F485147
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 900 | 366 | 1800 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10303137|Ga0307513_103031371 |
| Length | 194 |
| Sequence | MTATVQRPPRNGVDVPTLFATLDAVKGAPEIAQFQFRANNEWISGTHSRSVIQGFYGAGQEDMSRTDPFGYDADHPAVLVGSNQGPTPVEFLLHAIATCLTAGLVNIAAARGITLRRVSSAIEGDIDLLGVFGLSDVVRNGYRQIRVHFNVEGDASPEELAALVQQSRSRSAVYDVLVNGTDVQIDVSTPVKPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 168 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 182 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 183 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 202 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 212 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 213 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 214 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 215 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 216 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 217 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 218 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 219 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 220 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 221 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 222 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 223 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 319 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 366 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.44 |
| Nodule | 0 |
| Rhizoplane | 7.89 |
| Rhizosphere | 88.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307513_10303137 | 3300031456 | Unclassified | 1363 |
| 2 | JGI24740J21852_10055622 | 3300001979 | Bacteria | 1112 |
| 3 | JGI24739J22299_10041975 | 3300001989 | Bacteria | 1519 |
| 4 | JGI24737J22298_10051725 | 3300001990 | Bacteria | 1247 |
| 5 | JGI24738J21930_10080768 | 3300002075 | Bacteria | 680 |
| 6 | rootL2_10145234 | 3300003322 | Bacteria | 1170 |
| 7 | Ga0065707_10054229 | 3300005295 | Bacteria | 694 |
| 8 | Ga0070676_10059684 | 3300005328 | Bacteria | 2263 |
| 9 | Ga0070676_10094671 | 3300005328 | Bacteria | 1835 |
| 10 | Ga0070683_100008705 | 3300005329 | Bacteria | 8630 |
| 11 | Ga0070683_100014042 | 3300005329 | Bacteria | 6995 |
| 12 | Ga0070683_100092685 | 3300005329 | Bacteria | 2837 |
| 13 | Ga0070683_100253095 | 3300005329 | Bacteria | 1675 |
| 14 | Ga0070683_100556391 | 3300005329 | Bacteria | 1097 |
| 15 | Ga0070683_100584882 | 3300005329 | Bacteria | 1068 |
| 16 | Ga0070683_100631169 | 3300005329 | Bacteria | 1026 |
| 17 | Ga0070683_100666355 | 3300005329 | Bacteria | 996 |
| 18 | Ga0070690_100195731 | 3300005330 | Bacteria | 1404 |
| 19 | Ga0070670_100089926 | 3300005331 | Bacteria | 2639 |
| 20 | Ga0070670_100692813 | 3300005331 | Bacteria | 916 |
| 21 | Ga0068869_100062367 | 3300005334 | Bacteria | 2736 |
| 22 | Ga0068869_100202225 | 3300005334 | Bacteria | 1567 |
| 23 | Ga0068869_100366986 | 3300005334 | Bacteria | 1177 |
| 24 | Ga0068869_101128363 | 3300005334 | Bacteria | 687 |
| 25 | Ga0070680_100631204 | 3300005336 | Bacteria | 920 |
| 26 | Ga0070682_100010039 | 3300005337 | Bacteria | 5365 |
| 27 | Ga0070682_100419857 | 3300005337 | Bacteria | 1016 |
| 28 | Ga0068868_100155925 | 3300005338 | Bacteria | 1883 |
| 29 | Ga0068868_100339790 | 3300005338 | Bacteria | 1284 |
| 30 | Ga0068868_100446774 | 3300005338 | Bacteria | 1124 |
| 31 | Ga0070660_100201880 | 3300005339 | Bacteria | 1613 |
| 32 | Ga0070689_100223995 | 3300005340 | Bacteria | 1544 |
| 33 | Ga0070692_10043355 | 3300005345 | Bacteria | 2313 |
| 34 | Ga0070668_100130319 | 3300005347 | Bacteria | 2018 |
| 35 | Ga0070668_100178747 | 3300005347 | Bacteria | 1732 |
| 36 | Ga0070668_100717754 | 3300005347 | Unclassified | 883 |
| 37 | Ga0070668_101409877 | 3300005347 | Unclassified | 635 |
| 38 | Ga0070669_100866160 | 3300005353 | Bacteria | 770 |
| 39 | Ga0070675_100001370 | 3300005354 | Bacteria | 17869 |
| 40 | Ga0070671_100456279 | 3300005355 | Bacteria | 1097 |
| 41 | Ga0070674_101220094 | 3300005356 | Unclassified | 668 |
| 42 | Ga0070673_100294939 | 3300005364 | Bacteria | 1426 |
| 43 | Ga0070673_100515721 | 3300005364 | Bacteria | 1083 |
| 44 | Ga0070673_101011808 | 3300005364 | Bacteria | 774 |
| 45 | Ga0070659_100016561 | 3300005366 | Bacteria | 5535 |
| 46 | Ga0070667_100721381 | 3300005367 | Unclassified | 923 |
| 47 | Ga0070709_10009654 | 3300005434 | Bacteria | 5329 |
| 48 | Ga0070709_10198353 | 3300005434 | Bacteria | 1420 |
| 49 | Ga0070714_100190999 | 3300005435 | Bacteria | 1869 |
| 50 | Ga0070713_100116322 | 3300005436 | Bacteria | 2338 |
| 51 | Ga0070713_100796950 | 3300005436 | Bacteria | 905 |
| 52 | Ga0070710_10012686 | 3300005437 | Bacteria | 4193 |
| 53 | Ga0070701_10083915 | 3300005438 | Bacteria | 1731 |
| 54 | Ga0070711_100199364 | 3300005439 | Bacteria | 1543 |
| 55 | Ga0070711_100505291 | 3300005439 | Bacteria | 997 |
| 56 | Ga0070705_100490812 | 3300005440 | Bacteria | 930 |
| 57 | Ga0070705_100642648 | 3300005440 | Bacteria | 826 |
| 58 | Ga0070700_100097744 | 3300005441 | Bacteria | 1929 |
| 59 | Ga0070700_100170452 | 3300005441 | Bacteria | 1507 |
| 60 | Ga0070663_100924032 | 3300005455 | Bacteria | 755 |
| 61 | Ga0070678_100142643 | 3300005456 | Bacteria | 1919 |
| 62 | Ga0070678_100267581 | 3300005456 | Bacteria | 1440 |
| 63 | Ga0070678_100322763 | 3300005456 | Bacteria | 1319 |
| 64 | Ga0070678_100895760 | 3300005456 | Bacteria | 811 |
| 65 | Ga0070662_100123781 | 3300005457 | Bacteria | 1985 |
| 66 | Ga0068867_100118511 | 3300005459 | Bacteria | 2042 |
| 67 | Ga0068867_100131035 | 3300005459 | Bacteria | 1948 |
| 68 | Ga0070685_10173778 | 3300005466 | Bacteria | 1382 |
| 69 | Ga0070706_100065755 | 3300005467 | Bacteria | 3354 |
| 70 | Ga0070684_100005923 | 3300005535 | Bacteria | 9412 |
| 71 | Ga0070684_100039396 | 3300005535 | Bacteria | 4064 |
| 72 | Ga0070684_100123256 | 3300005535 | Bacteria | 2332 |
| 73 | Ga0070684_100166461 | 3300005535 | Bacteria | 2001 |
| 74 | Ga0070684_100348018 | 3300005535 | Bacteria | 1363 |
| 75 | Ga0068853_100266254 | 3300005539 | Bacteria | 1577 |
| 76 | Ga0068853_101493035 | 3300005539 | Bacteria | 654 |
| 77 | Ga0070686_100237388 | 3300005544 | Bacteria | 1325 |
| 78 | Ga0070686_101051357 | 3300005544 | Bacteria | 670 |
| 79 | Ga0070693_100159555 | 3300005547 | Bacteria | 1435 |
| 80 | Ga0070665_100277000 | 3300005548 | Bacteria | 1679 |
| 81 | Ga0070665_100421755 | 3300005548 | Unclassified | 1343 |
| 82 | Ga0070665_100925687 | 3300005548 | Bacteria | 884 |
| 83 | Ga0070704_100224071 | 3300005549 | Bacteria | 1530 |
| 84 | Ga0070704_100412435 | 3300005549 | Bacteria | 1155 |
| 85 | Ga0070704_100632815 | 3300005549 | Bacteria | 943 |
| 86 | Ga0068855_101316481 | 3300005563 | Bacteria | 747 |
| 87 | Ga0070664_100000166 | 3300005564 | Bacteria | 45730 |
| 88 | Ga0070664_100011090 | 3300005564 | Bacteria | 7308 |
| 89 | Ga0070664_100041142 | 3300005564 | Bacteria | 3899 |
| 90 | Ga0070664_100148577 | 3300005564 | Bacteria | 2068 |
| 91 | Ga0070664_100414640 | 3300005564 | Bacteria | 1233 |
| 92 | Ga0068857_100043014 | 3300005577 | Bacteria | 4008 |
| 93 | Ga0068857_100144335 | 3300005577 | Unclassified | 2153 |
| 94 | Ga0068857_100275039 | 3300005577 | Bacteria | 1548 |
| 95 | Ga0068857_100575451 | 3300005577 | Bacteria | 1063 |
| 96 | Ga0068857_100709980 | 3300005577 | Bacteria | 956 |
| 97 | Ga0068854_100530419 | 3300005578 | Unclassified | 996 |
| 98 | Ga0068856_100354443 | 3300005614 | Bacteria | 1486 |
| 99 | Ga0070702_100296888 | 3300005615 | Bacteria | 1116 |
| 100 | Ga0068852_100413609 | 3300005616 | Bacteria | 1329 |
| 101 | Ga0068852_100857738 | 3300005616 | Bacteria | 924 |
| 102 | Ga0068859_100236125 | 3300005617 | Bacteria | 1917 |
| 103 | Ga0068859_100556044 | 3300005617 | Bacteria | 1242 |
| 104 | Ga0068859_100601202 | 3300005617 | Bacteria | 1193 |
| 105 | Ga0068859_100671048 | 3300005617 | Bacteria | 1128 |
| 106 | Ga0068859_101719013 | 3300005617 | Unclassified | 693 |
| 107 | Ga0068864_100001167 | 3300005618 | Bacteria | 21843 |
| 108 | Ga0068864_100536668 | 3300005618 | Bacteria | 1129 |
| 109 | Ga0068861_100081911 | 3300005719 | Bacteria | 2528 |
| 110 | Ga0068861_100137617 | 3300005719 | Unclassified | 1989 |
| 111 | Ga0068861_100142995 | 3300005719 | Bacteria | 1955 |
| 112 | Ga0068851_10230539 | 3300005834 | Bacteria | 1044 |
| 113 | Ga0068870_10393173 | 3300005840 | Bacteria | 900 |
| 114 | Ga0068863_100014088 | 3300005841 | Bacteria | 7703 |
| 115 | Ga0068863_100030440 | 3300005841 | Bacteria | 5154 |
| 116 | Ga0068863_100348200 | 3300005841 | Bacteria | 1442 |
| 117 | Ga0068858_100152363 | 3300005842 | Bacteria | 2174 |
| 118 | Ga0068858_100183176 | 3300005842 | Bacteria | 1978 |
| 119 | Ga0068858_100190996 | 3300005842 | Bacteria | 1935 |
| 120 | Ga0068860_100013292 | 3300005843 | Bacteria | 8074 |
| 121 | Ga0068860_100227958 | 3300005843 | Bacteria | 1810 |
| 122 | Ga0068860_101591989 | 3300005843 | Bacteria | 675 |
| 123 | Ga0068862_100025776 | 3300005844 | Bacteria | 4938 |
| 124 | Ga0068862_100086914 | 3300005844 | Bacteria | 2719 |
| 125 | Ga0068862_100138257 | 3300005844 | Bacteria | 2160 |
| 126 | Ga0068862_100213986 | 3300005844 | Bacteria | 1742 |
| 127 | Ga0068862_100728164 | 3300005844 | Unclassified | 963 |
| 128 | Ga0081455_10001500 | 3300005937 | Bacteria | 28818 |
| 129 | Ga0081455_10001832 | 3300005937 | Bacteria | 25608 |
| 130 | Ga0081455_10007202 | 3300005937 | Bacteria | 11755 |
| 131 | Ga0081455_10012628 | 3300005937 | Bacteria | 8410 |
| 132 | Ga0081455_10016091 | 3300005937 | Bacteria | 7235 |
| 133 | Ga0081455_10069485 | 3300005937 | Bacteria | 2929 |
| 134 | Ga0081455_10163050 | 3300005937 | Bacteria | 1706 |
| 135 | Ga0081455_10350415 | 3300005937 | Bacteria | 1042 |
| 136 | Ga0081538_10001297 | 3300005981 | Bacteria | 25909 |
| 137 | Ga0081538_10003067 | 3300005981 | Bacteria | 15899 |
| 138 | Ga0081538_10008250 | 3300005981 | Bacteria | 8875 |
| 139 | Ga0081538_10017418 | 3300005981 | Bacteria | 5453 |
| 140 | Ga0081538_10076605 | 3300005981 | Bacteria | 1807 |
| 141 | Ga0081538_10115577 | 3300005981 | Unclassified | 1304 |
| 142 | Ga0081538_10152475 | 3300005981 | Bacteria | 1043 |
| 143 | Ga0081538_10213656 | 3300005981 | Bacteria | 774 |
| 144 | Ga0081540_1039940 | 3300005983 | Bacteria | 2453 |
| 145 | Ga0081539_10001229 | 3300005985 | Bacteria | 45745 |
| 146 | Ga0081539_10044108 | 3300005985 | Bacteria | 2577 |
| 147 | Ga0081539_10069907 | 3300005985 | Bacteria | 1887 |
| 148 | Ga0070717_10055276 | 3300006028 | Bacteria | 3274 |
| 149 | Ga0070717_10618117 | 3300006028 | Bacteria | 983 |
| 150 | Ga0075365_10005329 | 3300006038 | Bacteria | 6924 |
| 151 | Ga0075365_10014948 | 3300006038 | Bacteria | 4682 |
| 152 | Ga0075365_10070877 | 3300006038 | Bacteria | 2345 |
| 153 | Ga0075364_10001262 | 3300006051 | Bacteria | 13599 |
| 154 | Ga0070715_10017213 | 3300006163 | Bacteria | 2733 |
| 155 | Ga0070716_100381469 | 3300006173 | Bacteria | 1007 |
