F485113
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 899 | 444 | 836 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300038726|Ga0400490_19738|Ga0400490_19738_1550_2506 |
| Length | 318 |
| Sequence | LLRQSRSIHYNDGLLNKISIMATSPLLKTTISSLQLLHQGKVRDIYDVDDAHLLMVSSDRLSAFDVILPTGIDKKGAMLTQMANFWFEKLGHVVPNHLTGIDPSSVVKDPAEAAQLEGRAVVVKKLKPLPIEAIVRGYIVGSGWKEYQAKGTVCEIPLPAGLQLADKLPQPLFTPSSKADIGEHDENISIAQVEALIGKEMTEKVASVAIALYTQAAEYALTKGIIIADTKFEFGLDEHGVLHVMDEVLTPDSSRFWPLESYQVGSNPPSYDKQYVRDWLENSGWDKKPPAPALPPEVAKRTSEKYAEVYQKLTGKTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 5 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 6 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 7 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 8 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 9 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 10 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 11 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 12 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 13 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 14 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 15 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 16 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 17 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 18 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 19 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 20 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 21 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 22 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 23 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 24 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 25 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 26 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 27 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 28 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 29 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 30 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 31 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 32 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 33 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 34 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 35 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 36 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 37 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 38 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 39 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 40 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 41 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 42 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 43 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 44 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 45 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 46 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 47 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 48 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 49 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 50 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 51 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 52 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 53 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 54 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 55 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 56 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 57 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 58 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 59 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 60 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 61 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 62 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 63 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 64 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 65 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 66 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 67 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 68 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 69 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 70 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 71 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 72 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 73 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 74 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 75 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 81 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 86 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 87 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 88 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 89 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 90 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 91 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 92 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 93 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 94 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 95 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 102 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 117 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 123 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 124 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 125 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 126 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 127 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 128 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 129 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 130 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 131 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 132 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 133 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 135 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 137 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 138 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 139 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 140 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 141 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 142 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 143 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 144 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 162 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 169 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 181 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 182 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 246 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 250 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 251 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 252 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 253 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 254 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 255 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 256 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 259 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 267 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 268 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 274 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 275 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 276 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 277 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 278 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 279 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 280 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 281 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 282 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 283 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 284 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 285 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 289 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 290 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 291 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 292 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 293 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 294 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 295 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 296 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 297 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 389 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 393 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 394 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 395 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 396 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 397 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 398 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 399 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 400 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 401 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 402 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 403 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 404 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 405 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 426 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 427 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 428 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 430 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 431 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 432 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 438 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 444 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.88 |
| Metatranscriptomes | 1.11 |
| Isolates | 7.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.57 |
| Nodule | 0.67 |
| Rhizoplane | 2 |
| Rhizosphere | 77.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000497 | 3300002705 | Bacteria | 23452 |
| 2 | JGI25162J39368_1000284 | 3300002737 | Bacteria | 47815 |
| 3 | JGI25162J39368_1001938 | 3300002737 | Bacteria | 9364 |
| 4 | JGI25154J39366_1000269 | 3300002738 | Bacteria | 32398 |
| 5 | JGI25154J39366_1000423 | 3300002738 | Bacteria | 22650 |
| 6 | JGI25154J39366_1000432 | 3300002738 | Bacteria | 22245 |
| 7 | JGI25158J39367_1004193 | 3300002739 | Bacteria | 2173 |
| 8 | JGI25157J39369_1000158 | 3300002741 | Bacteria | 56328 |
| 9 | JGI25157J39369_1000203 | 3300002741 | Bacteria | 49480 |
| 10 | JGI25150J39212_1000958 | 3300002774 | Bacteria | 9153 |
| 11 | JGI25159J45721_1005430 | 3300002987 | Bacteria | 4001 |
| 12 | JGI25165J46597_1000384 | 3300003214 | Bacteria | 47815 |
| 13 | JGI25153J46596_10013454 | 3300003215 | Bacteria | 3455 |
| 14 | JGI25153J46596_10061407 | 3300003215 | Bacteria | 1018 |
| 15 | rootL2_10100680 | 3300003322 | Bacteria | 9467 |
| 16 | rootL2_10151808 | 3300003322 | Bacteria | 1107 |
| 17 | rootL2_10211541 | 3300003322 | Bacteria | 1016 |
| 18 | Ga0007410J51695_1033175 | 3300003574 | Bacteria | 4807 |
| 19 | Ga0007409J51694_1011722 | 3300003575 | Bacteria | 2155 |
| 20 | Ga0007416J51690_1019391 | 3300003577 | Bacteria | 4820 |
| 21 | Ga0032354_1027536 | 3300003693 | Bacteria | 4985 |
| 22 | Ga0055538_1000117 | 3300003751 | Bacteria | 60939 |
| 23 | Ga0055538_1000149 | 3300003751 | Bacteria | 47815 |
| 24 | Ga0055539_1000163 | 3300003752 | Bacteria | 60939 |
| 25 | Ga0055539_1000199 | 3300003752 | Bacteria | 47773 |
| 26 | Ga0055533_1000166 | 3300003756 | Bacteria | 60939 |
| 27 | Ga0055533_1000200 | 3300003756 | Bacteria | 47815 |
| 28 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 29 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 30 | Ga0055525_1000227 | 3300003759 | Bacteria | 60939 |
| 31 | Ga0055525_1000276 | 3300003759 | Bacteria | 47773 |
| 32 | Ga0055542_1007816 | 3300003762 | Bacteria | 2135 |
| 33 | Ga0055529_1000283 | 3300003763 | Bacteria | 60275 |
| 34 | Ga0055526_1000097 | 3300003771 | Bacteria | 79762 |
| 35 | Ga0055526_1000130 | 3300003771 | Bacteria | 66677 |
| 36 | Ga0055526_1000369 | 3300003771 | Bacteria | 36368 |
| 37 | Ga0055526_1005622 | 3300003771 | Bacteria | 7137 |
| 38 | Ga0055537_1000081 | 3300003773 | Bacteria | 69775 |
| 39 | Ga0055524_1011808 | 3300003775 | Bacteria | 3388 |
| 40 | Ga0055524_1021243 | 3300003775 | Bacteria | 2158 |
| 41 | Ga0055534_1000316 | 3300003784 | Bacteria | 32097 |
| 42 | Ga0055528_1000412 | 3300003790 | Bacteria | 34563 |
| 43 | Ga0055528_1030916 | 3300003790 | Bacteria | 1406 |
| 44 | Ga0055541_1000109 | 3300003841 | Bacteria | 60939 |
| 45 | Ga0055541_1000130 | 3300003841 | Bacteria | 47815 |
| 46 | Ga0055543_1015810 | 3300004625 | Bacteria | 1445 |
| 47 | Ga0065165_1000298 | 3300005262 | Bacteria | 83243 |
| 48 | Ga0065714_10113503 | 3300005288 | Bacteria | 1426 |
| 49 | Ga0065704_10154170 | 3300005289 | Bacteria | 1396 |
| 50 | Ga0065712_10110431 | 3300005290 | Bacteria | 1836 |
| 51 | Ga0065707_10113521 | 3300005295 | Bacteria | 2325 |
| 52 | Ga0070658_10076858 | 3300005327 | Bacteria | 2738 |
| 53 | Ga0070658_10217964 | 3300005327 | Bacteria | 1613 |
| 54 | Ga0070683_100002543 | 3300005329 | Bacteria | 14568 |
| 55 | Ga0070683_100110531 | 3300005329 | Bacteria | 2593 |
| 56 | Ga0070670_100002942 | 3300005331 | Bacteria | 14103 |
| 57 | Ga0070677_10018795 | 3300005333 | Bacteria | 2494 |
| 58 | Ga0070666_10026807 | 3300005335 | Bacteria | 3769 |
| 59 | Ga0070682_100003713 | 3300005337 | Bacteria | 8483 |
| 60 | Ga0068868_100000732 | 3300005338 | Bacteria | 22193 |
| 61 | Ga0070660_100004159 | 3300005339 | Bacteria | 9994 |
| 62 | Ga0070687_100000375 | 3300005343 | Bacteria | 15284 |
| 63 | Ga0070661_100032092 | 3300005344 | Bacteria | 3800 |
| 64 | Ga0070661_100072288 | 3300005344 | Bacteria | 2538 |
| 65 | Ga0070661_100275727 | 3300005344 | Bacteria | 1303 |
