteria 5574
605 Ga0307515_10685122 3300028794 Bacteria 640
606 Ga0265338_10008007 3300028800 Bacteria 12937
607 Ga0265332_10014006 3300031238 Bacteria 3549
608 Ga0265320_10001360 3300031240 Bacteria 17822
609 Ga0265320_10019444 3300031240 Bacteria 3714
610 Ga0265339_10001746 3300031249 Bacteria 16003
611 Ga0265339_10140729 3300031249 Bacteria 1227
612 Ga0265331_10219177 3300031250 Bacteria 855
613 Ga0307513_10280185 3300031456 Bacteria 1445
614 Ga0307513_10291657 3300031456 Bacteria 1403
615 Ga0307509_10899079 3300031507 Bacteria 550
616 Ga0307408_100382177 3300031548 Bacteria 1204
617 Ga0307408_100514829 3300031548 Bacteria 1050
618 Ga0307408_100819413 3300031548 Bacteria 846
619 Ga0307408_100925122 3300031548 Bacteria 799
620 Ga0307508_10018485 3300031616 Bacteria 6335
621 Ga0307514_10112879 3300031649 Bacteria 1920
622 Ga0265314_10005944 3300031711 Bacteria 10905
623 Ga0307516_10002339 3300031730 Bacteria 25478
624 Ga0307516_10056562 3300031730 Unclassified 3825
625 Ga0307516_10563554 3300031730 Bacteria 793
626 Ga0307516_10894284 3300031730 Bacteria 554
627 Ga0307405_10575747 3300031731 Bacteria 915
628 Ga0307405_10629642 3300031731 Bacteria 879
629 Ga0307413_10136072 3300031824 Bacteria 1690
630 Ga0307406_10276104 3300031901 Bacteria 1279
631 Ga0307406_11305768 3300031901 Bacteria 633
632 Ga0307412_10324612 3300031911 Bacteria 1226
633 Ga0307412_10426790 3300031911 Bacteria 1086
634 Ga0307412_10572230 3300031911 Bacteria 952
635 Ga0307416_100231067 3300032002 Bacteria 1783
636 Ga0307416_100930614 3300032002 Bacteria 970
637 Ga0307416_101314481 3300032002 Bacteria 829
638 Ga0307415_100144839 3300032126 Bacteria 1820
639 Ga0307415_100438602 3300032126 Bacteria 1126
640 Ga0307415_101399229 3300032126 Bacteria 666
641 Ga0307415_102011422 3300032126 Bacteria 563
642 Ga0316585_10250683 3300032137 Bacteria 587
643 Ga0307510_10000003 3300033180 Bacteria 756654
644 Ga0307510_10044313 3300033180 Bacteria 4820
645 Ga0307510_10079078 3300033180 Bacteria 3210
646 Ga0307510_10437551 3300033180 Bacteria 749
647 Ga0373930_0099159 3300034816 Bacteria 691
648 Ga0373948_0095558 3300034817 Bacteria 694
649 Ga0373958_0006070 3300034819 Bacteria 1866
650 Ga0373959_0077933 3300034820 Bacteria 759
651 Ga0373938_0018205 3300034957 Bacteria 1391
652 Ga0373926_0338748 3300035083 Bacteria 590
653 Ga0373928_0032388 3300035084 Bacteria 1165
654 Ga0373929_0018417 3300035085 Bacteria 1387
655 Ga0373934_0494830 3300035086 Bacteria 514
656 Ga0373940_0018758 3300035088 Bacteria 1739
657 Ga0373949_0000363 3300035090 Bacteria 16040
658 Ga0373923_0010330 3300035111 Bacteria 3394
659 Ga0373936_0005826 3300035113 Bacteria 4640
660 Ga0373936_0007502 3300035113 Bacteria 4102
661 Ga0373936_0422933 3300035113 Bacteria 613
662 Ga0373936_0495698 3300035113 Bacteria 568
663 Ga0373939_0002559 3300035114 Bacteria 4276
664 Ga0373941_0003464 3300035115 Bacteria 3575
665 Ga0373945_0390621 3300035116 Bacteria 608
666 Ga0373956_0102116 3300035119 Bacteria 1331
667 Ga0373956_0528165 3300035119 Bacteria 563
668 Ga0373957_0452451 3300035120 Bacteria 556
669 Ga0373943_0062876 3300035170 Bacteria 1859
670 Ga0373946_0022789 3300035171 Bacteria 2441
671 Ga0373955_0059558 3300035172 Bacteria 2103
672 Ga0373962_0031214 3300035242 Bacteria 1461
673 Ga0373931_0233356 3300035691 Bacteria 1112
674 Ga0373931_0266228 3300035691 Bacteria 1048
675 Ga0373935_0009132 3300035692 Bacteria 5933
676 Ga0373927_0021742 3300035695 Bacteria 4204
677 Ga0373933_0110429 3300035724 Bacteria 1715
678 Ga0373947_0012031 3300035725 Bacteria 4956
679 Ga0373947_0747442 3300035725 Bacteria 667
680 Ga0373937_0026247 3300036401 Bacteria 5264
681 Ga0373937_0049344 3300036401 Bacteria 3855
682 Ga0373937_0724448 3300036401 Unclassified 942
683 Ga0316582_0617732 3300036647 Unclassified 746
684 Ga0373925_0002595 3300037068 Bacteria 14366
685 Ga0373925_0122685 3300037068 Bacteria 2018
686 Ga0373925_1748264 3300037068 Bacteria 507
687 Ga0395899_0096381 3300037312 Bacteria 2139
688 Ga0395900_0005356 3300037418 Bacteria 13446
689 Ga0395898_0024771 3300037466 Bacteria 6050
690 Ga0316581_0063173 3300037588 Bacteria 1137
691 Ga0436364_0195188 3300037853 Bacteria 981
692 Ga0436364_0548762 3300037853 Bacteria 1859
693 Ga0395901_0030126 3300038443 Bacteria 5589
694 Ga0436363_0358913 3300039450 Bacteria 4800
695 Ga0436363_0643674 3300039450 Bacteria 521
696 Ga0436363_1313640 3300039450 Bacteria 1073
697 Ga0451789_1264309 3300041443 Bacteria 740
698 Ga0451791_0375005 3300041451 Bacteria 728
699 Ga0451795_0385379 3300041456 Bacteria 650
700 Ga0451800_0948311 3300041459 Bacteria 1067
701 Ga0451807_1959945 3300041486 Bacteria 1322
702 Ga0451837_1392969 3300041494 Bacteria 577
703 Ga0451843_1228507 3300041509 Bacteria 540
704 Ga0439445_0221988 3300042004 Bacteria 561
705 Ga0439450_079960 3300042008 Bacteria 812
706 Ga0439455_0108498 3300042012 Bacteria 771
707 Ga0439463_080894 3300042016 Bacteria 835
708 Ga0450898_138334 3300042134 Bacteria 528
709 Ga0451577_0720641 3300042876 Bacteria 903
710 Ga0451577_1359605 3300042876 Bacteria 631
711 Ga0466972_0198093 3300044658 Bacteria 941
712 Ga0466965_0116046 3300044683 Bacteria 1379
713 Ga0466966_0640214 3300044684 Bacteria 640
714 Ga0453684_0011849 3300044712 Bacteria 14526
715 Ga0466960_0110049 3300044901 Bacteria 1430
716 Ga0451576_0069529 3300045051 Bacteria 3664
717 Ga0451576_0102078 3300045051 Bacteria 2983
718 Ga0451576_0183919 3300045051 Bacteria 2182
719 Ga0451576_0200295 3300045051 Bacteria 2085
720 Ga0451576_0831166 3300045051 Bacteria 970
721 Ga0451576_1106872 3300045051 Bacteria 829
722 Ga0466958_0869728 3300045836 Unclassified 588
723 Ga0495603_0004320 3300046455 Bacteria 8476
724 Ga0495603_0149309 3300046455 Bacteria 1358
725 Ga0495603_0477827 3300046455 Bacteria 714
726 Ga0495629_0008693 3300046459 Bacteria 7475
727 Ga0495651_0257749 3300046462 Bacteria 1188
728 Ga0495653_0392990 3300046463 Bacteria 883
729 Ga0495650_0006812 3300046471 Bacteria 7045
730 Ga0495580_0373740 3300046472 Bacteria 963
731 Ga0495582_0381248 3300046473 Bacteria 812
732 Ga0495639_0005290 3300046475 Bacteria 5553
733 Ga0495662_0002831 3300046476 Bacteria 8772
734 Ga0495664_0124050 3300046477 Bacteria 1562
735 Ga0495664_0863097 3300046477 Bacteria 530
736 Ga0495584_0012037 3300046491 Bacteria 4423
737 Ga0495594_0004642 3300046499 Bacteria 7076
738 Ga0495618_0341962 3300046514 Bacteria 923
739 Ga0495628_0075786 3300046516 Bacteria 2619
740 Ga0495630_0120953 3300046517 Bacteria 1986
741 Ga0495631_0230968 3300046518 Bacteria 789
742 Ga0495643_0151729 3300046522 Bacteria 1147
743 Ga0495648_0157081 3300046524 Bacteria 1180
744 Ga0495663_0001798 3300046525 Bacteria 6633
745 Ga0495666_0026030 3300046526 Bacteria 2887
746 Ga0495652_0110824 3300046529 Bacteria 2207
747 Ga0495652_0877735 3300046529 Bacteria 593
748 Ga0495665_0040106 3300046531 Bacteria 2493
749 Ga0495640_0013286 3300046533 Bacteria 6261
750 Ga0495609_0454163 3300046538 Bacteria 509
751 Ga0495621_0418449 3300046539 Bacteria 570
752 Ga0495597_0012386 3300046542 Bacteria 4115
753 Ga0495622_0027653 3300046557 Bacteria 2647
754 Ga0495622_0264880 3300046557 Bacteria 754
755 Ga0495633_0432210 3300046558 Bacteria 595
756 Ga0495667_0022396 3300046559 Bacteria 4256
757 Ga0495656_0019194 3300046615 Bacteria 2637
758 Ga0495634_0003738 3300046642 Bacteria 12123
759 Ga0495625_0109517 3300046660 Bacteria 1889
760 Ga0495635_0106186 3300046663 Bacteria 1918
761 Ga0495657_0445850 3300046675 Bacteria 758
762 Ga0495599_0401040 3300046678 Bacteria 817
763 Ga0495646_0030611 3300046680 Bacteria 3360
764 Ga0495658_0003784 3300046683 Bacteria 7489
765 Ga0495658_0771612 3300046683 Bacteria 615
766 Ga0495669_0207793 3300046684 Bacteria 937
767 Ga0495613_0007099 3300046689 Bacteria 8338
768 Ga0495624_0010071 3300046690 Bacteria 6523
769 Ga0495671_0636991 3300046692 Bacteria 507
770 Ga0495600_0019190 3300046809 Bacteria 4364
771 Ga0495581_0009065 3300047315 Bacteria 5755
772 Ga0495636_0304774 3300047318 Bacteria 746
773 Ga0495674_0000458 3300047319 Bacteria 36828
774 Ga0495672_0154080 3300047320 Bacteria 1189
775 Ga0495676_0104327 3300047321 Bacteria 2092
776 Ga0495676_0515205 3300047321 Bacteria 784
777 Ga0495680_0265905 3300047322 Bacteria 1212
778 Ga0495687_000454 3300047443 Bacteria 50500
779 Ga0495675_0705539 3300047444 Bacteria 565
780 Ga0495685_231901 3300047447 Bacteria 588
781 Ga0495684_0130956 3300047471 Bacteria 1884
782 Ga0495686_0003031 3300047472 Bacteria 14902
783 Ga0495593_0006332 3300047673 Bacteria 6945
784 Ga0495602_0754154 3300048088 Bacteria 657
785 Ga0495602_0825171 3300048088 Bacteria 621
786 Ga0495626_0436193 3300048091 Bacteria 504
787 Ga0496101_0595709 3300048904 Unclassified 874
788 Ga0496102_0058118 3300048905 Bacteria 3533
789 Ga0496102_0331724 3300048905 Bacteria 1433
790 Ga0496103_0326736 3300048906 Bacteria 986