| 156 | Ga0070716_100444934 | 3300006173 | Bacteria | 943 |
| 157 | Ga0070716_100510322 | 3300006173 | Bacteria | 889 |
| 158 | Ga0075362_10002451 | 3300006177 | Bacteria | 6236 |
| 159 | Ga0075367_10020819 | 3300006178 | Bacteria | 3658 |
| 160 | Ga0075367_10624699 | 3300006178 | Bacteria | 685 |
| 161 | Ga0075367_10675089 | 3300006178 | Bacteria | 657 |
| 162 | Ga0075369_10140184 | 3300006186 | Bacteria | 1102 |
| 163 | Ga0097621_100213870 | 3300006237 | Bacteria | 1678 |
| 164 | Ga0097621_100423255 | 3300006237 | Bacteria | 1196 |
| 165 | Ga0075428_100000025 | 3300006844 | Bacteria | 124293 |
| 166 | Ga0075428_100007416 | 3300006844 | Bacteria | 12156 |
| 167 | Ga0075428_100027434 | 3300006844 | Bacteria | 6300 |
| 168 | Ga0075428_100037211 | 3300006844 | Bacteria | 5359 |
| 169 | Ga0075428_100047259 | 3300006844 | Bacteria | 4728 |
| 170 | Ga0075428_100059739 | 3300006844 | Bacteria | 4175 |
| 171 | Ga0075428_100095394 | 3300006844 | Bacteria | 3242 |
| 172 | Ga0075428_100098568 | 3300006844 | Bacteria | 3186 |
| 173 | Ga0075428_100147235 | 3300006844 | Bacteria | 2559 |
| 174 | Ga0075428_100634583 | 3300006844 | Bacteria | 1140 |
| 175 | Ga0075430_100002091 | 3300006846 | Bacteria | 16503 |
| 176 | Ga0075430_100004497 | 3300006846 | Bacteria | 11748 |
| 177 | Ga0075430_100031197 | 3300006846 | Bacteria | 4523 |
| 178 | Ga0075430_100061262 | 3300006846 | Bacteria | 3162 |
| 179 | Ga0075430_100369832 | 3300006846 | Bacteria | 1184 |
| 180 | Ga0075431_100008337 | 3300006847 | Bacteria | 10366 |
| 181 | Ga0075431_100045785 | 3300006847 | Bacteria | 4509 |
| 182 | Ga0075431_100047423 | 3300006847 | Bacteria | 4429 |
| 183 | Ga0075431_100116972 | 3300006847 | Bacteria | 2751 |
| 184 | Ga0075431_100367400 | 3300006847 | Bacteria | 1444 |
| 185 | Ga0075431_100385947 | 3300006847 | Bacteria | 1404 |
| 186 | Ga0075431_100554415 | 3300006847 | Bacteria | 1136 |
| 187 | Ga0075431_100625686 | 3300006847 | Bacteria | 1058 |
| 188 | Ga0075433_10878913 | 3300006852 | Bacteria | 782 |
| 189 | Ga0075434_100227174 | 3300006871 | Bacteria | 1886 |
| 190 | Ga0075429_100001644 | 3300006880 | Bacteria | 18480 |
| 191 | Ga0075429_100008197 | 3300006880 | Bacteria | 9082 |
| 192 | Ga0075429_100148315 | 3300006880 | Bacteria | 2054 |
| 193 | Ga0075429_100160847 | 3300006880 | Bacteria | 1966 |
| 194 | Ga0075429_100289258 | 3300006880 | Bacteria | 1435 |
| 195 | Ga0075429_100697809 | 3300006880 | Bacteria | 889 |
| 196 | Ga0075429_101318974 | 3300006880 | Bacteria | 629 |
| 197 | Ga0068865_100224580 | 3300006881 | Bacteria | 1470 |
| 198 | Ga0068865_100364035 | 3300006881 | Bacteria | 1175 |
| 199 | Ga0075436_100126729 | 3300006914 | Bacteria | 1789 |
| 200 | Ga0075436_100579989 | 3300006914 | Bacteria | 825 |
| 201 | Ga0097620_100236126 | 3300006931 | Bacteria | 1917 |
| 202 | Ga0097620_100556076 | 3300006931 | Bacteria | 1242 |
| 203 | Ga0097620_100601173 | 3300006931 | Bacteria | 1193 |
| 204 | Ga0097620_100671067 | 3300006931 | Bacteria | 1128 |
| 205 | Ga0097620_101394244 | 3300006931 | Bacteria | 773 |
| 206 | Ga0097620_101719392 | 3300006931 | Unclassified | 693 |
| 207 | Ga0099795_10080970 | 3300007788 | Bacteria | 1242 |
| 208 | Ga0111539_10000110 | 3300009094 | Bacteria | 89582 |
| 209 | Ga0111539_10006055 | 3300009094 | Bacteria | 15613 |
| 210 | Ga0111539_10128261 | 3300009094 | Bacteria | 2971 |
| 211 | Ga0111539_10334892 | 3300009094 | Bacteria | 1762 |
| 212 | Ga0111539_10481097 | 3300009094 | Bacteria | 1446 |
| 213 | Ga0111539_11388299 | 3300009094 | Bacteria | 815 |
| 214 | Ga0105245_10004699 | 3300009098 | Bacteria | 12074 |
| 215 | Ga0105245_10043372 | 3300009098 | Bacteria | 4012 |
| 216 | Ga0105245_10071285 | 3300009098 | Bacteria | 3156 |
| 217 | Ga0105245_10312623 | 3300009098 | Unclassified | 1545 |
| 218 | Ga0105245_11598265 | 3300009098 | Bacteria | 704 |
| 219 | Ga0105247_10331006 | 3300009101 | Bacteria | 1065 |
| 220 | Ga0114129_10016973 | 3300009147 | Bacteria | 10364 |
| 221 | Ga0114129_10115349 | 3300009147 | Bacteria | 3702 |
| 222 | Ga0114129_10144972 | 3300009147 | Bacteria | 3253 |
| 223 | Ga0114129_10166491 | 3300009147 | Bacteria | 3008 |
| 224 | Ga0114129_10167101 | 3300009147 | Bacteria | 3001 |
| 225 | Ga0114129_10192014 | 3300009147 | Bacteria | 2773 |
| 226 | Ga0114129_10258808 | 3300009147 | Bacteria | 2334 |
| 227 | Ga0114129_10339426 | 3300009147 | Bacteria | 1993 |
| 228 | Ga0114129_10478137 | 3300009147 | Bacteria | 1630 |
| 229 | Ga0114129_10771267 | 3300009147 | Bacteria | 1229 |
| 230 | Ga0114129_10821158 | 3300009147 | Bacteria | 1184 |
| 231 | Ga0114129_10951160 | 3300009147 | Bacteria | 1085 |
| 232 | Ga0114129_11410137 | 3300009147 | Unclassified | 859 |
| 233 | Ga0105243_10072153 | 3300009148 | Bacteria | 2794 |
| 234 | Ga0105243_10317937 | 3300009148 | Bacteria | 1417 |
| 235 | Ga0105243_10615826 | 3300009148 | Bacteria | 1047 |
| 236 | Ga0105241_10168629 | 3300009174 | Bacteria | 1806 |
| 237 | Ga0105242_10014322 | 3300009176 | Bacteria | 6142 |
| 238 | Ga0105242_10830843 | 3300009176 | Bacteria | 917 |
| 239 | Ga0105248_10022048 | 3300009177 | Bacteria | 7058 |
| 240 | Ga0105248_10164539 | 3300009177 | Bacteria | 2501 |
| 241 | Ga0105248_10270379 | 3300009177 | Bacteria | 1914 |
| 242 | Ga0105248_10325098 | 3300009177 | Bacteria | 1732 |
| 243 | Ga0105237_10880066 | 3300009545 | Bacteria | 902 |
| 244 | Ga0105238_10857064 | 3300009551 | Bacteria | 926 |
| 245 | Ga0105249_10018525 | 3300009553 | Bacteria | 6199 |
| 246 | Ga0105249_10033632 | 3300009553 | Bacteria | 4643 |
| 247 | Ga0105249_10238191 | 3300009553 | Bacteria | 1798 |
| 248 | Ga0105249_11428902 | 3300009553 | Bacteria | 764 |
| 249 | Ga0105239_10228485 | 3300010375 | Bacteria | 2088 |
| 250 | Ga0105246_10063172 | 3300011119 | Bacteria | 2582 |
| 251 | Ga0105246_10858057 | 3300011119 | Bacteria | 811 |
| 252 | Ga0157369_10233573 | 3300013105 | Unclassified | 1922 |
| 253 | Ga0157374_10417883 | 3300013296 | Bacteria | 1339 |
| 254 | Ga0157378_10016420 | 3300013297 | Bacteria | 6482 |
| 255 | Ga0157378_10594135 | 3300013297 | Bacteria | 1117 |
| 256 | Ga0163162_10626843 | 3300013306 | Bacteria | 1200 |
| 257 | Ga0163162_10777609 | 3300013306 | Bacteria | 1076 |
| 258 | Ga0157372_10523282 | 3300013307 | Bacteria | 1382 |
| 259 | Ga0157372_10579110 | 3300013307 | Bacteria | 1308 |
| 260 | Ga0157375_10329144 | 3300013308 | Bacteria | 1692 |
| 261 | Ga0157375_10566545 | 3300013308 | Bacteria | 1297 |
| 262 | Ga0157375_10768000 | 3300013308 | Bacteria | 1114 |
| 263 | Ga0163163_10180257 | 3300014325 | Bacteria | 2159 |
| 264 | Ga0163163_10724530 | 3300014325 | Bacteria | 1058 |
| 265 | Ga0157380_10001497 | 3300014326 | Bacteria | 15304 |
| 266 | Ga0157380_10039100 | 3300014326 | Bacteria | 3687 |
| 267 | Ga0157380_10301675 | 3300014326 | Bacteria | 1476 |
| 268 | Ga0157380_10478395 | 3300014326 | Bacteria | 1204 |
| 269 | Ga0157380_10531283 | 3300014326 | Bacteria | 1149 |
| 270 | Ga0157380_10610071 | 3300014326 | Bacteria | 1081 |
| 271 | Ga0182008_10428171 | 3300014497 | Bacteria | 716 |
| 272 | Ga0157377_10381980 | 3300014745 | Bacteria | 954 |
| 273 | Ga0157379_10451049 | 3300014968 | Bacteria | 1187 |
| 274 | Ga0157379_10866608 | 3300014968 | Bacteria | 855 |
| 275 | Ga0157376_10254219 | 3300014969 | Bacteria | 1643 |
| 276 | Ga0157376_11072503 | 3300014969 | Bacteria | 830 |
| 277 | Ga0182005_1104953 | 3300015265 | Bacteria | 794 |
| 278 | Ga0206354_10751738 | 3300020081 | Bacteria | 991 |
| 279 | Ga0207666_1005149 | 3300025271 | Bacteria | 1664 |
| 280 | Ga0207666_1008909 | 3300025271 | Unclassified | 1347 |
| 281 | Ga0207692_10072891 | 3300025898 | Bacteria | 1815 |
| 282 | Ga0207688_10088408 | 3300025901 | Bacteria | 1777 |
| 283 | Ga0207688_10344855 | 3300025901 | Bacteria | 917 |
| 284 | Ga0207647_10017518 | 3300025904 | Bacteria | 4869 |
| 285 | Ga0207685_10002871 | 3300025905 | Bacteria | 4061 |
| 286 | Ga0207699_10001824 | 3300025906 | Bacteria | 10018 |
| 287 | Ga0207645_10218233 | 3300025907 | Bacteria | 1257 |
| 288 | Ga0207643_10176807 | 3300025908 | Bacteria | 1290 |
| 289 | Ga0207643_10270922 | 3300025908 | Bacteria | 1051 |
| 290 | Ga0207684_10058146 | 3300025910 | Bacteria | 3281 |
| 291 | Ga0207663_10037528 | 3300025916 | Bacteria | 2921 |
| 292 | Ga0207660_10729165 | 3300025917 | Bacteria | 809 |
| 293 | Ga0207662_10291743 | 3300025918 | Bacteria | 1082 |
| 294 | Ga0207657_10104822 | 3300025919 | Bacteria | 2342 |
| 295 | Ga0207681_10074023 | 3300025923 | Bacteria | 2385 |
| 296 | Ga0207681_10483471 | 3300025923 | Bacteria | 1012 |
| 297 | Ga0207650_10202423 | 3300025925 | Bacteria | 1591 |
| 298 | Ga0207650_10311601 | 3300025925 | Bacteria | 1287 |
| 299 | Ga0207659_10012329 | 3300025926 | Bacteria | 5435 |
| 300 | Ga0207687_10063009 | 3300025927 | Unclassified | 2624 |
| 301 | Ga0207687_10070357 | 3300025927 | Bacteria | 2498 |
| 302 | Ga0207687_10186334 | 3300025927 | Bacteria | 1611 |
| 303 | Ga0207687_10225973 | 3300025927 | Unclassified | 1476 |
| 304 | Ga0207700_10020467 | 3300025928 | Bacteria | 4495 |
| 305 | Ga0207700_10086275 | 3300025928 | Bacteria | 2466 |
| 306 | Ga0207664_10027469 | 3300025929 | Bacteria | 4314 |
| 307 | Ga0207664_10143585 | 3300025929 | Bacteria | 2022 |
| 308 | Ga0207644_10122242 | 3300025931 | Bacteria | 1983 |
| 309 | Ga0207644_10495168 | 3300025931 | Bacteria | 1008 |
| 310 | Ga0207644_10876223 | 3300025931 | Bacteria | 752 |
| 311 | Ga0207690_10093900 | 3300025932 | Bacteria | 2127 |
| 312 | Ga0207706_10102914 | 3300025933 | Bacteria | 2512 |
| 313 | Ga0207706_10347199 | 3300025933 | Bacteria | 1290 |
| 314 | Ga0207686_10162872 | 3300025934 | Bacteria | 1565 |
| 315 | Ga0207686_10644087 | 3300025934 | Bacteria | 838 |
| 316 | Ga0207709_10208021 | 3300025935 | Bacteria | 1402 |
| 317 | Ga0207709_10547171 | 3300025935 | Bacteria | 910 |
| 318 | Ga0207670_10103006 | 3300025936 | Bacteria | 2042 |
| 319 | Ga0207670_10131242 | 3300025936 | Unclassified | 1836 |
| 320 | Ga0207669_10093298 | 3300025937 | Bacteria | 1967 |
| 321 | Ga0207669_10317373 | 3300025937 | Bacteria | 1191 |
| 322 | Ga0207669_10323124 | 3300025937 | Bacteria | 1182 |
| 323 | Ga0207665_10005700 | 3300025939 | Bacteria | 8296 |
| 324 | Ga0207665_10311295 | 3300025939 | Bacteria | 1180 |
| 325 | Ga0207691_10334561 | 3300025940 | Bacteria | 1297 |
| 326 | Ga0207711_10261275 | 3300025941 | Bacteria | 1591 |
| 327 | Ga0207711_10358806 | 3300025941 | Bacteria | 1350 |
| 328 | Ga0207689_10023691 | 3300025942 | Bacteria | 5149 |
| 329 | Ga0207689_10195544 | 3300025942 | Bacteria | 1669 |
| 330 | Ga0207689_10390392 | 3300025942 | Bacteria | 1159 |
| 331 | Ga0207689_10652442 | 3300025942 | Bacteria | 887 |
| 332 | Ga0207661_10023760 | 3300025944 | Bacteria | 4636 |
| 333 | Ga0207661_10079283 | 3300025944 | Bacteria | 2706 |
| 334 | Ga0207661_10445170 | 3300025944 | Bacteria | 1179 |
| 335 | Ga0207661_10555287 | 3300025944 | Bacteria | 1052 |
| 336 | Ga0207661_10743084 | 3300025944 | Unclassified | 903 |