| 66 | Ga0070692_10200308 | 3300005345 | Bacteria | 1169 |
| 67 | Ga0070675_100000909 | 3300005354 | Bacteria | 21059 |
| 68 | Ga0070671_100000836 | 3300005355 | Bacteria | 22365 |
| 69 | Ga0070673_100000415 | 3300005364 | Bacteria | 22516 |
| 70 | Ga0070659_100065478 | 3300005366 | Bacteria | 2878 |
| 71 | Ga0070659_100084873 | 3300005366 | Bacteria | 2532 |
| 72 | Ga0070667_100032155 | 3300005367 | Bacteria | 4376 |
| 73 | Ga0070710_10088524 | 3300005437 | Bacteria | 1822 |
| 74 | Ga0070694_100000516 | 3300005444 | Bacteria | 21285 |
| 75 | Ga0070694_100023548 | 3300005444 | Bacteria | 3963 |
| 76 | Ga0070663_100039213 | 3300005455 | Bacteria | 3309 |
| 77 | Ga0070678_100000308 | 3300005456 | Bacteria | 22695 |
| 78 | Ga0070662_100094477 | 3300005457 | Bacteria | 2251 |
| 79 | Ga0070662_100116959 | 3300005457 | Bacteria | 2039 |
| 80 | Ga0068867_100055143 | 3300005459 | Bacteria | 2938 |
| 81 | Ga0070698_100357184 | 3300005471 | Bacteria | 1393 |
| 82 | Ga0070672_100000186 | 3300005543 | Bacteria | 34186 |
| 83 | Ga0070695_100131676 | 3300005545 | Bacteria | 1724 |
| 84 | Ga0070693_100030673 | 3300005547 | Bacteria | 2941 |
| 85 | Ga0070693_100045122 | 3300005547 | Bacteria | 2497 |
| 86 | Ga0070704_100000018 | 3300005549 | Bacteria | 54668 |
| 87 | Ga0068855_100006550 | 3300005563 | Bacteria | 14154 |
| 88 | Ga0068855_100356438 | 3300005563 | Bacteria | 1610 |
| 89 | Ga0068854_100000468 | 3300005578 | Bacteria | 24905 |
| 90 | Ga0068854_100153867 | 3300005578 | Bacteria | 1775 |
| 91 | Ga0068852_100000221 | 3300005616 | Bacteria | 38665 |
| 92 | Ga0068852_100540258 | 3300005616 | Bacteria | 1165 |
| 93 | Ga0068864_100053179 | 3300005618 | Bacteria | 3493 |
| 94 | Ga0068866_10203398 | 3300005718 | Bacteria | 1185 |
| 95 | Ga0068861_100001180 | 3300005719 | Bacteria | 16253 |
| 96 | Ga0068863_100300494 | 3300005841 | Bacteria | 1557 |
| 97 | Ga0068858_100003083 | 3300005842 | Bacteria | 16679 |
| 98 | Ga0068860_100001150 | 3300005843 | Bacteria | 29000 |
| 99 | Ga0075368_10052551 | 3300006042 | Bacteria | 1621 |
| 100 | Ga0075364_10241356 | 3300006051 | Bacteria | 1227 |
| 101 | Ga0070716_100063273 | 3300006173 | Bacteria | 2148 |
| 102 | Ga0070716_100070041 | 3300006173 | Bacteria | 2058 |
| 103 | Ga0075362_10147164 | 3300006177 | Bacteria | 1128 |
| 104 | Ga0097621_100000202 | 3300006237 | Bacteria | 38810 |
| 105 | Ga0068871_100000840 | 3300006358 | Bacteria | 20567 |
| 106 | Ga0075428_100002361 | 3300006844 | Bacteria | 20488 |
| 107 | Ga0075434_100303159 | 3300006871 | Bacteria | 1618 |
| 108 | Ga0075429_100016430 | 3300006880 | Bacteria | 6414 |
| 109 | Ga0068865_100000995 | 3300006881 | Bacteria | 16253 |
| 110 | Ga0075436_100019561 | 3300006914 | Bacteria | 4640 |
| 111 | Ga0079104_1006538 | 3300006946 | Bacteria | 4384 |
| 112 | Ga0079104_1011217 | 3300006946 | Bacteria | 2895 |
| 113 | Ga0075435_100245874 | 3300007076 | Bacteria | 1522 |
| 114 | Ga0105251_10056540 | 3300009011 | Bacteria | 1857 |
| 115 | Ga0105244_10013324 | 3300009036 | Bacteria | 4813 |
| 116 | Ga0105244_10020166 | 3300009036 | Bacteria | 3706 |
| 117 | Ga0105244_10121984 | 3300009036 | Bacteria | 1262 |
| 118 | Ga0105240_10143149 | 3300009093 | Bacteria | 2856 |
| 119 | Ga0105240_10156199 | 3300009093 | Bacteria | 2713 |
| 120 | Ga0111539_10002093 | 3300009094 | Bacteria | 26670 |
| 121 | Ga0105245_10105175 | 3300009098 | Bacteria | 2618 |
| 122 | Ga0105245_10118126 | 3300009098 | Bacteria | 2474 |
| 123 | Ga0114129_10625744 | 3300009147 | Bacteria | 1392 |
| 124 | Ga0105243_10554076 | 3300009148 | Bacteria | 1099 |
| 125 | Ga0105242_10001129 | 3300009176 | Bacteria | 21023 |
| 126 | Ga0105242_10016961 | 3300009176 | Bacteria | 5668 |
| 127 | Ga0105242_10043759 | 3300009176 | Bacteria | 3624 |
| 128 | Ga0105237_10120736 | 3300009545 | Bacteria | 2615 |
| 129 | Ga0105237_10464231 | 3300009545 | Bacteria | 1272 |
| 130 | Ga0105238_10000505 | 3300009551 | Bacteria | 41099 |
| 131 | Ga0105238_10050112 | 3300009551 | Bacteria | 4204 |
| 132 | Ga0105238_10078969 | 3300009551 | Bacteria | 3281 |
| 133 | Ga0157373_10156712 | 3300013100 | Bacteria | 1602 |
| 134 | Ga0157371_10000399 | 3300013102 | Bacteria | 54380 |
| 135 | Ga0157370_10009913 | 3300013104 | Bacteria | 10094 |
| 136 | Ga0157378_10002410 | 3300013297 | Bacteria | 16624 |
| 137 | Ga0157378_10036498 | 3300013297 | Bacteria | 4349 |
| 138 | Ga0163162_10003271 | 3300013306 | Bacteria | 15506 |
| 139 | Ga0157372_10047926 | 3300013307 | Bacteria | 4749 |
| 140 | Ga0157375_10007942 | 3300013308 | Bacteria | 9288 |
| 141 | Ga0182008_10001399 | 3300014497 | Bacteria | 16252 |
| 142 | Ga0182008_10041786 | 3300014497 | Bacteria | 2286 |
| 143 | Ga0157377_10122419 | 3300014745 | Bacteria | 1578 |
| 144 | Ga0157376_10004021 | 3300014969 | Bacteria | 10171 |
| 145 | Ga0182006_1000010 | 3300015261 | Bacteria | 413414 |
| 146 | Ga0182006_1000055 | 3300015261 | Bacteria | 173139 |
| 147 | Ga0182007_10000030 | 3300015262 | Bacteria | 156866 |
| 148 | Ga0182007_10008037 | 3300015262 | Bacteria | 4362 |
| 149 | Ga0182007_10012398 | 3300015262 | Bacteria | 3279 |
| 150 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 151 | Ga0182005_1000009 | 3300015265 | Bacteria | 455334 |
| 152 | Ga0182005_1000402 | 3300015265 | Bacteria | 23631 |
| 153 | Ga0163161_10038295 | 3300017792 | Bacteria | 3439 |
| 154 | Ga0213872_10000117 | 3300021361 | Bacteria | 73833 |
| 155 | Ga0213872_10000205 | 3300021361 | Bacteria | 52617 |
| 156 | Ga0213872_10001659 | 3300021361 | Bacteria | 14028 |
| 157 | Ga0213872_10076759 | 3300021361 | Bacteria | 1502 |
| 158 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 159 | Ga0209435_100214 | 3300025206 | Bacteria | 16487 |
| 160 | Ga0209760_101321 | 3300025207 | Bacteria | 2686 |
| 161 | Ga0209784_100153 | 3300025224 | Bacteria | 62664 |
| 162 | Ga0209784_100191 | 3300025224 | Bacteria | 48497 |
| 163 | Ga0209566_100195 | 3300025225 | Bacteria | 62664 |
| 164 | Ga0209566_100252 | 3300025225 | Bacteria | 51250 |
| 165 | Ga0209674_100069 | 3300025226 | Bacteria | 243948 |
| 166 | Ga0209674_100198 | 3300025226 | Bacteria | 62664 |
| 167 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 168 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 169 | Ga0209563_100157 | 3300025230 | Bacteria | 62664 |
| 170 | Ga0209563_100167 | 3300025230 | Bacteria | 47867 |
| 171 | Ga0207427_100317 | 3300025231 | Bacteria | 32881 |
| 172 | Ga0209437_100084 | 3300025233 | Bacteria | 255423 |
| 173 | Ga0209437_100091 | 3300025233 | Bacteria | 243344 |
| 174 | Ga0209437_109387 | 3300025233 | Bacteria | 1527 |
| 175 | Ga0209258_100560 | 3300025242 | Bacteria | 32331 |
| 176 | Ga0207425_1000006 | 3300025245 | Bacteria | 808854 |
| 177 | Ga0207425_1000177 | 3300025245 | Bacteria | 52401 |
| 178 | Ga0207425_1001644 | 3300025245 | Bacteria | 8998 |
| 179 | Ga0209646_1000032 | 3300025246 | Bacteria | 375315 |
| 180 | Ga0209646_1000104 | 3300025246 | Bacteria | 163824 |
| 181 | Ga0209646_1000283 | 3300025246 | Bacteria | 44163 |
| 182 | Ga0209026_1000062 | 3300025250 | Bacteria | 213298 |
| 183 | Ga0209026_1001071 | 3300025250 | Bacteria | 13234 |
| 184 | Ga0209677_100039 | 3300025253 | Bacteria | 243974 |
| 185 | Ga0209677_100156 | 3300025253 | Bacteria | 62664 |
| 186 | Ga0209148_1000272 | 3300025254 | Bacteria | 81330 |
| 187 | Ga0209148_1009034 | 3300025254 | Bacteria | 1968 |
| 188 | Ga0209759_1000054 | 3300025256 | Bacteria | 211422 |
| 189 | Ga0209759_1000548 | 3300025256 | Bacteria | 38674 |
| 190 | Ga0209129_1000009 | 3300025258 | Bacteria | 633100 |
| 191 | Ga0209233_1000115 | 3300025261 | Bacteria | 243344 |
| 192 | Ga0209233_1034668 | 3300025261 | Bacteria | 1147 |
| 193 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 194 | Ga0209565_1001221 | 3300025263 | Bacteria | 12132 |
| 195 | Ga0209455_1000063 | 3300025272 | Bacteria | 333019 |
| 196 | Ga0209455_1001258 | 3300025272 | Bacteria | 11892 |
| 197 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 198 | Ga0209130_1000067 | 3300025284 | Bacteria | 184277 |
| 199 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 200 | Ga0209675_1003933 | 3300025291 | Bacteria | 6809 |
| 201 | Ga0209675_1006468 | 3300025291 | Bacteria | 4689 |
| 202 | Ga0209025_1015265 | 3300025294 | Bacteria | 4646 |
| 203 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 204 | Ga0209564_1000026 | 3300025295 | Bacteria | 519154 |
| 205 | Ga0209564_1000085 | 3300025295 | Bacteria | 251509 |
| 206 | Ga0209564_1000087 | 3300025295 | Bacteria | 250787 |
| 207 | Ga0209758_1000314 | 3300025297 | Bacteria | 93818 |
| 208 | Ga0209758_1001155 | 3300025297 | Bacteria | 33795 |
| 209 | Ga0209050_1000219 | 3300025298 | Bacteria | 128416 |
| 210 | Ga0209050_1000816 | 3300025298 | Bacteria | 43506 |
| 211 | Ga0209050_1029602 | 3300025298 | Bacteria | 1746 |
| 212 | Ga0209256_1000037 | 3300025299 | Bacteria | 377661 |
| 213 | Ga0209256_1000191 | 3300025299 | Bacteria | 117653 |
| 214 | Ga0209256_1002450 | 3300025299 | Bacteria | 15133 |
| 215 | Ga0209256_1007152 | 3300025299 | Bacteria | 5617 |
| 216 | Ga0207426_1004561 | 3300025302 | Bacteria | 6695 |
| 217 | Ga0207426_1037312 | 3300025302 | Bacteria | 1538 |
| 218 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 219 | Ga0207656_10000761 | 3300025321 | Bacteria | 10564 |
| 220 | Ga0207655_1000781 | 3300025728 | Bacteria | 34999 |
| 221 | Ga0207655_1024227 | 3300025728 | Bacteria | 2980 |
| 222 | Ga0207653_10008321 | 3300025885 | Bacteria | 3233 |
| 223 | Ga0207682_10003314 | 3300025893 | Bacteria | 7030 |
| 224 | Ga0207642_10002367 | 3300025899 | Bacteria | 5873 |
| 225 | Ga0207642_10124604 | 3300025899 | Bacteria | 1335 |
| 226 | Ga0207705_10003612 | 3300025909 | Bacteria | 11782 |
| 227 | Ga0207654_10009376 | 3300025911 | Bacteria | 4971 |
| 228 | Ga0207695_10001902 | 3300025913 | Bacteria | 32583 |
| 229 | Ga0207695_10003295 | 3300025913 | Bacteria | 22928 |
| 230 | Ga0207695_10078841 | 3300025913 | Bacteria | 3340 |
| 231 | Ga0207671_10029222 | 3300025914 | Bacteria | 4117 |
| 232 | Ga0207660_10008827 | 3300025917 | Bacteria | 6513 |
| 233 | Ga0207657_10028170 | 3300025919 | Bacteria | 5130 |
| 234 | Ga0207657_10064383 | 3300025919 | Bacteria | 3129 |
| 235 | Ga0207657_10336368 | 3300025919 | Bacteria | 1192 |
| 236 | Ga0207649_10037291 | 3300025920 | Bacteria | 2935 |
| 237 | Ga0207694_10000392 | 3300025924 | Bacteria | 40819 |
| 238 | Ga0207694_10060801 | 3300025924 | Bacteria | 2940 |
| 239 | Ga0207650_10001199 | 3300025925 | Bacteria | 19021 |
| 240 | Ga0207687_10219246 | 3300025927 | Bacteria | 1497 |
| 241 | Ga0207644_10000365 | 3300025931 | Bacteria | 29528 |
| 242 | Ga0207690_10046079 | 3300025932 | Bacteria | 2885 |
| 243 | Ga0207690_10196722 | 3300025932 | Bacteria | 1528 |
| 244 | Ga0207706_10081840 | 3300025933 | Bacteria | 2837 |
| 245 | Ga0207706_10228689 | 3300025933 | Bacteria | 1628 |
| 246 | Ga0207686_10001803 | 3300025934 | Bacteria | 11906 |
| 247 | Ga0207709_10000662 | 3300025935 | Bacteria | 27921 |
| 248 | Ga0207709_10020122 | 3300025935 | Bacteria | 3762 |
| 249 | Ga0207670_10007832 | 3300025936 | Bacteria | 5995 |
| 250 | Ga0207704_10000679 | 3300025938 | Bacteria | 15056 |
| 251 | Ga0207665_10125949 | 3300025939 | Bacteria | 1814 |
| 252 | Ga0207665_10247706 | 3300025939 | Bacteria | 1315 |
| 253 | Ga0207691_10000276 | 3300025940 | Bacteria | 50778 |
| 254 | Ga0207689_10187006 | 3300025942 | Bacteria | 1708 |
| 255 | Ga0207689_10327404 | 3300025942 | Bacteria | 1272 |
| 256 | Ga0207661_10138369 | 3300025944 | Bacteria | 2093 |
| 257 | Ga0207661_10209893 | 3300025944 | Bacteria | 1716 |
| 258 | Ga0207679_10011415 | 3300025945 | Bacteria | 5753 |
| 259 | Ga0207667_10000019 | 3300025949 | Bacteria | 386233 |
| 260 | Ga0207667_10000304 | 3300025949 | Bacteria | 68102 |
| 261 | Ga0207667_10014829 | 3300025949 | Bacteria | 8865 |
| 262 | Ga0207677_10010022 | 3300026023 | Bacteria | 5347 |
| 263 | Ga0207703_10029929 | 3300026035 | Bacteria | 4299 |
| 264 | Ga0207639_10028856 | 3300026041 | Bacteria | 4056 |
| 265 | Ga0207702_10029243 | 3300026078 | Bacteria | 4584 |
| 266 | Ga0207648_10044715 | 3300026089 | Bacteria | 3885 |
| 267 | Ga0207648_10095259 | 3300026089 | Bacteria | 2604 |
| 268 | Ga0207674_10063290 | 3300026116 | Bacteria | 3734 |
| 269 | Ga0207675_100002627 | 3300026118 | Bacteria | 17768 |
| 270 | Ga0207683_10001296 | 3300026121 | Bacteria | 22599 |
| 271 | Ga0207698_10000451 | 3300026142 | Bacteria | 23736 |
| 272 | Ga0207698_10152971 | 3300026142 | Bacteria | 2005 |
| 273 | Ga0209281_1004617 | 3300027111 | Bacteria | 4069 |
| 274 | Ga0209371_1002401 | 3300027312 | Bacteria | 10530 |
| 275 | Ga0209967_1001999 | 3300027364 | Bacteria | 2630 |
| 276 | Ga0210000_1000453 | 3300027462 | Bacteria | 5640 |
| 277 | Ga0209995_1005769 | 3300027471 | Bacteria | 1990 |
| 278 | Ga0209970_1005907 | 3300027614 | Bacteria | 2011 |
| 279 | Ga0209983_1021243 | 3300027665 | Bacteria | 1356 |
| 280 | Ga0209971_1014677 | 3300027682 | Bacteria | 1857 |
| 281 | Ga0209974_10006355 | 3300027876 | Bacteria | 4127 |
| 282 | Ga0207428_10002740 | 3300027907 | Bacteria | 17552 |
| 283 | Ga0268266_10200785 | 3300028379 | Bacteria | 1825 |
| 284 | Ga0268264_10001359 | 3300028381 | Bacteria | 22915 |
| 285 | Ga0268256_1002137 | 3300030500 | Bacteria | 10530 |
| 286 | Ga0265328_10000038 | 3300031239 | Bacteria | 91571 |
| 287 | Ga0265328_10003136 | 3300031239 | Bacteria | 7365 |
| 288 | Ga0265331_10000138 | 3300031250 | Bacteria | 96032 |
| 289 | Ga0265331_10007132 | 3300031250 | Bacteria | 6503 |
| 290 | Ga0265327_10000299 | 3300031251 | Bacteria | 96033 |
| 291 | Ga0265327_10000596 | 3300031251 | Bacteria | 60242 |
| 292 | Ga0265327_10001822 | 3300031251 | Bacteria | 24922 |
| 293 | Ga0265327_10014184 | 3300031251 | Bacteria | 5228 |
| 294 | Ga0265327_10072507 | 3300031251 | Bacteria | 1719 |
| 295 | Ga0307408_100000180 | 3300031548 | Bacteria | 70740 |
| 296 | Ga0307408_100000533 | 3300031548 | Bacteria | 32873 |
| 297 | Ga0307408_100482095 | 3300031548 | Bacteria | 1082 |