791 Ga0496104_0029652 3300048907 Bacteria 5076
792 Ga0496104_0761613 3300048907 Bacteria 875
793 Ga0496104_0788326 3300048907 Bacteria 857
794 Ga0496105_0771752 3300048908 Bacteria 733
795 Ga0496106_0651112 3300048909 Bacteria 842
796 Ga0496106_1205256 3300048909 Bacteria 590
797 Ga0496106_1492006 3300048909 Bacteria 520
798 Ga0496107_0149590 3300048910 Bacteria 1727
799 Ga0496108_1339466 3300048911 Bacteria 601
800 Ga0496108_1781354 3300048911 Bacteria 505
801 Ga0496109_0842128 3300048912 Bacteria 855
802 Ga0496110_1039755 3300048913 Bacteria 727
803 Ga0496111_0441284 3300048914 Bacteria 961
804 Ga0496111_1298763 3300048914 Bacteria 513
805 Ga0496112_0104538 3300048915 Bacteria 2802
806 Ga0496112_0387130 3300048915 Bacteria 1339
807 Ga0496113_0246439 3300048916 Bacteria 1426
808 Ga0496114_0197286 3300048917 Bacteria 1762
809 Ga0496114_0278202 3300048917 Bacteria 1475
810 Ga0496115_0022861 3300048918 Bacteria 4849
811 Ga0496116_0048712 3300048919 Bacteria 2841
812 Ga0496117_0000186 3300048920 Bacteria 127231
813 Ga0496118_0000003 3300048921 Bacteria 773148
814 Ga0496119_0000260 3300048922 Bacteria 74908
815 Ga0496119_0004656 3300048922 Bacteria 13528
816 Ga0496120_0000165 3300048923 Bacteria 111625
817 Ga0496121_0031038 3300048924 Bacteria 4893
818 Ga0496125_0048807 3300048928 Bacteria 3525
819 Ga0496125_0181348 3300048928 Bacteria 1402
820 Ga0496126_0067376 3300048929 Bacteria 3198
821 Ga0495682_0306830 3300049460 Bacteria 560
822 Ga0501294_005142 3300049517 Bacteria 1237
823 Ga0501294_033658 3300049517 Bacteria 609
824 Ga0501298_153835 3300049521 Bacteria 564
825 Ga0501298_163521 3300049521 Bacteria 551
826 Ga0501299_184142 3300049522 Bacteria 547
827 Ga0501301_007524 3300049524 Bacteria 841
828 Ga0501039_0791990 3300049575 Bacteria 740
829 Ga0501068_0159133 3300049584 Bacteria 1423
830 Ga0501071_0535482 3300049587 Bacteria 899
831 Ga0501077_0021965 3300049593 Bacteria 4041
832 Ga0501077_0750508 3300049593 Bacteria 627
833 Ga0501222_014548 3300049662 Bacteria 1038
834 Ga0501249_116985 3300049679 Bacteria 648
835 Ga0501253_015394 3300049683 Bacteria 1256
836 Ga0501257_018973 3300049686 Bacteria 1607
837 Ga0501262_017818 3300049759 Bacteria 950
838 Ga0501283_027278 3300049779 Bacteria 943
839 Ga0501035_1560274 3300049822 Bacteria 502
840 nmdc:mga03683_80241_c1 3300050489 Bacteria 1408
841 nmdc:mga03n38_187246_c1 3300050490 Bacteria 1064
842 nmdc:mga00v17_989833_c1 3300050491 Bacteria 530
843 nmdc:mga0yw44_1204446_c1 3300050492 Bacteria 511
844 nmdc:mga0yw44_245071_c1 3300050492 Bacteria 1192
845 nmdc:mga0yw44_619129_c1 3300050492 Bacteria 736
846 nmdc:mga0k408_13787_c1 3300050493 Bacteria 4440
847 nmdc:mga0k408_430042_c1 3300050493 Bacteria 785
848 nmdc:mga0k408_689959_c1 3300050493 Bacteria 599
849 nmdc:mga04h51_145001_c1 3300050495 Bacteria 903
850 nmdc:mga07m45_253237_c1 3300050496 Bacteria 1024
851 nmdc:mga07m45_60390_c1 3300050496 Bacteria 1958
852 nmdc:mga05p37_3871_c1 3300050507 Bacteria 17506
853 nmdc:mga05p37_456_c1 3300050507 Bacteria 44536
854 nmdc:mga09592_250996_c1 3300050508 Bacteria 1534
855 nmdc:mga09592_270908_c1 3300050508 Bacteria 1473
856 nmdc:mga09592_31068_c1 3300050508 Bacteria 4449
857 nmdc:mga09592_6064_c1 3300050508 Bacteria 9854
858 nmdc:mga0qj67_1177_c1 3300050509 Bacteria 18131
859 nmdc:mga0qj67_1546254_c1 3300050509 Bacteria 510
860 nmdc:mga0qj67_15748_c1 3300050509 Bacteria 5727
861 nmdc:mga0qj67_346216_c1 3300050509 Bacteria 1202
862 nmdc:mga06r32_1668_c1 3300050510 Bacteria 20034
863 nmdc:mga06r32_5109_c1 3300050510 Bacteria 11804
864 nmdc:mga06r32_635938_c1 3300050510 Bacteria 1036
865 nmdc:mga06r32_9857_c1 3300050510 Bacteria 8621
866 nmdc:mga08y16_107607_c1 3300050511 Bacteria 2903
867 nmdc:mga08y16_15611_c1 3300050511 Bacteria 7986
868 nmdc:mga08y16_4744_c1 3300050511 Bacteria 14171
869 nmdc:mga08y16_62253_c1 3300050511 Bacteria 3896
870 nmdc:mga08y16_8343_c1 3300050511 Bacteria 10839
871 nmdc:mga08y16_8995_c1 3300050511 Bacteria 10489
872 nmdc:mga0rr50_158068_c1 3300050513 Bacteria 1837
873 nmdc:mga0rr50_422969_c1 3300050513 Bacteria 1127
874 nmdc:mga08x19_42166_c1 3300050514 Bacteria 2908
875 nmdc:mga0a205_305996_c1 3300050515 Bacteria 1462
876 nmdc:mga0sz30_404072_c1 3300050516 Bacteria 612
877 Ga0500610_0264541 3300053079 Bacteria 783
878 Ga0495655_0118333 3300053083 Bacteria 804
879 Ga0495595_0007151 3300053084 Bacteria 4561
880 Ga0495619_0028832 3300053085 Bacteria 3582
881 Ga0495619_0048491 3300053085 Bacteria 2799
882 Ga0495619_0830978 3300053085 Bacteria 624
883 Ga0495619_0935011 3300053085 Bacteria 582
884 Ga0500583_0063396 3300053092 Bacteria 1751
885 Ga0500583_0327299 3300053092 Bacteria 746
886 Ga0500651_0102863 3300053093 Bacteria 1750
887 Ga0500566_0123529 3300053094 Unclassified 1393
888 Ga0500641_0043180 3300053096 Bacteria 1829
889 Ga0500558_210611 3300053106 Bacteria 669
890 Ga0500594_0072550 3300053118 Bacteria 1015
891 Ga0500595_021628 3300053119 Bacteria 2292
892 Ga0500597_118444 3300053120 Bacteria 1148
893 Ga0500614_008882 3300053123 Bacteria 2137
894 Ga0500628_072889 3300053129 Bacteria 864
895 Ga0500588_0006957 3300053146 Bacteria 2590
896 Ga0500588_0270202 3300053146 Bacteria 641
897 Ga0500589_037001 3300053147 Bacteria 2278
898 Ga0500604_0015642 3300053151 Bacteria 2081
899 Ga0500638_112449 3300053162 Bacteria 1256
900 Ga0500638_195041 3300053162 Bacteria 862
901 Ga0500637_0055021 3300053178 Bacteria 2272
902 Ga0500576_248229 3300053725 Bacteria 556

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0154080 Ga0495672_0154080_747_1046 98
2 3300009093 Ga0105240_12161646 Ga0105240_121616462 99
3 3300005336 Ga0070680_101560884 Ga0070680_1015608841 102
4 3300005440 Ga0070705_100232057 Ga0070705_1002320572 102
5 3300005445 Ga0070708_100210457 Ga0070708_1002104572 102
6 3300005468 Ga0070707_100648113 Ga0070707_1006481131 102
7 3300005468 Ga0070707_101905168 Ga0070707_1019051682 102
8 3300005471 Ga0070698_101734982 Ga0070698_1017349822 102
9 3300005536 Ga0070697_100917531 Ga0070697_1009175312 102
10 3300005546 Ga0070696_100075441 Ga0070696_1000754412 102
11 3300005549 Ga0070704_100403677 Ga0070704_1004036772 102
12 3300025921 Ga0207652_10657776 Ga0207652_106577762 102
13 3300025922 Ga0207646_10751061 Ga0207646_107510612 102
14 3300049584 Ga0501068_0159133 Ga0501068_0159133_106_414 102
15 3300005328 Ga0070676_11301477 Ga0070676_113014771 103
16 3300005338 Ga0068868_100327829 Ga0068868_1003278292 103
17 3300005434 Ga0070709_10014614 Ga0070709_100146143 103
18 3300005435 Ga0070714_100020507 Ga0070714_1000205074 103
19 3300005436 Ga0070713_100017912 Ga0070713_1000179124 103
20 3300005436 Ga0070713_100037196 Ga0070713_1000371962 103
21 3300005437 Ga0070710_10532322 Ga0070710_105323222 103
22 3300005439 Ga0070711_100112338 Ga0070711_1001123382 103
23 3300005439 Ga0070711_100116643 Ga0070711_1001166432 103
24 3300005545 Ga0070695_101563217 Ga0070695_1015632171 103
25 3300005546 Ga0070696_100612777 Ga0070696_1006127771 103
26 3300005719 Ga0068861_102071787 Ga0068861_1020717871 103
27 3300005844 Ga0068862_102355716 Ga0068862_1023557162 103
28 3300005981 Ga0081538_10115786 Ga0081538_101157861 103
29 3300006028 Ga0070717_10017129 Ga0070717_100171294 103
30 3300006028 Ga0070717_11559210 Ga0070717_115592102 103
31 3300006163 Ga0070715_10581806 Ga0070715_105818061 103
32 3300006173 Ga0070716_100198022 Ga0070716_1001980222 103
33 3300006175 Ga0070712_100128934 Ga0070712_1001289342 103
34 3300006852 Ga0075433_10291462 Ga0075433_102914622 103
35 3300006914 Ga0075436_100046567 Ga0075436_1000465673 103
36 3300007076 Ga0075435_100239069 Ga0075435_1002390692 103
37 3300013307 Ga0157372_11703019 Ga0157372_117030192 103
38 3300014969 Ga0157376_10764025 Ga0157376_107640252 103
39 3300021377 Ga0213874_10194768 Ga0213874_101947682 103
40 3300025898 Ga0207692_10352849 Ga0207692_103528491 103
41 3300025906 Ga0207699_11416195 Ga0207699_114161951 103
42 3300025916 Ga0207663_10911491 Ga0207663_109114912 103
43 3300025928 Ga0207700_10047179 Ga0207700_100471792 103
44 3300025929 Ga0207664_10024200 Ga0207664_100242002 103
45 3300025939 Ga0207665_10005554 Ga0207665_100055545 103
46 3300025942 Ga0207689_11313035 Ga0207689_113130352 103
47 3300025944 Ga0207661_10967268 Ga0207661_109672682 103
48 3300026023 Ga0207677_10316149 Ga0207677_103161492 103
49 3300026118 Ga0207675_101290544 Ga0207675_1012905442 103
50 3300028786 Ga0307517_10064623 Ga0307517_100646234 103
51 3300031456 Ga0307513_10291657 Ga0307513_102916572 103
52 3300031730 Ga0307516_10056562 Ga0307516_100565622 103
53 3300035090 Ga0373949_0000363 Ga0373949_0000363_8336_8647 103
54 3300036647 Ga0316582_0617732 Ga0316582_0617732_293_604 103
55 3300037853 Ga0436364_0195188 Ga0436364_0195188_37_348 103
56 3300039450 Ga0436363_0358913 Ga0436363_0358913_4268_4579 103
57 3300045836 Ga0466958_0869728 Ga0466958_0869728_183_494 103