| 337 | Ga0207679_10003783 | 3300025945 | Bacteria | 9376 |
| 338 | Ga0207679_10017782 | 3300025945 | Bacteria | 4750 |
| 339 | Ga0207679_10109228 | 3300025945 | Bacteria | 2179 |
| 340 | Ga0207651_10477643 | 3300025960 | Bacteria | 1074 |
| 341 | Ga0207712_10022581 | 3300025961 | Unclassified | 4144 |
| 342 | Ga0207712_10033845 | 3300025961 | Bacteria | 3457 |
| 343 | Ga0207712_10740553 | 3300025961 | Bacteria | 860 |
| 344 | Ga0207668_10464699 | 3300025972 | Bacteria | 1083 |
| 345 | Ga0207640_10401150 | 3300025981 | Bacteria | 1117 |
| 346 | Ga0207658_11080776 | 3300025986 | Bacteria | 733 |
| 347 | Ga0207658_11262341 | 3300025986 | Unclassified | 675 |
| 348 | Ga0207677_10015480 | 3300026023 | Bacteria | 4489 |
| 349 | Ga0207677_10227004 | 3300026023 | Bacteria | 1501 |
| 350 | Ga0207677_10535189 | 3300026023 | Bacteria | 1018 |
| 351 | Ga0207703_10117204 | 3300026035 | Bacteria | 2281 |
| 352 | Ga0207639_10327538 | 3300026041 | Unclassified | 1362 |
| 353 | Ga0207678_10075224 | 3300026067 | Bacteria | 2893 |
| 354 | Ga0207678_10307817 | 3300026067 | Bacteria | 1362 |
| 355 | Ga0207708_10107995 | 3300026075 | Bacteria | 2158 |
| 356 | Ga0207708_10114546 | 3300026075 | Bacteria | 2096 |
| 357 | Ga0207708_10142912 | 3300026075 | Bacteria | 1878 |
| 358 | Ga0207708_10544285 | 3300026075 | Bacteria | 978 |
| 359 | Ga0207708_10618568 | 3300026075 | Bacteria | 919 |
| 360 | Ga0207708_11040785 | 3300026075 | Bacteria | 712 |
| 361 | Ga0207641_10255892 | 3300026088 | Bacteria | 1637 |
| 362 | Ga0207641_10702647 | 3300026088 | Bacteria | 996 |
| 363 | Ga0207641_10718354 | 3300026088 | Bacteria | 985 |
| 364 | Ga0207648_10018650 | 3300026089 | Bacteria | 6279 |
| 365 | Ga0207676_10589673 | 3300026095 | Bacteria | 1066 |
| 366 | Ga0207674_10001699 | 3300026116 | Bacteria | 28201 |
| 367 | Ga0207674_10093831 | 3300026116 | Bacteria | 2989 |
| 368 | Ga0207674_10118203 | 3300026116 | Bacteria | 2621 |
| 369 | Ga0207674_10153566 | 3300026116 | Unclassified | 2258 |
| 370 | Ga0207674_10158399 | 3300026116 | Bacteria | 2219 |
| 371 | Ga0207674_10635169 | 3300026116 | Bacteria | 1031 |
| 372 | Ga0207675_100058587 | 3300026118 | Bacteria | 3594 |
| 373 | Ga0207675_100099074 | 3300026118 | Bacteria | 2745 |
| 374 | Ga0207675_100210881 | 3300026118 | Bacteria | 1868 |
| 375 | Ga0207675_100378084 | 3300026118 | Bacteria | 1392 |
| 376 | Ga0207683_10178261 | 3300026121 | Bacteria | 1926 |
| 377 | Ga0207683_10381665 | 3300026121 | Bacteria | 1295 |
| 378 | Ga0207683_10495359 | 3300026121 | Bacteria | 1128 |
| 379 | Ga0207683_10499319 | 3300026121 | Bacteria | 1124 |
| 380 | Ga0207698_10547765 | 3300026142 | Bacteria | 1133 |
| 381 | Ga0207698_10998889 | 3300026142 | Bacteria | 847 |
| 382 | Ga0207428_10009550 | 3300027907 | Bacteria | 8691 |
| 383 | Ga0207428_10047422 | 3300027907 | Bacteria | 3450 |
| 384 | Ga0207428_10148513 | 3300027907 | Bacteria | 1785 |
| 385 | Ga0268266_10357276 | 3300028379 | Unclassified | 1374 |
| 386 | Ga0268266_11034862 | 3300028379 | Bacteria | 794 |
| 387 | Ga0268265_10044792 | 3300028380 | Bacteria | 3297 |
| 388 | Ga0268265_10075273 | 3300028380 | Bacteria | 2644 |
| 389 | Ga0268265_10141845 | 3300028380 | Bacteria | 2013 |
| 390 | Ga0268265_10146018 | 3300028380 | Bacteria | 1988 |
| 391 | Ga0268265_10203817 | 3300028380 | Bacteria | 1718 |
| 392 | Ga0268265_10417880 | 3300028380 | Bacteria | 1244 |
| 393 | Ga0268265_10634508 | 3300028380 | Unclassified | 1025 |
| 394 | Ga0268265_10712170 | 3300028380 | Unclassified | 971 |
| 395 | Ga0268264_10005820 | 3300028381 | Bacteria | 10451 |
| 396 | Ga0307513_10554142 | 3300031456 | Bacteria | 862 |
| 397 | Ga0307408_100096534 | 3300031548 | Bacteria | 2243 |
| 398 | Ga0307408_100329127 | 3300031548 | Unclassified | 1289 |
| 399 | Ga0316576_10183753 | 3300031727 | Bacteria | 1577 |
| 400 | Ga0316578_10024241 | 3300031728 | Bacteria | 3402 |
| 401 | Ga0316578_10210999 | 3300031728 | Bacteria | 1168 |
| 402 | Ga0307405_10002249 | 3300031731 | Bacteria | 8447 |
| 403 | Ga0307405_10223959 | 3300031731 | Unclassified | 1382 |
| 404 | Ga0307405_10271313 | 3300031731 | Bacteria | 1272 |
| 405 | Ga0307405_10432311 | 3300031731 | Bacteria | 1039 |
| 406 | Ga0307405_10556663 | 3300031731 | Unclassified | 929 |
| 407 | Ga0307405_10574141 | 3300031731 | Unclassified | 916 |
| 408 | Ga0307405_10624666 | 3300031731 | Bacteria | 882 |
| 409 | Ga0316577_10268008 | 3300031733 | Unclassified | 966 |
| 410 | Ga0307413_10798174 | 3300031824 | Bacteria | 793 |
| 411 | Ga0307410_10059046 | 3300031852 | Bacteria | 2617 |
| 412 | Ga0307410_10100342 | 3300031852 | Bacteria | 2073 |
| 413 | Ga0307410_10874205 | 3300031852 | Bacteria | 769 |
| 414 | Ga0326468_10000188 | 3300031889 | Bacteria | 6294 |
| 415 | Ga0307406_10012241 | 3300031901 | Bacteria | 4889 |
| 416 | Ga0307406_10017809 | 3300031901 | Bacteria | 4142 |
| 417 | Ga0307406_10188488 | 3300031901 | Bacteria | 1508 |
| 418 | Ga0307406_10413422 | 3300031901 | Bacteria | 1073 |
| 419 | Ga0307406_10498221 | 3300031901 | Bacteria | 987 |
| 420 | Ga0307406_10697519 | 3300031901 | Unclassified | 847 |
| 421 | Ga0307407_10019808 | 3300031903 | Bacteria | 3433 |
| 422 | Ga0307407_10396063 | 3300031903 | Unclassified | 989 |
| 423 | Ga0307407_10865524 | 3300031903 | Bacteria | 691 |
| 424 | Ga0307412_10031284 | 3300031911 | Bacteria | 3360 |
| 425 | Ga0307409_100028114 | 3300031995 | Bacteria | 3999 |
| 426 | Ga0307409_100033170 | 3300031995 | Bacteria | 3754 |
| 427 | Ga0307409_100067406 | 3300031995 | Bacteria | 2826 |
| 428 | Ga0307409_100156504 | 3300031995 | Bacteria | 1986 |
| 429 | Ga0307409_100270315 | 3300031995 | Bacteria | 1565 |
| 430 | Ga0307409_100279949 | 3300031995 | Bacteria | 1541 |
| 431 | Ga0307409_100638527 | 3300031995 | Bacteria | 1057 |
| 432 | Ga0307409_100961066 | 3300031995 | Bacteria | 871 |
| 433 | Ga0307409_101001784 | 3300031995 | Bacteria | 854 |
| 434 | Ga0307409_101454018 | 3300031995 | Bacteria | 712 |
| 435 | Ga0307416_100001369 | 3300032002 | Bacteria | 13159 |
| 436 | Ga0307416_100035409 | 3300032002 | Bacteria | 3812 |
| 437 | Ga0307416_100051929 | 3300032002 | Bacteria | 3278 |
| 438 | Ga0307416_100264107 | 3300032002 | Bacteria | 1685 |
| 439 | Ga0307416_100802462 | 3300032002 | Bacteria | 1037 |
| 440 | Ga0307416_101200250 | 3300032002 | Unclassified | 864 |
| 441 | Ga0307416_101725282 | 3300032002 | Bacteria | 731 |
| 442 | Ga0307411_10059767 | 3300032005 | Bacteria | 2528 |
| 443 | Ga0307415_100000062 | 3300032126 | Bacteria | 45009 |
| 444 | Ga0307415_100005187 | 3300032126 | Bacteria | 6881 |
| 445 | Ga0307415_100015628 | 3300032126 | Bacteria | 4502 |
| 446 | Ga0307415_100107083 | 3300032126 | Bacteria | 2065 |
| 447 | Ga0307415_100138799 | 3300032126 | Bacteria | 1853 |
| 448 | Ga0307415_100171192 | 3300032126 | Bacteria | 1694 |
| 449 | Ga0307415_100299209 | 3300032126 | Bacteria | 1332 |
| 450 | Ga0307507_10061391 | 3300033179 | Bacteria | 3500 |
| 451 | Ga0373926_0031510 | 3300035083 | Bacteria | 1870 |
| 452 | Ga0373944_0137571 | 3300035089 | Bacteria | 853 |
| 453 | Ga0373923_0064483 | 3300035111 | Bacteria | 1562 |
| 454 | Ga0373936_0021561 | 3300035113 | Bacteria | 2506 |
| 455 | Ga0373941_0098995 | 3300035115 | Unclassified | 1012 |
| 456 | Ga0373956_0055707 | 3300035119 | Bacteria | 1784 |
| 457 | Ga0373960_0006574 | 3300035121 | Bacteria | 2732 |
| 458 | Ga0373943_0607148 | 3300035170 | Bacteria | 645 |
| 459 | Ga0373946_0117570 | 3300035171 | Bacteria | 1210 |
| 460 | Ga0373955_0040691 | 3300035172 | Bacteria | 2487 |
| 461 | Ga0373962_0122064 | 3300035242 | Bacteria | 832 |
| 462 | Ga0373962_0130577 | 3300035242 | Bacteria | 809 |
| 463 | Ga0316574_0062049 | 3300035398 | Bacteria | 2348 |
| 464 | Ga0316574_0071577 | 3300035398 | Bacteria | 2190 |
| 465 | Ga0316574_0100937 | 3300035398 | Bacteria | 1847 |
| 466 | Ga0316574_0101865 | 3300035398 | Bacteria | 1838 |
| 467 | Ga0373924_0040831 | 3300035410 | Bacteria | 1900 |
| 468 | Ga0373931_0363538 | 3300035691 | Bacteria | 908 |
| 469 | Ga0373931_0406664 | 3300035691 | Bacteria | 863 |
| 470 | Ga0373935_0196659 | 3300035692 | Bacteria | 1391 |
| 471 | Ga0373935_0382615 | 3300035692 | Bacteria | 1008 |
| 472 | Ga0373935_0635588 | 3300035692 | Bacteria | 782 |
| 473 | Ga0373927_0005542 | 3300035695 | Bacteria | 8688 |
| 474 | Ga0373927_0089361 | 3300035695 | Bacteria | 2000 |
| 475 | Ga0373927_0094308 | 3300035695 | Bacteria | 1945 |
| 476 | Ga0373927_0167024 | 3300035695 | Bacteria | 1442 |
| 477 | Ga0373927_0251611 | 3300035695 | Bacteria | 1161 |
| 478 | Ga0373933_0012722 | 3300035724 | Bacteria | 4651 |
| 479 | Ga0373933_0043596 | 3300035724 | Unclassified | 2655 |
| 480 | Ga0373947_0027228 | 3300035725 | Bacteria | 3345 |
| 481 | Ga0373947_0176819 | 3300035725 | Bacteria | 1388 |
| 482 | Ga0373937_0005105 | 3300036401 | Bacteria | 11183 |
| 483 | Ga0373937_0014768 | 3300036401 | Bacteria | 6894 |
| 484 | Ga0373937_0568782 | 3300036401 | Bacteria | 1077 |
| 485 | Ga0316582_0073242 | 3300036647 | Bacteria | 2223 |
| 486 | Ga0316584_0010254 | 3300036712 | Bacteria | 6545 |
| 487 | Ga0316584_0077384 | 3300036712 | Bacteria | 2492 |
| 488 | Ga0373925_0039804 | 3300037068 | Bacteria | 3478 |
| 489 | Ga0373925_1123506 | 3300037068 | Bacteria | 646 |
| 490 | Ga0395899_0026456 | 3300037312 | Bacteria | 4379 |
| 491 | Ga0395899_0036613 | 3300037312 | Bacteria | 3680 |
| 492 | Ga0395900_0017448 | 3300037418 | Bacteria | 7328 |
| 493 | Ga0395900_0122124 | 3300037418 | Bacteria | 2672 |
| 494 | Ga0395900_0150567 | 3300037418 | Bacteria | 2377 |
| 495 | Ga0395900_0175075 | 3300037418 | Bacteria | 2182 |
| 496 | Ga0395900_0578696 | 3300037418 | Bacteria | 1065 |
| 497 | Ga0395900_1309179 | 3300037418 | Unclassified | 638 |
| 498 | Ga0395898_0015353 | 3300037466 | Bacteria | 7853 |
| 499 | Ga0395898_0255855 | 3300037466 | Unclassified | 1670 |
| 500 | Ga0395898_0370976 | 3300037466 | Bacteria | 1365 |
| 501 | Ga0395905_0031331 | 3300037471 | Bacteria | 5006 |
| 502 | Ga0395905_0042789 | 3300037471 | Bacteria | 4249 |
| 503 | Ga0395905_0131660 | 3300037471 | Bacteria | 2352 |
| 504 | Ga0395905_0173746 | 3300037471 | Bacteria | 2023 |
| 505 | Ga0395905_0198962 | 3300037471 | Bacteria | 1879 |
| 506 | Ga0436364_0584685 | 3300037853 | Unclassified | 1961 |
| 507 | Ga0395901_0008943 | 3300038443 | Bacteria | 10142 |
| 508 | Ga0395901_0022893 | 3300038443 | Bacteria | 6406 |
| 509 | Ga0395901_0043358 | 3300038443 | Bacteria | 4667 |
| 510 | Ga0395901_0084370 | 3300038443 | Bacteria | 3320 |
| 511 | Ga0395901_0215521 | 3300038443 | Bacteria | 2008 |
| 512 | Ga0395901_0240017 | 3300038443 | Bacteria | 1890 |
| 513 | Ga0395901_1111877 | 3300038443 | Bacteria | 760 |
| 514 | Ga0436363_0333332 | 3300039450 | Bacteria | 2116 |
| 515 | Ga0439436_0104687 | 3300041404 | Bacteria | 789 |
| 516 | Ga0451853_2034849 | 3300041512 | Bacteria | 1592 |
| 517 | Ga0451853_3543434 | 3300041512 | Bacteria | 777 |
| 518 | Ga0439443_002387 | 3300042003 | Bacteria | 2242 |