| 298 | Ga0316575_10003949 | 3300031665 | Bacteria | 5188 |
| 299 | Ga0316579_10018724 | 3300031691 | Bacteria | 3050 |
| 300 | Ga0316578_10151188 | 3300031728 | Bacteria | 1398 |
| 301 | Ga0307518_10009169 | 3300031838 | Bacteria | 7063 |
| 302 | Ga0307416_100222234 | 3300032002 | Bacteria | 1812 |
| 303 | Ga0316583_10038198 | 3300032133 | Bacteria | 1702 |
| 304 | Ga0373953_0030268 | 3300035117 | Bacteria | 2098 |
| 305 | Ga0373954_0044214 | 3300035118 | Bacteria | 2078 |
| 306 | Ga0373955_0024236 | 3300035172 | Bacteria | 3101 |
| 307 | Ga0373924_0007425 | 3300035410 | Bacteria | 3959 |
| 308 | Ga0373931_0237796 | 3300035691 | Bacteria | 1103 |
| 309 | Ga0373933_0005227 | 3300035724 | Bacteria | 7081 |
| 310 | Ga0373937_0056523 | 3300036401 | Bacteria | 3604 |
| 311 | Ga0373937_0215897 | 3300036401 | Bacteria | 1805 |
| 312 | Ga0316582_0044737 | 3300036647 | Bacteria | 2784 |
| 313 | Ga0316582_0280702 | 3300036647 | Bacteria | 1143 |
| 314 | Ga0316582_0342472 | 3300036647 | Bacteria | 1028 |
| 315 | Ga0316584_0009596 | 3300036712 | Bacteria | 6726 |
| 316 | Ga0395899_0000093 | 3300037312 | Bacteria | 153541 |
| 317 | Ga0395899_0002578 | 3300037312 | Bacteria | 14617 |
| 318 | Ga0395899_0010125 | 3300037312 | Bacteria | 7230 |
| 319 | Ga0395899_0283124 | 3300037312 | Bacteria | 1127 |
| 320 | Ga0395899_0283829 | 3300037312 | Bacteria | 1125 |
| 321 | Ga0395900_0000267 | 3300037418 | Bacteria | 80920 |
| 322 | Ga0395900_0040547 | 3300037418 | Bacteria | 4798 |
| 323 | Ga0395900_0045762 | 3300037418 | Bacteria | 4507 |
| 324 | Ga0395900_0214321 | 3300037418 | Bacteria | 1943 |
| 325 | Ga0395900_0217458 | 3300037418 | Bacteria | 1927 |
| 326 | Ga0395900_0374663 | 3300037418 | Bacteria | 1392 |
| 327 | Ga0395900_0420226 | 3300037418 | Bacteria | 1298 |
| 328 | Ga0395898_0123185 | 3300037466 | Bacteria | 2484 |
| 329 | Ga0395898_0347908 | 3300037466 | Bacteria | 1413 |
| 330 | Ga0395905_0000137 | 3300037471 | Bacteria | 120800 |
| 331 | Ga0395905_0003859 | 3300037471 | Bacteria | 15810 |
| 332 | Ga0395905_0009356 | 3300037471 | Bacteria | 9581 |
| 333 | Ga0395905_0100043 | 3300037471 | Bacteria | 2722 |
| 334 | Ga0395905_0245727 | 3300037471 | Bacteria | 1672 |
| 335 | Ga0395905_0273789 | 3300037471 | Bacteria | 1574 |
| 336 | Ga0395901_0004507 | 3300038443 | Bacteria | 14046 |
| 337 | Ga0395901_0066463 | 3300038443 | Bacteria | 3755 |
| 338 | Ga0395901_0083899 | 3300038443 | Bacteria | 3330 |
| 339 | Ga0395901_0663565 | 3300038443 | Bacteria | 1044 |
| 340 | Ga0395901_0726052 | 3300038443 | Bacteria | 988 |
| 341 | Ga0400490_19738 | 3300038726 | Bacteria | 21312 |
| 342 | Ga0436361_0108899 | 3300039447 | Bacteria | 37383 |
| 343 | Ga0436361_0365472 | 3300039447 | Bacteria | 11020 |
| 344 | Ga0436361_0421155 | 3300039447 | Bacteria | 12501 |
| 345 | Ga0436361_0487158 | 3300039447 | Bacteria | 12381 |
| 346 | Ga0436361_0527946 | 3300039447 | Bacteria | 1136 |
| 347 | Ga0439437_005699 | 3300042000 | Bacteria | 1372 |
| 348 | Ga0439448_0006541 | 3300042005 | Bacteria | 3355 |
| 349 | Ga0439455_0008261 | 3300042012 | Bacteria | 2227 |
| 350 | Ga0439456_001190 | 3300042013 | Bacteria | 5170 |
| 351 | Ga0450911_000017 | 3300042115 | Bacteria | 104823 |
| 352 | Ga0450904_000186 | 3300042139 | Bacteria | 13567 |
| 353 | Ga0450904_001077 | 3300042139 | Bacteria | 4206 |
| 354 | Ga0439446_0002588 | 3300042156 | Bacteria | 4362 |
| 355 | Ga0450916_000123 | 3300042530 | Bacteria | 5284 |
| 356 | Ga0450901_002686 | 3300042533 | Bacteria | 1897 |
| 357 | Ga0451577_0000527 | 3300042876 | Bacteria | 63726 |
| 358 | Ga0451577_0000587 | 3300042876 | Bacteria | 58386 |
| 359 | Ga0451577_0002228 | 3300042876 | Bacteria | 23580 |
| 360 | Ga0451577_0002821 | 3300042876 | Bacteria | 20040 |
| 361 | Ga0466969_0048470 | 3300044656 | Bacteria | 2100 |
| 362 | Ga0466965_0229810 | 3300044683 | Bacteria | 990 |
| 363 | Ga0466965_0233089 | 3300044683 | Bacteria | 984 |
| 364 | Ga0466966_0001804 | 3300044684 | Bacteria | 13879 |
| 365 | Ga0466963_0280581 | 3300044694 | Bacteria | 1171 |
| 366 | Ga0466964_0001091 | 3300044706 | Bacteria | 9090 |
| 367 | Ga0466964_0037609 | 3300044706 | Bacteria | 1944 |
| 368 | Ga0453684_0000107 | 3300044712 | Bacteria | 362864 |
| 369 | Ga0453684_0002450 | 3300044712 | Bacteria | 45105 |
| 370 | Ga0453684_0003037 | 3300044712 | Bacteria | 39031 |
| 371 | Ga0453684_0003130 | 3300044712 | Bacteria | 38096 |
| 372 | Ga0453684_0034693 | 3300044712 | Bacteria | 6993 |
| 373 | Ga0453684_0053717 | 3300044712 | Bacteria | 5256 |
| 374 | Ga0453684_0814936 | 3300044712 | Bacteria | 1006 |
| 375 | Ga0466968_0005462 | 3300044735 | Bacteria | 4755 |
| 376 | Ga0466968_0016377 | 3300044735 | Bacteria | 2951 |
| 377 | Ga0466970_0003911 | 3300044765 | Bacteria | 7297 |
| 378 | Ga0466957_0021820 | 3300044842 | Bacteria | 3774 |
| 379 | Ga0466957_0064371 | 3300044842 | Bacteria | 2256 |
| 380 | Ga0466959_0135357 | 3300045049 | Bacteria | 1744 |
| 381 | Ga0451576_0000325 | 3300045051 | Bacteria | 115644 |
| 382 | Ga0451576_0002559 | 3300045051 | Bacteria | 26842 |
| 383 | Ga0451576_0003298 | 3300045051 | Bacteria | 22416 |
| 384 | Ga0451576_0092791 | 3300045051 | Bacteria | 3140 |
| 385 | Ga0451576_0109414 | 3300045051 | Bacteria | 2876 |
| 386 | Ga0466967_0009867 | 3300045976 | Bacteria | 7120 |
| 387 | Ga0466967_0164786 | 3300045976 | Bacteria | 2082 |
| 388 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 389 | Ga0495617_000053 | 3300046452 | Bacteria | 103718 |
| 390 | Ga0495617_000189 | 3300046452 | Bacteria | 38970 |
| 391 | Ga0495617_001777 | 3300046452 | Bacteria | 9209 |
| 392 | Ga0495627_000065 | 3300046453 | Bacteria | 132414 |
| 393 | Ga0495627_000915 | 3300046453 | Bacteria | 20456 |
| 394 | Ga0495627_002699 | 3300046453 | Bacteria | 8299 |
| 395 | Ga0495592_0006738 | 3300046454 | Bacteria | 8569 |
| 396 | Ga0495592_0011284 | 3300046454 | Bacteria | 6757 |
| 397 | Ga0495592_0047786 | 3300046454 | Bacteria | 3186 |
| 398 | Ga0495603_0020894 | 3300046455 | Bacteria | 3963 |
| 399 | Ga0495603_0052336 | 3300046455 | Bacteria | 2424 |
| 400 | Ga0495590_0000023 | 3300046457 | Bacteria | 196939 |
| 401 | Ga0495590_0000423 | 3300046457 | Bacteria | 21352 |
| 402 | Ga0495590_0007300 | 3300046457 | Bacteria | 4269 |
| 403 | Ga0495591_000893 | 3300046458 | Bacteria | 20883 |
| 404 | Ga0495629_0008060 | 3300046459 | Bacteria | 7754 |
| 405 | Ga0495629_0044367 | 3300046459 | Bacteria | 3120 |
| 406 | Ga0495638_0012727 | 3300046460 | Bacteria | 5753 |
| 407 | Ga0495638_0025052 | 3300046460 | Bacteria | 3882 |
| 408 | Ga0495638_0150819 | 3300046460 | Bacteria | 1348 |
| 409 | Ga0495651_0017536 | 3300046462 | Bacteria | 5545 |
| 410 | Ga0495651_0058119 | 3300046462 | Bacteria | 2967 |
| 411 | Ga0495651_0207606 | 3300046462 | Bacteria | 1366 |
| 412 | Ga0495653_0000007 | 3300046463 | Bacteria | 314281 |
| 413 | Ga0495653_0034843 | 3300046463 | Bacteria | 3976 |
| 414 | Ga0495653_0043318 | 3300046463 | Bacteria | 3499 |
| 415 | Ga0495653_0043630 | 3300046463 | Bacteria | 3485 |
| 416 | Ga0495653_0048598 | 3300046463 | Bacteria | 3273 |
| 417 | Ga0495650_0000056 | 3300046471 | Bacteria | 307565 |
| 418 | Ga0495650_0000263 | 3300046471 | Bacteria | 101749 |
| 419 | Ga0495650_0000391 | 3300046471 | Bacteria | 74982 |
| 420 | Ga0495650_0000513 | 3300046471 | Bacteria | 57517 |
| 421 | Ga0495650_0001177 | 3300046471 | Bacteria | 27813 |
| 422 | Ga0495650_0001570 | 3300046471 | Bacteria | 21478 |
| 423 | Ga0495650_0003681 | 3300046471 | Bacteria | 10981 |
| 424 | Ga0495582_0034143 | 3300046473 | Bacteria | 2796 |
| 425 | Ga0495605_0000005 | 3300046474 | Bacteria | 376973 |
| 426 | Ga0495605_0000276 | 3300046474 | Bacteria | 57745 |
| 427 | Ga0495605_0000463 | 3300046474 | Bacteria | 36335 |
| 428 | Ga0495605_0003780 | 3300046474 | Bacteria | 8982 |
| 429 | Ga0495605_0015087 | 3300046474 | Bacteria | 4213 |
| 430 | Ga0495605_0024736 | 3300046474 | Bacteria | 3138 |
| 431 | Ga0495605_0078075 | 3300046474 | Bacteria | 1552 |
| 432 | Ga0495664_0012870 | 3300046477 | Bacteria | 4740 |
| 433 | Ga0495584_0000011 | 3300046491 | Bacteria | 208322 |
| 434 | Ga0495584_0000407 | 3300046491 | Bacteria | 29756 |
| 435 | Ga0495584_0011678 | 3300046491 | Bacteria | 4495 |
| 436 | Ga0495584_0021406 | 3300046491 | Bacteria | 3285 |
| 437 | Ga0495584_0023014 | 3300046491 | Bacteria | 3160 |
| 438 | Ga0495584_0047462 | 3300046491 | Bacteria | 2165 |
| 439 | Ga0495584_0076907 | 3300046491 | Bacteria | 1678 |
| 440 | Ga0495584_0092902 | 3300046491 | Bacteria | 1522 |
| 441 | Ga0495585_0000106 | 3300046492 | Bacteria | 89096 |
| 442 | Ga0495585_0000231 | 3300046492 | Bacteria | 57572 |
| 443 | Ga0495585_0000661 | 3300046492 | Bacteria | 31722 |
| 444 | Ga0495585_0003484 | 3300046492 | Bacteria | 10619 |
| 445 | Ga0495585_0008809 | 3300046492 | Bacteria | 6090 |
| 446 | Ga0495585_0008946 | 3300046492 | Bacteria | 6039 |
| 447 | Ga0495585_0018535 | 3300046492 | Bacteria | 4014 |
| 448 | Ga0495585_0044513 | 3300046492 | Bacteria | 2479 |
| 449 | Ga0495585_0044618 | 3300046492 | Bacteria | 2476 |
| 450 | Ga0495585_0059809 | 3300046492 | Bacteria | 2098 |
| 451 | Ga0495585_0067734 | 3300046492 | Bacteria | 1951 |
| 452 | Ga0495585_0086479 | 3300046492 | Bacteria | 1693 |
| 453 | Ga0495594_0020621 | 3300046499 | Bacteria | 3511 |
| 454 | Ga0495594_0066322 | 3300046499 | Bacteria | 2002 |
| 455 | Ga0495594_0129749 | 3300046499 | Bacteria | 1427 |
| 456 | Ga0495594_0132564 | 3300046499 | Bacteria | 1411 |
| 457 | Ga0495594_0177980 | 3300046499 | Bacteria | 1210 |
| 458 | Ga0495596_0000167 | 3300046500 | Bacteria | 46189 |
| 459 | Ga0495596_0014205 | 3300046500 | Bacteria | 3358 |
| 460 | Ga0495596_0015538 | 3300046500 | Bacteria | 3184 |
| 461 | Ga0495596_0020140 | 3300046500 | Bacteria | 2732 |
| 462 | Ga0495596_0049083 | 3300046500 | Bacteria | 1654 |
| 463 | Ga0495596_0074882 | 3300046500 | Bacteria | 1314 |
| 464 | Ga0495607_0004161 | 3300046501 | Bacteria | 10763 |
| 465 | Ga0495607_0007201 | 3300046501 | Bacteria | 7724 |
| 466 | Ga0495607_0008583 | 3300046501 | Bacteria | 6976 |
| 467 | Ga0495607_0045420 | 3300046501 | Bacteria | 2584 |
| 468 | Ga0495607_0045876 | 3300046501 | Bacteria | 2568 |
| 469 | Ga0495607_0074160 | 3300046501 | Bacteria | 1889 |
| 470 | Ga0495583_0000004 | 3300046506 | Bacteria | 655287 |
| 471 | Ga0495583_0000204 | 3300046506 | Bacteria | 99749 |
| 472 | Ga0495583_0001039 | 3300046506 | Bacteria | 31364 |
| 473 | Ga0495583_0001924 | 3300046506 | Bacteria | 19210 |
| 474 | Ga0495583_0004914 | 3300046506 | Bacteria | 9296 |
| 475 | Ga0495583_0009235 | 3300046506 | Bacteria | 5912 |
| 476 | Ga0495583_0015642 | 3300046506 | Bacteria | 4114 |
| 477 | Ga0495583_0060923 | 3300046506 | Bacteria | 1685 |
| 478 | Ga0495606_0000007 | 3300046507 | Bacteria | 323713 |
| 479 | Ga0495606_0000044 | 3300046507 | Bacteria | 212802 |
| 480 | Ga0495606_0000135 | 3300046507 | Bacteria | 125830 |
| 481 | Ga0495606_0004898 | 3300046507 | Bacteria | 13105 |
| 482 | Ga0495606_0008217 | 3300046507 | Bacteria | 9122 |
| 483 | Ga0495606_0012120 | 3300046507 | Bacteria | 6952 |
| 484 | Ga0495606_0018285 | 3300046507 | Bacteria | 5263 |
| 485 | Ga0495606_0022663 | 3300046507 | Bacteria | 4566 |
| 486 | Ga0495608_0000970 | 3300046511 | Bacteria | 20268 |
| 487 | Ga0495608_0003690 | 3300046511 | Bacteria | 11009 |
| 488 | Ga0495608_0004043 | 3300046511 | Bacteria | 10528 |
| 489 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 490 | Ga0495610_0000670 | 3300046512 | Bacteria | 33331 |
| 491 | Ga0495610_0009390 | 3300046512 | Bacteria | 6190 |
| 492 | Ga0495610_0011329 | 3300046512 | Bacteria | 5458 |
| 493 | Ga0495616_0000845 | 3300046513 | Bacteria | 22352 |
| 494 | Ga0495616_0000954 | 3300046513 | Bacteria | 20790 |
| 495 | Ga0495616_0024752 | 3300046513 | Bacteria | 3215 |
| 496 | Ga0495616_0026767 | 3300046513 | Bacteria | 3065 |
| 497 | Ga0495616_0046538 | 3300046513 | Bacteria | 2188 |
| 498 | Ga0495616_0050953 | 3300046513 | Bacteria | 2067 |
| 499 | Ga0495616_0054221 | 3300046513 | Bacteria | 1989 |
| 500 | Ga0495618_0007057 | 3300046514 | Bacteria | 6798 |
| 501 | Ga0495618_0022757 | 3300046514 | Bacteria | 3871 |
| 502 | Ga0495618_0026265 | 3300046514 | Bacteria | 3619 |
| 503 | Ga0495628_0005360 | 3300046516 | Bacteria | 11252 |
| 504 | Ga0495628_0006429 | 3300046516 | Bacteria | 10265 |
| 505 | Ga0495628_0042112 | 3300046516 | Bacteria | 3643 |
| 506 | Ga0495628_0081330 | 3300046516 | Bacteria | 2516 |
| 507 | Ga0495630_0012748 | 3300046517 | Bacteria | 6106 |
| 508 | Ga0495631_0055086 | 3300046518 | Bacteria | 1732 |
| 509 | Ga0495631_0055138 | 3300046518 | Bacteria | 1731 |
| 510 | Ga0495632_0000236 | 3300046519 | Bacteria | 55200 |
| 511 | Ga0495632_0002684 | 3300046519 | Bacteria | 13315 |
| 512 | Ga0495632_0003478 | 3300046519 | Bacteria | 11139 |
| 513 | Ga0495632_0073536 | 3300046519 | Bacteria | 1638 |
| 514 | Ga0495637_0000049 | 3300046520 | Bacteria | 103081 |
| 515 | Ga0495637_0001263 | 3300046520 | Bacteria | 15271 |
| 516 | Ga0495637_0005037 | 3300046520 | Bacteria | 6790 |
| 517 | Ga0495637_0005121 | 3300046520 | Bacteria | 6724 |
| 518 | Ga0495643_0000250 | 3300046522 | Bacteria | 78905 |
| 519 | Ga0495643_0000349 | 3300046522 | Bacteria | 62735 |
| 520 | Ga0495643_0000400 | 3300046522 | Bacteria | 56861 |
| 521 | Ga0495643_0001823 | 3300046522 | Bacteria | 18130 |
| 522 | Ga0495643_0002736 | 3300046522 | Bacteria | 13571 |
| 523 | Ga0495643_0013936 | 3300046522 | Bacteria | 4792 |
| 524 | Ga0495643_0014196 | 3300046522 | Bacteria | 4743 |
| 525 | Ga0495643_0016260 | 3300046522 | Bacteria | 4374 |
| 526 | Ga0495643_0017918 | 3300046522 | Bacteria | 4129 |
| 527 | Ga0495643_0107629 | 3300046522 | Bacteria | 1421 |
| 528 | Ga0495644_0012255 | 3300046523 | Bacteria | 3296 |
| 529 | Ga0495644_0071865 | 3300046523 | Bacteria | 1300 |
| 530 | Ga0495648_0000008 | 3300046524 | Bacteria | 336584 |
| 531 | Ga0495648_0000305 | 3300046524 | Bacteria | 54610 |
| 532 | Ga0495648_0000666 | 3300046524 | Bacteria | 36662 |
| 533 | Ga0495648_0001937 | 3300046524 | Bacteria | 19717 |