58 3300048904 Ga0496101_0595709 Ga0496101_0595709_411_722 103
59 3300048907 Ga0496104_0761613 Ga0496104_0761613_41_352 103
60 3300049593 Ga0501077_0021965 Ga0501077_0021965_1287_1598 103
61 3300049593 Ga0501077_0750508 Ga0501077_0750508_213_524 103
62 3300050513 nmdc:mga0rr50_158068_c1 nmdc:mga0rr50_158068_c1_803_1114 103
63 3300050513 nmdc:mga0rr50_422969_c1 nmdc:mga0rr50_422969_c1_309_620 103
64 3300050514 nmdc:mga08x19_42166_c1 nmdc:mga08x19_42166_c1_780_1091 103
65 3300053094 Ga0500566_0123529 Ga0500566_0123529_338_649 103
66 3300053123 Ga0500614_008882 Ga0500614_008882_518_829 103
67 3300053162 Ga0500638_112449 Ga0500638_112449_154_465 103
68 3300053178 Ga0500637_0055021 Ga0500637_0055021_676_987 103
69 3300002077 JGI24744J21845_10078175 JGI24744J21845_100781751 104
70 3300003215 JGI25153J46596_10004955 JGI25153J46596_100049556 104
71 3300003323 rootH1_10170689 rootH1_101706893 104
72 3300004798 Ga0058859_10007278 Ga0058859_100072782 104
73 3300005290 Ga0065712_10070708 Ga0065712_100707081 104
74 3300005295 Ga0065707_10087797 Ga0065707_100877978 104
75 3300005295 Ga0065707_10124122 Ga0065707_101241224 104
76 3300005327 Ga0070658_11341319 Ga0070658_113413191 104
77 3300005328 Ga0070676_10006250 Ga0070676_100062506 104
78 3300005328 Ga0070676_10213058 Ga0070676_102130581 104
79 3300005329 Ga0070683_100221580 Ga0070683_1002215801 104
80 3300005329 Ga0070683_101660997 Ga0070683_1016609971 104
81 3300005330 Ga0070690_100004845 Ga0070690_1000048452 104
82 3300005330 Ga0070690_100032929 Ga0070690_1000329293 104
83 3300005331 Ga0070670_100008902 Ga0070670_1000089026 104
84 3300005331 Ga0070670_100120552 Ga0070670_1001205522 104
85 3300005331 Ga0070670_100127330 Ga0070670_1001273302 104
86 3300005331 Ga0070670_100295989 Ga0070670_1002959892 104
87 3300005331 Ga0070670_100634107 Ga0070670_1006341072 104
88 3300005331 Ga0070670_101188779 Ga0070670_1011887791 104
89 3300005333 Ga0070677_10692932 Ga0070677_106929321 104
90 3300005333 Ga0070677_10706178 Ga0070677_107061781 104
91 3300005334 Ga0068869_100048516 Ga0068869_1000485164 104
92 3300005334 Ga0068869_100072059 Ga0068869_1000720592 104
93 3300005334 Ga0068869_100592476 Ga0068869_1005924762 104
94 3300005334 Ga0068869_100667532 Ga0068869_1006675321 104
95 3300005335 Ga0070666_10623468 Ga0070666_106234682 104
96 3300005336 Ga0070680_100089415 Ga0070680_1000894151 104
97 3300005337 Ga0070682_100649080 Ga0070682_1006490802 104
98 3300005338 Ga0068868_100444394 Ga0068868_1004443942 104
99 3300005338 Ga0068868_100491741 Ga0068868_1004917412 104
100 3300005338 Ga0068868_100945002 Ga0068868_1009450022 104
101 3300005338 Ga0068868_101221872 Ga0068868_1012218721 104
102 3300005338 Ga0068868_101784677 Ga0068868_1017846772 104
103 3300005339 Ga0070660_100738975 Ga0070660_1007389751 104
104 3300005340 Ga0070689_100002318 Ga0070689_10000231810 104
105 3300005343 Ga0070687_100001735 Ga0070687_1000017353 104
106 3300005343 Ga0070687_100132426 Ga0070687_1001324262 104
107 3300005343 Ga0070687_100379197 Ga0070687_1003791972 104
108 3300005344 Ga0070661_100080340 Ga0070661_1000803404 104
109 3300005344 Ga0070661_100519668 Ga0070661_1005196681 104
110 3300005344 Ga0070661_100896384 Ga0070661_1008963841 104
111 3300005344 Ga0070661_101672753 Ga0070661_1016727531 104
112 3300005345 Ga0070692_10196058 Ga0070692_101960582 104
113 3300005345 Ga0070692_11063170 Ga0070692_110631701 104
114 3300005347 Ga0070668_100100711 Ga0070668_1001007113 104
115 3300005347 Ga0070668_100679905 Ga0070668_1006799052 104
116 3300005353 Ga0070669_100032396 Ga0070669_1000323965 104
117 3300005353 Ga0070669_100137207 Ga0070669_1001372072 104
118 3300005353 Ga0070669_100190119 Ga0070669_1001901192 104
119 3300005354 Ga0070675_100592230 Ga0070675_1005922301 104
120 3300005354 Ga0070675_101159412 Ga0070675_1011594122 104
121 3300005355 Ga0070671_100030098 Ga0070671_1000300983 104
122 3300005355 Ga0070671_100197809 Ga0070671_1001978093 104
123 3300005356 Ga0070674_100283453 Ga0070674_1002834532 104
124 3300005356 Ga0070674_100326027 Ga0070674_1003260272 104
125 3300005356 Ga0070674_100720985 Ga0070674_1007209852 104
126 3300005364 Ga0070673_100000317 Ga0070673_10000031725 104
127 3300005364 Ga0070673_100118429 Ga0070673_1001184293 104
128 3300005364 Ga0070673_100949121 Ga0070673_1009491211 104
129 3300005364 Ga0070673_101171633 Ga0070673_1011716332 104
130 3300005365 Ga0070688_100001119 Ga0070688_1000011194 104
131 3300005365 Ga0070688_100506878 Ga0070688_1005068782 104
132 3300005366 Ga0070659_100482370 Ga0070659_1004823702 104
133 3300005366 Ga0070659_100873661 Ga0070659_1008736612 104
134 3300005367 Ga0070667_100122916 Ga0070667_1001229164 104
135 3300005367 Ga0070667_100192544 Ga0070667_1001925442 104
136 3300005367 Ga0070667_101388834 Ga0070667_1013888341 104
137 3300005367 Ga0070667_101809994 Ga0070667_1018099942 104
138 3300005406 Ga0070703_10101445 Ga0070703_101014452 104
139 3300005438 Ga0070701_10007594 Ga0070701_100075945 104
140 3300005438 Ga0070701_11353664 Ga0070701_113536641 104
141 3300005440 Ga0070705_100599646 Ga0070705_1005996461 104
142 3300005440 Ga0070705_100840726 Ga0070705_1008407261 104
143 3300005441 Ga0070700_100567998 Ga0070700_1005679982 104
144 3300005441 Ga0070700_100756833 Ga0070700_1007568332 104
145 3300005444 Ga0070694_100147625 Ga0070694_1001476251 104
146 3300005455 Ga0070663_100873917 Ga0070663_1008739171 104
147 3300005456 Ga0070678_100031268 Ga0070678_1000312685 104
148 3300005456 Ga0070678_100278101 Ga0070678_1002781013 104
149 3300005456 Ga0070678_100337502 Ga0070678_1003375022 104
150 3300005456 Ga0070678_101527101 Ga0070678_1015271011 104
151 3300005457 Ga0070662_100002863 Ga0070662_1000028638 104
152 3300005457 Ga0070662_100025780 Ga0070662_1000257802 104
153 3300005458 Ga0070681_10026906 Ga0070681_100269067 104
154 3300005458 Ga0070681_11180454 Ga0070681_111804541 104
155 3300005459 Ga0068867_100016517 Ga0068867_1000165172 104
156 3300005459 Ga0068867_100311574 Ga0068867_1003115742 104
157 3300005459 Ga0068867_100467944 Ga0068867_1004679442 104
158 3300005466 Ga0070685_10103872 Ga0070685_101038721 104
159 3300005530 Ga0070679_100153455 Ga0070679_1001534555 104
160 3300005530 Ga0070679_100582983 Ga0070679_1005829832 104
161 3300005535 Ga0070684_100006100 Ga0070684_1000061005 104
162 3300005539 Ga0068853_100111272 Ga0068853_1001112721 104
163 3300005539 Ga0068853_100118015 Ga0068853_1001180154 104
164 3300005539 Ga0068853_100237294 Ga0068853_1002372943 104
165 3300005539 Ga0068853_100885631 Ga0068853_1008856311 104
166 3300005539 Ga0068853_101548891 Ga0068853_1015488912 104
167 3300005543 Ga0070672_100070580 Ga0070672_1000705802 104
168 3300005543 Ga0070672_100142954 Ga0070672_1001429543 104
169 3300005543 Ga0070672_100698845 Ga0070672_1006988452 104
170 3300005544 Ga0070686_100002445 Ga0070686_1000024452 104
171 3300005544 Ga0070686_100095174 Ga0070686_1000951742 104
172 3300005544 Ga0070686_100484324 Ga0070686_1004843242 104
173 3300005544 Ga0070686_101804248 Ga0070686_1018042481 104
174 3300005546 Ga0070696_100001844 Ga0070696_1000018445 104
175 3300005546 Ga0070696_100504633 Ga0070696_1005046332 104
176 3300005546 Ga0070696_101120139 Ga0070696_1011201391 104
177 3300005548 Ga0070665_100031487 Ga0070665_1000314873 104
178 3300005548 Ga0070665_100101282 Ga0070665_1001012823 104
179 3300005548 Ga0070665_100390388 Ga0070665_1003903882 104
180 3300005548 Ga0070665_100447285 Ga0070665_1004472852 104
181 3300005548 Ga0070665_100659316 Ga0070665_1006593162 104
182 3300005548 Ga0070665_100780351 Ga0070665_1007803512 104
183 3300005548 Ga0070665_100790015 Ga0070665_1007900151 104
184 3300005548 Ga0070665_100941862 Ga0070665_1009418622 104
185 3300005548 Ga0070665_101482845 Ga0070665_1014828452 104
186 3300005549 Ga0070704_100359716 Ga0070704_1003597162 104
187 3300005563 Ga0068855_100407207 Ga0068855_1004072071 104
188 3300005564 Ga0070664_100008545 Ga0070664_1000085454 104
189 3300005564 Ga0070664_100016232 Ga0070664_1000162322 104
190 3300005564 Ga0070664_100474321 Ga0070664_1004743212 104
191 3300005564 Ga0070664_100963799 Ga0070664_1009637992 104
192 3300005577 Ga0068857_100014969 Ga0068857_1000149694 104
193 3300005577 Ga0068857_100040174 Ga0068857_1000401745 104
194 3300005577 Ga0068857_100117239 Ga0068857_1001172392 104
195 3300005577 Ga0068857_100153872 Ga0068857_1001538724 104
196 3300005577 Ga0068857_101061684 Ga0068857_1010616842 104
197 3300005578 Ga0068854_100017705 Ga0068854_1000177055 104
198 3300005578 Ga0068854_100236014 Ga0068854_1002360141 104
199 3300005614 Ga0068856_100128803 Ga0068856_1001288033 104
200 3300005615 Ga0070702_100273293 Ga0070702_1002732932 104
201 3300005615 Ga0070702_100446992 Ga0070702_1004469921 104
202 3300005616 Ga0068852_100032511 Ga0068852_1000325112 104
203 3300005616 Ga0068852_100098682 Ga0068852_1000986822 104