| 519 | Ga0439448_0023992 | 3300042005 | Bacteria | 1905 |
| 520 | Ga0439448_0034932 | 3300042005 | Bacteria | 1608 |
| 521 | Ga0439448_0074053 | 3300042005 | Bacteria | 1137 |
| 522 | Ga0439449_0110606 | 3300042007 | Bacteria | 1018 |
| 523 | Ga0439450_003858 | 3300042008 | Bacteria | 2516 |
| 524 | Ga0439455_0053815 | 3300042012 | Bacteria | 1056 |
| 525 | Ga0439463_016811 | 3300042016 | Bacteria | 1810 |
| 526 | Ga0439463_103725 | 3300042016 | Bacteria | 734 |
| 527 | Ga0450888_028337 | 3300042126 | Bacteria | 741 |
| 528 | Ga0450904_016427 | 3300042139 | Bacteria | 741 |
| 529 | Ga0439459_0061355 | 3300042438 | Bacteria | 850 |
| 530 | Ga0439460_0027907 | 3300042461 | Bacteria | 1589 |
| 531 | Ga0439460_0128551 | 3300042461 | Bacteria | 834 |
| 532 | Ga0450916_005602 | 3300042530 | Unclassified | 1457 |
| 533 | Ga0439440_0017687 | 3300042993 | Bacteria | 1572 |
| 534 | Ga0439440_0080878 | 3300042993 | Unclassified | 859 |
| 535 | Ga0466972_0145684 | 3300044658 | Bacteria | 1114 |
| 536 | Ga0466972_0181448 | 3300044658 | Bacteria | 987 |
| 537 | Ga0466965_0039043 | 3300044683 | Bacteria | 2333 |
| 538 | Ga0466965_0195306 | 3300044683 | Bacteria | 1072 |
| 539 | Ga0466963_0048883 | 3300044694 | Bacteria | 2796 |
| 540 | Ga0466963_0607321 | 3300044694 | Bacteria | 772 |
| 541 | Ga0466964_0013700 | 3300044706 | Bacteria | 3077 |
| 542 | Ga0466964_0479025 | 3300044706 | Bacteria | 665 |
| 543 | Ga0466971_0115148 | 3300044719 | Bacteria | 1242 |
| 544 | Ga0466970_0103545 | 3300044765 | Bacteria | 1551 |
| 545 | Ga0466957_0016990 | 3300044842 | Bacteria | 4257 |
| 546 | Ga0466960_0197491 | 3300044901 | Bacteria | 1097 |
| 547 | Ga0466960_0233550 | 3300044901 | Bacteria | 1016 |
| 548 | Ga0466959_0508411 | 3300045049 | Bacteria | 814 |
| 549 | Ga0466967_0018937 | 3300045976 | Bacteria | 5522 |
| 550 | Ga0466967_0074479 | 3300045976 | Unclassified | 3049 |
| 551 | Ga0466967_0165280 | 3300045976 | Bacteria | 2079 |
| 552 | Ga0466967_0180558 | 3300045976 | Bacteria | 1990 |
| 553 | Ga0466967_0316511 | 3300045976 | Bacteria | 1504 |
| 554 | Ga0466967_0524080 | 3300045976 | Bacteria | 1165 |
| 555 | Ga0495617_027975 | 3300046452 | Bacteria | 1896 |
| 556 | Ga0495592_0026090 | 3300046454 | Bacteria | 4433 |
| 557 | Ga0495592_0239910 | 3300046454 | Bacteria | 1203 |
| 558 | Ga0495603_0156972 | 3300046455 | Bacteria | 1320 |
| 559 | Ga0495603_0308766 | 3300046455 | Bacteria | 908 |
| 560 | Ga0495603_0570877 | 3300046455 | Bacteria | 648 |
| 561 | Ga0495603_0590159 | 3300046455 | Bacteria | 636 |
| 562 | Ga0495629_0007280 | 3300046459 | Bacteria | 8149 |
| 563 | Ga0495629_0017398 | 3300046459 | Bacteria | 5152 |
| 564 | Ga0495641_0005202 | 3300046461 | Bacteria | 8878 |
| 565 | Ga0495641_0261003 | 3300046461 | Bacteria | 779 |
| 566 | Ga0495651_0074238 | 3300046462 | Bacteria | 2580 |
| 567 | Ga0495651_0086119 | 3300046462 | Unclassified | 2365 |
| 568 | Ga0495651_0341126 | 3300046462 | Bacteria | 993 |
| 569 | Ga0495653_0010732 | 3300046463 | Bacteria | 7501 |
| 570 | Ga0495653_0015635 | 3300046463 | Bacteria | 6186 |
| 571 | Ga0495653_0697607 | 3300046463 | Unclassified | 617 |
| 572 | Ga0495650_0122359 | 3300046471 | Bacteria | 957 |
| 573 | Ga0495580_0008439 | 3300046472 | Bacteria | 8195 |
| 574 | Ga0495580_0180051 | 3300046472 | Unclassified | 1460 |
| 575 | Ga0495582_0004846 | 3300046473 | Bacteria | 7548 |
| 576 | Ga0495582_0028187 | 3300046473 | Bacteria | 3082 |
| 577 | Ga0495582_0114188 | 3300046473 | Bacteria | 1518 |
| 578 | Ga0495582_0215942 | 3300046473 | Bacteria | 1097 |
| 579 | Ga0495639_0004795 | 3300046475 | Bacteria | 5815 |
| 580 | Ga0495662_0015684 | 3300046476 | Bacteria | 3677 |
| 581 | Ga0495662_0016596 | 3300046476 | Bacteria | 3568 |
| 582 | Ga0495664_0117563 | 3300046477 | Bacteria | 1607 |
| 583 | Ga0495664_0296610 | 3300046477 | Bacteria | 976 |
| 584 | Ga0495664_0418290 | 3300046477 | Unclassified | 804 |
| 585 | Ga0495585_0052022 | 3300046492 | Bacteria | 2268 |
| 586 | Ga0495594_0003880 | 3300046499 | Bacteria | 7688 |
| 587 | Ga0495607_0088444 | 3300046501 | Bacteria | 1684 |
| 588 | Ga0495608_0016303 | 3300046511 | Bacteria | 5140 |
| 589 | Ga0495616_0108352 | 3300046513 | Bacteria | 1293 |
| 590 | Ga0495618_0015130 | 3300046514 | Bacteria | 4706 |
| 591 | Ga0495618_0287090 | 3300046514 | Bacteria | 1025 |
| 592 | Ga0495618_0314611 | 3300046514 | Bacteria | 971 |
| 593 | Ga0495618_0345456 | 3300046514 | Bacteria | 918 |
| 594 | Ga0495620_0200805 | 3300046515 | Bacteria | 767 |
| 595 | Ga0495628_0015811 | 3300046516 | Bacteria | 6298 |
| 596 | Ga0495628_0067847 | 3300046516 | Bacteria | 2784 |
| 597 | Ga0495628_0156227 | 3300046516 | Unclassified | 1735 |
| 598 | Ga0495628_0426084 | 3300046516 | Bacteria | 966 |
| 599 | Ga0495630_0013920 | 3300046517 | Bacteria | 5851 |
| 600 | Ga0495630_0023575 | 3300046517 | Bacteria | 4549 |
| 601 | Ga0495631_0063105 | 3300046518 | Bacteria | 1605 |
| 602 | Ga0495631_0197629 | 3300046518 | Bacteria | 860 |
| 603 | Ga0495632_0099894 | 3300046519 | Bacteria | 1368 |
| 604 | Ga0495632_0156169 | 3300046519 | Bacteria | 1053 |
| 605 | Ga0495644_0015601 | 3300046523 | Bacteria | 2911 |
| 606 | Ga0495666_0110678 | 3300046526 | Bacteria | 1290 |
| 607 | Ga0495652_0047328 | 3300046529 | Bacteria | 3688 |
| 608 | Ga0495652_0197363 | 3300046529 | Bacteria | 1530 |
| 609 | Ga0495652_0228950 | 3300046529 | Bacteria | 1392 |
| 610 | Ga0495665_0000492 | 3300046531 | Bacteria | 19853 |
| 611 | Ga0495665_0207816 | 3300046531 | Bacteria | 1014 |
| 612 | Ga0495640_0084675 | 3300046533 | Bacteria | 2102 |
| 613 | Ga0495586_0242250 | 3300046535 | Bacteria | 1028 |
| 614 | Ga0495598_0047661 | 3300046537 | Bacteria | 1278 |
| 615 | Ga0495609_0170249 | 3300046538 | Bacteria | 920 |
| 616 | Ga0495621_0107029 | 3300046539 | Bacteria | 1069 |
| 617 | Ga0495645_0056971 | 3300046543 | Bacteria | 2837 |
| 618 | Ga0495622_0015630 | 3300046557 | Bacteria | 3527 |
| 619 | Ga0495633_0069770 | 3300046558 | Bacteria | 1640 |
| 620 | Ga0495667_0006426 | 3300046559 | Bacteria | 7972 |
| 621 | Ga0495667_0015093 | 3300046559 | Bacteria | 5215 |
| 622 | Ga0495667_0074920 | 3300046559 | Unclassified | 2203 |
| 623 | Ga0495656_0058374 | 3300046615 | Bacteria | 1674 |
| 624 | Ga0495668_0008468 | 3300046616 | Bacteria | 6417 |
| 625 | Ga0495634_0033124 | 3300046642 | Bacteria | 3551 |
| 626 | Ga0495634_0045870 | 3300046642 | Bacteria | 2952 |
| 627 | Ga0495634_0144678 | 3300046642 | Unclassified | 1507 |
| 628 | Ga0495634_0158202 | 3300046642 | Bacteria | 1430 |
| 629 | Ga0495611_0024261 | 3300046648 | Bacteria | 2638 |
| 630 | Ga0495611_0077992 | 3300046648 | Bacteria | 1520 |
| 631 | Ga0495625_0168955 | 3300046660 | Bacteria | 1461 |
| 632 | Ga0495635_0014622 | 3300046663 | Bacteria | 5490 |
| 633 | Ga0495635_0014899 | 3300046663 | Bacteria | 5441 |
| 634 | Ga0495635_0053207 | 3300046663 | Bacteria | 2789 |
| 635 | Ga0495661_0074306 | 3300046665 | Bacteria | 1979 |
| 636 | Ga0495588_0054144 | 3300046674 | Bacteria | 2070 |
| 637 | Ga0495657_0013171 | 3300046675 | Bacteria | 6111 |
| 638 | Ga0495657_0051671 | 3300046675 | Unclassified | 2759 |
| 639 | Ga0495599_0014724 | 3300046678 | Bacteria | 4843 |
| 640 | Ga0495623_0079452 | 3300046679 | Bacteria | 2032 |
| 641 | Ga0495623_0170485 | 3300046679 | Bacteria | 1272 |
| 642 | Ga0495646_0020610 | 3300046680 | Bacteria | 4171 |
| 643 | Ga0495646_0268941 | 3300046680 | Bacteria | 909 |
| 644 | Ga0495647_0197998 | 3300046681 | Bacteria | 880 |
| 645 | Ga0495647_0352447 | 3300046681 | Unclassified | 670 |
| 646 | Ga0495658_0006596 | 3300046683 | Bacteria | 5702 |
| 647 | Ga0495658_0101601 | 3300046683 | Bacteria | 1717 |
| 648 | Ga0495658_0529090 | 3300046683 | Bacteria | 755 |
| 649 | Ga0495669_0034574 | 3300046684 | Bacteria | 2228 |
| 650 | Ga0495669_0401308 | 3300046684 | Bacteria | 664 |
| 651 | Ga0495613_0056488 | 3300046689 | Bacteria | 2882 |
| 652 | Ga0495624_0011511 | 3300046690 | Bacteria | 6081 |
| 653 | Ga0495624_0299140 | 3300046690 | Bacteria | 970 |
| 654 | Ga0495670_0073285 | 3300046691 | Bacteria | 1735 |
| 655 | Ga0495671_0034743 | 3300046692 | Bacteria | 2562 |
| 656 | Ga0495600_0231893 | 3300046809 | Bacteria | 1178 |
| 657 | Ga0495581_0006807 | 3300047315 | Bacteria | 6627 |
| 658 | Ga0495581_0050721 | 3300047315 | Bacteria | 2397 |
| 659 | Ga0495604_0008697 | 3300047317 | Bacteria | 8024 |
| 660 | Ga0495636_0410133 | 3300047318 | Bacteria | 646 |
| 661 | Ga0495674_0018859 | 3300047319 | Bacteria | 6416 |
| 662 | Ga0495674_0022208 | 3300047319 | Bacteria | 5853 |
| 663 | Ga0495674_0087932 | 3300047319 | Bacteria | 2658 |
| 664 | Ga0495672_0127803 | 3300047320 | Bacteria | 1341 |
| 665 | Ga0495680_0002548 | 3300047322 | Bacteria | 18595 |
| 666 | Ga0495680_0016498 | 3300047322 | Bacteria | 6341 |
| 667 | Ga0495683_0178631 | 3300047323 | Bacteria | 971 |
| 668 | Ga0495677_0104083 | 3300047445 | Bacteria | 1076 |
| 669 | Ga0495684_0024232 | 3300047471 | Bacteria | 4671 |
| 670 | Ga0495684_0041602 | 3300047471 | Bacteria | 3522 |
| 671 | Ga0495684_0061853 | 3300047471 | Unclassified | 2848 |
| 672 | Ga0495684_0285757 | 3300047471 | Bacteria | 1189 |
| 673 | Ga0495593_0005800 | 3300047673 | Bacteria | 7282 |
| 674 | Ga0495593_0043690 | 3300047673 | Bacteria | 2400 |
| 675 | Ga0495602_0050962 | 3300048088 | Bacteria | 3693 |
| 676 | Ga0495602_0211551 | 3300048088 | Unclassified | 1471 |
| 677 | Ga0496100_0396607 | 3300048903 | Bacteria | 1050 |
| 678 | Ga0496100_0509086 | 3300048903 | Bacteria | 928 |
| 679 | Ga0496101_0777104 | 3300048904 | Bacteria | 755 |
| 680 | Ga0496101_0799976 | 3300048904 | Bacteria | 743 |
| 681 | Ga0496102_0057072 | 3300048905 | Bacteria | 3563 |
| 682 | Ga0496103_0059887 | 3300048906 | Bacteria | 2366 |
| 683 | Ga0496103_0309693 | 3300048906 | Bacteria | 1016 |
| 684 | Ga0496104_0047636 | 3300048907 | Bacteria | 4040 |
| 685 | Ga0496104_0071096 | 3300048907 | Bacteria | 3308 |
| 686 | Ga0496104_0136960 | 3300048907 | Bacteria | 2352 |
| 687 | Ga0496104_0140590 | 3300048907 | Bacteria | 2319 |
| 688 | Ga0496104_0160131 | 3300048907 | Bacteria | 2159 |
| 689 | Ga0496104_0202055 | 3300048907 | Bacteria | 1899 |
| 690 | Ga0496104_0300489 | 3300048907 | Bacteria | 1517 |
| 691 | Ga0496104_0567875 | 3300048907 | Bacteria | 1045 |
| 692 | Ga0496104_1333784 | 3300048907 | Bacteria | 621 |
| 693 | Ga0496105_0080716 | 3300048908 | Unclassified | 2687 |
| 694 | Ga0496105_0088465 | 3300048908 | Bacteria | 2559 |
| 695 | Ga0496105_0113494 | 3300048908 | Bacteria | 2236 |
| 696 | Ga0496105_0137244 | 3300048908 | Bacteria | 2014 |
| 697 | Ga0496105_0145896 | 3300048908 | Bacteria | 1946 |
| 698 | Ga0496107_0036002 | 3300048910 | Bacteria | 3550 |
| 699 | Ga0496107_0714208 | 3300048910 | Bacteria | 737 |
| 700 | Ga0496108_0004143 | 3300048911 | Bacteria | 11658 |
| 701 | Ga0496108_0017402 | 3300048911 | Bacteria | 5882 |
| 702 | Ga0496108_0038553 | 3300048911 | Bacteria | 3981 |
| 703 | Ga0496108_0145123 | 3300048911 | Bacteria | 2046 |