| 534 | Ga0495648_0004977 | 3300046524 | Bacteria | 11165 |
| 535 | Ga0495648_0022493 | 3300046524 | Bacteria | 4338 |
| 536 | Ga0495648_0023837 | 3300046524 | Bacteria | 4180 |
| 537 | Ga0495663_0001409 | 3300046525 | Bacteria | 7583 |
| 538 | Ga0495666_0000409 | 3300046526 | Bacteria | 18954 |
| 539 | Ga0495666_0001755 | 3300046526 | Bacteria | 10695 |
| 540 | Ga0495666_0018256 | 3300046526 | Bacteria | 3493 |
| 541 | Ga0495642_0000183 | 3300046528 | Bacteria | 37080 |
| 542 | Ga0495642_0004033 | 3300046528 | Bacteria | 5732 |
| 543 | Ga0495642_0004566 | 3300046528 | Bacteria | 5365 |
| 544 | Ga0495642_0071506 | 3300046528 | Bacteria | 1451 |
| 545 | Ga0495652_0028719 | 3300046529 | Bacteria | 4892 |
| 546 | Ga0495652_0031001 | 3300046529 | Bacteria | 4685 |
| 547 | Ga0495652_0036817 | 3300046529 | Bacteria | 4250 |
| 548 | Ga0495652_0064033 | 3300046529 | Bacteria | 3094 |
| 549 | Ga0495652_0096947 | 3300046529 | Bacteria | 2400 |
| 550 | Ga0495654_0000005 | 3300046530 | Bacteria | 491381 |
| 551 | Ga0495654_0004538 | 3300046530 | Bacteria | 8217 |
| 552 | Ga0495654_0109730 | 3300046530 | Bacteria | 1260 |
| 553 | Ga0495665_0029852 | 3300046531 | Bacteria | 2919 |
| 554 | Ga0495640_0000613 | 3300046533 | Bacteria | 26252 |
| 555 | Ga0495640_0019150 | 3300046533 | Bacteria | 5056 |
| 556 | Ga0495586_0007641 | 3300046535 | Bacteria | 5766 |
| 557 | Ga0495586_0143163 | 3300046535 | Bacteria | 1342 |
| 558 | Ga0495587_0005037 | 3300046536 | Bacteria | 8646 |
| 559 | Ga0495609_0000234 | 3300046538 | Bacteria | 52809 |
| 560 | Ga0495609_0000287 | 3300046538 | Bacteria | 46542 |
| 561 | Ga0495609_0001031 | 3300046538 | Bacteria | 19581 |
| 562 | Ga0495609_0005567 | 3300046538 | Bacteria | 6575 |
| 563 | Ga0495609_0012071 | 3300046538 | Bacteria | 4100 |
| 564 | Ga0495609_0012258 | 3300046538 | Bacteria | 4066 |
| 565 | Ga0495609_0021428 | 3300046538 | Bacteria | 2981 |
| 566 | Ga0495609_0035191 | 3300046538 | Bacteria | 2267 |
| 567 | Ga0495621_0072441 | 3300046539 | Bacteria | 1272 |
| 568 | Ga0495597_0000413 | 3300046542 | Bacteria | 36843 |
| 569 | Ga0495597_0000750 | 3300046542 | Bacteria | 25631 |
| 570 | Ga0495597_0001696 | 3300046542 | Bacteria | 15257 |
| 571 | Ga0495597_0002784 | 3300046542 | Bacteria | 10762 |
| 572 | Ga0495597_0010977 | 3300046542 | Bacteria | 4403 |
| 573 | Ga0495597_0027075 | 3300046542 | Bacteria | 2630 |
| 574 | Ga0495597_0066169 | 3300046542 | Bacteria | 1566 |
| 575 | Ga0495622_0000027 | 3300046557 | Bacteria | 135256 |
| 576 | Ga0495622_0000392 | 3300046557 | Bacteria | 29644 |
| 577 | Ga0495622_0081834 | 3300046557 | Bacteria | 1485 |
| 578 | Ga0495633_0000226 | 3300046558 | Bacteria | 69863 |
| 579 | Ga0495633_0000257 | 3300046558 | Bacteria | 62726 |
| 580 | Ga0495633_0001596 | 3300046558 | Bacteria | 17189 |
| 581 | Ga0495633_0010270 | 3300046558 | Bacteria | 5118 |
| 582 | Ga0495633_0017041 | 3300046558 | Bacteria | 3726 |
| 583 | Ga0495633_0036476 | 3300046558 | Bacteria | 2355 |
| 584 | Ga0495633_0041829 | 3300046558 | Bacteria | 2178 |
| 585 | Ga0495633_0066280 | 3300046558 | Bacteria | 1686 |
| 586 | Ga0495667_0000672 | 3300046559 | Bacteria | 21886 |
| 587 | Ga0495667_0040824 | 3300046559 | Bacteria | 3079 |
| 588 | Ga0495667_0070613 | 3300046559 | Bacteria | 2278 |
| 589 | Ga0495656_0007307 | 3300046615 | Bacteria | 3899 |
| 590 | Ga0495668_0000008 | 3300046616 | Bacteria | 498364 |
| 591 | Ga0495668_0000147 | 3300046616 | Bacteria | 106018 |
| 592 | Ga0495668_0000347 | 3300046616 | Bacteria | 61748 |
| 593 | Ga0495668_0000927 | 3300046616 | Bacteria | 32722 |
| 594 | Ga0495668_0040921 | 3300046616 | Bacteria | 2583 |
| 595 | Ga0495668_0118561 | 3300046616 | Bacteria | 1447 |
| 596 | Ga0495668_0155486 | 3300046616 | Bacteria | 1252 |
| 597 | Ga0495634_0001130 | 3300046642 | Bacteria | 24672 |
| 598 | Ga0495634_0009521 | 3300046642 | Bacteria | 7163 |
| 599 | Ga0495634_0024726 | 3300046642 | Bacteria | 4210 |
| 600 | Ga0495611_0002392 | 3300046648 | Bacteria | 8633 |
| 601 | Ga0495611_0008616 | 3300046648 | Bacteria | 4314 |
| 602 | Ga0495611_0010484 | 3300046648 | Bacteria | 3920 |
| 603 | Ga0495611_0015705 | 3300046648 | Bacteria | 3235 |
| 604 | Ga0495611_0021017 | 3300046648 | Bacteria | 2815 |
| 605 | Ga0495611_0021089 | 3300046648 | Bacteria | 2811 |
| 606 | Ga0495611_0033320 | 3300046648 | Bacteria | 2272 |
| 607 | Ga0495611_0080107 | 3300046648 | Bacteria | 1500 |
| 608 | Ga0495625_0000378 | 3300046660 | Bacteria | 67950 |
| 609 | Ga0495625_0001532 | 3300046660 | Bacteria | 27620 |
| 610 | Ga0495625_0004513 | 3300046660 | Bacteria | 13131 |
| 611 | Ga0495625_0005512 | 3300046660 | Bacteria | 11504 |
| 612 | Ga0495625_0006440 | 3300046660 | Bacteria | 10452 |
| 613 | Ga0495625_0022876 | 3300046660 | Bacteria | 4782 |
| 614 | Ga0495625_0043139 | 3300046660 | Bacteria | 3273 |
| 615 | Ga0495625_0105396 | 3300046660 | Bacteria | 1931 |
| 616 | Ga0495625_0152866 | 3300046660 | Bacteria | 1550 |
| 617 | Ga0495625_0301172 | 3300046660 | Bacteria | 1026 |
| 618 | Ga0495635_0007345 | 3300046663 | Bacteria | 7690 |
| 619 | Ga0495635_0012815 | 3300046663 | Bacteria | 5873 |
| 620 | Ga0495659_0000146 | 3300046664 | Bacteria | 30932 |
| 621 | Ga0495659_0001227 | 3300046664 | Bacteria | 8871 |
| 622 | Ga0495661_0000862 | 3300046665 | Bacteria | 28269 |
| 623 | Ga0495661_0001364 | 3300046665 | Bacteria | 20615 |
| 624 | Ga0495661_0001624 | 3300046665 | Bacteria | 18413 |
| 625 | Ga0495661_0002895 | 3300046665 | Bacteria | 12981 |
| 626 | Ga0495661_0010766 | 3300046665 | Bacteria | 6225 |
| 627 | Ga0495661_0070174 | 3300046665 | Bacteria | 2051 |
| 628 | Ga0495661_0089403 | 3300046665 | Bacteria | 1755 |
| 629 | Ga0495588_0000070 | 3300046674 | Bacteria | 227611 |
| 630 | Ga0495588_0006477 | 3300046674 | Bacteria | 5277 |
| 631 | Ga0495588_0015851 | 3300046674 | Bacteria | 3634 |
| 632 | Ga0495588_0022714 | 3300046674 | Bacteria | 3101 |
| 633 | Ga0495588_0073547 | 3300046674 | Bacteria | 1779 |
| 634 | Ga0495588_0113648 | 3300046674 | Bacteria | 1426 |
| 635 | Ga0495588_0124430 | 3300046674 | Bacteria | 1359 |
| 636 | Ga0495599_0025359 | 3300046678 | Bacteria | 3710 |
| 637 | Ga0495623_0039900 | 3300046679 | Bacteria | 2998 |
| 638 | Ga0495623_0124209 | 3300046679 | Bacteria | 1551 |
| 639 | Ga0495646_0002738 | 3300046680 | Bacteria | 10892 |
| 640 | Ga0495646_0023938 | 3300046680 | Bacteria | 3845 |
| 641 | Ga0495646_0105097 | 3300046680 | Bacteria | 1614 |
| 642 | Ga0495658_0035167 | 3300046683 | Bacteria | 2754 |
| 643 | Ga0495669_0000297 | 3300046684 | Bacteria | 27622 |
| 644 | Ga0495669_0014223 | 3300046684 | Bacteria | 3402 |
| 645 | Ga0495669_0117808 | 3300046684 | Bacteria | 1243 |
| 646 | Ga0495613_0007452 | 3300046689 | Bacteria | 8156 |
| 647 | Ga0495624_0050899 | 3300046690 | Bacteria | 2623 |
| 648 | Ga0495624_0053059 | 3300046690 | Bacteria | 2560 |
| 649 | Ga0495670_0008811 | 3300046691 | Bacteria | 4967 |
| 650 | Ga0495670_0009767 | 3300046691 | Bacteria | 4716 |
| 651 | Ga0495670_0019193 | 3300046691 | Bacteria | 3368 |
| 652 | Ga0495670_0040744 | 3300046691 | Bacteria | 2316 |
| 653 | Ga0495670_0063760 | 3300046691 | Bacteria | 1855 |
| 654 | Ga0495671_0000024 | 3300046692 | Bacteria | 246812 |
| 655 | Ga0495671_0000203 | 3300046692 | Bacteria | 52373 |
| 656 | Ga0495671_0000919 | 3300046692 | Bacteria | 20872 |
| 657 | Ga0495671_0020352 | 3300046692 | Bacteria | 3496 |
| 658 | Ga0495671_0025245 | 3300046692 | Bacteria | 3090 |
| 659 | Ga0495671_0041911 | 3300046692 | Bacteria | 2303 |
| 660 | Ga0495671_0045238 | 3300046692 | Bacteria | 2204 |
| 661 | Ga0495649_0000150 | 3300046694 | Bacteria | 60827 |
| 662 | Ga0495649_0020292 | 3300046694 | Bacteria | 3729 |
| 663 | Ga0495649_0045909 | 3300046694 | Bacteria | 2380 |
| 664 | Ga0495649_0057105 | 3300046694 | Bacteria | 2105 |
| 665 | Ga0495589_0000175 | 3300046794 | Bacteria | 57368 |
| 666 | Ga0495589_0000218 | 3300046794 | Bacteria | 48625 |
| 667 | Ga0495589_0068393 | 3300046794 | Bacteria | 1737 |
| 668 | Ga0495589_0080356 | 3300046794 | Bacteria | 1586 |
| 669 | Ga0495600_0050073 | 3300046809 | Bacteria | 2725 |
| 670 | Ga0495660_0000113 | 3300046810 | Bacteria | 86593 |
| 671 | Ga0495660_0001117 | 3300046810 | Bacteria | 19163 |
| 672 | Ga0495660_0005782 | 3300046810 | Bacteria | 7389 |
| 673 | Ga0495660_0018484 | 3300046810 | Bacteria | 4008 |
| 674 | Ga0495660_0041108 | 3300046810 | Bacteria | 2561 |
| 675 | Ga0495660_0080801 | 3300046810 | Bacteria | 1705 |
| 676 | Ga0495660_0138423 | 3300046810 | Bacteria | 1214 |
| 677 | Ga0495581_0008180 | 3300047315 | Bacteria | 6058 |
| 678 | Ga0495581_0010305 | 3300047315 | Bacteria | 5406 |
| 679 | Ga0495581_0015553 | 3300047315 | Bacteria | 4416 |
| 680 | Ga0495604_0022452 | 3300047317 | Bacteria | 5038 |
| 681 | Ga0495604_0066984 | 3300047317 | Bacteria | 2729 |
| 682 | Ga0495636_0000463 | 3300047318 | Bacteria | 15005 |
| 683 | Ga0495636_0008508 | 3300047318 | Bacteria | 4049 |
| 684 | Ga0495636_0015151 | 3300047318 | Bacteria | 3071 |
| 685 | Ga0495636_0032298 | 3300047318 | Bacteria | 2147 |
| 686 | Ga0495674_0004779 | 3300047319 | Bacteria | 13028 |
| 687 | Ga0495674_0072060 | 3300047319 | Bacteria | 2980 |
| 688 | Ga0495672_0000035 | 3300047320 | Bacteria | 290329 |
| 689 | Ga0495672_0000363 | 3300047320 | Bacteria | 58040 |
| 690 | Ga0495672_0000533 | 3300047320 | Bacteria | 43150 |
| 691 | Ga0495672_0000802 | 3300047320 | Bacteria | 33855 |
| 692 | Ga0495672_0016919 | 3300047320 | Bacteria | 4888 |
| 693 | Ga0495672_0021979 | 3300047320 | Bacteria | 4154 |
| 694 | Ga0495672_0036911 | 3300047320 | Bacteria | 2995 |
| 695 | Ga0495672_0041382 | 3300047320 | Bacteria | 2787 |
| 696 | Ga0495672_0072717 | 3300047320 | Bacteria | 1941 |
| 697 | Ga0495676_0000635 | 3300047321 | Bacteria | 29072 |
| 698 | Ga0495676_0243828 | 3300047321 | Bacteria | 1229 |
| 699 | Ga0495680_0000812 | 3300047322 | Bacteria | 34880 |
| 700 | Ga0495680_0007985 | 3300047322 | Bacteria | 9647 |
| 701 | Ga0495680_0056924 | 3300047322 | Bacteria | 3026 |
| 702 | Ga0495683_0000088 | 3300047323 | Bacteria | 92118 |
| 703 | Ga0495683_0002367 | 3300047323 | Bacteria | 11438 |
| 704 | Ga0495683_0010816 | 3300047323 | Bacteria | 4812 |
| 705 | Ga0495683_0024612 | 3300047323 | Bacteria | 3088 |
| 706 | Ga0495683_0026176 | 3300047323 | Bacteria | 2985 |
| 707 | Ga0495683_0073178 | 3300047323 | Bacteria | 1680 |
| 708 | Ga0495683_0090424 | 3300047323 | Bacteria | 1483 |
| 709 | Ga0495687_000186 | 3300047443 | Bacteria | 90747 |
| 710 | Ga0495687_000256 | 3300047443 | Bacteria | 71778 |
| 711 | Ga0495687_000288 | 3300047443 | Bacteria | 66346 |
| 712 | Ga0495687_001033 | 3300047443 | Bacteria | 27654 |
| 713 | Ga0495687_003432 | 3300047443 | Bacteria | 11495 |
| 714 | Ga0495687_004752 | 3300047443 | Bacteria | 8979 |
| 715 | Ga0495687_018142 | 3300047443 | Bacteria | 3485 |
| 716 | Ga0495675_0010465 | 3300047444 | Bacteria | 5796 |
| 717 | Ga0495675_0040886 | 3300047444 | Bacteria | 2955 |
| 718 | Ga0495677_0000161 | 3300047445 | Bacteria | 32173 |
| 719 | Ga0495677_0003275 | 3300047445 | Bacteria | 6310 |
| 720 | Ga0495677_0005176 | 3300047445 | Bacteria | 4961 |
| 721 | Ga0495677_0007072 | 3300047445 | Bacteria | 4201 |
| 722 | Ga0495679_018839 | 3300047446 | Bacteria | 2440 |
| 723 | Ga0495679_040441 | 3300047446 | Bacteria | 1449 |
| 724 | Ga0495685_000004 | 3300047447 | Bacteria | 115775 |
| 725 | Ga0495685_009748 | 3300047447 | Bacteria | 3214 |
| 726 | Ga0495673_0000033 | 3300047469 | Bacteria | 354152 |
| 727 | Ga0495673_0000034 | 3300047469 | Bacteria | 326920 |
| 728 | Ga0495673_0000219 | 3300047469 | Bacteria | 84634 |
| 729 | Ga0495681_0000601 | 3300047470 | Bacteria | 27490 |
| 730 | Ga0495681_0027146 | 3300047470 | Bacteria | 2967 |
| 731 | Ga0495686_0000167 | 3300047472 | Bacteria | 124849 |
| 732 | Ga0495686_0000612 | 3300047472 | Bacteria | 49335 |
| 733 | Ga0495686_0000722 | 3300047472 | Bacteria | 44277 |
| 734 | Ga0495593_0002957 | 3300047673 | Bacteria | 10221 |
| 735 | Ga0495593_0010066 | 3300047673 | Bacteria | 5476 |
| 736 | Ga0495614_0002564 | 3300048089 | Bacteria | 8081 |
| 737 | Ga0495614_0023062 | 3300048089 | Bacteria | 2684 |
| 738 | Ga0495626_0000030 | 3300048091 | Bacteria | 202562 |
| 739 | Ga0495626_0001606 | 3300048091 | Bacteria | 17620 |
| 740 | Ga0495626_0002072 | 3300048091 | Bacteria | 14593 |
| 741 | Ga0495626_0007245 | 3300048091 | Bacteria | 6195 |
| 742 | Ga0495626_0008403 | 3300048091 | Bacteria | 5663 |
| 743 | Ga0495626_0028196 | 3300048091 | Bacteria | 2724 |
| 744 | Ga0495626_0091662 | 3300048091 | Bacteria | 1335 |
| 745 | Ga0496100_0049502 | 3300048903 | Bacteria | 2718 |
| 746 | Ga0496101_0231646 | 3300048904 | Bacteria | 1436 |
| 747 | Ga0496102_0000105 | 3300048905 | Bacteria | 119523 |
| 748 | Ga0496102_0000107 | 3300048905 | Bacteria | 118250 |
| 749 | Ga0496102_0018743 | 3300048905 | Bacteria | 6086 |
| 750 | Ga0496102_0131559 | 3300048905 | Bacteria | 2342 |
| 751 | Ga0496103_0001686 | 3300048906 | Bacteria | 14449 |
| 752 | Ga0496103_0117023 | 3300048906 | Bacteria | 1696 |
| 753 | Ga0496106_0085869 | 3300048909 | Bacteria | 2423 |
| 754 | Ga0496106_0440922 | 3300048909 | Bacteria | 1046 |
| 755 | Ga0496108_0099642 | 3300048911 | Bacteria | 2477 |
| 756 | Ga0496110_0000073 | 3300048913 | Bacteria | 51301 |
| 757 | Ga0496110_0146736 | 3300048913 | Bacteria | 2134 |
| 758 | Ga0496111_0184689 | 3300048914 | Bacteria | 1550 |
| 759 | Ga0496114_0025774 | 3300048917 | Bacteria | 4809 |
| 760 | Ga0496114_0026559 | 3300048917 | Bacteria | 4741 |
| 761 | Ga0496115_0006825 | 3300048918 | Bacteria | 8377 |
| 762 | Ga0496116_0013018 | 3300048919 | Bacteria | 6746 |
| 763 | Ga0496116_0045394 | 3300048919 | Bacteria | 2975 |
| 764 | Ga0496116_0048597 | 3300048919 | Bacteria | 2846 |
| 765 | Ga0496117_0000010 | 3300048920 | Bacteria | 611954 |
| 766 | Ga0496118_0000009 | 3300048921 | Bacteria | 611954 |
| 767 | Ga0496121_0006620 | 3300048924 | Bacteria | 14278 |
| 768 | Ga0496121_0047291 | 3300048924 | Bacteria | 3673 |
| 769 | Ga0496121_0182475 | 3300048924 | Bacteria | 1513 |