204 3300005616 Ga0068852_100827561 Ga0068852_1008275612 104
205 3300005616 Ga0068852_101671631 Ga0068852_1016716311 104
206 3300005617 Ga0068859_100173238 Ga0068859_1001732383 104
207 3300005617 Ga0068859_100295362 Ga0068859_1002953622 104
208 3300005617 Ga0068859_100368076 Ga0068859_1003680763 104
209 3300005617 Ga0068859_100401341 Ga0068859_1004013412 104
210 3300005617 Ga0068859_101393798 Ga0068859_1013937982 104
211 3300005618 Ga0068864_100002908 Ga0068864_10000290815 104
212 3300005618 Ga0068864_100050437 Ga0068864_1000504373 104
213 3300005618 Ga0068864_100115144 Ga0068864_1001151445 104
214 3300005618 Ga0068864_100524099 Ga0068864_1005240991 104
215 3300005718 Ga0068866_10043985 Ga0068866_100439852 104
216 3300005718 Ga0068866_10602610 Ga0068866_106026101 104
217 3300005718 Ga0068866_10771041 Ga0068866_107710412 104
218 3300005719 Ga0068861_100002630 Ga0068861_10000263011 104
219 3300005719 Ga0068861_100003108 Ga0068861_10000310811 104
220 3300005719 Ga0068861_100005158 Ga0068861_1000051588 104
221 3300005719 Ga0068861_101662371 Ga0068861_1016623712 104
222 3300005834 Ga0068851_10193840 Ga0068851_101938402 104
223 3300005840 Ga0068870_10019848 Ga0068870_100198482 104
224 3300005840 Ga0068870_10248240 Ga0068870_102482402 104
225 3300005841 Ga0068863_100000209 Ga0068863_10000020933 104
226 3300005841 Ga0068863_100208951 Ga0068863_1002089513 104
227 3300005841 Ga0068863_100621586 Ga0068863_1006215862 104
228 3300005841 Ga0068863_100900125 Ga0068863_1009001252 104
229 3300005841 Ga0068863_101535979 Ga0068863_1015359791 104
230 3300005841 Ga0068863_102398743 Ga0068863_1023987432 104
231 3300005842 Ga0068858_100022830 Ga0068858_1000228308 104
232 3300005842 Ga0068858_100367161 Ga0068858_1003671612 104
233 3300005842 Ga0068858_100407605 Ga0068858_1004076052 104
234 3300005843 Ga0068860_100004201 Ga0068860_1000042018 104
235 3300005843 Ga0068860_100006195 Ga0068860_1000061954 104
236 3300005843 Ga0068860_100234346 Ga0068860_1002343461 104
237 3300005843 Ga0068860_100446568 Ga0068860_1004465682 104
238 3300005843 Ga0068860_100863446 Ga0068860_1008634462 104
239 3300005843 Ga0068860_101168643 Ga0068860_1011686432 104
240 3300005843 Ga0068860_101617348 Ga0068860_1016173481 104
241 3300005844 Ga0068862_100003257 Ga0068862_1000032576 104
242 3300005844 Ga0068862_100027941 Ga0068862_1000279412 104
243 3300005844 Ga0068862_100031016 Ga0068862_1000310164 104
244 3300005844 Ga0068862_100088646 Ga0068862_1000886464 104
245 3300005844 Ga0068862_100155300 Ga0068862_1001553004 104
246 3300005844 Ga0068862_100549435 Ga0068862_1005494352 104
247 3300005844 Ga0068862_101848142 Ga0068862_1018481422 104
248 3300005937 Ga0081455_10643142 Ga0081455_106431422 104
249 3300006038 Ga0075365_10077303 Ga0075365_100773032 104
250 3300006038 Ga0075365_10091811 Ga0075365_100918113 104
251 3300006038 Ga0075365_10374454 Ga0075365_103744541 104
252 3300006038 Ga0075365_10469943 Ga0075365_104699432 104
253 3300006038 Ga0075365_10563383 Ga0075365_105633832 104
254 3300006042 Ga0075368_10168323 Ga0075368_101683232 104
255 3300006048 Ga0075363_100132018 Ga0075363_1001320182 104
256 3300006048 Ga0075363_100189867 Ga0075363_1001898673 104
257 3300006048 Ga0075363_100789954 Ga0075363_1007899542 104
258 3300006048 Ga0075363_100822275 Ga0075363_1008222751 104
259 3300006051 Ga0075364_10335443 Ga0075364_103354431 104
260 3300006051 Ga0075364_10482137 Ga0075364_104821371 104
261 3300006173 Ga0070716_100559606 Ga0070716_1005596061 104
262 3300006177 Ga0075362_10036702 Ga0075362_100367024 104
263 3300006177 Ga0075362_10036902 Ga0075362_100369022 104
264 3300006178 Ga0075367_10027825 Ga0075367_100278254 104
265 3300006178 Ga0075367_10081052 Ga0075367_100810522 104
266 3300006178 Ga0075367_10294902 Ga0075367_102949022 104
267 3300006178 Ga0075367_10575263 Ga0075367_105752632 104
268 3300006178 Ga0075367_10849788 Ga0075367_108497882 104
269 3300006186 Ga0075369_10209065 Ga0075369_102090652 104
270 3300006186 Ga0075369_10216384 Ga0075369_102163841 104
271 3300006195 Ga0075366_10557513 Ga0075366_105575131 104
272 3300006237 Ga0097621_100323789 Ga0097621_1003237892 104
273 3300006237 Ga0097621_100646784 Ga0097621_1006467842 104
274 3300006237 Ga0097621_101144361 Ga0097621_1011443612 104
275 3300006353 Ga0075370_10381044 Ga0075370_103810442 104
276 3300006353 Ga0075370_10466376 Ga0075370_104663761 104
277 3300006358 Ga0068871_100039747 Ga0068871_1000397475 104
278 3300006358 Ga0068871_100662407 Ga0068871_1006624073 104
279 3300006358 Ga0068871_100855338 Ga0068871_1008553381 104
280 3300006358 Ga0068871_101642205 Ga0068871_1016422052 104
281 3300006844 Ga0075428_100003563 Ga0075428_10000356312 104
282 3300006844 Ga0075428_100030049 Ga0075428_1000300492 104
283 3300006844 Ga0075428_100057015 Ga0075428_1000570156 104
284 3300006844 Ga0075428_100082305 Ga0075428_1000823052 104
285 3300006846 Ga0075430_100010470 Ga0075430_1000104706 104
286 3300006846 Ga0075430_100042080 Ga0075430_1000420802 104
287 3300006846 Ga0075430_100138634 Ga0075430_1001386343 104
288 3300006847 Ga0075431_100007733 Ga0075431_1000077332 104
289 3300006847 Ga0075431_100162361 Ga0075431_1001623612 104
290 3300006847 Ga0075431_100169172 Ga0075431_1001691722 104
291 3300006847 Ga0075431_100575651 Ga0075431_1005756511 104
292 3300006852 Ga0075433_10335340 Ga0075433_103353402 104
293 3300006880 Ga0075429_100002556 Ga0075429_1000025567 104
294 3300006880 Ga0075429_100003351 Ga0075429_1000033518 104
295 3300006880 Ga0075429_100005811 Ga0075429_10000581112 104
296 3300006880 Ga0075429_100061828 Ga0075429_1000618282 104
297 3300006880 Ga0075429_100596375 Ga0075429_1005963752 104
298 3300006881 Ga0068865_100003091 Ga0068865_10000309110 104
299 3300006881 Ga0068865_100085945 Ga0068865_1000859451 104
300 3300006881 Ga0068865_100893305 Ga0068865_1008933052 104
301 3300006931 Ga0097620_100173249 Ga0097620_1001732493 104
302 3300006931 Ga0097620_100295374 Ga0097620_1002953742 104
303 3300006931 Ga0097620_100368087 Ga0097620_1003680871 104
304 3300006931 Ga0097620_100401321 Ga0097620_1004013212 104
305 3300006931 Ga0097620_100995713 Ga0097620_1009957132 104
306 3300006931 Ga0097620_101393835 Ga0097620_1013938352 104
307 3300007076 Ga0075435_100285628 Ga0075435_1002856281 104
308 3300007265 Ga0099794_10148152 Ga0099794_101481522 104
309 3300009093 Ga0105240_10066942 Ga0105240_100669422 104
310 3300009093 Ga0105240_10129094 Ga0105240_101290942 104
311 3300009093 Ga0105240_10171492 Ga0105240_101714923 104
312 3300009093 Ga0105240_10319425 Ga0105240_103194253 104
313 3300009093 Ga0105240_11223714 Ga0105240_112237141 104
314 3300009093 Ga0105240_11461706 Ga0105240_114617062 104
315 3300009094 Ga0111539_10006979 Ga0111539_1000697912 104
316 3300009094 Ga0111539_10086104 Ga0111539_100861044 104
317 3300009094 Ga0111539_10096982 Ga0111539_100969823 104
318 3300009094 Ga0111539_10167080 Ga0111539_101670805 104
319 3300009094 Ga0111539_10268477 Ga0111539_102684772 104
320 3300009098 Ga0105245_10200038 Ga0105245_102000382 104
321 3300009098 Ga0105245_10362686 Ga0105245_103626862 104
322 3300009098 Ga0105245_10510353 Ga0105245_105103531 104
323 3300009098 Ga0105245_12630657 Ga0105245_126306571 104
324 3300009101 Ga0105247_10032863 Ga0105247_100328633 104
325 3300009101 Ga0105247_10437767 Ga0105247_104377672 104
326 3300009147 Ga0114129_10000190 Ga0114129_1000019072 104
327 3300009147 Ga0114129_10043388 Ga0114129_100433882 104
328 3300009147 Ga0114129_10044795 Ga0114129_100447955 104
329 3300009148 Ga0105243_10017116 Ga0105243_100171165 104
330 3300009148 Ga0105243_10046246 Ga0105243_100462462 104
331 3300009148 Ga0105243_11566660 Ga0105243_115666601 104
332 3300009148 Ga0105243_12409622 Ga0105243_124096221 104
333 3300009148 Ga0105243_12646343 Ga0105243_126463431 104
334 3300009174 Ga0105241_10011183 Ga0105241_100111835 104
335 3300009174 Ga0105241_10337158 Ga0105241_103371583 104
336 3300009174 Ga0105241_10565549 Ga0105241_105655492 104
337 3300009174 Ga0105241_10896366 Ga0105241_108963662 104
338 3300009174 Ga0105241_11227678 Ga0105241_112276781 104
339 3300009174 Ga0105241_11236630 Ga0105241_112366301 104
340 3300009174 Ga0105241_11374575 Ga0105241_113745751 104
341 3300009174 Ga0105241_11589162 Ga0105241_115891621 104
342 3300009174 Ga0105241_11966339 Ga0105241_119663391 104
343 3300009174 Ga0105241_12386144 Ga0105241_123861442 104
344 3300009176 Ga0105242_10039640 Ga0105242_100396404 104
345 3300009176 Ga0105242_10069305 Ga0105242_100693054 104
346 3300009176 Ga0105242_10257036 Ga0105242_102570361 104
347 3300009176 Ga0105242_11151006 Ga0105242_111510061 104
348 3300009177 Ga0105248_10001641 Ga0105248_100016413 104
349 3300009177 Ga0105248_10284928 Ga0105248_102849282 104
350 3300009177 Ga0105248_11568671 Ga0105248_115686711 104
351 3300009545 Ga0105237_10022435 Ga0105237_100224356 104
352 3300009545 Ga0105237_10222058 Ga0105237_102220582 104