| 704 | Ga0496108_0187235 | 3300048911 | Bacteria | 1793 |
| 705 | Ga0496108_0250524 | 3300048911 | Bacteria | 1541 |
| 706 | Ga0496108_0443168 | 3300048911 | Bacteria | 1134 |
| 707 | Ga0496108_0450349 | 3300048911 | Bacteria | 1125 |
| 708 | Ga0496108_0491996 | 3300048911 | Bacteria | 1071 |
| 709 | Ga0496108_0755638 | 3300048911 | Bacteria | 841 |
| 710 | Ga0496109_0020555 | 3300048912 | Bacteria | 5831 |
| 711 | Ga0496109_0022763 | 3300048912 | Bacteria | 5552 |
| 712 | Ga0496109_0024072 | 3300048912 | Bacteria | 5410 |
| 713 | Ga0496109_0055056 | 3300048912 | Bacteria | 3629 |
| 714 | Ga0496109_0083907 | 3300048912 | Bacteria | 2938 |
| 715 | Ga0496109_0236443 | 3300048912 | Bacteria | 1719 |
| 716 | Ga0496109_0348394 | 3300048912 | Bacteria | 1399 |
| 717 | Ga0496109_0805222 | 3300048912 | Bacteria | 877 |
| 718 | Ga0496109_0941224 | 3300048912 | Bacteria | 802 |
| 719 | Ga0496110_0014250 | 3300048913 | Bacteria | 6596 |
| 720 | Ga0496110_0036836 | 3300048913 | Bacteria | 4250 |
| 721 | Ga0496110_0060353 | 3300048913 | Unclassified | 3344 |
| 722 | Ga0496110_0065141 | 3300048913 | Bacteria | 3221 |
| 723 | Ga0496110_0115839 | 3300048913 | Bacteria | 2412 |
| 724 | Ga0496110_0311269 | 3300048913 | Bacteria | 1434 |
| 725 | Ga0496110_0654060 | 3300048913 | Bacteria | 951 |
| 726 | Ga0496110_0877986 | 3300048913 | Bacteria | 802 |
| 727 | Ga0496111_0011606 | 3300048914 | Bacteria | 5942 |
| 728 | Ga0496111_0086690 | 3300048914 | Bacteria | 2291 |
| 729 | Ga0496111_0261318 | 3300048914 | Bacteria | 1284 |
| 730 | Ga0496111_0365687 | 3300048914 | Bacteria | 1067 |
| 731 | Ga0496111_0398191 | 3300048914 | Bacteria | 1018 |
| 732 | Ga0496111_0434746 | 3300048914 | Bacteria | 969 |
| 733 | Ga0496112_0076404 | 3300048915 | Bacteria | 3312 |
| 734 | Ga0496112_0159329 | 3300048915 | Bacteria | 2223 |
| 735 | Ga0496112_0229830 | 3300048915 | Bacteria | 1809 |
| 736 | Ga0496112_0370345 | 3300048915 | Bacteria | 1374 |
| 737 | Ga0496113_0028501 | 3300048916 | Bacteria | 4017 |
| 738 | Ga0496113_0091833 | 3300048916 | Bacteria | 2341 |
| 739 | Ga0496113_0108117 | 3300048916 | Bacteria | 2162 |
| 740 | Ga0496113_0421886 | 3300048916 | Bacteria | 1071 |
| 741 | Ga0496114_0013663 | 3300048917 | Bacteria | 6509 |
| 742 | Ga0496114_0120243 | 3300048917 | Bacteria | 2258 |
| 743 | Ga0496114_0207230 | 3300048917 | Bacteria | 1719 |
| 744 | Ga0496114_0340723 | 3300048917 | Bacteria | 1326 |
| 745 | Ga0496114_0387982 | 3300048917 | Bacteria | 1237 |
| 746 | Ga0496114_0562384 | 3300048917 | Bacteria | 1007 |
| 747 | Ga0496115_0203370 | 3300048918 | Bacteria | 1636 |
| 748 | Ga0496119_0280880 | 3300048922 | Unclassified | 828 |
| 749 | Ga0501031_0104826 | 3300049568 | Bacteria | 1845 |
| 750 | Ga0501031_0308444 | 3300049568 | Bacteria | 1025 |
| 751 | Ga0501032_0038677 | 3300049569 | Bacteria | 3247 |
| 752 | Ga0501032_0085904 | 3300049569 | Bacteria | 2091 |
| 753 | Ga0501032_0226568 | 3300049569 | Bacteria | 1216 |
| 754 | Ga0501033_0055098 | 3300049570 | Bacteria | 2940 |
| 755 | Ga0501033_0143315 | 3300049570 | Bacteria | 1727 |
| 756 | Ga0501033_0176175 | 3300049570 | Bacteria | 1534 |
| 757 | Ga0501033_0785511 | 3300049570 | Bacteria | 644 |
| 758 | Ga0501034_0005466 | 3300049571 | Bacteria | 13875 |
| 759 | Ga0501034_0235657 | 3300049571 | Bacteria | 1778 |
| 760 | Ga0501036_0007988 | 3300049572 | Bacteria | 8659 |
| 761 | Ga0501036_0031460 | 3300049572 | Bacteria | 4484 |
| 762 | Ga0501036_0420586 | 3300049572 | Bacteria | 1114 |
| 763 | Ga0501036_0437376 | 3300049572 | Bacteria | 1090 |
| 764 | Ga0501036_0636749 | 3300049572 | Bacteria | 883 |
| 765 | Ga0501036_0868242 | 3300049572 | Bacteria | 741 |
| 766 | Ga0501038_0016848 | 3300049574 | Bacteria | 6613 |
| 767 | Ga0501038_0649313 | 3300049574 | Bacteria | 794 |
| 768 | Ga0501039_0006633 | 3300049575 | Bacteria | 8794 |
| 769 | Ga0501039_0016305 | 3300049575 | Bacteria | 5692 |
| 770 | Ga0501039_0026363 | 3300049575 | Bacteria | 4466 |
| 771 | Ga0501039_0084786 | 3300049575 | Bacteria | 2468 |
| 772 | Ga0501040_0008149 | 3300049576 | Bacteria | 6810 |
| 773 | Ga0501040_0045923 | 3300049576 | Bacteria | 2981 |
| 774 | Ga0501040_0266429 | 3300049576 | Bacteria | 1223 |
| 775 | Ga0501040_0462436 | 3300049576 | Unclassified | 913 |
| 776 | Ga0501041_0010794 | 3300049577 | Bacteria | 5388 |
| 777 | Ga0501041_0127147 | 3300049577 | Bacteria | 1587 |
| 778 | Ga0501041_0132974 | 3300049577 | Bacteria | 1550 |
| 779 | Ga0501041_0294468 | 3300049577 | Bacteria | 1022 |
| 780 | Ga0501042_0000585 | 3300049578 | Bacteria | 19297 |
| 781 | Ga0501042_0022956 | 3300049578 | Bacteria | 4359 |
| 782 | Ga0501042_0112491 | 3300049578 | Bacteria | 1960 |
| 783 | Ga0501042_0489904 | 3300049578 | Bacteria | 892 |
| 784 | Ga0501043_0102225 | 3300049579 | Bacteria | 2253 |
| 785 | Ga0501043_0525588 | 3300049579 | Bacteria | 881 |
| 786 | Ga0501046_0006309 | 3300049580 | Bacteria | 10513 |
| 787 | Ga0501046_0011240 | 3300049580 | Bacteria | 7664 |
| 788 | Ga0501046_0304329 | 3300049580 | Bacteria | 1164 |
| 789 | Ga0501046_0634971 | 3300049580 | Bacteria | 756 |
| 790 | Ga0501048_0003742 | 3300049582 | Bacteria | 11602 |
| 791 | Ga0501048_0018724 | 3300049582 | Bacteria | 5090 |
| 792 | Ga0501048_0060872 | 3300049582 | Bacteria | 2674 |
| 793 | Ga0501068_0018768 | 3300049584 | Bacteria | 4008 |
| 794 | Ga0501068_0806435 | 3300049584 | Bacteria | 616 |
| 795 | Ga0501071_0019886 | 3300049587 | Bacteria | 4663 |
| 796 | Ga0501071_0062099 | 3300049587 | Bacteria | 2706 |
| 797 | Ga0501071_0133691 | 3300049587 | Bacteria | 1844 |
| 798 | Ga0501071_0147261 | 3300049587 | Bacteria | 1755 |
| 799 | Ga0501072_0009478 | 3300049588 | Bacteria | 7402 |
| 800 | Ga0501072_0017404 | 3300049588 | Bacteria | 5522 |
| 801 | Ga0501072_0022514 | 3300049588 | Bacteria | 4887 |
| 802 | Ga0501072_0223356 | 3300049588 | Bacteria | 1501 |
| 803 | Ga0501072_0654079 | 3300049588 | Bacteria | 827 |
| 804 | Ga0501074_0043565 | 3300049590 | Bacteria | 3248 |
| 805 | Ga0501074_0067397 | 3300049590 | Bacteria | 2574 |
| 806 | Ga0501074_0156172 | 3300049590 | Bacteria | 1630 |
| 807 | Ga0501075_0008588 | 3300049591 | Bacteria | 7121 |
| 808 | Ga0501075_0067211 | 3300049591 | Bacteria | 2706 |
| 809 | Ga0501075_0074951 | 3300049591 | Bacteria | 2559 |
| 810 | Ga0501075_0158775 | 3300049591 | Bacteria | 1725 |
| 811 | Ga0501075_0788323 | 3300049591 | Bacteria | 723 |
| 812 | Ga0501076_0004817 | 3300049592 | Bacteria | 9631 |
| 813 | Ga0501076_0011934 | 3300049592 | Bacteria | 6489 |
| 814 | Ga0501076_0053101 | 3300049592 | Bacteria | 3211 |
| 815 | Ga0501076_0064034 | 3300049592 | Bacteria | 2930 |
| 816 | Ga0501076_0272859 | 3300049592 | Bacteria | 1385 |
| 817 | Ga0501077_0001358 | 3300049593 | Bacteria | 14721 |
| 818 | Ga0501079_0004828 | 3300049741 | Bacteria | 9984 |
| 819 | Ga0501079_0004873 | 3300049741 | Bacteria | 9947 |
| 820 | Ga0501079_0112143 | 3300049741 | Bacteria | 2119 |
| 821 | Ga0501079_0239150 | 3300049741 | Bacteria | 1419 |
| 822 | Ga0501079_0646607 | 3300049741 | Bacteria | 833 |
| 823 | Ga0501080_0056262 | 3300049742 | Bacteria | 3664 |
| 824 | Ga0501080_0294268 | 3300049742 | Bacteria | 1474 |
| 825 | Ga0501080_0974650 | 3300049742 | Bacteria | 736 |
| 826 | Ga0501081_0006343 | 3300049743 | Bacteria | 7667 |
| 827 | Ga0501081_0006921 | 3300049743 | Bacteria | 7368 |
| 828 | Ga0501081_0016106 | 3300049743 | Bacteria | 4937 |
| 829 | Ga0501081_0307312 | 3300049743 | Bacteria | 1164 |
| 830 | Ga0501081_0407538 | 3300049743 | Bacteria | 1007 |
| 831 | Ga0501081_0462758 | 3300049743 | Unclassified | 943 |
| 832 | Ga0501035_0028140 | 3300049822 | Bacteria | 5133 |
| 833 | Ga0501035_0143352 | 3300049822 | Bacteria | 2076 |
| 834 | Ga0501044_0148807 | 3300049823 | Bacteria | 2325 |
| 835 | Ga0501045_0001805 | 3300049824 | Bacteria | 14461 |
| 836 | Ga0501045_0003599 | 3300049824 | Bacteria | 10646 |
| 837 | Ga0501045_0012531 | 3300049824 | Bacteria | 5972 |
| 838 | Ga0501045_0017710 | 3300049824 | Bacteria | 5059 |
| 839 | Ga0501045_0059240 | 3300049824 | Bacteria | 2805 |
| 840 | Ga0501045_0062693 | 3300049824 | Bacteria | 2728 |
| 841 | Ga0501045_0078605 | 3300049824 | Bacteria | 2432 |
| 842 | Ga0501045_0530097 | 3300049824 | Unclassified | 874 |
| 843 | nmdc:mga03n38_4330_c1 | 3300050490 | Unclassified | 4686 |
| 844 | nmdc:mga00v17_202743_c1 | 3300050491 | Unclassified | 1282 |
| 845 | nmdc:mga00v17_232_c1 | 3300050491 | Bacteria | 33139 |
| 846 | nmdc:mga00v17_590933_c1 | 3300050491 | Bacteria | 716 |
| 847 | nmdc:mga0yw44_108146_c1 | 3300050492 | Unclassified | 1779 |
| 848 | nmdc:mga0yw44_12501_c1 | 3300050492 | Unclassified | 4429 |
| 849 | nmdc:mga0yw44_158738_c1 | 3300050492 | Bacteria | 1479 |
| 850 | nmdc:mga0yw44_75010_c1 | 3300050492 | Bacteria | 2108 |
| 851 | nmdc:mga06z11_174649_c1 | 3300050494 | Unclassified | 1236 |
| 852 | nmdc:mga06z11_363216_c1 | 3300050494 | Bacteria | 868 |
| 853 | nmdc:mga06z11_444076_c1 | 3300050494 | Bacteria | 783 |
| 854 | nmdc:mga04h51_20188_c1 | 3300050495 | Unclassified | 1985 |
| 855 | nmdc:mga07m45_398624_c1 | 3300050496 | Unclassified | 799 |
| 856 | nmdc:mga05p37_217828_c1 | 3300050507 | Bacteria | 2305 |
| 857 | nmdc:mga05p37_247969_c1 | 3300050507 | Bacteria | 2137 |
| 858 | nmdc:mga05p37_369349_c1 | 3300050507 | Bacteria | 1684 |
| 859 | nmdc:mga05p37_372959_c1 | 3300050507 | Bacteria | 1674 |
| 860 | nmdc:mga05p37_666452_c1 | 3300050507 | Bacteria | 1162 |
| 861 | nmdc:mga05p37_790528_c1 | 3300050507 | Bacteria | 1040 |
| 862 | nmdc:mga09592_133260_c1 | 3300050508 | Bacteria | 2139 |
| 863 | nmdc:mga09592_297590_c1 | 3300050508 | Bacteria | 1399 |
| 864 | nmdc:mga09592_510452_c1 | 3300050508 | Bacteria | 1034 |
| 865 | nmdc:mga0qj67_73861_c1 | 3300050509 | Bacteria | 2724 |
| 866 | nmdc:mga06r32_101518_c1 | 3300050510 | Bacteria | 2824 |
| 867 | nmdc:mga06r32_192112_c1 | 3300050510 | Bacteria | 2029 |
| 868 | nmdc:mga06r32_31670_c1 | 3300050510 | Bacteria | 4969 |
| 869 | nmdc:mga06r32_411402_c1 | 3300050510 | Bacteria | 1334 |
| 870 | nmdc:mga06r32_577723_c1 | 3300050510 | Bacteria | 1096 |
| 871 | nmdc:mga08y16_129970_c1 | 3300050511 | Bacteria | 2620 |
| 872 | nmdc:mga08y16_19975_c1 | 3300050511 | Bacteria | 7068 |
| 873 | nmdc:mga08y16_24268_c1 | 3300050511 | Bacteria | 6401 |
| 874 | nmdc:mga08y16_4166_c1 | 3300050511 | Bacteria | 15097 |
| 875 | nmdc:mga08y16_606052_c1 | 3300050511 | Bacteria | 1103 |
| 876 | nmdc:mga08y16_702989_c1 | 3300050511 | Bacteria | 1010 |
| 877 | nmdc:mga08y16_813553_c1 | 3300050511 | Bacteria | 926 |
| 878 | nmdc:mga0n895_229395_c1 | 3300050512 | Bacteria | 1885 |
| 879 | nmdc:mga0n895_959085_c1 | 3300050512 | Bacteria | 838 |
| 880 | nmdc:mga08x19_740637_c1 | 3300050514 | Bacteria | 698 |
| 881 | Ga0495601_0051960 | 3300053077 | Bacteria | 2587 |
| 882 | Ga0495612_0026671 | 3300053078 | Bacteria | 2322 |
| 883 | Ga0495655_0103372 | 3300053083 | Bacteria | 847 |
| 884 | Ga0495655_0153867 | 3300053083 | Bacteria | 725 |
| 885 | Ga0495655_0178647 | 3300053083 | Bacteria | 683 |