| 770 | Ga0496122_0000513 | 3300048925 | Bacteria | 80013 |
| 771 | Ga0496122_0007032 | 3300048925 | Bacteria | 12652 |
| 772 | Ga0496122_0016475 | 3300048925 | Bacteria | 6990 |
| 773 | Ga0496122_0032257 | 3300048925 | Bacteria | 4336 |
| 774 | Ga0496123_0000145 | 3300048926 | Bacteria | 144475 |
| 775 | Ga0496123_0004593 | 3300048926 | Bacteria | 14378 |
| 776 | Ga0496124_0219768 | 3300048927 | Bacteria | 1430 |
| 777 | Ga0496124_0225892 | 3300048927 | Bacteria | 1404 |
| 778 | Ga0496124_0316752 | 3300048927 | Bacteria | 1119 |
| 779 | Ga0496125_0001146 | 3300048928 | Bacteria | 40202 |
| 780 | Ga0496125_0001481 | 3300048928 | Bacteria | 33868 |
| 781 | Ga0496125_0002429 | 3300048928 | Bacteria | 24227 |
| 782 | Ga0496125_0089129 | 3300048928 | Bacteria | 2321 |
| 783 | Ga0496125_0146323 | 3300048928 | Bacteria | 1632 |
| 784 | Ga0496125_0245586 | 3300048928 | Bacteria | 1133 |
| 785 | Ga0496126_0012107 | 3300048929 | Bacteria | 8855 |
| 786 | Ga0501308_006927 | 3300049128 | Bacteria | 1175 |
| 787 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 788 | Ga0495678_000603 | 3300049459 | Bacteria | 33820 |
| 789 | Ga0495678_001473 | 3300049459 | Bacteria | 18420 |
| 790 | Ga0495678_003704 | 3300049459 | Bacteria | 9246 |
| 791 | Ga0495678_005875 | 3300049459 | Bacteria | 6644 |
| 792 | Ga0495678_007980 | 3300049459 | Bacteria | 5413 |
| 793 | Ga0495678_038547 | 3300049459 | Bacteria | 1932 |
| 794 | Ga0495682_0000518 | 3300049460 | Bacteria | 26647 |
| 795 | Ga0495682_0003041 | 3300049460 | Bacteria | 7621 |
| 796 | Ga0495682_0021545 | 3300049460 | Bacteria | 2414 |
| 797 | Ga0501314_000393 | 3300049530 | Bacteria | 2677 |
| 798 | Ga0501032_0030037 | 3300049569 | Bacteria | 3728 |
| 799 | Ga0501034_0010412 | 3300049571 | Bacteria | 9692 |
| 800 | Ga0501036_0006700 | 3300049572 | Bacteria | 9362 |
| 801 | Ga0501037_0003283 | 3300049573 | Bacteria | 11747 |
| 802 | Ga0501037_0031632 | 3300049573 | Bacteria | 3908 |
| 803 | Ga0501039_0000283 | 3300049575 | Bacteria | 36268 |
| 804 | Ga0501040_0012451 | 3300049576 | Bacteria | 5574 |
| 805 | Ga0501043_0097550 | 3300049579 | Bacteria | 2311 |
| 806 | Ga0501069_0029393 | 3300049585 | Bacteria | 3016 |
| 807 | Ga0501070_0142183 | 3300049586 | Bacteria | 1981 |
| 808 | Ga0501071_0009066 | 3300049587 | Bacteria | 6604 |
| 809 | Ga0501076_0000603 | 3300049592 | Bacteria | 23033 |
| 810 | Ga0501077_0097183 | 3300049593 | Bacteria | 1866 |
| 811 | Ga0501079_0000776 | 3300049741 | Bacteria | 21901 |
| 812 | Ga0501080_0007320 | 3300049742 | Bacteria | 9960 |
| 813 | Ga0501080_0194747 | 3300049742 | Bacteria | 1862 |
| 814 | Ga0501081_0000610 | 3300049743 | Bacteria | 20405 |
| 815 | Ga0501083_0102967 | 3300049744 | Bacteria | 1882 |
| 816 | Ga0501269_003128 | 3300049766 | Bacteria | 2008 |
| 817 | Ga0501279_006410 | 3300049775 | Bacteria | 1553 |
| 818 | Ga0501280_003301 | 3300049776 | Bacteria | 2501 |
| 819 | Ga0501035_0009176 | 3300049822 | Bacteria | 9198 |
| 820 | Ga0501226_000028 | 3300049853 | Bacteria | 88553 |
| 821 | nmdc:mga03683_51223_c1 | 3300050489 | Bacteria | 1722 |
| 822 | nmdc:mga0k408_13143_c1 | 3300050493 | Bacteria | 4536 |
| 823 | nmdc:mga09592_4923_c1 | 3300050508 | Bacteria | 10828 |
| 824 | nmdc:mga08y16_606132_c1 | 3300050511 | Bacteria | 1103 |
| 825 | nmdc:mga08y16_7893_c1 | 3300050511 | Bacteria | 11137 |
| 826 | Ga0495601_0003433 | 3300053077 | Bacteria | 9079 |
| 827 | Ga0495619_0159829 | 3300053085 | Bacteria | 1556 |
| 828 | Ga0500618_000699 | 3300053125 | Bacteria | 19697 |
| 829 | Ga0500618_000954 | 3300053125 | Bacteria | 14768 |
| 830 | Ga0500618_016744 | 3300053125 | Bacteria | 1830 |
| 831 | Ga0500574_008828 | 3300053141 | Bacteria | 2163 |
| 832 | Ga0587088_002031 | 3300059508 | Bacteria | 2227 |
| 833 | Ga0587062_004949 | 3300059639 | Bacteria | 1447 |
| 834 | Ga0587067_004268 | 3300059640 | Bacteria | 1850 |
| 835 | Ga0587104_000425 | 3300059650 | Bacteria | 1774 |
| 836 | Ga0501082_0000944 | 3300060353 | Bacteria | 25748 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050511 | nmdc:mga08y16_606132_c1 | nmdc:mga08y16_606132_c1_289_1092 | 267 |
| 2 | 3300046535 | Ga0495586_0143163 | Ga0495586_0143163_514_1329 | 271 |
| 3 | 3300046542 | Ga0495597_0066169 | Ga0495597_0066169_596_1414 | 272 |
| 4 | 3300046530 | Ga0495654_0109730 | Ga0495654_0109730_15_860 | 273 |
| 5 | 3300042530 | Ga0450916_000123 | Ga0450916_000123_785_1654 | 277 |
| 6 | 3300042533 | Ga0450901_002686 | Ga0450901_002686_271_1140 | 277 |
| 7 | 3300049530 | Ga0501314_000393 | Ga0501314_000393_1691_2560 | 277 |
| 8 | 3300049853 | Ga0501226_000028 | Ga0501226_000028_25916_26785 | 277 |
| 9 | 3300042000 | Ga0439437_005699 | Ga0439437_005699_116_985 | 278 |
| 10 | 3300042012 | Ga0439455_0008261 | Ga0439455_0008261_851_1720 | 278 |
| 11 | 3300042013 | Ga0439456_001190 | Ga0439456_001190_4270_5139 | 278 |
| 12 | 3300042115 | Ga0450911_000017 | Ga0450911_000017_58060_58929 | 278 |
| 13 | 3300042156 | Ga0439446_0002588 | Ga0439446_0002588_2007_2876 | 278 |
| 14 | 3300042139 | Ga0450904_000186 | Ga0450904_000186_2706_3575 | 279 |
| 15 | 3300049569 | Ga0501032_0030037 | Ga0501032_0030037_2722_3591 | 279 |
| 16 | 3300049573 | Ga0501037_0031632 | Ga0501037_0031632_1337_2206 | 279 |
| 17 | 3300003322 | rootL2_10100680 | rootL2_101006809 | 280 |
| 18 | 3300046522 | Ga0495643_0013936 | Ga0495643_0013936_2745_3614 | 281 |
| 19 | 3300046522 | Ga0495643_0017918 | Ga0495643_0017918_1312_2181 | 281 |
| 20 | 3300046692 | Ga0495671_0041911 | Ga0495671_0041911_670_1539 | 281 |
| 21 | 3300046694 | Ga0495649_0057105 | Ga0495649_0057105_196_1065 | 281 |
| 22 | 3300050493 | nmdc:mga0k408_13143_c1 | nmdc:mga0k408_13143_c1_39_899 | 282 |
| 23 | 3300045049 | Ga0466959_0135357 | Ga0466959_0135357_588_1439 | 283 |
| 24 | iso_pu_bacteria | 3007252601 | 3007256378 | 284 |
| 25 | iso_pu_bacteria | 3007315729 | 3007319404 | 284 |
| 26 | 3300038443 | Ga0395901_0663565 | Ga0395901_0663565_33_890 | 285 |
| 27 | 3300046691 | Ga0495670_0063760 | Ga0495670_0063760_981_1838 | 285 |
| 28 | iso_pu_bacteria | 2808606373 | 2808907178 | 285 |
| 29 | iso_pu_bacteria | 2842805378 | 2842805523 | 285 |
| 30 | iso_pu_bacteria | 651053060 | 651176781 | 285 |
| 31 | 3300005547 | Ga0070693_100030673 | Ga0070693_1000306733 | 287 |
| 32 | 3300027312 | Ga0209371_1002401 | Ga0209371_10024016 | 288 |
| 33 | 3300030500 | Ga0268256_1002137 | Ga0268256_10021378 | 288 |
| 34 | 3300006042 | Ga0075368_10052551 | Ga0075368_100525512 | 289 |
| 35 | 3300006051 | Ga0075364_10241356 | Ga0075364_102413562 | 289 |
| 36 | 3300013104 | Ga0157370_10009913 | Ga0157370_1000991312 | 289 |
| 37 | 3300044712 | Ga0453684_0003037 | Ga0453684_0003037_19371_20252 | 291 |
| 38 | 3300045051 | Ga0451576_0000325 | Ga0451576_0000325_24122_25003 | 291 |
| 39 | 3300049776 | Ga0501280_003301 | Ga0501280_003301_546_1427 | 291 |
| 40 | iso_pu_bacteria | 2989392574 | 2989393514 | 291 |
| 41 | 3300005329 | Ga0070683_100110531 | Ga0070683_1001105312 | 292 |
| 42 | 3300005471 | Ga0070698_100357184 | Ga0070698_1003571842 | 292 |
| 43 | 3300005547 | Ga0070693_100045122 | Ga0070693_1000451222 | 292 |
| 44 | 3300006871 | Ga0075434_100303159 | Ga0075434_1003031592 | 292 |
| 45 | 3300007076 | Ga0075435_100245874 | Ga0075435_1002458741 | 292 |
| 46 | 3300009551 | Ga0105238_10050112 | Ga0105238_100501123 | 292 |
| 47 | 3300026078 | Ga0207702_10029243 | Ga0207702_100292433 | 292 |
| 48 | 3300027364 | Ga0209967_1001999 | Ga0209967_10019992 | 292 |
| 49 | 3300027462 | Ga0210000_1000453 | Ga0210000_10004533 | 292 |
| 50 | 3300027471 | Ga0209995_1005769 | Ga0209995_10057692 | 292 |
| 51 | 3300027614 | Ga0209970_1005907 | Ga0209970_10059073 | 292 |
| 52 | 3300027665 | Ga0209983_1021243 | Ga0209983_10212432 | 292 |
| 53 | 3300027682 | Ga0209971_1014677 | Ga0209971_10146772 | 292 |
| 54 | 3300027876 | Ga0209974_10006355 | Ga0209974_100063552 | 292 |
| 55 | 3300042876 | Ga0451577_0000527 | Ga0451577_0000527_50189_51070 | 292 |
| 56 | 3300044712 | Ga0453684_0000107 | Ga0453684_0000107_12644_13525 | 292 |
| 57 | 3300044712 | Ga0453684_0003130 | Ga0453684_0003130_7983_8870 | 292 |
| 58 | 3300045051 | Ga0451576_0092791 | Ga0451576_0092791_885_1775 | 292 |
| 59 | 3300049572 | Ga0501036_0006700 | Ga0501036_0006700_2913_3803 | 292 |
| 60 | 3300049573 | Ga0501037_0003283 | Ga0501037_0003283_3070_3960 | 292 |
| 61 | 3300049575 | Ga0501039_0000283 | Ga0501039_0000283_17689_18579 | 292 |
| 62 | 3300049576 | Ga0501040_0012451 | Ga0501040_0012451_4106_4996 | 292 |
| 63 | 3300049579 | Ga0501043_0097550 | Ga0501043_0097550_1397_2287 | 292 |
| 64 | 3300049587 | Ga0501071_0009066 | Ga0501071_0009066_1072_1962 | 292 |
| 65 | 3300049592 | Ga0501076_0000603 | Ga0501076_0000603_12947_13837 | 292 |
| 66 | 3300049593 | Ga0501077_0097183 | Ga0501077_0097183_226_1116 | 292 |
| 67 | 3300049741 | Ga0501079_0000776 | Ga0501079_0000776_12235_13125 | 292 |
| 68 | 3300049742 | Ga0501080_0007320 | Ga0501080_0007320_3793_4683 | 292 |
| 69 | 3300049743 | Ga0501081_0000610 | Ga0501081_0000610_12941_13831 | 292 |
| 70 | 3300049744 | Ga0501083_0102967 | Ga0501083_0102967_305_1195 | 292 |
| 71 | 3300060353 | Ga0501082_0000944 | Ga0501082_0000944_11696_12586 | 292 |
| 72 | 3300005295 | Ga0065707_10113521 | Ga0065707_101135212 | 293 |
| 73 | 3300005545 | Ga0070695_100131676 | Ga0070695_1001316762 | 293 |
| 74 | 3300006844 | Ga0075428_100002361 | Ga0075428_10000236116 | 293 |
| 75 | 3300006880 | Ga0075429_100016430 | Ga0075429_1000164301 | 293 |
| 76 | 3300009094 | Ga0111539_10002093 | Ga0111539_1000209316 | 293 |
| 77 | 3300027907 | Ga0207428_10002740 | Ga0207428_100027407 | 293 |
| 78 | 3300036647 | Ga0316582_0280702 | Ga0316582_0280702_48_935 | 293 |
| 79 | 3300042876 | Ga0451577_0000587 | Ga0451577_0000587_36401_37297 | 293 |
| 80 | 3300044712 | Ga0453684_0002450 | Ga0453684_0002450_403_1299 | 293 |
| 81 | 3300044712 | Ga0453684_0034693 | Ga0453684_0034693_5941_6831 | 293 |
| 82 | 3300044712 | Ga0453684_0053717 | Ga0453684_0053717_3906_4802 | 293 |
| 83 | 3300044712 | Ga0453684_0814936 | Ga0453684_0814936_24_920 | 293 |
| 84 | 3300045051 | Ga0451576_0002559 | Ga0451576_0002559_19705_20589 | 293 |
| 85 | 3300049571 | Ga0501034_0010412 | Ga0501034_0010412_3512_4399 | 293 |
| 86 | 3300049585 | Ga0501069_0029393 | Ga0501069_0029393_1322_2215 | 293 |
| 87 | 3300049586 | Ga0501070_0142183 | Ga0501070_0142183_969_1862 | 293 |
| 88 | 3300049742 | Ga0501080_0194747 | Ga0501080_0194747_23_916 | 293 |
| 89 | 3300050508 | nmdc:mga09592_4923_c1 | nmdc:mga09592_4923_c1_9883_10776 | 293 |
| 90 | 3300050511 | nmdc:mga08y16_7893_c1 | nmdc:mga08y16_7893_c1_4836_5729 | 293 |
| 91 | iso_pu_bacteria | 2600255292 | 2601670344 | 293 |
| 92 | iso_pu_bacteria | 2643221645 | 2644249443 | 293 |
| 93 | iso_pu_bacteria | 2643221664 | 2644359546 | 293 |
| 94 | iso_pu_bacteria | 2738541280 | 2738740860 | 293 |
| 95 | iso_pu_bacteria | 2738541300 | 2738845181 | 293 |
| 96 | iso_pu_bacteria | 2738543018 | 2739274776 | 293 |
| 97 | iso_pu_bacteria | 2738543030 | 2739343820 | 293 |
| 98 | iso_pu_bacteria | 2842711865 | 2842713755 | 293 |
| 99 | iso_pu_bacteria | 2857547612 | 2857548320 | 293 |
| 100 | iso_pu_bacteria | 2857558681 | 2857562277 | 293 |
| 101 | iso_pu_bacteria | 2885080285 | 2885083539 | 293 |
| 102 | iso_pu_bacteria | 2904424332 | 2904429800 | 293 |
| 103 | iso_pu_bacteria | 2932410948 | 2932412920 | 293 |
| 104 | iso_pu_bacteria | 2932416698 | 2932420435 | 293 |
| 105 | 3300005290 | Ga0065712_10110431 | Ga0065712_101104312 | 294 |
| 106 | 3300005327 | Ga0070658_10076858 | Ga0070658_100768582 | 294 |
| 107 | 3300005329 | Ga0070683_100002543 | Ga0070683_10000254314 | 294 |
| 108 | 3300005331 | Ga0070670_100002942 | Ga0070670_1000029422 | 294 |
| 109 | 3300005333 | Ga0070677_10018795 | Ga0070677_100187953 | 294 |
| 110 | 3300005335 | Ga0070666_10026807 | Ga0070666_100268072 | 294 |
| 111 | 3300005337 | Ga0070682_100003713 | Ga0070682_1000037132 | 294 |
| 112 | 3300005338 | Ga0068868_100000732 | Ga0068868_1000007325 | 294 |
| 113 | 3300005343 | Ga0070687_100000375 | Ga0070687_1000003752 | 294 |
| 114 | 3300005344 | Ga0070661_100072288 | Ga0070661_1000722881 | 294 |
| 115 | 3300005345 | Ga0070692_10200308 | Ga0070692_102003082 | 294 |
| 116 | 3300005354 | Ga0070675_100000909 | Ga0070675_1000009092 | 294 |
| 117 | 3300005355 | Ga0070671_100000836 | Ga0070671_10000083618 | 294 |
| 118 | 3300005364 | Ga0070673_100000415 | Ga0070673_1000004154 | 294 |
| 119 | 3300005367 | Ga0070667_100032155 | Ga0070667_1000321552 | 294 |
| 120 | 3300005437 | Ga0070710_10088524 | Ga0070710_100885242 | 294 |
| 121 | 3300005444 | Ga0070694_100000516 | Ga0070694_10000051613 | 294 |
| 122 | 3300005444 | Ga0070694_100023548 | Ga0070694_1000235481 | 294 |
| 123 | 3300005455 | Ga0070663_100039213 | Ga0070663_1000392133 | 294 |
| 124 | 3300005456 | Ga0070678_100000308 | Ga0070678_1000003085 | 294 |
| 125 | 3300005457 | Ga0070662_100094477 | Ga0070662_1000944772 | 294 |
| 126 | 3300005459 | Ga0068867_100055143 | Ga0068867_1000551433 | 294 |
| 127 | 3300005543 | Ga0070672_100000186 | Ga0070672_10000018614 | 294 |
| 128 | 3300005549 | Ga0070704_100000018 | Ga0070704_10000001819 | 294 |
| 129 | 3300005578 | Ga0068854_100000468 | Ga0068854_10000046819 | 294 |
| 130 | 3300005616 | Ga0068852_100000221 | Ga0068852_10000022118 | 294 |
| 131 | 3300005616 | Ga0068852_100540258 | Ga0068852_1005402582 | 294 |
| 132 | 3300005618 | Ga0068864_100053179 | Ga0068864_1000531793 | 294 |
| 133 | 3300005718 | Ga0068866_10203398 | Ga0068866_102033981 | 294 |
| 134 | 3300005719 | Ga0068861_100001180 | Ga0068861_1000011803 | 294 |
| 135 | 3300005841 | Ga0068863_100300494 | Ga0068863_1003004942 | 294 |
| 136 | 3300005842 | Ga0068858_100003083 | Ga0068858_1000030833 | 294 |
| 137 | 3300005843 | Ga0068860_100001150 | Ga0068860_10000115015 | 294 |
| 138 | 3300006173 | Ga0070716_100070041 | Ga0070716_1000700412 | 294 |
| 139 | 3300006237 | Ga0097621_100000202 | Ga0097621_10000020225 | 294 |
| 140 | 3300006358 | Ga0068871_100000840 | Ga0068871_1000008402 | 294 |