353 3300009545 Ga0105237_10349554 Ga0105237_103495542 104
354 3300009545 Ga0105237_10380643 Ga0105237_103806432 104
355 3300009545 Ga0105237_10496501 Ga0105237_104965012 104
356 3300009545 Ga0105237_10892310 Ga0105237_108923102 104
357 3300009545 Ga0105237_12649822 Ga0105237_126498221 104
358 3300009551 Ga0105238_10110557 Ga0105238_101105572 104
359 3300009551 Ga0105238_10137943 Ga0105238_101379432 104
360 3300009551 Ga0105238_10182868 Ga0105238_101828682 104
361 3300009551 Ga0105238_10404518 Ga0105238_104045182 104
362 3300009551 Ga0105238_11620165 Ga0105238_116201652 104
363 3300009551 Ga0105238_11681949 Ga0105238_116819491 104
364 3300009553 Ga0105249_10006407 Ga0105249_100064072 104
365 3300009553 Ga0105249_10008962 Ga0105249_100089629 104
366 3300009553 Ga0105249_10043781 Ga0105249_100437816 104
367 3300009553 Ga0105249_10044664 Ga0105249_100446641 104
368 3300010159 Ga0099796_10293484 Ga0099796_102934842 104
369 3300010375 Ga0105239_10004648 Ga0105239_100046489 104
370 3300010375 Ga0105239_10349631 Ga0105239_103496312 104
371 3300010375 Ga0105239_10492626 Ga0105239_104926262 104
372 3300010375 Ga0105239_10568606 Ga0105239_105686062 104
373 3300010375 Ga0105239_10651175 Ga0105239_106511752 104
374 3300010375 Ga0105239_10931150 Ga0105239_109311501 104
375 3300010375 Ga0105239_11085294 Ga0105239_110852942 104
376 3300010375 Ga0105239_11397329 Ga0105239_113973292 104
377 3300011119 Ga0105246_10070976 Ga0105246_100709762 104
378 3300011119 Ga0105246_10144409 Ga0105246_101444092 104
379 3300011119 Ga0105246_10547618 Ga0105246_105476181 104
380 3300011119 Ga0105246_10553993 Ga0105246_105539932 104
381 3300011119 Ga0105246_12116713 Ga0105246_121167131 104
382 3300013105 Ga0157369_11075906 Ga0157369_110759062 104
383 3300013296 Ga0157374_10016443 Ga0157374_100164432 104
384 3300013296 Ga0157374_10052960 Ga0157374_100529604 104
385 3300013296 Ga0157374_10342113 Ga0157374_103421132 104
386 3300013296 Ga0157374_10867361 Ga0157374_108673612 104
387 3300013297 Ga0157378_10002071 Ga0157378_1000207113 104
388 3300013297 Ga0157378_11834741 Ga0157378_118347412 104
389 3300013306 Ga0163162_10050059 Ga0163162_100500592 104
390 3300013306 Ga0163162_10056528 Ga0163162_100565282 104
391 3300013306 Ga0163162_10100678 Ga0163162_101006782 104
392 3300013306 Ga0163162_10179297 Ga0163162_101792972 104
393 3300013306 Ga0163162_10561966 Ga0163162_105619662 104
394 3300013306 Ga0163162_12222513 Ga0163162_122225131 104
395 3300013306 Ga0163162_12989558 Ga0163162_129895581 104
396 3300013308 Ga0157375_10025378 Ga0157375_100253782 104
397 3300013308 Ga0157375_10185639 Ga0157375_101856393 104
398 3300013308 Ga0157375_11108616 Ga0157375_111086161 104
399 3300014325 Ga0163163_10036850 Ga0163163_100368502 104
400 3300014325 Ga0163163_10091453 Ga0163163_100914533 104
401 3300014325 Ga0163163_10101945 Ga0163163_101019452 104
402 3300014325 Ga0163163_10403616 Ga0163163_104036162 104
403 3300014325 Ga0163163_11190762 Ga0163163_111907622 104
404 3300014325 Ga0163163_12557002 Ga0163163_125570021 104
405 3300014325 Ga0163163_12689405 Ga0163163_126894052 104
406 3300014326 Ga0157380_10091197 Ga0157380_100911974 104
407 3300014326 Ga0157380_10314326 Ga0157380_103143262 104
408 3300014326 Ga0157380_11481259 Ga0157380_114812592 104
409 3300014326 Ga0157380_11608155 Ga0157380_116081551 104
410 3300014326 Ga0157380_12466707 Ga0157380_124667072 104
411 3300014745 Ga0157377_10114695 Ga0157377_101146952 104
412 3300014745 Ga0157377_11483003 Ga0157377_114830031 104
413 3300014968 Ga0157379_10854697 Ga0157379_108546972 104
414 3300014969 Ga0157376_10024119 Ga0157376_100241191 104
415 3300014969 Ga0157376_10207021 Ga0157376_102070213 104
416 3300014969 Ga0157376_10843013 Ga0157376_108430132 104
417 3300014969 Ga0157376_11952922 Ga0157376_119529222 104
418 3300017792 Ga0163161_10520032 Ga0163161_105200322 104
419 3300017792 Ga0163161_10863978 Ga0163161_108639782 104
420 3300021361 Ga0213872_10003293 Ga0213872_100032939 104
421 3300025245 Ga0207425_1053565 Ga0207425_10535652 104
422 3300025258 Ga0209129_1030275 Ga0209129_10302752 104
423 3300025297 Ga0209758_1001140 Ga0209758_100114013 104
424 3300025321 Ga0207656_10073397 Ga0207656_100733972 104
425 3300025893 Ga0207682_10057209 Ga0207682_100572093 104
426 3300025899 Ga0207642_10022482 Ga0207642_100224822 104
427 3300025899 Ga0207642_10033949 Ga0207642_100339492 104
428 3300025899 Ga0207642_10040147 Ga0207642_100401472 104
429 3300025900 Ga0207710_10027246 Ga0207710_100272462 104
430 3300025900 Ga0207710_10135298 Ga0207710_101352982 104
431 3300025900 Ga0207710_10637799 Ga0207710_106377991 104
432 3300025901 Ga0207688_10317166 Ga0207688_103171662 104
433 3300025901 Ga0207688_10331588 Ga0207688_103315881 104
434 3300025901 Ga0207688_10398430 Ga0207688_103984302 104
435 3300025901 Ga0207688_10992972 Ga0207688_109929722 104
436 3300025903 Ga0207680_10197579 Ga0207680_101975792 104
437 3300025904 Ga0207647_10353229 Ga0207647_103532291 104
438 3300025907 Ga0207645_10005536 Ga0207645_100055363 104
439 3300025907 Ga0207645_10097880 Ga0207645_100978803 104
440 3300025907 Ga0207645_10129302 Ga0207645_101293023 104
441 3300025908 Ga0207643_10004975 Ga0207643_100049756 104
442 3300025908 Ga0207643_10043790 Ga0207643_100437904 104
443 3300025909 Ga0207705_10079520 Ga0207705_100795202 104
444 3300025912 Ga0207707_10014510 Ga0207707_100145107 104
445 3300025913 Ga0207695_10390788 Ga0207695_103907882 104
446 3300025913 Ga0207695_10484489 Ga0207695_104844891 104
447 3300025914 Ga0207671_10037840 Ga0207671_100378405 104
448 3300025914 Ga0207671_10092271 Ga0207671_100922713 104
449 3300025914 Ga0207671_10298619 Ga0207671_102986192 104
450 3300025914 Ga0207671_10334291 Ga0207671_103342912 104
451 3300025914 Ga0207671_10507995 Ga0207671_105079951 104
452 3300025914 Ga0207671_10536744 Ga0207671_105367442 104
453 3300025914 Ga0207671_11541164 Ga0207671_115411641 104
454 3300025915 Ga0207693_10106838 Ga0207693_101068383 104
455 3300025917 Ga0207660_10021907 Ga0207660_100219075 104
456 3300025917 Ga0207660_11020511 Ga0207660_110205111 104
457 3300025918 Ga0207662_10006753 Ga0207662_100067532 104
458 3300025918 Ga0207662_10027055 Ga0207662_100270553 104
459 3300025919 Ga0207657_10611922 Ga0207657_106119222 104
460 3300025920 Ga0207649_10379711 Ga0207649_103797112 104
461 3300025920 Ga0207649_10479764 Ga0207649_104797642 104
462 3300025921 Ga0207652_10122145 Ga0207652_101221452 104
463 3300025921 Ga0207652_11845057 Ga0207652_118450572 104
464 3300025923 Ga0207681_10027647 Ga0207681_100276475 104
465 3300025923 Ga0207681_10046892 Ga0207681_100468922 104
466 3300025923 Ga0207681_10072030 Ga0207681_100720302 104
467 3300025923 Ga0207681_10778058 Ga0207681_107780582 104
468 3300025924 Ga0207694_10187604 Ga0207694_101876042 104
469 3300025924 Ga0207694_10201244 Ga0207694_102012442 104
470 3300025924 Ga0207694_10258752 Ga0207694_102587522 104
471 3300025924 Ga0207694_10804681 Ga0207694_108046811 104
472 3300025924 Ga0207694_11030138 Ga0207694_110301382 104
473 3300025925 Ga0207650_10012000 Ga0207650_100120002 104
474 3300025925 Ga0207650_10032210 Ga0207650_100322102 104
475 3300025925 Ga0207650_10073807 Ga0207650_100738072 104
476 3300025925 Ga0207650_10078116 Ga0207650_100781162 104
477 3300025925 Ga0207650_10330608 Ga0207650_103306082 104
478 3300025925 Ga0207650_10588159 Ga0207650_105881592 104
479 3300025925 Ga0207650_10698509 Ga0207650_106985091 104
480 3300025925 Ga0207650_11358069 Ga0207650_113580691 104
481 3300025926 Ga0207659_10419440 Ga0207659_104194402 104
482 3300025927 Ga0207687_10337985 Ga0207687_103379851 104
483 3300025927 Ga0207687_10922442 Ga0207687_109224421 104
484 3300025927 Ga0207687_11056798 Ga0207687_110567982 104
485 3300025931 Ga0207644_10017849 Ga0207644_100178494 104
486 3300025932 Ga0207690_10985449 Ga0207690_109854492 104
487 3300025933 Ga0207706_10001958 Ga0207706_1000195813 104
488 3300025933 Ga0207706_10019028 Ga0207706_100190285 104
489 3300025933 Ga0207706_10305936 Ga0207706_103059363 104
490 3300025934 Ga0207686_10192762 Ga0207686_101927622 104
491 3300025934 Ga0207686_10961472 Ga0207686_109614722 104
492 3300025935 Ga0207709_10058920 Ga0207709_100589202 104
493 3300025936 Ga0207670_10890042 Ga0207670_108900422 104
494 3300025937 Ga0207669_10106591 Ga0207669_101065913 104
495 3300025937 Ga0207669_10710684 Ga0207669_107106842 104
496 3300025937 Ga0207669_10983605 Ga0207669_109836052 104
497 3300025938 Ga0207704_10007178 Ga0207704_100071786 104
498 3300025938 Ga0207704_10204329 Ga0207704_102043292 104
499 3300025939 Ga0207665_10336428 Ga0207665_103364282 104
500 3300025940 Ga0207691_10076321 Ga0207691_100763214 104
501 3300025940 Ga0207691_10083409 Ga0207691_100834092 104
502 3300025940 Ga0207691_10611832 Ga0207691_106118321 104
503 3300025940 Ga0207691_10894955 Ga0207691_108949552 104