| 886 | Ga0495595_0023084 | 3300053084 | Bacteria | 2736 |
| 887 | Ga0495619_0441133 | 3300053085 | Bacteria | 898 |
| 888 | Ga0495619_0456772 | 3300053085 | Bacteria | 880 |
| 889 | Ga0501084_0002921 | 3300054114 | Bacteria | 13831 |
| 890 | Ga0501084_0032793 | 3300054114 | Bacteria | 4346 |
| 891 | Ga0501084_0062737 | 3300054114 | Bacteria | 3111 |
| 892 | Ga0501084_0123481 | 3300054114 | Bacteria | 2178 |
| 893 | Ga0501084_0337565 | 3300054114 | Bacteria | 1273 |
| 894 | Ga0501082_0093338 | 3300060353 | Bacteria | 2600 |
| 895 | Ga0466962_0003114 | 3300061719 | Bacteria | 7881 |
| 896 | Ga0530510_0017785 | 3300061734 | Bacteria | 5040 |
| 897 | Ga0530510_0022733 | 3300061734 | Bacteria | 4467 |
| 898 | Ga0530510_0031502 | 3300061734 | Bacteria | 3812 |
| 899 | Ga0530510_0185988 | 3300061734 | Bacteria | 1541 |
| 900 | Ga0530510_0292237 | 3300061734 | Bacteria | 1218 |
| 901 | Ga0307513_10303137 | |||
| 902 | JGI24740J21852_10055622 | |||
| 903 | JGI24739J22299_10041975 | |||
| 904 | JGI24737J22298_10051725 | |||
| 905 | JGI24738J21930_10080768 | |||
| 906 | rootL2_10145234 | |||
| 907 | Ga0065707_10054229 | |||
| 908 | Ga0070676_10059684 | |||
| 909 | Ga0070676_10094671 | |||
| 910 | Ga0070683_100008705 | |||
| 911 | Ga0070683_100014042 | |||
| 912 | Ga0070683_100092685 | |||
| 913 | Ga0070683_100253095 | |||
| 914 | Ga0070683_100556391 | |||
| 915 | Ga0070683_100584882 | |||
| 916 | Ga0070683_100631169 | |||
| 917 | Ga0070683_100666355 | |||
| 918 | Ga0070690_100195731 | |||
| 919 | Ga0070670_100089926 | |||
| 920 | Ga0070670_100692813 | |||
| 921 | Ga0068869_100062367 | |||
| 922 | Ga0068869_100202225 | |||
| 923 | Ga0068869_100366986 | |||
| 924 | Ga0068869_101128363 | |||
| 925 | Ga0070680_100631204 | |||
| 926 | Ga0070682_100010039 | |||
| 927 | Ga0070682_100419857 | |||
| 928 | Ga0068868_100155925 | |||
| 929 | Ga0068868_100339790 | |||
| 930 | Ga0068868_100446774 | |||
| 931 | Ga0070660_100201880 | |||
| 932 | Ga0070689_100223995 | |||
| 933 | Ga0070692_10043355 | |||
| 934 | Ga0070668_100130319 | |||
| 935 | Ga0070668_100178747 | |||
| 936 | Ga0070668_100717754 | |||
| 937 | Ga0070668_101409877 | |||
| 938 | Ga0070669_100866160 | |||
| 939 | Ga0070675_100001370 | |||
| 940 | Ga0070671_100456279 | |||
| 941 | Ga0070674_101220094 | |||
| 942 | Ga0070673_100294939 | |||
| 943 | Ga0070673_100515721 | |||
| 944 | Ga0070673_101011808 | |||
| 945 | Ga0070659_100016561 | |||
| 946 | Ga0070667_100721381 | |||
| 947 | Ga0070709_10009654 | |||
| 948 | Ga0070709_10198353 | |||
| 949 | Ga0070714_100190999 | |||
| 950 | Ga0070713_100116322 | |||
| 951 | Ga0070713_100796950 | |||
| 952 | Ga0070710_10012686 | |||
| 953 | Ga0070701_10083915 | |||
| 954 | Ga0070711_100199364 | |||
| 955 | Ga0070711_100505291 | |||
| 956 | Ga0070705_100490812 | |||
| 957 | Ga0070705_100642648 | |||
| 958 | Ga0070700_100097744 | |||
| 959 | Ga0070700_100170452 | |||
| 960 | Ga0070663_100924032 | |||
| 961 | Ga0070678_100142643 | |||
| 962 | Ga0070678_100267581 | |||
| 963 | Ga0070678_100322763 | |||
| 964 | Ga0070678_100895760 | |||
| 965 | Ga0070662_100123781 | |||
| 966 | Ga0068867_100118511 | |||
| 967 | Ga0068867_100131035 | |||
| 968 | Ga0070685_10173778 | |||
| 969 | Ga0070706_100065755 | |||
| 970 | Ga0070684_100005923 | |||
| 971 | Ga0070684_100039396 | |||
| 972 | Ga0070684_100123256 | |||
| 973 | Ga0070684_100166461 | |||
| 974 | Ga0070684_100348018 | |||
| 975 | Ga0068853_100266254 | |||
| 976 | Ga0068853_101493035 | |||
| 977 | Ga0070686_100237388 | |||
| 978 | Ga0070686_101051357 | |||
| 979 | Ga0070693_100159555 | |||
| 980 | Ga0070665_100277000 | |||
| 981 | Ga0070665_100421755 | |||
| 982 | Ga0070665_100925687 | |||
| 983 | Ga0070704_100224071 | |||
| 984 | Ga0070704_100412435 | |||
| 985 | Ga0070704_100632815 | |||
| 986 | Ga0068855_101316481 | |||
| 987 | Ga0070664_100000166 | |||
| 988 | Ga0070664_100011090 | |||
| 989 | Ga0070664_100041142 | |||
| 990 | Ga0070664_100148577 | |||
| 991 | Ga0070664_100414640 | |||
| 992 | Ga0068857_100043014 | |||
| 993 | Ga0068857_100144335 | |||
| 994 | Ga0068857_100275039 | |||
| 995 | Ga0068857_100575451 | |||
| 996 | Ga0068857_100709980 | |||
| 997 | Ga0068854_100530419 | |||
| 998 | Ga0068856_100354443 | |||
| 999 | Ga0070702_100296888 | |||
| 1000 | Ga0068852_100413609 | |||
| 1001 | Ga0068852_100857738 | |||
| 1002 | Ga0068859_100236125 | |||
| 1003 | Ga0068859_100556044 | |||
| 1004 | Ga0068859_100601202 | |||
| 1005 | Ga0068859_100671048 | |||
| 1006 | Ga0068859_101719013 | |||
| 1007 | Ga0068864_100001167 | |||
| 1008 | Ga0068864_100536668 | |||
| 1009 | Ga0068861_100081911 | |||
| 1010 | Ga0068861_100137617 | |||
| 1011 | Ga0068861_100142995 | |||
| 1012 | Ga0068851_10230539 | |||
| 1013 | Ga0068870_10393173 | |||
| 1014 | Ga0068863_100014088 | |||
| 1015 | Ga0068863_100030440 | |||
| 1016 | Ga0068863_100348200 | |||
| 1017 | Ga0068858_100152363 | |||
| 1018 | Ga0068858_100183176 | |||
| 1019 | Ga0068858_100190996 | |||
| 1020 | Ga0068860_100013292 | |||
| 1021 | Ga0068860_100227958 | |||
| 1022 | Ga0068860_101591989 | |||
| 1023 | Ga0068862_100025776 | |||
| 1024 | Ga0068862_100086914 | |||
| 1025 | Ga0068862_100138257 | |||
| 1026 | Ga0068862_100213986 | |||
| 1027 | Ga0068862_100728164 | |||
| 1028 | Ga0081455_10001500 | |||
| 1029 | Ga0081455_10001832 | |||
| 1030 | Ga0081455_10007202 | |||
| 1031 | Ga0081455_10012628 | |||
| 1032 | Ga0081455_10016091 | |||
| 1033 | Ga0081455_10069485 | |||
| 1034 | Ga0081455_10163050 | |||
| 1035 | Ga0081455_10350415 | |||
| 1036 | Ga0081538_10001297 | |||
| 1037 | Ga0081538_10003067 | |||
| 1038 | Ga0081538_10008250 | |||
| 1039 | Ga0081538_10017418 | |||
| 1040 | Ga0081538_10076605 | |||
| 1041 | Ga0081538_10115577 | |||
| 1042 | Ga0081538_10152475 | |||
| 1043 | Ga0081538_10213656 | |||
| 1044 | Ga0081540_1039940 | |||
| 1045 | Ga0081539_10001229 | |||
| 1046 | Ga0081539_10044108 | |||
| 1047 | Ga0081539_10069907 | |||
| 1048 | Ga0070717_10055276 | |||
| 1049 | Ga0070717_10618117 | |||
| 1050 | Ga0075365_10005329 | |||
| 1051 | Ga0075365_10014948 | |||
| 1052 | Ga0075365_10070877 | |||
| 1053 | Ga0075364_10001262 | |||
| 1054 | Ga0070715_10017213 | |||
| 1055 | Ga0070716_100381469 | |||
| 1056 | Ga0070716_100444934 | |||
| 1057 | Ga0070716_100510322 | |||
| 1058 | Ga0075362_10002451 | |||
| 1059 | Ga0075367_10020819 | |||
| 1060 | Ga0075367_10624699 | |||
| 1061 | Ga0075367_10675089 | |||
| 1062 | Ga0075369_10140184 | |||
| 1063 | Ga0097621_100213870 | |||
| 1064 | Ga0097621_100423255 | |||
| 1065 | Ga0075428_100000025 | |||
| 1066 | Ga0075428_100007416 | |||
| 1067 | Ga0075428_100027434 | |||
| 1068 | Ga0075428_100037211 | |||
| 1069 | Ga0075428_100047259 | |||
| 1070 | Ga0075428_100059739 | |||
| 1071 | Ga0075428_100095394 | |||
| 1072 | Ga0075428_100098568 | |||
| 1073 | Ga0075428_100147235 | |||
| 1074 | Ga0075428_100634583 | |||
| 1075 | Ga0075430_100002091 | |||
| 1076 | Ga0075430_100004497 | |||
| 1077 | Ga0075430_100031197 | |||
| 1078 | Ga0075430_100061262 | |||
| 1079 | Ga0075430_100369832 | |||
| 1080 | Ga0075431_100008337 | |||
| 1081 | Ga0075431_100045785 | |||
| 1082 | Ga0075431_100047423 | |||
| 1083 | Ga0075431_100116972 | |||
| 1084 | Ga0075431_100367400 | |||
| 1085 | Ga0075431_100385947 | |||
| 1086 | Ga0075431_100554415 | |||
| 1087 | Ga0075431_100625686 | |||
| 1088 | Ga0075433_10878913 | |||
| 1089 | Ga0075434_100227174 | |||
| 1090 | Ga0075429_100001644 | |||
| 1091 | Ga0075429_100008197 | |||
| 1092 | Ga0075429_100148315 | |||
| 1093 | Ga0075429_100160847 | |||
| 1094 | Ga0075429_100289258 | |||
| 1095 | Ga0075429_100697809 | |||
| 1096 | Ga0075429_101318974 | |||
| 1097 | Ga0068865_100224580 | |||
| 1098 | Ga0068865_100364035 | |||
| 1099 | Ga0075436_100126729 | |||
| 1100 | Ga0075436_100579989 | |||
| 1101 | Ga0097620_100236126 | |||
| 1102 | Ga0097620_100556076 | |||
| 1103 | Ga0097620_100601173 | |||
| 1104 | Ga0097620_100671067 | |||
| 1105 | Ga0097620_101394244 | |||
| 1106 | Ga0097620_101719392 | |||
| 1107 | Ga0099795_10080970 | |||
| 1108 | Ga0111539_10000110 | |||
| 1109 | Ga0111539_10006055 | |||
| 1110 | Ga0111539_10128261 | |||
| 1111 | Ga0111539_10334892 | |||
| 1112 | Ga0111539_10481097 | |||
| 1113 | Ga0111539_11388299 | |||
| 1114 | Ga0105245_10004699 | |||
| 1115 | Ga0105245_10043372 | |||
| 1116 | Ga0105245_10071285 | |||
| 1117 | Ga0105245_10312623 | |||
| 1118 | Ga0105245_11598265 | |||
| 1119 | Ga0105247_10331006 | |||
| 1120 | Ga0114129_10016973 | |||
| 1121 | Ga0114129_10115349 | |||
| 1122 | Ga0114129_10144972 | |||
| 1123 | Ga0114129_10166491 | |||
| 1124 | Ga0114129_10167101 | |||
| 1125 | Ga0114129_10192014 | |||
| 1126 | Ga0114129_10258808 | |||
| 1127 | Ga0114129_10339426 | |||
| 1128 | Ga0114129_10478137 | |||
| 1129 | Ga0114129_10771267 | |||
| 1130 | Ga0114129_10821158 | |||
| 1131 | Ga0114129_10951160 | |||
| 1132 | Ga0114129_11410137 | |||
| 1133 | Ga0105243_10072153 | |||
| 1134 | Ga0105243_10317937 | |||
| 1135 | Ga0105243_10615826 | |||
| 1136 | Ga0105241_10168629 | |||
| 1137 | Ga0105242_10014322 | |||
| 1138 | Ga0105242_10830843 | |||
| 1139 | Ga0105248_10022048 | |||
| 1140 | Ga0105248_10164539 | |||
| 1141 | Ga0105248_10270379 | |||
| 1142 | Ga0105248_10325098 | |||
| 1143 | Ga0105237_10880066 | |||
| 1144 | Ga0105238_10857064 | |||
| 1145 | Ga0105249_10018525 | |||
| 1146 | Ga0105249_10033632 | |||
| 1147 | Ga0105249_10238191 | |||
| 1148 | Ga0105249_11428902 | |||
| 1149 | Ga0105239_10228485 | |||
| 1150 | Ga0105246_10063172 | |||
| 1151 | Ga0105246_10858057 | |||
| 1152 | Ga0157369_10233573 | |||
| 1153 | Ga0157374_10417883 | |||
| 1154 | Ga0157378_10016420 | |||
| 1155 | Ga0157378_10594135 | |||
| 1156 | Ga0163162_10626843 | |||
| 1157 | Ga0163162_10777609 | |||
| 1158 | Ga0157372_10523282 | |||
| 1159 | Ga0157372_10579110 | |||
| 1160 | Ga0157375_10329144 | |||
| 1161 | Ga0157375_10566545 | |||
| 1162 | Ga0157375_10768000 | |||
| 1163 | Ga0163163_10180257 | |||
| 1164 | Ga0163163_10724530 | |||
| 1165 | Ga0157380_10001497 | |||
| 1166 | Ga0157380_10039100 | |||
| 1167 | Ga0157380_10301675 | |||
| 1168 | Ga0157380_10478395 | |||
| 1169 | Ga0157380_10531283 | |||
| 1170 | Ga0157380_10610071 | |||
| 1171 | Ga0182008_10428171 | |||
| 1172 | Ga0157377_10381980 | |||
| 1173 | Ga0157379_10451049 | |||
| 1174 | Ga0157379_10866608 | |||
| 1175 | Ga0157376_10254219 | |||
| 1176 | Ga0157376_11072503 | |||
| 1177 | Ga0182005_1104953 | |||
| 1178 | Ga0206354_10751738 | |||
| 1179 | Ga0207666_1005149 | |||
| 1180 | Ga0207666_1008909 | |||
| 1181 | Ga0207692_10072891 | |||
| 1182 | Ga0207688_10088408 | |||
| 1183 | Ga0207688_10344855 | |||
| 1184 | Ga0207647_10017518 | |||
| 1185 | Ga0207685_10002871 | |||
| 1186 | Ga0207699_10001824 | |||
| 1187 | Ga0207645_10218233 | |||
| 1188 | Ga0207643_10176807 | |||
| 1189 | Ga0207643_10270922 | |||
| 1190 | Ga0207684_10058146 | |||
| 1191 | Ga0207663_10037528 | |||
| 1192 | Ga0207660_10729165 | |||
| 1193 | Ga0207662_10291743 | |||