| 141 | 3300006881 | Ga0068865_100000995 | Ga0068865_1000009953 | 294 |
| 142 | 3300006914 | Ga0075436_100019561 | Ga0075436_1000195614 | 294 |
| 143 | 3300009098 | Ga0105245_10105175 | Ga0105245_101051754 | 294 |
| 144 | 3300009147 | Ga0114129_10625744 | Ga0114129_106257442 | 294 |
| 145 | 3300009148 | Ga0105243_10554076 | Ga0105243_105540761 | 294 |
| 146 | 3300009176 | Ga0105242_10001129 | Ga0105242_1000112918 | 294 |
| 147 | 3300009176 | Ga0105242_10016961 | Ga0105242_100169617 | 294 |
| 148 | 3300013297 | Ga0157378_10002410 | Ga0157378_1000241016 | 294 |
| 149 | 3300013297 | Ga0157378_10036498 | Ga0157378_100364983 | 294 |
| 150 | 3300013306 | Ga0163162_10003271 | Ga0163162_1000327113 | 294 |
| 151 | 3300013308 | Ga0157375_10007942 | Ga0157375_100079426 | 294 |
| 152 | 3300014745 | Ga0157377_10122419 | Ga0157377_101224191 | 294 |
| 153 | 3300014969 | Ga0157376_10004021 | Ga0157376_100040213 | 294 |
| 154 | 3300025321 | Ga0207656_10000761 | Ga0207656_1000076110 | 294 |
| 155 | 3300025885 | Ga0207653_10008321 | Ga0207653_100083212 | 294 |
| 156 | 3300025893 | Ga0207682_10003314 | Ga0207682_100033146 | 294 |
| 157 | 3300025899 | Ga0207642_10002367 | Ga0207642_100023676 | 294 |
| 158 | 3300025899 | Ga0207642_10124604 | Ga0207642_101246041 | 294 |
| 159 | 3300025917 | Ga0207660_10008827 | Ga0207660_100088273 | 294 |
| 160 | 3300025925 | Ga0207650_10001199 | Ga0207650_1000119917 | 294 |
| 161 | 3300025931 | Ga0207644_10000365 | Ga0207644_1000036510 | 294 |
| 162 | 3300025933 | Ga0207706_10081840 | Ga0207706_100818402 | 294 |
| 163 | 3300025935 | Ga0207709_10000662 | Ga0207709_100006625 | 294 |
| 164 | 3300025936 | Ga0207670_10007832 | Ga0207670_100078322 | 294 |
| 165 | 3300025938 | Ga0207704_10000679 | Ga0207704_1000067917 | 294 |
| 166 | 3300025939 | Ga0207665_10247706 | Ga0207665_102477062 | 294 |
| 167 | 3300025940 | Ga0207691_10000276 | Ga0207691_1000027627 | 294 |
| 168 | 3300025942 | Ga0207689_10327404 | Ga0207689_103274041 | 294 |
| 169 | 3300025944 | Ga0207661_10138369 | Ga0207661_101383691 | 294 |
| 170 | 3300026023 | Ga0207677_10010022 | Ga0207677_100100221 | 294 |
| 171 | 3300026035 | Ga0207703_10029929 | Ga0207703_100299293 | 294 |
| 172 | 3300026041 | Ga0207639_10028856 | Ga0207639_100288565 | 294 |
| 173 | 3300026089 | Ga0207648_10044715 | Ga0207648_100447153 | 294 |
| 174 | 3300026118 | Ga0207675_100002627 | Ga0207675_10000262715 | 294 |
| 175 | 3300026121 | Ga0207683_10001296 | Ga0207683_100012965 | 294 |
| 176 | 3300026142 | Ga0207698_10000451 | Ga0207698_1000045117 | 294 |
| 177 | 3300028379 | Ga0268266_10200785 | Ga0268266_102007852 | 294 |
| 178 | 3300028381 | Ga0268264_10001359 | Ga0268264_1000135913 | 294 |
| 179 | 3300031665 | Ga0316575_10003949 | Ga0316575_100039493 | 294 |
| 180 | 3300031691 | Ga0316579_10018724 | Ga0316579_100187243 | 294 |
| 181 | 3300031728 | Ga0316578_10151188 | Ga0316578_101511882 | 294 |
| 182 | 3300032133 | Ga0316583_10038198 | Ga0316583_100381982 | 294 |
| 183 | 3300035117 | Ga0373953_0030268 | Ga0373953_0030268_133_1017 | 294 |
| 184 | 3300035118 | Ga0373954_0044214 | Ga0373954_0044214_847_1731 | 294 |
| 185 | 3300035172 | Ga0373955_0024236 | Ga0373955_0024236_942_1826 | 294 |
| 186 | 3300035410 | Ga0373924_0007425 | Ga0373924_0007425_2927_3811 | 294 |
| 187 | 3300035724 | Ga0373933_0005227 | Ga0373933_0005227_1736_2620 | 294 |
| 188 | 3300036401 | Ga0373937_0056523 | Ga0373937_0056523_1925_2809 | 294 |
| 189 | 3300036401 | Ga0373937_0215897 | Ga0373937_0215897_726_1613 | 294 |
| 190 | 3300036647 | Ga0316582_0044737 | Ga0316582_0044737_1866_2759 | 294 |
| 191 | 3300046454 | Ga0495592_0006738 | Ga0495592_0006738_3540_4424 | 294 |
| 192 | 3300046511 | Ga0495608_0000970 | Ga0495608_0000970_15568_16452 | 294 |
| 193 | 3300046514 | Ga0495618_0007057 | Ga0495618_0007057_4186_5070 | 294 |
| 194 | 3300046516 | Ga0495628_0081330 | Ga0495628_0081330_1440_2324 | 294 |
| 195 | 3300046517 | Ga0495630_0012748 | Ga0495630_0012748_4067_4951 | 294 |
| 196 | 3300046529 | Ga0495652_0096947 | Ga0495652_0096947_1325_2209 | 294 |
| 197 | 3300046533 | Ga0495640_0019150 | Ga0495640_0019150_193_1077 | 294 |
| 198 | 3300046535 | Ga0495586_0007641 | Ga0495586_0007641_4138_5022 | 294 |
| 199 | 3300046539 | Ga0495621_0072441 | Ga0495621_0072441_129_1013 | 294 |
| 200 | 3300046559 | Ga0495667_0000672 | Ga0495667_0000672_3849_4733 | 294 |
| 201 | 3300046559 | Ga0495667_0070613 | Ga0495667_0070613_432_1316 | 294 |
| 202 | 3300046642 | Ga0495634_0001130 | Ga0495634_0001130_7087_7971 | 294 |
| 203 | 3300046679 | Ga0495623_0124209 | Ga0495623_0124209_348_1232 | 294 |
| 204 | 3300046683 | Ga0495658_0035167 | Ga0495658_0035167_1076_1960 | 294 |
| 205 | 3300046689 | Ga0495613_0007452 | Ga0495613_0007452_3195_4079 | 294 |
| 206 | 3300046690 | Ga0495624_0050899 | Ga0495624_0050899_848_1732 | 294 |
| 207 | 3300047317 | Ga0495604_0066984 | Ga0495604_0066984_848_1732 | 294 |
| 208 | 3300047322 | Ga0495680_0000812 | Ga0495680_0000812_13538_14422 | 294 |
| 209 | 3300047322 | Ga0495680_0056924 | Ga0495680_0056924_1761_2645 | 294 |
| 210 | 3300048904 | Ga0496101_0231646 | Ga0496101_0231646_431_1321 | 294 |
| 211 | 3300048909 | Ga0496106_0440922 | Ga0496106_0440922_117_1007 | 294 |
| 212 | 3300048911 | Ga0496108_0099642 | Ga0496108_0099642_1414_2304 | 294 |
| 213 | 3300048917 | Ga0496114_0025774 | Ga0496114_0025774_2917_3807 | 294 |
| 214 | 3300053077 | Ga0495601_0003433 | Ga0495601_0003433_4383_5267 | 294 |
| 215 | 3300053085 | Ga0495619_0159829 | Ga0495619_0159829_74_958 | 294 |
| 216 | iso_pu_bacteria | 2511231003 | 2511249150 | 294 |
| 217 | iso_pu_bacteria | 2511231026 | 2511387184 | 294 |
| 218 | iso_pu_bacteria | 2521172590 | 2521556693 | 294 |
| 219 | iso_pu_bacteria | 2548876994 | 2550692428 | 294 |
| 220 | iso_pu_bacteria | 2551306416 | 2553006714 | 294 |
| 221 | iso_pu_bacteria | 2643221554 | 2643790930 | 294 |
| 222 | iso_pu_bacteria | 2643221556 | 2643797590 | 294 |
| 223 | iso_pu_bacteria | 2643221603 | 2644026806 | 294 |
| 224 | iso_pu_bacteria | 2643221638 | 2644214922 | 294 |
| 225 | iso_pu_bacteria | 2643221684 | 2644470628 | 294 |
| 226 | iso_pu_bacteria | 2738541297 | 2738825734 | 294 |
| 227 | iso_pu_bacteria | 2738541357 | 2739149531 | 294 |
| 228 | iso_pu_bacteria | 2738543003 | 2739191450 | 294 |
| 229 | iso_pu_bacteria | 2738543026 | 2739317927 | 294 |
| 230 | iso_pu_bacteria | 2738543029 | 2739336168 | 294 |
| 231 | iso_pu_bacteria | 2765235838 | 2765567875 | 294 |
| 232 | iso_pu_bacteria | 2808606386 | 2808982758 | 294 |
| 233 | iso_pu_bacteria | 2808606415 | 2809130259 | 294 |
| 234 | iso_pu_bacteria | 2808606418 | 2809144086 | 294 |
| 235 | iso_pu_bacteria | 2808606419 | 2809150264 | 294 |
| 236 | iso_pu_bacteria | 2818991436 | 2819545321 | 294 |
| 237 | iso_pu_bacteria | 2818991445 | 2819592571 | 294 |
| 238 | iso_pu_bacteria | 2818991449 | 2819618059 | 294 |
| 239 | iso_pu_bacteria | 2821131069 | 2821134361 | 294 |
| 240 | iso_pu_bacteria | 2839094727 | 2839097838 | 294 |
| 241 | iso_pu_bacteria | 2852618963 | 2852621513 | 294 |
| 242 | iso_pu_bacteria | 2857553236 | 2857554891 | 294 |
| 243 | iso_pu_bacteria | 2857564685 | 2857566129 | 294 |
| 244 | iso_pu_bacteria | 2884811622 | 2884812358 | 294 |
| 245 | iso_pu_bacteria | 2884836552 | 2884838940 | 294 |
| 246 | iso_pu_bacteria | 2884852848 | 2884855232 | 294 |
| 247 | iso_pu_bacteria | 2896154374 | 2896156099 | 294 |
| 248 | iso_pu_bacteria | 2904439833 | 2904441924 | 294 |
| 249 | iso_pu_bacteria | 2904530477 | 2904533221 | 294 |
| 250 | iso_pu_bacteria | 2904584206 | 2904586168 | 294 |
| 251 | iso_pu_bacteria | 2904589729 | 2904592018 | 294 |
| 252 | iso_pu_bacteria | 2904601388 | 2904601820 | 294 |
| 253 | iso_pu_bacteria | 2919046199 | 2919049464 | 294 |
| 254 | iso_pu_bacteria | 2919079590 | 2919083853 | 294 |
| 255 | iso_pu_bacteria | 2919476304 | 2919479022 | 294 |
| 256 | iso_pu_bacteria | 2923510766 | 2923515286 | 294 |
| 257 | iso_pu_bacteria | 2928130867 | 2928132243 | 294 |
| 258 | iso_pu_bacteria | 8047673197 | 8047678884 | 294 |
| 259 | 3300013307 | Ga0157372_10047926 | Ga0157372_100479262 | 295 |
| 260 | 3300025944 | Ga0207661_10209893 | Ga0207661_102098932 | 295 |
| 261 | 3300036647 | Ga0316582_0342472 | Ga0316582_0342472_15_917 | 295 |
| 262 | 3300036712 | Ga0316584_0009596 | Ga0316584_0009596_3375_4277 | 295 |
| 263 | 3300038726 | Ga0400490_19738 | Ga0400490_19738_1550_2506 | 295 |
| 264 | 3300042876 | Ga0451577_0002821 | Ga0451577_0002821_18434_19324 | 295 |
| 265 | 3300045051 | Ga0451576_0003298 | Ga0451576_0003298_11344_12234 | 295 |
| 266 | 3300006173 | Ga0070716_100063273 | Ga0070716_1000632732 | 296 |
| 267 | 3300025939 | Ga0207665_10125949 | Ga0207665_101259492 | 296 |
| 268 | 3300035691 | Ga0373931_0237796 | Ga0373931_0237796_41_946 | 296 |
| 269 | 3300045051 | Ga0451576_0109414 | Ga0451576_0109414_190_1089 | 296 |
| 270 | 3300046454 | Ga0495592_0047786 | Ga0495592_0047786_592_1482 | 296 |
| 271 | 3300046459 | Ga0495629_0044367 | Ga0495629_0044367_970_1860 | 296 |
| 272 | 3300046462 | Ga0495651_0207606 | Ga0495651_0207606_141_1031 | 296 |
| 273 | 3300046463 | Ga0495653_0048598 | Ga0495653_0048598_466_1356 | 296 |
| 274 | 3300046477 | Ga0495664_0012870 | Ga0495664_0012870_2020_2910 | 296 |
| 275 | 3300046511 | Ga0495608_0003690 | Ga0495608_0003690_1603_2493 | 296 |
| 276 | 3300046514 | Ga0495618_0026265 | Ga0495618_0026265_897_1787 | 296 |
| 277 | 3300046516 | Ga0495628_0042112 | Ga0495628_0042112_1603_2493 | 296 |
| 278 | 3300046526 | Ga0495666_0000409 | Ga0495666_0000409_2965_3855 | 296 |
| 279 | 3300046529 | Ga0495652_0064033 | Ga0495652_0064033_583_1473 | 296 |
| 280 | 3300046531 | Ga0495665_0029852 | Ga0495665_0029852_1243_2133 | 296 |
| 281 | 3300046533 | Ga0495640_0000613 | Ga0495640_0000613_17513_18403 | 296 |
| 282 | 3300046559 | Ga0495667_0040824 | Ga0495667_0040824_1226_2116 | 296 |
| 283 | 3300046642 | Ga0495634_0024726 | Ga0495634_0024726_1071_1961 | 296 |
| 284 | 3300046663 | Ga0495635_0007345 | Ga0495635_0007345_1061_1951 | 296 |
| 285 | 3300046679 | Ga0495623_0039900 | Ga0495623_0039900_1433_2323 | 296 |
| 286 | 3300046690 | Ga0495624_0053059 | Ga0495624_0053059_1596_2486 | 296 |
| 287 | 3300047315 | Ga0495581_0008180 | Ga0495581_0008180_921_1811 | 296 |
| 288 | 3300047319 | Ga0495674_0072060 | Ga0495674_0072060_1269_2159 | 296 |
| 289 | 3300047444 | Ga0495675_0010465 | Ga0495675_0010465_3700_4590 | 296 |
| 290 | 3300047673 | Ga0495593_0010066 | Ga0495593_0010066_3700_4590 | 296 |
| 291 | 3300048089 | Ga0495614_0002564 | Ga0495614_0002564_2644_3534 | 296 |
| 292 | 3300002738 | JGI25154J39366_1000269 | JGI25154J39366_10002693 | 297 |
| 293 | 3300002774 | JGI25150J39212_1000958 | JGI25150J39212_10009585 | 297 |
| 294 | 3300003215 | JGI25153J46596_10061407 | JGI25153J46596_100614071 | 297 |
| 295 | 3300003771 | Ga0055526_1000097 | Ga0055526_100009775 | 297 |
| 296 | 3300003771 | Ga0055526_1000130 | Ga0055526_100013065 | 297 |
| 297 | 3300005288 | Ga0065714_10113503 | Ga0065714_101135032 | 297 |
| 298 | 3300006177 | Ga0075362_10147164 | Ga0075362_101471641 | 297 |
| 299 | 3300009036 | Ga0105244_10013324 | Ga0105244_100133245 | 297 |
| 300 | 3300009036 | Ga0105244_10020166 | Ga0105244_100201664 | 297 |
| 301 | 3300014497 | Ga0182008_10001399 | Ga0182008_1000139910 | 297 |
| 302 | 3300015261 | Ga0182006_1000010 | Ga0182006_1000010132 | 297 |
| 303 | 3300015262 | Ga0182007_10000030 | Ga0182007_10000030138 | 297 |
| 304 | 3300015265 | Ga0182005_1000009 | Ga0182005_1000009252 | 297 |
| 305 | 3300017792 | Ga0163161_10038295 | Ga0163161_100382952 | 297 |
| 306 | 3300021361 | Ga0213872_10000117 | Ga0213872_1000011717 | 297 |
| 307 | 3300021361 | Ga0213872_10001659 | Ga0213872_100016592 | 297 |
| 308 | 3300021361 | Ga0213872_10076759 | Ga0213872_100767592 | 297 |
| 309 | 3300025245 | Ga0207425_1001644 | Ga0207425_100164411 | 297 |
| 310 | 3300025246 | Ga0209646_1000104 | Ga0209646_100010413 | 297 |
| 311 | 3300025294 | Ga0209025_1015265 | Ga0209025_10152653 | 297 |
| 312 | 3300025295 | Ga0209564_1000006 | Ga0209564_1000006716 | 297 |
| 313 | 3300025295 | Ga0209564_1000026 | Ga0209564_1000026186 | 297 |
| 314 | 3300025297 | Ga0209758_1000314 | Ga0209758_100031482 | 297 |
| 315 | 3300025728 | Ga0207655_1000781 | Ga0207655_10007813 | 297 |
| 316 | 3300025728 | Ga0207655_1024227 | Ga0207655_10242272 | 297 |
| 317 | 3300031239 | Ga0265328_10000038 | Ga0265328_1000003871 | 297 |
| 318 | 3300031239 | Ga0265328_10003136 | Ga0265328_100031365 | 297 |
| 319 | 3300031250 | Ga0265331_10000138 | Ga0265331_1000013873 | 297 |
| 320 | 3300031250 | Ga0265331_10007132 | Ga0265331_100071322 | 297 |
| 321 | 3300031251 | Ga0265327_10000299 | Ga0265327_1000029921 | 297 |
| 322 | 3300031251 | Ga0265327_10000596 | Ga0265327_100005964 | 297 |
| 323 | 3300031251 | Ga0265327_10001822 | Ga0265327_1000182211 | 297 |
| 324 | 3300031251 | Ga0265327_10014184 | Ga0265327_100141846 | 297 |
| 325 | 3300031251 | Ga0265327_10072507 | Ga0265327_100725072 | 297 |
| 326 | 3300039447 | Ga0436361_0108899 | Ga0436361_0108899_34808_35701 | 297 |
| 327 | 3300039447 | Ga0436361_0487158 | Ga0436361_0487158_9224_10117 | 297 |
| 328 | 3300039447 | Ga0436361_0527946 | Ga0436361_0527946_65_958 | 297 |
| 329 | 3300042876 | Ga0451577_0002228 | Ga0451577_0002228_14874_15770 | 297 |
| 330 | 3300046452 | Ga0495617_001777 | Ga0495617_001777_719_1612 | 297 |
| 331 | 3300046457 | Ga0495590_0000023 | Ga0495590_0000023_131327_132220 | 297 |
| 332 | 3300046460 | Ga0495638_0150819 | Ga0495638_0150819_133_1026 | 297 |
| 333 | 3300046471 | Ga0495650_0000263 | Ga0495650_0000263_35690_36583 | 297 |
| 334 | 3300046471 | Ga0495650_0001177 | Ga0495650_0001177_626_1519 | 297 |
| 335 | 3300046471 | Ga0495650_0001570 | Ga0495650_0001570_12982_13875 | 297 |
| 336 | 3300046474 | Ga0495605_0000005 | Ga0495605_0000005_318372_319265 | 297 |
| 337 | 3300046491 | Ga0495584_0021406 | Ga0495584_0021406_1824_2717 | 297 |
| 338 | 3300046507 | Ga0495606_0000044 | Ga0495606_0000044_154989_155882 | 297 |
| 339 | 3300046507 | Ga0495606_0004898 | Ga0495606_0004898_10460_11353 | 297 |