504 3300025941 Ga0207711_10053812 Ga0207711_100538122 104
505 3300025941 Ga0207711_10471911 Ga0207711_104719111 104
506 3300025941 Ga0207711_10679359 Ga0207711_106793591 104
507 3300025942 Ga0207689_10004545 Ga0207689_100045452 104
508 3300025942 Ga0207689_10033646 Ga0207689_100336463 104
509 3300025942 Ga0207689_10085901 Ga0207689_100859014 104
510 3300025942 Ga0207689_10429384 Ga0207689_104293842 104
511 3300025942 Ga0207689_10489486 Ga0207689_104894862 104
512 3300025942 Ga0207689_10906656 Ga0207689_109066562 104
513 3300025945 Ga0207679_10014101 Ga0207679_100141013 104
514 3300025945 Ga0207679_10027742 Ga0207679_100277421 104
515 3300025945 Ga0207679_10406656 Ga0207679_104066562 104
516 3300025945 Ga0207679_10959356 Ga0207679_109593561 104
517 3300025949 Ga0207667_10268859 Ga0207667_102688592 104
518 3300025960 Ga0207651_10149145 Ga0207651_101491452 104
519 3300025961 Ga0207712_10012759 Ga0207712_100127595 104
520 3300025961 Ga0207712_10324269 Ga0207712_103242692 104
521 3300025961 Ga0207712_10437150 Ga0207712_104371501 104
522 3300025972 Ga0207668_10195352 Ga0207668_101953523 104
523 3300025972 Ga0207668_10746790 Ga0207668_107467902 104
524 3300025972 Ga0207668_10823305 Ga0207668_108233052 104
525 3300025972 Ga0207668_11376149 Ga0207668_113761492 104
526 3300025981 Ga0207640_10034004 Ga0207640_100340043 104
527 3300025981 Ga0207640_11374650 Ga0207640_113746501 104
528 3300025981 Ga0207640_11987127 Ga0207640_119871271 104
529 3300025986 Ga0207658_10131514 Ga0207658_101315144 104
530 3300025986 Ga0207658_10336016 Ga0207658_103360161 104
531 3300026023 Ga0207677_10115026 Ga0207677_101150263 104
532 3300026023 Ga0207677_10145675 Ga0207677_101456751 104
533 3300026023 Ga0207677_10222458 Ga0207677_102224582 104
534 3300026023 Ga0207677_10266038 Ga0207677_102660383 104
535 3300026023 Ga0207677_10941541 Ga0207677_109415412 104
536 3300026023 Ga0207677_12042850 Ga0207677_120428501 104
537 3300026035 Ga0207703_10007019 Ga0207703_100070194 104
538 3300026035 Ga0207703_10030057 Ga0207703_100300574 104
539 3300026035 Ga0207703_10082021 Ga0207703_100820212 104
540 3300026035 Ga0207703_11127699 Ga0207703_111276992 104
541 3300026041 Ga0207639_10149650 Ga0207639_101496501 104
542 3300026041 Ga0207639_10179667 Ga0207639_101796673 104
543 3300026041 Ga0207639_10705694 Ga0207639_107056941 104
544 3300026041 Ga0207639_10778829 Ga0207639_107788291 104
545 3300026067 Ga0207678_10096695 Ga0207678_100966952 104
546 3300026067 Ga0207678_11159704 Ga0207678_111597042 104
547 3300026067 Ga0207678_11867935 Ga0207678_118679351 104
548 3300026075 Ga0207708_10207224 Ga0207708_102072242 104
549 3300026075 Ga0207708_10415548 Ga0207708_104155482 104
550 3300026078 Ga0207702_10103204 Ga0207702_101032042 104
551 3300026088 Ga0207641_10164548 Ga0207641_101645482 104
552 3300026088 Ga0207641_10249101 Ga0207641_102491012 104
553 3300026088 Ga0207641_10644546 Ga0207641_106445461 104
554 3300026088 Ga0207641_11148261 Ga0207641_111482612 104
555 3300026088 Ga0207641_11341846 Ga0207641_113418461 104
556 3300026088 Ga0207641_12037479 Ga0207641_120374791 104
557 3300026089 Ga0207648_10000432 Ga0207648_100004326 104
558 3300026089 Ga0207648_10023486 Ga0207648_100234866 104
559 3300026089 Ga0207648_10369553 Ga0207648_103695532 104
560 3300026089 Ga0207648_10573319 Ga0207648_105733192 104
561 3300026089 Ga0207648_12020357 Ga0207648_120203572 104
562 3300026095 Ga0207676_10046399 Ga0207676_100463992 104
563 3300026095 Ga0207676_10115994 Ga0207676_101159942 104
564 3300026095 Ga0207676_10250913 Ga0207676_102509132 104
565 3300026095 Ga0207676_10283029 Ga0207676_102830292 104
566 3300026095 Ga0207676_10413278 Ga0207676_104132782 104
567 3300026095 Ga0207676_11876739 Ga0207676_118767392 104
568 3300026116 Ga0207674_10047879 Ga0207674_100478795 104
569 3300026116 Ga0207674_10058004 Ga0207674_100580045 104
570 3300026116 Ga0207674_10132716 Ga0207674_101327162 104
571 3300026116 Ga0207674_10294773 Ga0207674_102947732 104
572 3300026116 Ga0207674_10330443 Ga0207674_103304432 104
573 3300026116 Ga0207674_10745138 Ga0207674_107451382 104
574 3300026116 Ga0207674_11131998 Ga0207674_111319981 104
575 3300026118 Ga0207675_100001061 Ga0207675_10000106122 104
576 3300026118 Ga0207675_100005869 Ga0207675_1000058696 104
577 3300026118 Ga0207675_100012122 Ga0207675_1000121228 104
578 3300026118 Ga0207675_100118514 Ga0207675_1001185143 104
579 3300026118 Ga0207675_100317199 Ga0207675_1003171993 104
580 3300026118 Ga0207675_100577216 Ga0207675_1005772162 104
581 3300026121 Ga0207683_10032553 Ga0207683_100325532 104
582 3300026121 Ga0207683_10049686 Ga0207683_100496865 104
583 3300026121 Ga0207683_10091800 Ga0207683_100918002 104
584 3300026121 Ga0207683_10254244 Ga0207683_102542441 104
585 3300026121 Ga0207683_10330256 Ga0207683_103302562 104
586 3300026121 Ga0207683_10791864 Ga0207683_107918642 104
587 3300026121 Ga0207683_11970816 Ga0207683_119708162 104
588 3300026142 Ga0207698_10092126 Ga0207698_100921262 104
589 3300026142 Ga0207698_10623127 Ga0207698_106231272 104
590 3300026142 Ga0207698_10807692 Ga0207698_108076922 104
591 3300026142 Ga0207698_12703072 Ga0207698_127030722 104
592 3300027378 Ga0209981_1081966 Ga0209981_10819661 104
593 3300027512 Ga0209179_1032041 Ga0209179_10320412 104
594 3300027671 Ga0209588_1003812 Ga0209588_10038121 104
595 3300027671 Ga0209588_1123605 Ga0209588_11236052 104
596 3300027866 Ga0209813_10137154 Ga0209813_101371542 104
597 3300027907 Ga0207428_10000488 Ga0207428_1000048848 104
598 3300027907 Ga0207428_10006456 Ga0207428_100064567 104
599 3300027907 Ga0207428_10086949 Ga0207428_100869494 104
600 3300027907 Ga0207428_10252419 Ga0207428_102524192 104
601 3300027907 Ga0207428_10364837 Ga0207428_103648372 104
602 3300028379 Ga0268266_10006491 Ga0268266_100064918 104
603 3300028379 Ga0268266_10015202 Ga0268266_100152026 104
604 3300028379 Ga0268266_10053579 Ga0268266_100535792 104
605 3300028379 Ga0268266_10139264 Ga0268266_101392642 104
606 3300028379 Ga0268266_10270874 Ga0268266_102708741 104
607 3300028379 Ga0268266_10391515 Ga0268266_103915152 104
608 3300028379 Ga0268266_10919199 Ga0268266_109191992 104
609 3300028379 Ga0268266_11594596 Ga0268266_115945962 104
610 3300028379 Ga0268266_11724832 Ga0268266_117248321 104
611 3300028379 Ga0268266_11819507 Ga0268266_118195071 104
612 3300028380 Ga0268265_10003020 Ga0268265_100030209 104
613 3300028380 Ga0268265_10030478 Ga0268265_100304786 104
614 3300028380 Ga0268265_10111601 Ga0268265_101116012 104
615 3300028380 Ga0268265_10118729 Ga0268265_101187292 104
616 3300028380 Ga0268265_10132270 Ga0268265_101322702 104
617 3300028380 Ga0268265_10897386 Ga0268265_108973862 104
618 3300028381 Ga0268264_10032350 Ga0268264_100323507 104
619 3300028381 Ga0268264_10392360 Ga0268264_103923602 104
620 3300028381 Ga0268264_10635797 Ga0268264_106357972 104
621 3300028381 Ga0268264_11444434 Ga0268264_114444341 104
622 3300028573 Ga0265334_10036290 Ga0265334_100362902 104
623 3300028573 Ga0265334_10103029 Ga0265334_101030292 104
624 3300028794 Ga0307515_10058169 Ga0307515_100581693 104
625 3300028794 Ga0307515_10685122 Ga0307515_106851221 104
626 3300028800 Ga0265338_10008007 Ga0265338_100080073 104
627 3300031238 Ga0265332_10014006 Ga0265332_100140062 104
628 3300031240 Ga0265320_10001360 Ga0265320_100013608 104
629 3300031240 Ga0265320_10019444 Ga0265320_100194441 104
630 3300031249 Ga0265339_10001746 Ga0265339_1000174612 104
631 3300031249 Ga0265339_10140729 Ga0265339_101407291 104
632 3300031250 Ga0265331_10219177 Ga0265331_102191771 104
633 3300031456 Ga0307513_10280185 Ga0307513_102801852 104
634 3300031507 Ga0307509_10899079 Ga0307509_108990792 104
635 3300031548 Ga0307408_100382177 Ga0307408_1003821772 104
636 3300031548 Ga0307408_100514829 Ga0307408_1005148291 104
637 3300031548 Ga0307408_100819413 Ga0307408_1008194131 104
638 3300031548 Ga0307408_100925122 Ga0307408_1009251222 104
639 3300031616 Ga0307508_10018485 Ga0307508_100184852 104
640 3300031649 Ga0307514_10112879 Ga0307514_101128793 104
641 3300031711 Ga0265314_10005944 Ga0265314_100059446 104
642 3300031730 Ga0307516_10002339 Ga0307516_1000233919 104
643 3300031730 Ga0307516_10563554 Ga0307516_105635541 104
644 3300031730 Ga0307516_10894284 Ga0307516_108942841 104
645 3300031731 Ga0307405_10575747 Ga0307405_105757472 104
646 3300031731 Ga0307405_10629642 Ga0307405_106296422 104
647 3300031824 Ga0307413_10136072 Ga0307413_101360722 104
648 3300031901 Ga0307406_10276104 Ga0307406_102761042 104
649 3300031901 Ga0307406_11305768 Ga0307406_113057681 104
650 3300031911 Ga0307412_10324612 Ga0307412_103246122 104
651 3300031911 Ga0307412_10426790 Ga0307412_104267902 104
652 3300031911 Ga0307412_10572230 Ga0307412_105722302 104
653 3300032002 Ga0307416_100231067 Ga0307416_1002310675 104
654 3300032002 Ga0307416_100930614 Ga0307416_1009306142 104