| 1194 | Ga0207657_10104822 | |||
| 1195 | Ga0207681_10074023 | |||
| 1196 | Ga0207681_10483471 | |||
| 1197 | Ga0207650_10202423 | |||
| 1198 | Ga0207650_10311601 | |||
| 1199 | Ga0207659_10012329 | |||
| 1200 | Ga0207687_10063009 | |||
| 1201 | Ga0207687_10070357 | |||
| 1202 | Ga0207687_10186334 | |||
| 1203 | Ga0207687_10225973 | |||
| 1204 | Ga0207700_10020467 | |||
| 1205 | Ga0207700_10086275 | |||
| 1206 | Ga0207664_10027469 | |||
| 1207 | Ga0207664_10143585 | |||
| 1208 | Ga0207644_10122242 | |||
| 1209 | Ga0207644_10495168 | |||
| 1210 | Ga0207644_10876223 | |||
| 1211 | Ga0207690_10093900 | |||
| 1212 | Ga0207706_10102914 | |||
| 1213 | Ga0207706_10347199 | |||
| 1214 | Ga0207686_10162872 | |||
| 1215 | Ga0207686_10644087 | |||
| 1216 | Ga0207709_10208021 | |||
| 1217 | Ga0207709_10547171 | |||
| 1218 | Ga0207670_10103006 | |||
| 1219 | Ga0207670_10131242 | |||
| 1220 | Ga0207669_10093298 | |||
| 1221 | Ga0207669_10317373 | |||
| 1222 | Ga0207669_10323124 | |||
| 1223 | Ga0207665_10005700 | |||
| 1224 | Ga0207665_10311295 | |||
| 1225 | Ga0207691_10334561 | |||
| 1226 | Ga0207711_10261275 | |||
| 1227 | Ga0207711_10358806 | |||
| 1228 | Ga0207689_10023691 | |||
| 1229 | Ga0207689_10195544 | |||
| 1230 | Ga0207689_10390392 | |||
| 1231 | Ga0207689_10652442 | |||
| 1232 | Ga0207661_10023760 | |||
| 1233 | Ga0207661_10079283 | |||
| 1234 | Ga0207661_10445170 | |||
| 1235 | Ga0207661_10555287 | |||
| 1236 | Ga0207661_10743084 | |||
| 1237 | Ga0207679_10003783 | |||
| 1238 | Ga0207679_10017782 | |||
| 1239 | Ga0207679_10109228 | |||
| 1240 | Ga0207651_10477643 | |||
| 1241 | Ga0207712_10022581 | |||
| 1242 | Ga0207712_10033845 | |||
| 1243 | Ga0207712_10740553 | |||
| 1244 | Ga0207668_10464699 | |||
| 1245 | Ga0207640_10401150 | |||
| 1246 | Ga0207658_11080776 | |||
| 1247 | Ga0207658_11262341 | |||
| 1248 | Ga0207677_10015480 | |||
| 1249 | Ga0207677_10227004 | |||
| 1250 | Ga0207677_10535189 | |||
| 1251 | Ga0207703_10117204 | |||
| 1252 | Ga0207639_10327538 | |||
| 1253 | Ga0207678_10075224 | |||
| 1254 | Ga0207678_10307817 | |||
| 1255 | Ga0207708_10107995 | |||
| 1256 | Ga0207708_10114546 | |||
| 1257 | Ga0207708_10142912 | |||
| 1258 | Ga0207708_10544285 | |||
| 1259 | Ga0207708_10618568 | |||
| 1260 | Ga0207708_11040785 | |||
| 1261 | Ga0207641_10255892 | |||
| 1262 | Ga0207641_10702647 | |||
| 1263 | Ga0207641_10718354 | |||
| 1264 | Ga0207648_10018650 | |||
| 1265 | Ga0207676_10589673 | |||
| 1266 | Ga0207674_10001699 | |||
| 1267 | Ga0207674_10093831 | |||
| 1268 | Ga0207674_10118203 | |||
| 1269 | Ga0207674_10153566 | |||
| 1270 | Ga0207674_10158399 | |||
| 1271 | Ga0207674_10635169 | |||
| 1272 | Ga0207675_100058587 | |||
| 1273 | Ga0207675_100099074 | |||
| 1274 | Ga0207675_100210881 | |||
| 1275 | Ga0207675_100378084 | |||
| 1276 | Ga0207683_10178261 | |||
| 1277 | Ga0207683_10381665 | |||
| 1278 | Ga0207683_10495359 | |||
| 1279 | Ga0207683_10499319 | |||
| 1280 | Ga0207698_10547765 | |||
| 1281 | Ga0207698_10998889 | |||
| 1282 | Ga0207428_10009550 | |||
| 1283 | Ga0207428_10047422 | |||
| 1284 | Ga0207428_10148513 | |||
| 1285 | Ga0268266_10357276 | |||
| 1286 | Ga0268266_11034862 | |||
| 1287 | Ga0268265_10044792 | |||
| 1288 | Ga0268265_10075273 | |||
| 1289 | Ga0268265_10141845 | |||
| 1290 | Ga0268265_10146018 | |||
| 1291 | Ga0268265_10203817 | |||
| 1292 | Ga0268265_10417880 | |||
| 1293 | Ga0268265_10634508 | |||
| 1294 | Ga0268265_10712170 | |||
| 1295 | Ga0268264_10005820 | |||
| 1296 | Ga0307513_10554142 | |||
| 1297 | Ga0307408_100096534 | |||
| 1298 | Ga0307408_100329127 | |||
| 1299 | Ga0316576_10183753 | |||
| 1300 | Ga0316578_10024241 | |||
| 1301 | Ga0316578_10210999 | |||
| 1302 | Ga0307405_10002249 | |||
| 1303 | Ga0307405_10223959 | |||
| 1304 | Ga0307405_10271313 | |||
| 1305 | Ga0307405_10432311 | |||
| 1306 | Ga0307405_10556663 | |||
| 1307 | Ga0307405_10574141 | |||
| 1308 | Ga0307405_10624666 | |||
| 1309 | Ga0316577_10268008 | |||
| 1310 | Ga0307413_10798174 | |||
| 1311 | Ga0307410_10059046 | |||
| 1312 | Ga0307410_10100342 | |||
| 1313 | Ga0307410_10874205 | |||
| 1314 | Ga0326468_10000188 | |||
| 1315 | Ga0307406_10012241 | |||
| 1316 | Ga0307406_10017809 | |||
| 1317 | Ga0307406_10188488 | |||
| 1318 | Ga0307406_10413422 | |||
| 1319 | Ga0307406_10498221 | |||
| 1320 | Ga0307406_10697519 | |||
| 1321 | Ga0307407_10019808 | |||
| 1322 | Ga0307407_10396063 | |||
| 1323 | Ga0307407_10865524 | |||
| 1324 | Ga0307412_10031284 | |||
| 1325 | Ga0307409_100028114 | |||
| 1326 | Ga0307409_100033170 | |||
| 1327 | Ga0307409_100067406 | |||
| 1328 | Ga0307409_100156504 | |||
| 1329 | Ga0307409_100270315 | |||
| 1330 | Ga0307409_100279949 | |||
| 1331 | Ga0307409_100638527 | |||
| 1332 | Ga0307409_100961066 | |||
| 1333 | Ga0307409_101001784 | |||
| 1334 | Ga0307409_101454018 | |||
| 1335 | Ga0307416_100001369 | |||
| 1336 | Ga0307416_100035409 | |||
| 1337 | Ga0307416_100051929 | |||
| 1338 | Ga0307416_100264107 | |||
| 1339 | Ga0307416_100802462 | |||
| 1340 | Ga0307416_101200250 | |||
| 1341 | Ga0307416_101725282 | |||
| 1342 | Ga0307411_10059767 | |||
| 1343 | Ga0307415_100000062 | |||
| 1344 | Ga0307415_100005187 | |||
| 1345 | Ga0307415_100015628 | |||
| 1346 | Ga0307415_100107083 | |||
| 1347 | Ga0307415_100138799 | |||
| 1348 | Ga0307415_100171192 | |||
| 1349 | Ga0307415_100299209 | |||
| 1350 | Ga0307507_10061391 | |||
| 1351 | Ga0373926_0031510 | |||
| 1352 | Ga0373944_0137571 | |||
| 1353 | Ga0373923_0064483 | |||
| 1354 | Ga0373936_0021561 | |||
| 1355 | Ga0373941_0098995 | |||
| 1356 | Ga0373956_0055707 | |||
| 1357 | Ga0373960_0006574 | |||
| 1358 | Ga0373943_0607148 | |||
| 1359 | Ga0373946_0117570 | |||
| 1360 | Ga0373955_0040691 | |||
| 1361 | Ga0373962_0122064 | |||
| 1362 | Ga0373962_0130577 | |||
| 1363 | Ga0316574_0062049 | |||
| 1364 | Ga0316574_0071577 | |||
| 1365 | Ga0316574_0100937 | |||
| 1366 | Ga0316574_0101865 | |||
| 1367 | Ga0373924_0040831 | |||
| 1368 | Ga0373931_0363538 | |||
| 1369 | Ga0373931_0406664 | |||
| 1370 | Ga0373935_0196659 | |||
| 1371 | Ga0373935_0382615 | |||
| 1372 | Ga0373935_0635588 | |||
| 1373 | Ga0373927_0005542 | |||
| 1374 | Ga0373927_0089361 | |||
| 1375 | Ga0373927_0094308 | |||
| 1376 | Ga0373927_0167024 | |||
| 1377 | Ga0373927_0251611 | |||
| 1378 | Ga0373933_0012722 | |||
| 1379 | Ga0373933_0043596 | |||
| 1380 | Ga0373947_0027228 | |||
| 1381 | Ga0373947_0176819 | |||
| 1382 | Ga0373937_0005105 | |||
| 1383 | Ga0373937_0014768 | |||
| 1384 | Ga0373937_0568782 | |||
| 1385 | Ga0316582_0073242 | |||
| 1386 | Ga0316584_0010254 | |||
| 1387 | Ga0316584_0077384 | |||
| 1388 | Ga0373925_0039804 | |||
| 1389 | Ga0373925_1123506 | |||
| 1390 | Ga0395899_0026456 | |||
| 1391 | Ga0395899_0036613 | |||
| 1392 | Ga0395900_0017448 | |||
| 1393 | Ga0395900_0122124 | |||
| 1394 | Ga0395900_0150567 | |||
| 1395 | Ga0395900_0175075 | |||
| 1396 | Ga0395900_0578696 | |||
| 1397 | Ga0395900_1309179 | |||
| 1398 | Ga0395898_0015353 | |||
| 1399 | Ga0395898_0255855 | |||
| 1400 | Ga0395898_0370976 | |||
| 1401 | Ga0395905_0031331 | |||
| 1402 | Ga0395905_0042789 | |||
| 1403 | Ga0395905_0131660 | |||
| 1404 | Ga0395905_0173746 | |||
| 1405 | Ga0395905_0198962 | |||
| 1406 | Ga0436364_0584685 | |||
| 1407 | Ga0395901_0008943 | |||
| 1408 | Ga0395901_0022893 | |||
| 1409 | Ga0395901_0043358 | |||
| 1410 | Ga0395901_0084370 | |||
| 1411 | Ga0395901_0215521 | |||
| 1412 | Ga0395901_0240017 | |||
| 1413 | Ga0395901_1111877 | |||
| 1414 | Ga0436363_0333332 | |||
| 1415 | Ga0439436_0104687 | |||
| 1416 | Ga0451853_2034849 | |||
| 1417 | Ga0451853_3543434 | |||
| 1418 | Ga0439443_002387 | |||
| 1419 | Ga0439448_0023992 | |||
| 1420 | Ga0439448_0034932 | |||
| 1421 | Ga0439448_0074053 | |||
| 1422 | Ga0439449_0110606 | |||
| 1423 | Ga0439450_003858 | |||
| 1424 | Ga0439455_0053815 | |||
| 1425 | Ga0439463_016811 | |||
| 1426 | Ga0439463_103725 | |||
| 1427 | Ga0450888_028337 | |||
| 1428 | Ga0450904_016427 | |||
| 1429 | Ga0439459_0061355 | |||
| 1430 | Ga0439460_0027907 | |||
| 1431 | Ga0439460_0128551 | |||
| 1432 | Ga0450916_005602 | |||
| 1433 | Ga0439440_0017687 | |||
| 1434 | Ga0439440_0080878 | |||
| 1435 | Ga0466972_0145684 | |||
| 1436 | Ga0466972_0181448 | |||
| 1437 | Ga0466965_0039043 | |||
| 1438 | Ga0466965_0195306 | |||
| 1439 | Ga0466963_0048883 | |||
| 1440 | Ga0466963_0607321 | |||
| 1441 | Ga0466964_0013700 | |||
| 1442 | Ga0466964_0479025 | |||
| 1443 | Ga0466971_0115148 | |||
| 1444 | Ga0466970_0103545 | |||
| 1445 | Ga0466957_0016990 | |||
| 1446 | Ga0466960_0197491 | |||
| 1447 | Ga0466960_0233550 | |||
| 1448 | Ga0466959_0508411 | |||
| 1449 | Ga0466967_0018937 | |||
| 1450 | Ga0466967_0074479 | |||
| 1451 | Ga0466967_0165280 | |||
| 1452 | Ga0466967_0180558 | |||
| 1453 | Ga0466967_0316511 | |||
| 1454 | Ga0466967_0524080 | |||
| 1455 | Ga0495617_027975 | |||
| 1456 | Ga0495592_0026090 | |||
| 1457 | Ga0495592_0239910 | |||
| 1458 | Ga0495603_0156972 | |||
| 1459 | Ga0495603_0308766 | |||
| 1460 | Ga0495603_0570877 | |||
| 1461 | Ga0495603_0590159 | |||
| 1462 | Ga0495629_0007280 | |||
| 1463 | Ga0495629_0017398 | |||
| 1464 | Ga0495641_0005202 | |||
| 1465 | Ga0495641_0261003 | |||
| 1466 | Ga0495651_0074238 | |||
| 1467 | Ga0495651_0086119 | |||
| 1468 | Ga0495651_0341126 | |||
| 1469 | Ga0495653_0010732 | |||
| 1470 | Ga0495653_0015635 | |||
| 1471 | Ga0495653_0697607 | |||
| 1472 | Ga0495650_0122359 | |||
| 1473 | Ga0495580_0008439 | |||
| 1474 | Ga0495580_0180051 | |||
| 1475 | Ga0495582_0004846 | |||
| 1476 | Ga0495582_0028187 | |||
| 1477 | Ga0495582_0114188 | |||
| 1478 | Ga0495582_0215942 | |||
| 1479 | Ga0495639_0004795 | |||
| 1480 | Ga0495662_0015684 | |||
| 1481 | Ga0495662_0016596 | |||
| 1482 | Ga0495664_0117563 | |||
| 1483 | Ga0495664_0296610 | |||
| 1484 | Ga0495664_0418290 | |||
| 1485 | Ga0495585_0052022 | |||
| 1486 | Ga0495594_0003880 | |||
| 1487 | Ga0495607_0088444 | |||
| 1488 | Ga0495608_0016303 | |||
| 1489 | Ga0495616_0108352 | |||
| 1490 | Ga0495618_0015130 | |||
| 1491 | Ga0495618_0287090 | |||
| 1492 | Ga0495618_0314611 | |||
| 1493 | Ga0495618_0345456 | |||
| 1494 | Ga0495620_0200805 | |||
| 1495 | Ga0495628_0015811 | |||
| 1496 | Ga0495628_0067847 | |||
| 1497 | Ga0495628_0156227 | |||
| 1498 | Ga0495628_0426084 | |||
| 1499 | Ga0495630_0013920 | |||
| 1500 | Ga0495630_0023575 | |||
| 1501 | Ga0495631_0063105 | |||
| 1502 | Ga0495631_0197629 | |||
| 1503 | Ga0495632_0099894 | |||
| 1504 | Ga0495632_0156169 | |||
| 1505 | Ga0495644_0015601 | |||
| 1506 | Ga0495666_0110678 | |||
| 1507 | Ga0495652_0047328 | |||
| 1508 | Ga0495652_0197363 | |||
| 1509 | Ga0495652_0228950 | |||
| 1510 | Ga0495665_0000492 | |||
| 1511 | Ga0495665_0207816 | |||
| 1512 | Ga0495640_0084675 | |||
| 1513 | Ga0495586_0242250 | |||
| 1514 | Ga0495598_0047661 | |||
| 1515 | Ga0495609_0170249 | |||
| 1516 | Ga0495621_0107029 | |||
| 1517 | Ga0495645_0056971 | |||
| 1518 | Ga0495622_0015630 | |||
| 1519 | Ga0495633_0069770 | |||