| 340 | 3300046507 | Ga0495606_0008217 | Ga0495606_0008217_7637_8530 | 297 |
| 341 | 3300046507 | Ga0495606_0022663 | Ga0495606_0022663_3390_4283 | 297 |
| 342 | 3300046512 | Ga0495610_0009390 | Ga0495610_0009390_4783_5676 | 297 |
| 343 | 3300046512 | Ga0495610_0011329 | Ga0495610_0011329_3923_4816 | 297 |
| 344 | 3300046513 | Ga0495616_0026767 | Ga0495616_0026767_1464_2357 | 297 |
| 345 | 3300046520 | Ga0495637_0005037 | Ga0495637_0005037_948_1841 | 297 |
| 346 | 3300046522 | Ga0495643_0000250 | Ga0495643_0000250_76226_77119 | 297 |
| 347 | 3300046522 | Ga0495643_0000349 | Ga0495643_0000349_1787_2680 | 297 |
| 348 | 3300046524 | Ga0495648_0000008 | Ga0495648_0000008_66493_67386 | 297 |
| 349 | 3300046524 | Ga0495648_0022493 | Ga0495648_0022493_628_1521 | 297 |
| 350 | 3300046538 | Ga0495609_0005567 | Ga0495609_0005567_395_1288 | 297 |
| 351 | 3300046538 | Ga0495609_0035191 | Ga0495609_0035191_228_1121 | 297 |
| 352 | 3300046557 | Ga0495622_0000027 | Ga0495622_0000027_71434_72327 | 297 |
| 353 | 3300046557 | Ga0495622_0000392 | Ga0495622_0000392_563_1456 | 297 |
| 354 | 3300046558 | Ga0495633_0000226 | Ga0495633_0000226_18286_19179 | 297 |
| 355 | 3300046558 | Ga0495633_0000257 | Ga0495633_0000257_59894_60787 | 297 |
| 356 | 3300046558 | Ga0495633_0001596 | Ga0495633_0001596_15723_16616 | 297 |
| 357 | 3300046558 | Ga0495633_0036476 | Ga0495633_0036476_828_1721 | 297 |
| 358 | 3300046616 | Ga0495668_0000147 | Ga0495668_0000147_30848_31741 | 297 |
| 359 | 3300046616 | Ga0495668_0000347 | Ga0495668_0000347_49582_50475 | 297 |
| 360 | 3300046660 | Ga0495625_0000378 | Ga0495625_0000378_66463_67356 | 297 |
| 361 | 3300046660 | Ga0495625_0005512 | Ga0495625_0005512_4139_5032 | 297 |
| 362 | 3300046660 | Ga0495625_0006440 | Ga0495625_0006440_1022_1915 | 297 |
| 363 | 3300046660 | Ga0495625_0152866 | Ga0495625_0152866_506_1399 | 297 |
| 364 | 3300046664 | Ga0495659_0000146 | Ga0495659_0000146_530_1423 | 297 |
| 365 | 3300046692 | Ga0495671_0000203 | Ga0495671_0000203_51066_51959 | 297 |
| 366 | 3300046694 | Ga0495649_0020292 | Ga0495649_0020292_2063_2956 | 297 |
| 367 | 3300046694 | Ga0495649_0045909 | Ga0495649_0045909_720_1613 | 297 |
| 368 | 3300046810 | Ga0495660_0001117 | Ga0495660_0001117_17444_18337 | 297 |
| 369 | 3300047318 | Ga0495636_0008508 | Ga0495636_0008508_2588_3481 | 297 |
| 370 | 3300047320 | Ga0495672_0000035 | Ga0495672_0000035_185749_186642 | 297 |
| 371 | 3300047320 | Ga0495672_0000363 | Ga0495672_0000363_56541_57434 | 297 |
| 372 | 3300047443 | Ga0495687_018142 | Ga0495687_018142_1095_1988 | 297 |
| 373 | 3300047445 | Ga0495677_0007072 | Ga0495677_0007072_2064_2957 | 297 |
| 374 | 3300047447 | Ga0495685_009748 | Ga0495685_009748_774_1667 | 297 |
| 375 | 3300047469 | Ga0495673_0000034 | Ga0495673_0000034_21890_22783 | 297 |
| 376 | 3300047470 | Ga0495681_0027146 | Ga0495681_0027146_1008_1901 | 297 |
| 377 | 3300048906 | Ga0496103_0001686 | Ga0496103_0001686_598_1491 | 297 |
| 378 | 3300048914 | Ga0496111_0184689 | Ga0496111_0184689_187_1080 | 297 |
| 379 | 3300048919 | Ga0496116_0045394 | Ga0496116_0045394_861_1754 | 297 |
| 380 | 3300048919 | Ga0496116_0048597 | Ga0496116_0048597_1923_2816 | 297 |
| 381 | 3300048920 | Ga0496117_0000010 | Ga0496117_0000010_329565_330458 | 297 |
| 382 | 3300048921 | Ga0496118_0000009 | Ga0496118_0000009_281497_282390 | 297 |
| 383 | 3300048924 | Ga0496121_0006620 | Ga0496121_0006620_12788_13681 | 297 |
| 384 | 3300048926 | Ga0496123_0004593 | Ga0496123_0004593_8085_8978 | 297 |
| 385 | 3300048927 | Ga0496124_0219768 | Ga0496124_0219768_338_1231 | 297 |
| 386 | 3300048927 | Ga0496124_0316752 | Ga0496124_0316752_53_946 | 297 |
| 387 | 3300048928 | Ga0496125_0146323 | Ga0496125_0146323_528_1421 | 297 |
| 388 | 3300049128 | Ga0501308_006927 | Ga0501308_006927_135_1028 | 297 |
| 389 | 3300049459 | Ga0495678_038547 | Ga0495678_038547_414_1307 | 297 |
| 390 | 3300049460 | Ga0495682_0021545 | Ga0495682_0021545_111_1004 | 297 |
| 391 | 3300049766 | Ga0501269_003128 | Ga0501269_003128_625_1518 | 297 |
| 392 | 3300050489 | nmdc:mga03683_51223_c1 | nmdc:mga03683_51223_c1_558_1451 | 297 |
| 393 | 3300002737 | JGI25162J39368_1000284 | JGI25162J39368_100028411 | 298 |
| 394 | 3300002739 | JGI25158J39367_1004193 | JGI25158J39367_10041933 | 298 |
| 395 | 3300002987 | JGI25159J45721_1005430 | JGI25159J45721_10054302 | 298 |
| 396 | 3300003214 | JGI25165J46597_1000384 | JGI25165J46597_100038411 | 298 |
| 397 | 3300003215 | JGI25153J46596_10013454 | JGI25153J46596_100134543 | 298 |
| 398 | 3300003322 | rootL2_10151808 | rootL2_101518081 | 298 |
| 399 | 3300003322 | rootL2_10211541 | rootL2_102115411 | 298 |
| 400 | 3300003574 | Ga0007410J51695_1033175 | Ga0007410J51695_10331754 | 298 |
| 401 | 3300003575 | Ga0007409J51694_1011722 | Ga0007409J51694_10117222 | 298 |
| 402 | 3300003577 | Ga0007416J51690_1019391 | Ga0007416J51690_10193914 | 298 |
| 403 | 3300003693 | Ga0032354_1027536 | Ga0032354_10275364 | 298 |
| 404 | 3300003751 | Ga0055538_1000117 | Ga0055538_100011739 | 298 |
| 405 | 3300003751 | Ga0055538_1000149 | Ga0055538_100014911 | 298 |
| 406 | 3300003752 | Ga0055539_1000163 | Ga0055539_100016339 | 298 |
| 407 | 3300003752 | Ga0055539_1000199 | Ga0055539_100019938 | 298 |
| 408 | 3300003756 | Ga0055533_1000166 | Ga0055533_100016639 | 298 |
| 409 | 3300003756 | Ga0055533_1000200 | Ga0055533_100020011 | 298 |
| 410 | 3300003759 | Ga0055525_1000009 | Ga0055525_1000009513 | 298 |
| 411 | 3300003759 | Ga0055525_1000227 | Ga0055525_100022739 | 298 |
| 412 | 3300003759 | Ga0055525_1000276 | Ga0055525_100027638 | 298 |
| 413 | 3300003762 | Ga0055542_1007816 | Ga0055542_10078163 | 298 |
| 414 | 3300003763 | Ga0055529_1000283 | Ga0055529_100028326 | 298 |
| 415 | 3300003771 | Ga0055526_1000369 | Ga0055526_10003692 | 298 |
| 416 | 3300003771 | Ga0055526_1005622 | Ga0055526_10056222 | 298 |
| 417 | 3300003773 | Ga0055537_1000081 | Ga0055537_100008165 | 298 |
| 418 | 3300003775 | Ga0055524_1011808 | Ga0055524_10118082 | 298 |
| 419 | 3300003775 | Ga0055524_1021243 | Ga0055524_10212432 | 298 |
| 420 | 3300003784 | Ga0055534_1000316 | Ga0055534_100031630 | 298 |
| 421 | 3300003790 | Ga0055528_1000412 | Ga0055528_10004123 | 298 |
| 422 | 3300003790 | Ga0055528_1030916 | Ga0055528_10309162 | 298 |
| 423 | 3300003841 | Ga0055541_1000109 | Ga0055541_100010924 | 298 |
| 424 | 3300003841 | Ga0055541_1000130 | Ga0055541_100013011 | 298 |
| 425 | 3300004625 | Ga0055543_1015810 | Ga0055543_10158102 | 298 |
| 426 | 3300005262 | Ga0065165_1000298 | Ga0065165_100029862 | 298 |
| 427 | 3300005289 | Ga0065704_10154170 | Ga0065704_101541701 | 298 |
| 428 | 3300005327 | Ga0070658_10217964 | Ga0070658_102179642 | 298 |
| 429 | 3300005339 | Ga0070660_100004159 | Ga0070660_1000041592 | 298 |
| 430 | 3300005344 | Ga0070661_100032092 | Ga0070661_1000320923 | 298 |
| 431 | 3300005344 | Ga0070661_100275727 | Ga0070661_1002757272 | 298 |
| 432 | 3300005366 | Ga0070659_100065478 | Ga0070659_1000654783 | 298 |
| 433 | 3300005366 | Ga0070659_100084873 | Ga0070659_1000848732 | 298 |
| 434 | 3300005457 | Ga0070662_100116959 | Ga0070662_1001169593 | 298 |
| 435 | 3300005563 | Ga0068855_100006550 | Ga0068855_1000065502 | 298 |
| 436 | 3300005563 | Ga0068855_100356438 | Ga0068855_1003564382 | 298 |
| 437 | 3300005578 | Ga0068854_100153867 | Ga0068854_1001538671 | 298 |
| 438 | 3300006946 | Ga0079104_1006538 | Ga0079104_10065382 | 298 |
| 439 | 3300006946 | Ga0079104_1011217 | Ga0079104_10112173 | 298 |
| 440 | 3300009036 | Ga0105244_10121984 | Ga0105244_101219842 | 298 |
| 441 | 3300009098 | Ga0105245_10118126 | Ga0105245_101181263 | 298 |
| 442 | 3300009176 | Ga0105242_10043759 | Ga0105242_100437592 | 298 |
| 443 | 3300009545 | Ga0105237_10120736 | Ga0105237_101207363 | 298 |
| 444 | 3300009545 | Ga0105237_10464231 | Ga0105237_104642312 | 298 |
| 445 | 3300009551 | Ga0105238_10000505 | Ga0105238_1000050532 | 298 |
| 446 | 3300013100 | Ga0157373_10156712 | Ga0157373_101567121 | 298 |
| 447 | 3300013102 | Ga0157371_10000399 | Ga0157371_1000039915 | 298 |
| 448 | 3300014497 | Ga0182008_10041786 | Ga0182008_100417862 | 298 |
| 449 | 3300015261 | Ga0182006_1000055 | Ga0182006_100005538 | 298 |
| 450 | 3300015262 | Ga0182007_10012398 | Ga0182007_100123982 | 298 |
| 451 | 3300015265 | Ga0182005_1000003 | Ga0182005_1000003247 | 298 |
| 452 | 3300015265 | Ga0182005_1000402 | Ga0182005_100040213 | 298 |
| 453 | 3300021361 | Ga0213872_10000205 | Ga0213872_1000020544 | 298 |
| 454 | 3300025206 | Ga0209435_100004 | Ga0209435_100004204 | 298 |
| 455 | 3300025206 | Ga0209435_100214 | Ga0209435_1002141 | 298 |
| 456 | 3300025207 | Ga0209760_101321 | Ga0209760_1013213 | 298 |
| 457 | 3300025224 | Ga0209784_100153 | Ga0209784_10015326 | 298 |
| 458 | 3300025224 | Ga0209784_100191 | Ga0209784_10019112 | 298 |
| 459 | 3300025225 | Ga0209566_100195 | Ga0209566_10019526 | 298 |
| 460 | 3300025225 | Ga0209566_100252 | Ga0209566_10025215 | 298 |
| 461 | 3300025226 | Ga0209674_100069 | Ga0209674_10006912 | 298 |
| 462 | 3300025226 | Ga0209674_100198 | Ga0209674_10019826 | 298 |
| 463 | 3300025229 | Ga0209147_100011 | Ga0209147_100011302 | 298 |
| 464 | 3300025230 | Ga0209563_100015 | Ga0209563_100015629 | 298 |
| 465 | 3300025230 | Ga0209563_100157 | Ga0209563_10015726 | 298 |
| 466 | 3300025230 | Ga0209563_100167 | Ga0209563_10016711 | 298 |
| 467 | 3300025231 | Ga0207427_100317 | Ga0207427_1003174 | 298 |
| 468 | 3300025233 | Ga0209437_100084 | Ga0209437_100084145 | 298 |
| 469 | 3300025233 | Ga0209437_100091 | Ga0209437_10009111 | 298 |
| 470 | 3300025233 | Ga0209437_109387 | Ga0209437_1093872 | 298 |
| 471 | 3300025242 | Ga0209258_100560 | Ga0209258_10056010 | 298 |
| 472 | 3300025245 | Ga0207425_1000006 | Ga0207425_1000006500 | 298 |
| 473 | 3300025245 | Ga0207425_1000177 | Ga0207425_100017741 | 298 |
| 474 | 3300025246 | Ga0209646_1000032 | Ga0209646_1000032158 | 298 |
| 475 | 3300025250 | Ga0209026_1000062 | Ga0209026_100006217 | 298 |
| 476 | 3300025250 | Ga0209026_1001071 | Ga0209026_10010712 | 298 |
| 477 | 3300025253 | Ga0209677_100039 | Ga0209677_10003912 | 298 |
| 478 | 3300025253 | Ga0209677_100156 | Ga0209677_10015626 | 298 |
| 479 | 3300025254 | Ga0209148_1000272 | Ga0209148_100027251 | 298 |
| 480 | 3300025254 | Ga0209148_1009034 | Ga0209148_10090343 | 298 |
| 481 | 3300025256 | Ga0209759_1000054 | Ga0209759_10000542 | 298 |
| 482 | 3300025258 | Ga0209129_1000009 | Ga0209129_1000009329 | 298 |
| 483 | 3300025261 | Ga0209233_1000115 | Ga0209233_100011511 | 298 |
| 484 | 3300025261 | Ga0209233_1034668 | Ga0209233_10346682 | 298 |
| 485 | 3300025263 | Ga0209565_1000006 | Ga0209565_1000006516 | 298 |
| 486 | 3300025263 | Ga0209565_1001221 | Ga0209565_100122111 | 298 |
| 487 | 3300025272 | Ga0209455_1000063 | Ga0209455_100006354 | 298 |
| 488 | 3300025273 | Ga0209673_1000004 | Ga0209673_1000004313 | 298 |
| 489 | 3300025284 | Ga0209130_1000067 | Ga0209130_1000067140 | 298 |
| 490 | 3300025291 | Ga0209675_1000006 | Ga0209675_1000006515 | 298 |
| 491 | 3300025291 | Ga0209675_1003933 | Ga0209675_10039337 | 298 |
| 492 | 3300025291 | Ga0209675_1006468 | Ga0209675_10064685 | 298 |
| 493 | 3300025295 | Ga0209564_1000085 | Ga0209564_1000085240 | 298 |
| 494 | 3300025295 | Ga0209564_1000087 | Ga0209564_100008795 | 298 |
| 495 | 3300025297 | Ga0209758_1001155 | Ga0209758_10011559 | 298 |
| 496 | 3300025298 | Ga0209050_1000219 | Ga0209050_100021949 | 298 |
| 497 | 3300025298 | Ga0209050_1000816 | Ga0209050_100081616 | 298 |
| 498 | 3300025298 | Ga0209050_1029602 | Ga0209050_10296022 | 298 |
| 499 | 3300025299 | Ga0209256_1000037 | Ga0209256_1000037157 | 298 |
| 500 | 3300025299 | Ga0209256_1000191 | Ga0209256_100019180 | 298 |
| 501 | 3300025299 | Ga0209256_1002450 | Ga0209256_10024502 | 298 |
| 502 | 3300025299 | Ga0209256_1007152 | Ga0209256_10071522 | 298 |
| 503 | 3300025302 | Ga0207426_1004561 | Ga0207426_10045611 | 298 |
| 504 | 3300025302 | Ga0207426_1037312 | Ga0207426_10373122 | 298 |
| 505 | 3300025304 | Ga0209257_1000010 | Ga0209257_1000010331 | 298 |
| 506 | 3300025909 | Ga0207705_10003612 | Ga0207705_100036126 | 298 |
| 507 | 3300025911 | Ga0207654_10009376 | Ga0207654_100093763 | 298 |
| 508 | 3300025913 | Ga0207695_10003295 | Ga0207695_1000329520 | 298 |
| 509 | 3300025913 | Ga0207695_10078841 | Ga0207695_100788413 | 298 |
| 510 | 3300025914 | Ga0207671_10029222 | Ga0207671_100292223 | 298 |
| 511 | 3300025919 | Ga0207657_10028170 | Ga0207657_100281705 | 298 |
| 512 | 3300025919 | Ga0207657_10064383 | Ga0207657_100643832 | 298 |
| 513 | 3300025919 | Ga0207657_10336368 | Ga0207657_103363682 | 298 |
| 514 | 3300025920 | Ga0207649_10037291 | Ga0207649_100372913 | 298 |
| 515 | 3300025924 | Ga0207694_10000392 | Ga0207694_1000039232 | 298 |
| 516 | 3300025924 | Ga0207694_10060801 | Ga0207694_100608013 | 298 |
| 517 | 3300025927 | Ga0207687_10219246 | Ga0207687_102192462 | 298 |
| 518 | 3300025932 | Ga0207690_10046079 | Ga0207690_100460792 | 298 |
| 519 | 3300025932 | Ga0207690_10196722 | Ga0207690_101967222 | 298 |
| 520 | 3300025933 | Ga0207706_10228689 | Ga0207706_102286892 | 298 |
| 521 | 3300025934 | Ga0207686_10001803 | Ga0207686_1000180314 | 298 |
| 522 | 3300025935 | Ga0207709_10020122 | Ga0207709_100201223 | 298 |
| 523 | 3300025942 | Ga0207689_10187006 | Ga0207689_101870062 | 298 |
| 524 | 3300025945 | Ga0207679_10011415 | Ga0207679_100114153 | 298 |
| 525 | 3300025949 | Ga0207667_10000019 | Ga0207667_10000019194 | 298 |
| 526 | 3300025949 | Ga0207667_10000304 | Ga0207667_1000030460 | 298 |
| 527 | 3300025949 | Ga0207667_10014829 | Ga0207667_100148296 | 298 |
| 528 | 3300026089 | Ga0207648_10095259 | Ga0207648_100952592 | 298 |
| 529 | 3300026116 | Ga0207674_10063290 | Ga0207674_100632904 | 298 |
| 530 | 3300026142 | Ga0207698_10152971 | Ga0207698_101529711 | 298 |
| 531 | 3300027111 | Ga0209281_1004617 | Ga0209281_10046173 | 298 |
| 532 | 3300031548 | Ga0307408_100000180 | Ga0307408_10000018049 | 298 |
| 533 | 3300031548 | Ga0307408_100000533 | Ga0307408_10000053333 | 298 |
| 534 | 3300031548 | Ga0307408_100482095 | Ga0307408_1004820951 | 298 |