655 3300032002 Ga0307416_101314481 Ga0307416_1013144811 104
656 3300032126 Ga0307415_100144839 Ga0307415_1001448392 104
657 3300032126 Ga0307415_100438602 Ga0307415_1004386021 104
658 3300032126 Ga0307415_101399229 Ga0307415_1013992291 104
659 3300032126 Ga0307415_102011422 Ga0307415_1020114222 104
660 3300032137 Ga0316585_10250683 Ga0316585_102506831 104
661 3300033180 Ga0307510_10000003 Ga0307510_10000003346 104
662 3300033180 Ga0307510_10044313 Ga0307510_100443132 104
663 3300033180 Ga0307510_10079078 Ga0307510_100790782 104
664 3300033180 Ga0307510_10437551 Ga0307510_104375511 104
665 3300034816 Ga0373930_0099159 Ga0373930_0099159_355_681 104
666 3300034817 Ga0373948_0095558 Ga0373948_0095558_103_429 104
667 3300034819 Ga0373958_0006070 Ga0373958_0006070_182_508 104
668 3300034820 Ga0373959_0077933 Ga0373959_0077933_246_572 104
669 3300034957 Ga0373938_0018205 Ga0373938_0018205_542_868 104
670 3300035083 Ga0373926_0338748 Ga0373926_0338748_114_434 104
671 3300035084 Ga0373928_0032388 Ga0373928_0032388_360_686 104
672 3300035085 Ga0373929_0018417 Ga0373929_0018417_1032_1358 104
673 3300035086 Ga0373934_0494830 Ga0373934_0494830_41_355 104
674 3300035088 Ga0373940_0018758 Ga0373940_0018758_366_692 104
675 3300035111 Ga0373923_0010330 Ga0373923_0010330_2813_3127 104
676 3300035113 Ga0373936_0005826 Ga0373936_0005826_1956_2276 104
677 3300035113 Ga0373936_0007502 Ga0373936_0007502_3766_4080 104
678 3300035113 Ga0373936_0422933 Ga0373936_0422933_28_348 104
679 3300035113 Ga0373936_0495698 Ga0373936_0495698_66_386 104
680 3300035114 Ga0373939_0002559 Ga0373939_0002559_875_1201 104
681 3300035115 Ga0373941_0003464 Ga0373941_0003464_535_861 104
682 3300035116 Ga0373945_0390621 Ga0373945_0390621_66_380 104
683 3300035119 Ga0373956_0102116 Ga0373956_0102116_115_429 104
684 3300035119 Ga0373956_0528165 Ga0373956_0528165_88_408 104
685 3300035120 Ga0373957_0452451 Ga0373957_0452451_184_504 104
686 3300035170 Ga0373943_0062876 Ga0373943_0062876_1324_1638 104
687 3300035171 Ga0373946_0022789 Ga0373946_0022789_1787_2101 104
688 3300035172 Ga0373955_0059558 Ga0373955_0059558_322_636 104
689 3300035242 Ga0373962_0031214 Ga0373962_0031214_720_1046 104
690 3300035691 Ga0373931_0233356 Ga0373931_0233356_441_767 104
691 3300035691 Ga0373931_0266228 Ga0373931_0266228_24_344 104
692 3300035692 Ga0373935_0009132 Ga0373935_0009132_3727_4041 104
693 3300035695 Ga0373927_0021742 Ga0373927_0021742_1393_1707 104
694 3300035724 Ga0373933_0110429 Ga0373933_0110429_352_666 104
695 3300035725 Ga0373947_0012031 Ga0373947_0012031_171_485 104
696 3300035725 Ga0373947_0747442 Ga0373947_0747442_248_562 104
697 3300036401 Ga0373937_0026247 Ga0373937_0026247_353_667 104
698 3300036401 Ga0373937_0049344 Ga0373937_0049344_690_1007 104
699 3300036401 Ga0373937_0724448 Ga0373937_0724448_87_401 104
700 3300037068 Ga0373925_0002595 Ga0373925_0002595_11953_12267 104
701 3300037068 Ga0373925_0122685 Ga0373925_0122685_307_621 104
702 3300037068 Ga0373925_1748264 Ga0373925_1748264_51_365 104
703 3300037312 Ga0395899_0096381 Ga0395899_0096381_457_774 104
704 3300037418 Ga0395900_0005356 Ga0395900_0005356_9515_9832 104
705 3300037466 Ga0395898_0024771 Ga0395898_0024771_3848_4165 104
706 3300037588 Ga0316581_0063173 Ga0316581_0063173_199_528 104
707 3300037853 Ga0436364_0548762 Ga0436364_0548762_986_1306 104
708 3300038443 Ga0395901_0030126 Ga0395901_0030126_680_997 104
709 3300039450 Ga0436363_0643674 Ga0436363_0643674_96_419 104
710 3300039450 Ga0436363_1313640 Ga0436363_1313640_605_922 104
711 3300041443 Ga0451789_1264309 Ga0451789_1264309_272_586 104
712 3300041451 Ga0451791_0375005 Ga0451791_0375005_311_625 104
713 3300041456 Ga0451795_0385379 Ga0451795_0385379_125_439 104
714 3300041459 Ga0451800_0948311 Ga0451800_0948311_736_1056 104
715 3300041486 Ga0451807_1959945 Ga0451807_1959945_83_403 104
716 3300041494 Ga0451837_1392969 Ga0451837_1392969_105_422 104
717 3300041509 Ga0451843_1228507 Ga0451843_1228507_30_350 104
718 3300042004 Ga0439445_0221988 Ga0439445_0221988_164_529 104
719 3300042008 Ga0439450_079960 Ga0439450_079960_59_379 104
720 3300042012 Ga0439455_0108498 Ga0439455_0108498_125_445 104
721 3300042016 Ga0439463_080894 Ga0439463_080894_101_421 104
722 3300042134 Ga0450898_138334 Ga0450898_138334_95_478 104
723 3300042876 Ga0451577_0720641 Ga0451577_0720641_487_813 104
724 3300042876 Ga0451577_1359605 Ga0451577_1359605_23_340 104
725 3300044658 Ga0466972_0198093 Ga0466972_0198093_370_684 104
726 3300044683 Ga0466965_0116046 Ga0466965_0116046_406_720 104
727 3300044684 Ga0466966_0640214 Ga0466966_0640214_96_413 104
728 3300044712 Ga0453684_0011849 Ga0453684_0011849_1196_1510 104
729 3300044901 Ga0466960_0110049 Ga0466960_0110049_803_1117 104
730 3300045051 Ga0451576_0069529 Ga0451576_0069529_678_998 104
731 3300045051 Ga0451576_0102078 Ga0451576_0102078_2051_2377 104
732 3300045051 Ga0451576_0183919 Ga0451576_0183919_129_449 104
733 3300045051 Ga0451576_0200295 Ga0451576_0200295_1319_1645 104
734 3300045051 Ga0451576_0831166 Ga0451576_0831166_231_545 104
735 3300045051 Ga0451576_1106872 Ga0451576_1106872_356_673 104
736 3300046455 Ga0495603_0004320 Ga0495603_0004320_6573_6887 104
737 3300046455 Ga0495603_0149309 Ga0495603_0149309_477_791 104
738 3300046455 Ga0495603_0477827 Ga0495603_0477827_267_581 104
739 3300046459 Ga0495629_0008693 Ga0495629_0008693_313_627 104
740 3300046462 Ga0495651_0257749 Ga0495651_0257749_157_471 104
741 3300046463 Ga0495653_0392990 Ga0495653_0392990_190_504 104
742 3300046471 Ga0495650_0006812 Ga0495650_0006812_2819_3133 104
743 3300046472 Ga0495580_0373740 Ga0495580_0373740_158_472 104
744 3300046473 Ga0495582_0381248 Ga0495582_0381248_451_765 104
745 3300046475 Ga0495639_0005290 Ga0495639_0005290_353_667 104
746 3300046476 Ga0495662_0002831 Ga0495662_0002831_7651_7965 104
747 3300046477 Ga0495664_0124050 Ga0495664_0124050_916_1230 104
748 3300046477 Ga0495664_0863097 Ga0495664_0863097_95_424 104
749 3300046491 Ga0495584_0012037 Ga0495584_0012037_2431_2745 104
750 3300046499 Ga0495594_0004642 Ga0495594_0004642_2619_2933 104
751 3300046514 Ga0495618_0341962 Ga0495618_0341962_109_423 104
752 3300046516 Ga0495628_0075786 Ga0495628_0075786_258_572 104
753 3300046517 Ga0495630_0120953 Ga0495630_0120953_29_343 104
754 3300046518 Ga0495631_0230968 Ga0495631_0230968_315_629 104
755 3300046522 Ga0495643_0151729 Ga0495643_0151729_494_808 104
756 3300046524 Ga0495648_0157081 Ga0495648_0157081_272_595 104
757 3300046525 Ga0495663_0001798 Ga0495663_0001798_1418_1732 104
758 3300046526 Ga0495666_0026030 Ga0495666_0026030_301_615 104
759 3300046529 Ga0495652_0110824 Ga0495652_0110824_1730_2044 104
760 3300046529 Ga0495652_0877735 Ga0495652_0877735_233_547 104
761 3300046531 Ga0495665_0040106 Ga0495665_0040106_1194_1508 104
762 3300046533 Ga0495640_0013286 Ga0495640_0013286_5439_5753 104
763 3300046538 Ga0495609_0454163 Ga0495609_0454163_155_469 104
764 3300046539 Ga0495621_0418449 Ga0495621_0418449_183_497 104
765 3300046542 Ga0495597_0012386 Ga0495597_0012386_636_950 104
766 3300046557 Ga0495622_0027653 Ga0495622_0027653_2110_2424 104
767 3300046557 Ga0495622_0264880 Ga0495622_0264880_275_589 104
768 3300046558 Ga0495633_0432210 Ga0495633_0432210_247_573 104
769 3300046559 Ga0495667_0022396 Ga0495667_0022396_237_551 104
770 3300046615 Ga0495656_0019194 Ga0495656_0019194_2080_2394 104
771 3300046642 Ga0495634_0003738 Ga0495634_0003738_476_790 104
772 3300046660 Ga0495625_0109517 Ga0495625_0109517_809_1123 104
773 3300046663 Ga0495635_0106186 Ga0495635_0106186_314_628 104
774 3300046675 Ga0495657_0445850 Ga0495657_0445850_262_576 104
775 3300046678 Ga0495599_0401040 Ga0495599_0401040_214_528 104
776 3300046680 Ga0495646_0030611 Ga0495646_0030611_2914_3228 104
777 3300046683 Ga0495658_0003784 Ga0495658_0003784_6823_7137 104
778 3300046683 Ga0495658_0771612 Ga0495658_0771612_155_475 104
779 3300046684 Ga0495669_0207793 Ga0495669_0207793_88_408 104
780 3300046689 Ga0495613_0007099 Ga0495613_0007099_339_653 104
781 3300046690 Ga0495624_0010071 Ga0495624_0010071_3794_4108 104
782 3300046692 Ga0495671_0636991 Ga0495671_0636991_98_412 104
783 3300046809 Ga0495600_0019190 Ga0495600_0019190_1581_1895 104
784 3300047315 Ga0495581_0009065 Ga0495581_0009065_4022_4336 104
785 3300047318 Ga0495636_0304774 Ga0495636_0304774_98_412 104
786 3300047319 Ga0495674_0000458 Ga0495674_0000458_643_957 104
787 3300047321 Ga0495676_0104327 Ga0495676_0104327_1571_1885 104
788 3300047321 Ga0495676_0515205 Ga0495676_0515205_149_463 104
789 3300047322 Ga0495680_0265905 Ga0495680_0265905_75_389 104
790 3300047443 Ga0495687_000454 Ga0495687_000454_29308_29622 104
791 3300047444 Ga0495675_0705539 Ga0495675_0705539_10_330 104
792 3300047447 Ga0495685_231901 Ga0495685_231901_83_397 104
793 3300047471 Ga0495684_0130956 Ga0495684_0130956_1086_1400 104