| 1520 | Ga0495667_0006426 | |||
| 1521 | Ga0495667_0015093 | |||
| 1522 | Ga0495667_0074920 | |||
| 1523 | Ga0495656_0058374 | |||
| 1524 | Ga0495668_0008468 | |||
| 1525 | Ga0495634_0033124 | |||
| 1526 | Ga0495634_0045870 | |||
| 1527 | Ga0495634_0144678 | |||
| 1528 | Ga0495634_0158202 | |||
| 1529 | Ga0495611_0024261 | |||
| 1530 | Ga0495611_0077992 | |||
| 1531 | Ga0495625_0168955 | |||
| 1532 | Ga0495635_0014622 | |||
| 1533 | Ga0495635_0014899 | |||
| 1534 | Ga0495635_0053207 | |||
| 1535 | Ga0495661_0074306 | |||
| 1536 | Ga0495588_0054144 | |||
| 1537 | Ga0495657_0013171 | |||
| 1538 | Ga0495657_0051671 | |||
| 1539 | Ga0495599_0014724 | |||
| 1540 | Ga0495623_0079452 | |||
| 1541 | Ga0495623_0170485 | |||
| 1542 | Ga0495646_0020610 | |||
| 1543 | Ga0495646_0268941 | |||
| 1544 | Ga0495647_0197998 | |||
| 1545 | Ga0495647_0352447 | |||
| 1546 | Ga0495658_0006596 | |||
| 1547 | Ga0495658_0101601 | |||
| 1548 | Ga0495658_0529090 | |||
| 1549 | Ga0495669_0034574 | |||
| 1550 | Ga0495669_0401308 | |||
| 1551 | Ga0495613_0056488 | |||
| 1552 | Ga0495624_0011511 | |||
| 1553 | Ga0495624_0299140 | |||
| 1554 | Ga0495670_0073285 | |||
| 1555 | Ga0495671_0034743 | |||
| 1556 | Ga0495600_0231893 | |||
| 1557 | Ga0495581_0006807 | |||
| 1558 | Ga0495581_0050721 | |||
| 1559 | Ga0495604_0008697 | |||
| 1560 | Ga0495636_0410133 | |||
| 1561 | Ga0495674_0018859 | |||
| 1562 | Ga0495674_0022208 | |||
| 1563 | Ga0495674_0087932 | |||
| 1564 | Ga0495672_0127803 | |||
| 1565 | Ga0495680_0002548 | |||
| 1566 | Ga0495680_0016498 | |||
| 1567 | Ga0495683_0178631 | |||
| 1568 | Ga0495677_0104083 | |||
| 1569 | Ga0495684_0024232 | |||
| 1570 | Ga0495684_0041602 | |||
| 1571 | Ga0495684_0061853 | |||
| 1572 | Ga0495684_0285757 | |||
| 1573 | Ga0495593_0005800 | |||
| 1574 | Ga0495593_0043690 | |||
| 1575 | Ga0495602_0050962 | |||
| 1576 | Ga0495602_0211551 | |||
| 1577 | Ga0496100_0396607 | |||
| 1578 | Ga0496100_0509086 | |||
| 1579 | Ga0496101_0777104 | |||
| 1580 | Ga0496101_0799976 | |||
| 1581 | Ga0496102_0057072 | |||
| 1582 | Ga0496103_0059887 | |||
| 1583 | Ga0496103_0309693 | |||
| 1584 | Ga0496104_0047636 | |||
| 1585 | Ga0496104_0071096 | |||
| 1586 | Ga0496104_0136960 | |||
| 1587 | Ga0496104_0140590 | |||
| 1588 | Ga0496104_0160131 | |||
| 1589 | Ga0496104_0202055 | |||
| 1590 | Ga0496104_0300489 | |||
| 1591 | Ga0496104_0567875 | |||
| 1592 | Ga0496104_1333784 | |||
| 1593 | Ga0496105_0080716 | |||
| 1594 | Ga0496105_0088465 | |||
| 1595 | Ga0496105_0113494 | |||
| 1596 | Ga0496105_0137244 | |||
| 1597 | Ga0496105_0145896 | |||
| 1598 | Ga0496107_0036002 | |||
| 1599 | Ga0496107_0714208 | |||
| 1600 | Ga0496108_0004143 | |||
| 1601 | Ga0496108_0017402 | |||
| 1602 | Ga0496108_0038553 | |||
| 1603 | Ga0496108_0145123 | |||
| 1604 | Ga0496108_0187235 | |||
| 1605 | Ga0496108_0250524 | |||
| 1606 | Ga0496108_0443168 | |||
| 1607 | Ga0496108_0450349 | |||
| 1608 | Ga0496108_0491996 | |||
| 1609 | Ga0496108_0755638 | |||
| 1610 | Ga0496109_0020555 | |||
| 1611 | Ga0496109_0022763 | |||
| 1612 | Ga0496109_0024072 | |||
| 1613 | Ga0496109_0055056 | |||
| 1614 | Ga0496109_0083907 | |||
| 1615 | Ga0496109_0236443 | |||
| 1616 | Ga0496109_0348394 | |||
| 1617 | Ga0496109_0805222 | |||
| 1618 | Ga0496109_0941224 | |||
| 1619 | Ga0496110_0014250 | |||
| 1620 | Ga0496110_0036836 | |||
| 1621 | Ga0496110_0060353 | |||
| 1622 | Ga0496110_0065141 | |||
| 1623 | Ga0496110_0115839 | |||
| 1624 | Ga0496110_0311269 | |||
| 1625 | Ga0496110_0654060 | |||
| 1626 | Ga0496110_0877986 | |||
| 1627 | Ga0496111_0011606 | |||
| 1628 | Ga0496111_0086690 | |||
| 1629 | Ga0496111_0261318 | |||
| 1630 | Ga0496111_0365687 | |||
| 1631 | Ga0496111_0398191 | |||
| 1632 | Ga0496111_0434746 | |||
| 1633 | Ga0496112_0076404 | |||
| 1634 | Ga0496112_0159329 | |||
| 1635 | Ga0496112_0229830 | |||
| 1636 | Ga0496112_0370345 | |||
| 1637 | Ga0496113_0028501 | |||
| 1638 | Ga0496113_0091833 | |||
| 1639 | Ga0496113_0108117 | |||
| 1640 | Ga0496113_0421886 | |||
| 1641 | Ga0496114_0013663 | |||
| 1642 | Ga0496114_0120243 | |||
| 1643 | Ga0496114_0207230 | |||
| 1644 | Ga0496114_0340723 | |||
| 1645 | Ga0496114_0387982 | |||
| 1646 | Ga0496114_0562384 | |||
| 1647 | Ga0496115_0203370 | |||
| 1648 | Ga0496119_0280880 | |||
| 1649 | Ga0501031_0104826 | |||
| 1650 | Ga0501031_0308444 | |||
| 1651 | Ga0501032_0038677 | |||
| 1652 | Ga0501032_0085904 | |||
| 1653 | Ga0501032_0226568 | |||
| 1654 | Ga0501033_0055098 | |||
| 1655 | Ga0501033_0143315 | |||
| 1656 | Ga0501033_0176175 | |||
| 1657 | Ga0501033_0785511 | |||
| 1658 | Ga0501034_0005466 | |||
| 1659 | Ga0501034_0235657 | |||
| 1660 | Ga0501036_0007988 | |||
| 1661 | Ga0501036_0031460 | |||
| 1662 | Ga0501036_0420586 | |||
| 1663 | Ga0501036_0437376 | |||
| 1664 | Ga0501036_0636749 | |||
| 1665 | Ga0501036_0868242 | |||
| 1666 | Ga0501038_0016848 | |||
| 1667 | Ga0501038_0649313 | |||
| 1668 | Ga0501039_0006633 | |||
| 1669 | Ga0501039_0016305 | |||
| 1670 | Ga0501039_0026363 | |||
| 1671 | Ga0501039_0084786 | |||
| 1672 | Ga0501040_0008149 | |||
| 1673 | Ga0501040_0045923 | |||
| 1674 | Ga0501040_0266429 | |||
| 1675 | Ga0501040_0462436 | |||
| 1676 | Ga0501041_0010794 | |||
| 1677 | Ga0501041_0127147 | |||
| 1678 | Ga0501041_0132974 | |||
| 1679 | Ga0501041_0294468 | |||
| 1680 | Ga0501042_0000585 | |||
| 1681 | Ga0501042_0022956 | |||
| 1682 | Ga0501042_0112491 | |||
| 1683 | Ga0501042_0489904 | |||
| 1684 | Ga0501043_0102225 | |||
| 1685 | Ga0501043_0525588 | |||
| 1686 | Ga0501046_0006309 | |||
| 1687 | Ga0501046_0011240 | |||
| 1688 | Ga0501046_0304329 | |||
| 1689 | Ga0501046_0634971 | |||
| 1690 | Ga0501048_0003742 | |||
| 1691 | Ga0501048_0018724 | |||
| 1692 | Ga0501048_0060872 | |||
| 1693 | Ga0501068_0018768 | |||
| 1694 | Ga0501068_0806435 | |||
| 1695 | Ga0501071_0019886 | |||
| 1696 | Ga0501071_0062099 | |||
| 1697 | Ga0501071_0133691 | |||
| 1698 | Ga0501071_0147261 | |||
| 1699 | Ga0501072_0009478 | |||
| 1700 | Ga0501072_0017404 | |||
| 1701 | Ga0501072_0022514 | |||
| 1702 | Ga0501072_0223356 | |||
| 1703 | Ga0501072_0654079 | |||
| 1704 | Ga0501074_0043565 | |||
| 1705 | Ga0501074_0067397 | |||
| 1706 | Ga0501074_0156172 | |||
| 1707 | Ga0501075_0008588 | |||
| 1708 | Ga0501075_0067211 | |||
| 1709 | Ga0501075_0074951 | |||
| 1710 | Ga0501075_0158775 | |||
| 1711 | Ga0501075_0788323 | |||
| 1712 | Ga0501076_0004817 | |||
| 1713 | Ga0501076_0011934 | |||
| 1714 | Ga0501076_0053101 | |||
| 1715 | Ga0501076_0064034 | |||
| 1716 | Ga0501076_0272859 | |||
| 1717 | Ga0501077_0001358 | |||
| 1718 | Ga0501079_0004828 | |||
| 1719 | Ga0501079_0004873 | |||
| 1720 | Ga0501079_0112143 | |||
| 1721 | Ga0501079_0239150 | |||
| 1722 | Ga0501079_0646607 | |||
| 1723 | Ga0501080_0056262 | |||
| 1724 | Ga0501080_0294268 | |||
| 1725 | Ga0501080_0974650 | |||
| 1726 | Ga0501081_0006343 | |||
| 1727 | Ga0501081_0006921 | |||
| 1728 | Ga0501081_0016106 | |||
| 1729 | Ga0501081_0307312 | |||
| 1730 | Ga0501081_0407538 | |||
| 1731 | Ga0501081_0462758 | |||
| 1732 | Ga0501035_0028140 | |||
| 1733 | Ga0501035_0143352 | |||
| 1734 | Ga0501044_0148807 | |||
| 1735 | Ga0501045_0001805 | |||
| 1736 | Ga0501045_0003599 | |||
| 1737 | Ga0501045_0012531 | |||
| 1738 | Ga0501045_0017710 | |||
| 1739 | Ga0501045_0059240 | |||
| 1740 | Ga0501045_0062693 | |||
| 1741 | Ga0501045_0078605 | |||
| 1742 | Ga0501045_0530097 | |||
| 1743 | nmdc:mga03n38_4330_c1 | |||
| 1744 | nmdc:mga00v17_202743_c1 | |||
| 1745 | nmdc:mga00v17_232_c1 | |||
| 1746 | nmdc:mga00v17_590933_c1 | |||
| 1747 | nmdc:mga0yw44_108146_c1 | |||
| 1748 | nmdc:mga0yw44_12501_c1 | |||
| 1749 | nmdc:mga0yw44_158738_c1 | |||
| 1750 | nmdc:mga0yw44_75010_c1 | |||
| 1751 | nmdc:mga06z11_174649_c1 | |||
| 1752 | nmdc:mga06z11_363216_c1 | |||
| 1753 | nmdc:mga06z11_444076_c1 | |||
| 1754 | nmdc:mga04h51_20188_c1 | |||
| 1755 | nmdc:mga07m45_398624_c1 | |||
| 1756 | nmdc:mga05p37_217828_c1 | |||
| 1757 | nmdc:mga05p37_247969_c1 | |||
| 1758 | nmdc:mga05p37_369349_c1 | |||
| 1759 | nmdc:mga05p37_372959_c1 | |||
| 1760 | nmdc:mga05p37_666452_c1 | |||
| 1761 | nmdc:mga05p37_790528_c1 | |||
| 1762 | nmdc:mga09592_133260_c1 | |||
| 1763 | nmdc:mga09592_297590_c1 | |||
| 1764 | nmdc:mga09592_510452_c1 | |||
| 1765 | nmdc:mga0qj67_73861_c1 | |||
| 1766 | nmdc:mga06r32_101518_c1 | |||
| 1767 | nmdc:mga06r32_192112_c1 | |||
| 1768 | nmdc:mga06r32_31670_c1 | |||
| 1769 | nmdc:mga06r32_411402_c1 | |||
| 1770 | nmdc:mga06r32_577723_c1 | |||
| 1771 | nmdc:mga08y16_129970_c1 | |||
| 1772 | nmdc:mga08y16_19975_c1 | |||
| 1773 | nmdc:mga08y16_24268_c1 | |||
| 1774 | nmdc:mga08y16_4166_c1 | |||
| 1775 | nmdc:mga08y16_606052_c1 | |||
| 1776 | nmdc:mga08y16_702989_c1 | |||
| 1777 | nmdc:mga08y16_813553_c1 | |||
| 1778 | nmdc:mga0n895_229395_c1 | |||
| 1779 | nmdc:mga0n895_959085_c1 | |||
| 1780 | nmdc:mga08x19_740637_c1 | |||
| 1781 | Ga0495601_0051960 | |||
| 1782 | Ga0495612_0026671 | |||
| 1783 | Ga0495655_0103372 | |||
| 1784 | Ga0495655_0153867 | |||
| 1785 | Ga0495655_0178647 | |||
| 1786 | Ga0495595_0023084 | |||
| 1787 | Ga0495619_0441133 | |||
| 1788 | Ga0495619_0456772 | |||
| 1789 | Ga0501084_0002921 | |||
| 1790 | Ga0501084_0032793 | |||
| 1791 | Ga0501084_0062737 | |||
| 1792 | Ga0501084_0123481 | |||
| 1793 | Ga0501084_0337565 | |||
| 1794 | Ga0501082_0093338 | |||
| 1795 | Ga0466962_0003114 | |||
| 1796 | Ga0530510_0017785 | |||
| 1797 | Ga0530510_0022733 | |||
| 1798 | Ga0530510_0031502 | |||
| 1799 | Ga0530510_0185988 | |||
| 1800 | Ga0530510_0292237 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2opl-assembly1.cif.gz_A | crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution | 0.9632 | 10 | 187 |
| 2opl-assembly1.cif.gz_A | crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution | 0.9426 | 10 | 187 |
| 1ml8-assembly1.cif.gz_A-2 | structural genomics | 0.8866 | 37 | 177 |
| 2onf-assembly1.cif.gz_B | crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution | 0.8694 | 35 | 179 |
| 1lql-assembly4.cif.gz_G | crystal structure of osmc like protein from mycoplasma pneumoniae | 0.8575 | 35 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2oplB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9552 | 10 | 176 | 3.30.300.20 |
| 2oplB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9331 | 10 | 176 | 3.30.300.20 |
| 1ml8A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9014 | 86 | 177 | 3.30.300.20 |
| 1lqlE02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8839 | 87 | 179 | 3.30.300.20 |
| 2egtA02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8766 | 86 | 176 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N7T5D2-F1-model_v4 | deleted | 0.9888 | 10 | 189 |
|
| AF-A0A0K6H592-F1-model_v4 | deleted | 0.9885 | 10 | 188 |
|
| AF-A0A4Q5YWE9-F1-model_v4 | deleted | 0.9861 | 89 | 187 |
|
| AF-A0A2V8FCJ2-F1-model_v4 | Osmotically inducible protein C | 0.9828 | 31 | 187 |
|
| AF-A0A7T9GBB2-F1-model_v4 | deleted | 0.9793 | 10 | 187 |
|