794 3300047472 Ga0495686_0003031 Ga0495686_0003031_13705_14022 104
795 3300047673 Ga0495593_0006332 Ga0495593_0006332_353_667 104
796 3300048088 Ga0495602_0754154 Ga0495602_0754154_53_373 104
797 3300048088 Ga0495602_0825171 Ga0495602_0825171_172_486 104
798 3300048091 Ga0495626_0436193 Ga0495626_0436193_169_483 104
799 3300048905 Ga0496102_0058118 Ga0496102_0058118_1250_1573 104
800 3300048905 Ga0496102_0331724 Ga0496102_0331724_37_378 104
801 3300048906 Ga0496103_0326736 Ga0496103_0326736_585_908 104
802 3300048907 Ga0496104_0029652 Ga0496104_0029652_2337_2657 104
803 3300048907 Ga0496104_0788326 Ga0496104_0788326_139_462 104
804 3300048908 Ga0496105_0771752 Ga0496105_0771752_274_594 104
805 3300048909 Ga0496106_0651112 Ga0496106_0651112_436_783 104
806 3300048909 Ga0496106_1205256 Ga0496106_1205256_96_416 104
807 3300048909 Ga0496106_1492006 Ga0496106_1492006_62_385 104
808 3300048910 Ga0496107_0149590 Ga0496107_0149590_1188_1511 104
809 3300048911 Ga0496108_1339466 Ga0496108_1339466_244_561 104
810 3300048911 Ga0496108_1781354 Ga0496108_1781354_132_452 104
811 3300048912 Ga0496109_0842128 Ga0496109_0842128_506_826 104
812 3300048913 Ga0496110_1039755 Ga0496110_1039755_325_642 104
813 3300048914 Ga0496111_0441284 Ga0496111_0441284_152_472 104
814 3300048914 Ga0496111_1298763 Ga0496111_1298763_10_330 104
815 3300048915 Ga0496112_0104538 Ga0496112_0104538_207_527 104
816 3300048915 Ga0496112_0387130 Ga0496112_0387130_891_1211 104
817 3300048916 Ga0496113_0246439 Ga0496113_0246439_1040_1360 104
818 3300048917 Ga0496114_0197286 Ga0496114_0197286_418_738 104
819 3300048917 Ga0496114_0278202 Ga0496114_0278202_606_929 104
820 3300048918 Ga0496115_0022861 Ga0496115_0022861_4221_4541 104
821 3300048919 Ga0496116_0048712 Ga0496116_0048712_1818_2141 104
822 3300048920 Ga0496117_0000186 Ga0496117_0000186_81784_82107 104
823 3300048921 Ga0496118_0000003 Ga0496118_0000003_274375_274698 104
824 3300048922 Ga0496119_0000260 Ga0496119_0000260_3113_3436 104
825 3300048922 Ga0496119_0004656 Ga0496119_0004656_5658_5981 104
826 3300048923 Ga0496120_0000165 Ga0496120_0000165_17260_17583 104
827 3300048924 Ga0496121_0031038 Ga0496121_0031038_1918_2241 104
828 3300048928 Ga0496125_0048807 Ga0496125_0048807_204_527 104
829 3300048928 Ga0496125_0181348 Ga0496125_0181348_721_1044 104
830 3300048929 Ga0496126_0067376 Ga0496126_0067376_1441_1764 104
831 3300049460 Ga0495682_0306830 Ga0495682_0306830_67_381 104
832 3300049517 Ga0501294_005142 Ga0501294_005142_541_855 104
833 3300049517 Ga0501294_033658 Ga0501294_033658_152_472 104
834 3300049521 Ga0501298_153835 Ga0501298_153835_40_360 104
835 3300049521 Ga0501298_163521 Ga0501298_163521_146_466 104
836 3300049522 Ga0501299_184142 Ga0501299_184142_168_482 104
837 3300049524 Ga0501301_007524 Ga0501301_007524_342_656 104
838 3300049575 Ga0501039_0791990 Ga0501039_0791990_37_351 104
839 3300049587 Ga0501071_0535482 Ga0501071_0535482_307_651 104
840 3300049662 Ga0501222_014548 Ga0501222_014548_693_1007 104
841 3300049679 Ga0501249_116985 Ga0501249_116985_276_596 104
842 3300049683 Ga0501253_015394 Ga0501253_015394_253_573 104
843 3300049686 Ga0501257_018973 Ga0501257_018973_859_1173 104
844 3300049759 Ga0501262_017818 Ga0501262_017818_96_410 104
845 3300049779 Ga0501283_027278 Ga0501283_027278_553_873 104
846 3300049822 Ga0501035_1560274 Ga0501035_1560274_91_405 104
847 3300050489 nmdc:mga03683_80241_c1 nmdc:mga03683_80241_c1_975_1289 104
848 3300050490 nmdc:mga03n38_187246_c1 nmdc:mga03n38_187246_c1_531_845 104
849 3300050491 nmdc:mga00v17_989833_c1 nmdc:mga00v17_989833_c1_196_510 104
850 3300050492 nmdc:mga0yw44_1204446_c1 nmdc:mga0yw44_1204446_c1_74_388 104
851 3300050492 nmdc:mga0yw44_245071_c1 nmdc:mga0yw44_245071_c1_22_339 104
852 3300050492 nmdc:mga0yw44_619129_c1 nmdc:mga0yw44_619129_c1_64_381 104
853 3300050493 nmdc:mga0k408_13787_c1 nmdc:mga0k408_13787_c1_1963_2277 104
854 3300050493 nmdc:mga0k408_430042_c1 nmdc:mga0k408_430042_c1_196_510 104
855 3300050493 nmdc:mga0k408_689959_c1 nmdc:mga0k408_689959_c1_243_557 104
856 3300050495 nmdc:mga04h51_145001_c1 nmdc:mga04h51_145001_c1_387_701 104
857 3300050496 nmdc:mga07m45_253237_c1 nmdc:mga07m45_253237_c1_430_750 104
858 3300050496 nmdc:mga07m45_60390_c1 nmdc:mga07m45_60390_c1_412_726 104
859 3300050507 nmdc:mga05p37_3871_c1 nmdc:mga05p37_3871_c1_12532_12852 104
860 3300050507 nmdc:mga05p37_456_c1 nmdc:mga05p37_456_c1_36472_36798 104
861 3300050508 nmdc:mga09592_250996_c1 nmdc:mga09592_250996_c1_54_374 104
862 3300050508 nmdc:mga09592_270908_c1 nmdc:mga09592_270908_c1_302_622 104
863 3300050508 nmdc:mga09592_31068_c1 nmdc:mga09592_31068_c1_1896_2216 104
864 3300050508 nmdc:mga09592_6064_c1 nmdc:mga09592_6064_c1_5870_6196 104
865 3300050509 nmdc:mga0qj67_1177_c1 nmdc:mga0qj67_1177_c1_16326_16688 104
866 3300050509 nmdc:mga0qj67_1546254_c1 nmdc:mga0qj67_1546254_c1_32_352 104
867 3300050509 nmdc:mga0qj67_15748_c1 nmdc:mga0qj67_15748_c1_5208_5528 104
868 3300050509 nmdc:mga0qj67_346216_c1 nmdc:mga0qj67_346216_c1_655_975 104
869 3300050510 nmdc:mga06r32_1668_c1 nmdc:mga06r32_1668_c1_15742_16104 104
870 3300050510 nmdc:mga06r32_5109_c1 nmdc:mga06r32_5109_c1_2986_3306 104
871 3300050510 nmdc:mga06r32_635938_c1 nmdc:mga06r32_635938_c1_26_346 104
872 3300050510 nmdc:mga06r32_9857_c1 nmdc:mga06r32_9857_c1_3483_3803 104
873 3300050511 nmdc:mga08y16_107607_c1 nmdc:mga08y16_107607_c1_1725_2045 104
874 3300050511 nmdc:mga08y16_15611_c1 nmdc:mga08y16_15611_c1_6174_6494 104
875 3300050511 nmdc:mga08y16_4744_c1 nmdc:mga08y16_4744_c1_10314_10640 104
876 3300050511 nmdc:mga08y16_62253_c1 nmdc:mga08y16_62253_c1_1550_1870 104
877 3300050511 nmdc:mga08y16_8343_c1 nmdc:mga08y16_8343_c1_28_348 104
878 3300050511 nmdc:mga08y16_8995_c1 nmdc:mga08y16_8995_c1_1470_1790 104
879 3300050515 nmdc:mga0a205_305996_c1 nmdc:mga0a205_305996_c1_104_421 104
880 3300050516 nmdc:mga0sz30_404072_c1 nmdc:mga0sz30_404072_c1_72_386 104
881 3300053079 Ga0500610_0264541 Ga0500610_0264541_243_557 104
882 3300053083 Ga0495655_0118333 Ga0495655_0118333_93_410 104
883 3300053084 Ga0495595_0007151 Ga0495595_0007151_2018_2332 104
884 3300053085 Ga0495619_0028832 Ga0495619_0028832_1491_1805 104
885 3300053085 Ga0495619_0048491 Ga0495619_0048491_2227_2541 104
886 3300053085 Ga0495619_0830978 Ga0495619_0830978_150_470 104
887 3300053085 Ga0495619_0935011 Ga0495619_0935011_203_517 104
888 3300053092 Ga0500583_0063396 Ga0500583_0063396_505_819 104
889 3300053092 Ga0500583_0327299 Ga0500583_0327299_55_369 104
890 3300053093 Ga0500651_0102863 Ga0500651_0102863_41_355 104
891 3300053096 Ga0500641_0043180 Ga0500641_0043180_1371_1685 104
892 3300053106 Ga0500558_210611 Ga0500558_210611_225_548 104
893 3300053118 Ga0500594_0072550 Ga0500594_0072550_472_786 104
894 3300053119 Ga0500595_021628 Ga0500595_021628_65_379 104
895 3300053120 Ga0500597_118444 Ga0500597_118444_539_853 104
896 3300053129 Ga0500628_072889 Ga0500628_072889_72_389 104
897 3300053146 Ga0500588_0006957 Ga0500588_0006957_2055_2369 104
898 3300053146 Ga0500588_0270202 Ga0500588_0270202_230_544 104
899 3300053147 Ga0500589_037001 Ga0500589_037001_676_990 104
900 3300053151 Ga0500604_0015642 Ga0500604_0015642_871_1185 104
901 3300053162 Ga0500638_195041 Ga0500638_195041_200_514 104
902 3300053725 Ga0500576_248229 Ga0500576_248229_121_444 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07110

EthD

EthD domain

14

92

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bf4-assembly1.cif.gz_B crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 a resolution 0.9782 2 103
3bf4-assembly1.cif.gz_B crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 a resolution 0.9508 2 103
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.7676 1 102
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.7543 1 102
1si9-assembly1.cif.gz_A boiling stable protein isolated from populus tremula 0.7328 2 99
ID Description Score Start End Superfamily
3bf4B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9637 3 100 3.30.70.100
3bf4B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.944 3 100 3.30.70.100
2pgcA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7237 2 102 3.30.70.100
af_A0A1D6PLI0_180_283_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7232 2 102 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.721 2 102 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6G8BRD0-F1-model_v4 EthD family reductase 0.9919 1 102 GO:0016491
AF-F0BK37-F1-model_v4 EthD domain-containing protein 0.9917 2 104 GO:0016491
AF-A0A2S7D7B8-F1-model_v4 EthD family reductase 0.9915 1 104 GO:0016491
AF-A6E9T8-F1-model_v4 Ethyl tert-butyl ether degradation EthD 0.9914 1 103 GO:0016491
AF-A0A0H2X9Q8-F1-model_v4 EthD domain-containing protein 0.9909 2 104 GO:0016491

Feature Viewer

pLDDT pTM Quality
97.2 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map