| 535 | 3300032002 | Ga0307416_100222234 | Ga0307416_1002222342 | 298 |
| 536 | 3300037312 | Ga0395899_0002578 | Ga0395899_0002578_2299_3195 | 298 |
| 537 | 3300037312 | Ga0395899_0010125 | Ga0395899_0010125_6257_7153 | 298 |
| 538 | 3300037312 | Ga0395899_0283124 | Ga0395899_0283124_97_993 | 298 |
| 539 | 3300037312 | Ga0395899_0283829 | Ga0395899_0283829_168_1064 | 298 |
| 540 | 3300037418 | Ga0395900_0000267 | Ga0395900_0000267_78709_79605 | 298 |
| 541 | 3300037418 | Ga0395900_0040547 | Ga0395900_0040547_1005_1901 | 298 |
| 542 | 3300037418 | Ga0395900_0045762 | Ga0395900_0045762_2899_3795 | 298 |
| 543 | 3300037418 | Ga0395900_0214321 | Ga0395900_0214321_239_1135 | 298 |
| 544 | 3300037418 | Ga0395900_0217458 | Ga0395900_0217458_391_1287 | 298 |
| 545 | 3300037418 | Ga0395900_0374663 | Ga0395900_0374663_457_1353 | 298 |
| 546 | 3300037418 | Ga0395900_0420226 | Ga0395900_0420226_61_957 | 298 |
| 547 | 3300037466 | Ga0395898_0123185 | Ga0395898_0123185_634_1530 | 298 |
| 548 | 3300037466 | Ga0395898_0347908 | Ga0395898_0347908_124_1020 | 298 |
| 549 | 3300037471 | Ga0395905_0000137 | Ga0395905_0000137_75978_76874 | 298 |
| 550 | 3300037471 | Ga0395905_0003859 | Ga0395905_0003859_14858_15754 | 298 |
| 551 | 3300037471 | Ga0395905_0009356 | Ga0395905_0009356_2809_3705 | 298 |
| 552 | 3300037471 | Ga0395905_0100043 | Ga0395905_0100043_1543_2439 | 298 |
| 553 | 3300037471 | Ga0395905_0245727 | Ga0395905_0245727_704_1600 | 298 |
| 554 | 3300037471 | Ga0395905_0273789 | Ga0395905_0273789_404_1300 | 298 |
| 555 | 3300038443 | Ga0395901_0004507 | Ga0395901_0004507_2275_3171 | 298 |
| 556 | 3300038443 | Ga0395901_0066463 | Ga0395901_0066463_2170_3066 | 298 |
| 557 | 3300038443 | Ga0395901_0083899 | Ga0395901_0083899_282_1178 | 298 |
| 558 | 3300038443 | Ga0395901_0726052 | Ga0395901_0726052_60_956 | 298 |
| 559 | 3300039447 | Ga0436361_0365472 | Ga0436361_0365472_4731_5627 | 298 |
| 560 | 3300039447 | Ga0436361_0421155 | Ga0436361_0421155_9746_10642 | 298 |
| 561 | 3300042005 | Ga0439448_0006541 | Ga0439448_0006541_569_1465 | 298 |
| 562 | 3300042139 | Ga0450904_001077 | Ga0450904_001077_1902_2798 | 298 |
| 563 | 3300044656 | Ga0466969_0048470 | Ga0466969_0048470_878_1777 | 298 |
| 564 | 3300044683 | Ga0466965_0229810 | Ga0466965_0229810_37_933 | 298 |
| 565 | 3300044683 | Ga0466965_0233089 | Ga0466965_0233089_59_955 | 298 |
| 566 | 3300044684 | Ga0466966_0001804 | Ga0466966_0001804_9996_10892 | 298 |
| 567 | 3300044694 | Ga0466963_0280581 | Ga0466963_0280581_188_1084 | 298 |
| 568 | 3300044706 | Ga0466964_0001091 | Ga0466964_0001091_6170_7066 | 298 |
| 569 | 3300044706 | Ga0466964_0037609 | Ga0466964_0037609_413_1309 | 298 |
| 570 | 3300044735 | Ga0466968_0005462 | Ga0466968_0005462_409_1305 | 298 |
| 571 | 3300044735 | Ga0466968_0016377 | Ga0466968_0016377_1177_2073 | 298 |
| 572 | 3300044765 | Ga0466970_0003911 | Ga0466970_0003911_682_1578 | 298 |
| 573 | 3300044842 | Ga0466957_0021820 | Ga0466957_0021820_1179_2075 | 298 |
| 574 | 3300044842 | Ga0466957_0064371 | Ga0466957_0064371_275_1171 | 298 |
| 575 | 3300045976 | Ga0466967_0009867 | Ga0466967_0009867_5797_6693 | 298 |
| 576 | 3300045976 | Ga0466967_0164786 | Ga0466967_0164786_437_1333 | 298 |
| 577 | 3300046452 | Ga0495617_000002 | Ga0495617_000002_17320_18216 | 298 |
| 578 | 3300046452 | Ga0495617_000053 | Ga0495617_000053_69252_70148 | 298 |
| 579 | 3300046452 | Ga0495617_000189 | Ga0495617_000189_18023_18919 | 298 |
| 580 | 3300046453 | Ga0495627_000065 | Ga0495627_000065_42103_42999 | 298 |
| 581 | 3300046453 | Ga0495627_000915 | Ga0495627_000915_16662_17558 | 298 |
| 582 | 3300046453 | Ga0495627_002699 | Ga0495627_002699_343_1239 | 298 |
| 583 | 3300046454 | Ga0495592_0011284 | Ga0495592_0011284_696_1592 | 298 |
| 584 | 3300046455 | Ga0495603_0020894 | Ga0495603_0020894_2561_3457 | 298 |
| 585 | 3300046455 | Ga0495603_0052336 | Ga0495603_0052336_781_1677 | 298 |
| 586 | 3300046457 | Ga0495590_0000423 | Ga0495590_0000423_5465_6361 | 298 |
| 587 | 3300046457 | Ga0495590_0007300 | Ga0495590_0007300_98_994 | 298 |
| 588 | 3300046458 | Ga0495591_000893 | Ga0495591_000893_1491_2387 | 298 |
| 589 | 3300046459 | Ga0495629_0008060 | Ga0495629_0008060_2776_3672 | 298 |
| 590 | 3300046460 | Ga0495638_0012727 | Ga0495638_0012727_2829_3725 | 298 |
| 591 | 3300046460 | Ga0495638_0025052 | Ga0495638_0025052_955_1851 | 298 |
| 592 | 3300046462 | Ga0495651_0017536 | Ga0495651_0017536_2832_3728 | 298 |
| 593 | 3300046462 | Ga0495651_0058119 | Ga0495651_0058119_706_1602 | 298 |
| 594 | 3300046463 | Ga0495653_0000007 | Ga0495653_0000007_40388_41284 | 298 |
| 595 | 3300046463 | Ga0495653_0034843 | Ga0495653_0034843_961_1857 | 298 |
| 596 | 3300046463 | Ga0495653_0043318 | Ga0495653_0043318_1488_2384 | 298 |
| 597 | 3300046463 | Ga0495653_0043630 | Ga0495653_0043630_723_1619 | 298 |
| 598 | 3300046471 | Ga0495650_0000056 | Ga0495650_0000056_45421_46317 | 298 |
| 599 | 3300046471 | Ga0495650_0000391 | Ga0495650_0000391_13668_14564 | 298 |
| 600 | 3300046471 | Ga0495650_0000513 | Ga0495650_0000513_2443_3339 | 298 |
| 601 | 3300046471 | Ga0495650_0003681 | Ga0495650_0003681_2581_3477 | 298 |
| 602 | 3300046473 | Ga0495582_0034143 | Ga0495582_0034143_1310_2206 | 298 |
| 603 | 3300046474 | Ga0495605_0000276 | Ga0495605_0000276_42977_43873 | 298 |
| 604 | 3300046474 | Ga0495605_0000463 | Ga0495605_0000463_33399_34295 | 298 |
| 605 | 3300046474 | Ga0495605_0003780 | Ga0495605_0003780_780_1676 | 298 |
| 606 | 3300046474 | Ga0495605_0015087 | Ga0495605_0015087_236_1132 | 298 |
| 607 | 3300046474 | Ga0495605_0024736 | Ga0495605_0024736_526_1422 | 298 |
| 608 | 3300046474 | Ga0495605_0078075 | Ga0495605_0078075_459_1355 | 298 |
| 609 | 3300046491 | Ga0495584_0000011 | Ga0495584_0000011_187212_188108 | 298 |
| 610 | 3300046491 | Ga0495584_0000407 | Ga0495584_0000407_1379_2275 | 298 |
| 611 | 3300046491 | Ga0495584_0011678 | Ga0495584_0011678_3184_4080 | 298 |
| 612 | 3300046491 | Ga0495584_0023014 | Ga0495584_0023014_535_1431 | 298 |
| 613 | 3300046491 | Ga0495584_0047462 | Ga0495584_0047462_581_1477 | 298 |
| 614 | 3300046491 | Ga0495584_0076907 | Ga0495584_0076907_370_1266 | 298 |
| 615 | 3300046491 | Ga0495584_0092902 | Ga0495584_0092902_445_1341 | 298 |
| 616 | 3300046492 | Ga0495585_0000106 | Ga0495585_0000106_734_1630 | 298 |
| 617 | 3300046492 | Ga0495585_0000231 | Ga0495585_0000231_20067_20963 | 298 |
| 618 | 3300046492 | Ga0495585_0000661 | Ga0495585_0000661_22232_23128 | 298 |
| 619 | 3300046492 | Ga0495585_0003484 | Ga0495585_0003484_8827_9723 | 298 |
| 620 | 3300046492 | Ga0495585_0008809 | Ga0495585_0008809_839_1735 | 298 |
| 621 | 3300046492 | Ga0495585_0008946 | Ga0495585_0008946_605_1501 | 298 |
| 622 | 3300046492 | Ga0495585_0018535 | Ga0495585_0018535_2646_3542 | 298 |
| 623 | 3300046492 | Ga0495585_0044513 | Ga0495585_0044513_1358_2254 | 298 |
| 624 | 3300046492 | Ga0495585_0044618 | Ga0495585_0044618_1277_2173 | 298 |
| 625 | 3300046492 | Ga0495585_0059809 | Ga0495585_0059809_84_980 | 298 |
| 626 | 3300046492 | Ga0495585_0067734 | Ga0495585_0067734_569_1465 | 298 |
| 627 | 3300046492 | Ga0495585_0086479 | Ga0495585_0086479_475_1371 | 298 |
| 628 | 3300046499 | Ga0495594_0020621 | Ga0495594_0020621_1000_1896 | 298 |
| 629 | 3300046499 | Ga0495594_0066322 | Ga0495594_0066322_1001_1897 | 298 |
| 630 | 3300046499 | Ga0495594_0129749 | Ga0495594_0129749_300_1196 | 298 |
| 631 | 3300046499 | Ga0495594_0132564 | Ga0495594_0132564_135_1031 | 298 |
| 632 | 3300046499 | Ga0495594_0177980 | Ga0495594_0177980_107_1003 | 298 |
| 633 | 3300046500 | Ga0495596_0000167 | Ga0495596_0000167_8393_9289 | 298 |
| 634 | 3300046500 | Ga0495596_0014205 | Ga0495596_0014205_15_911 | 298 |
| 635 | 3300046500 | Ga0495596_0015538 | Ga0495596_0015538_2213_3109 | 298 |
| 636 | 3300046500 | Ga0495596_0020140 | Ga0495596_0020140_410_1306 | 298 |
| 637 | 3300046500 | Ga0495596_0049083 | Ga0495596_0049083_241_1137 | 298 |
| 638 | 3300046500 | Ga0495596_0074882 | Ga0495596_0074882_12_908 | 298 |
| 639 | 3300046501 | Ga0495607_0004161 | Ga0495607_0004161_1867_2763 | 298 |
| 640 | 3300046501 | Ga0495607_0007201 | Ga0495607_0007201_4117_5013 | 298 |
| 641 | 3300046501 | Ga0495607_0008583 | Ga0495607_0008583_368_1264 | 298 |
| 642 | 3300046501 | Ga0495607_0045420 | Ga0495607_0045420_1050_1946 | 298 |
| 643 | 3300046501 | Ga0495607_0045876 | Ga0495607_0045876_176_1072 | 298 |
| 644 | 3300046501 | Ga0495607_0074160 | Ga0495607_0074160_870_1766 | 298 |
| 645 | 3300046506 | Ga0495583_0000004 | Ga0495583_0000004_333487_334383 | 298 |
| 646 | 3300046506 | Ga0495583_0000204 | Ga0495583_0000204_62008_62904 | 298 |
| 647 | 3300046506 | Ga0495583_0001039 | Ga0495583_0001039_17362_18258 | 298 |
| 648 | 3300046506 | Ga0495583_0001924 | Ga0495583_0001924_16271_17167 | 298 |
| 649 | 3300046506 | Ga0495583_0004914 | Ga0495583_0004914_7897_8793 | 298 |
| 650 | 3300046506 | Ga0495583_0009235 | Ga0495583_0009235_405_1301 | 298 |
| 651 | 3300046506 | Ga0495583_0015642 | Ga0495583_0015642_704_1600 | 298 |
| 652 | 3300046506 | Ga0495583_0060923 | Ga0495583_0060923_619_1515 | 298 |
| 653 | 3300046507 | Ga0495606_0000007 | Ga0495606_0000007_95123_96019 | 298 |
| 654 | 3300046507 | Ga0495606_0000135 | Ga0495606_0000135_34300_35196 | 298 |
| 655 | 3300046507 | Ga0495606_0012120 | Ga0495606_0012120_1573_2523 | 298 |
| 656 | 3300046507 | Ga0495606_0018285 | Ga0495606_0018285_2243_3139 | 298 |
| 657 | 3300046511 | Ga0495608_0004043 | Ga0495608_0004043_1668_2564 | 298 |
| 658 | 3300046512 | Ga0495610_0000021 | Ga0495610_0000021_306846_307742 | 298 |
| 659 | 3300046512 | Ga0495610_0000670 | Ga0495610_0000670_17100_17996 | 298 |
| 660 | 3300046513 | Ga0495616_0000845 | Ga0495616_0000845_490_1386 | 298 |
| 661 | 3300046513 | Ga0495616_0000954 | Ga0495616_0000954_17626_18522 | 298 |
| 662 | 3300046513 | Ga0495616_0024752 | Ga0495616_0024752_2299_3195 | 298 |
| 663 | 3300046513 | Ga0495616_0046538 | Ga0495616_0046538_89_985 | 298 |
| 664 | 3300046513 | Ga0495616_0050953 | Ga0495616_0050953_454_1350 | 298 |
| 665 | 3300046513 | Ga0495616_0054221 | Ga0495616_0054221_202_1098 | 298 |
| 666 | 3300046514 | Ga0495618_0022757 | Ga0495618_0022757_1332_2228 | 298 |
| 667 | 3300046516 | Ga0495628_0005360 | Ga0495628_0005360_7848_8744 | 298 |
| 668 | 3300046516 | Ga0495628_0006429 | Ga0495628_0006429_8575_9471 | 298 |
| 669 | 3300046518 | Ga0495631_0055086 | Ga0495631_0055086_517_1413 | 298 |
| 670 | 3300046518 | Ga0495631_0055138 | Ga0495631_0055138_530_1426 | 298 |
| 671 | 3300046519 | Ga0495632_0000236 | Ga0495632_0000236_2487_3383 | 298 |
| 672 | 3300046519 | Ga0495632_0002684 | Ga0495632_0002684_2147_3043 | 298 |
| 673 | 3300046519 | Ga0495632_0003478 | Ga0495632_0003478_9617_10513 | 298 |
| 674 | 3300046519 | Ga0495632_0073536 | Ga0495632_0073536_377_1273 | 298 |
| 675 | 3300046520 | Ga0495637_0000049 | Ga0495637_0000049_71817_72713 | 298 |
| 676 | 3300046520 | Ga0495637_0001263 | Ga0495637_0001263_14343_15239 | 298 |
| 677 | 3300046520 | Ga0495637_0005121 | Ga0495637_0005121_4679_5575 | 298 |
| 678 | 3300046522 | Ga0495643_0000400 | Ga0495643_0000400_55062_55958 | 298 |
| 679 | 3300046522 | Ga0495643_0001823 | Ga0495643_0001823_2103_2999 | 298 |
| 680 | 3300046522 | Ga0495643_0002736 | Ga0495643_0002736_1867_2763 | 298 |
| 681 | 3300046522 | Ga0495643_0014196 | Ga0495643_0014196_1845_2741 | 298 |
| 682 | 3300046522 | Ga0495643_0016260 | Ga0495643_0016260_2751_3647 | 298 |
| 683 | 3300046522 | Ga0495643_0107629 | Ga0495643_0107629_65_961 | 298 |
| 684 | 3300046523 | Ga0495644_0012255 | Ga0495644_0012255_2171_3067 | 298 |
| 685 | 3300046523 | Ga0495644_0071865 | Ga0495644_0071865_113_1009 | 298 |
| 686 | 3300046524 | Ga0495648_0000305 | Ga0495648_0000305_33732_34628 | 298 |
| 687 | 3300046524 | Ga0495648_0000666 | Ga0495648_0000666_603_1499 | 298 |
| 688 | 3300046524 | Ga0495648_0001937 | Ga0495648_0001937_18336_19232 | 298 |
| 689 | 3300046524 | Ga0495648_0004977 | Ga0495648_0004977_9545_10441 | 298 |
| 690 | 3300046524 | Ga0495648_0023837 | Ga0495648_0023837_2946_3842 | 298 |
| 691 | 3300046525 | Ga0495663_0001409 | Ga0495663_0001409_962_1858 | 298 |
| 692 | 3300046526 | Ga0495666_0001755 | Ga0495666_0001755_3907_4803 | 298 |
| 693 | 3300046526 | Ga0495666_0018256 | Ga0495666_0018256_439_1335 | 298 |
| 694 | 3300046528 | Ga0495642_0000183 | Ga0495642_0000183_27577_28473 | 298 |
| 695 | 3300046528 | Ga0495642_0004033 | Ga0495642_0004033_1361_2257 | 298 |
| 696 | 3300046528 | Ga0495642_0004566 | Ga0495642_0004566_1774_2670 | 298 |
| 697 | 3300046528 | Ga0495642_0071506 | Ga0495642_0071506_503_1399 | 298 |
| 698 | 3300046529 | Ga0495652_0028719 | Ga0495652_0028719_308_1204 | 298 |
| 699 | 3300046529 | Ga0495652_0031001 | Ga0495652_0031001_1863_2759 | 298 |
| 700 | 3300046529 | Ga0495652_0036817 | Ga0495652_0036817_1381_2277 | 298 |
| 701 | 3300046530 | Ga0495654_0000005 | Ga0495654_0000005_257908_258804 | 298 |
| 702 | 3300046530 | Ga0495654_0004538 | Ga0495654_0004538_5451_6347 | 298 |
| 703 | 3300046536 | Ga0495587_0005037 | Ga0495587_0005037_7738_8634 | 298 |
| 704 | 3300046538 | Ga0495609_0000234 | Ga0495609_0000234_1204_2100 | 298 |
| 705 | 3300046538 | Ga0495609_0000287 | Ga0495609_0000287_706_1602 | 298 |
| 706 | 3300046538 | Ga0495609_0001031 | Ga0495609_0001031_3463_4359 | 298 |
| 707 | 3300046538 | Ga0495609_0012071 | Ga0495609_0012071_2085_2981 | 298 |
| 708 | 3300046538 | Ga0495609_0012258 | Ga0495609_0012258_2942_3838 | 298 |
| 709 | 3300046538 | Ga0495609_0021428 | Ga0495609_0021428_701_1597 | 298 |
| 710 | 3300046542 | Ga0495597_0000413 | Ga0495597_0000413_35443_36339 | 298 |
| 711 | 3300046542 | Ga0495597_0000750 | Ga0495597_0000750_10146_11042 | 298 |
| 712 | 3300046542 | Ga0495597_0001696 | Ga0495597_0001696_9342_10238 | 298 |
| 713 | 3300046542 | Ga0495597_0002784 | Ga0495597_0002784_7042_7938 | 298 |
| 714 | 3300046542 | Ga0495597_0010977 | Ga0495597_0010977_2949_3845 | 298 |
| 715 | 3300046542 | Ga0495597_0027075 | Ga0495597_0027075_841_1737 | 298 |
| 716 | 3300046557 | Ga0495622_0081834 | Ga0495622_0081834_549_1445 | 298 |
| 717 | 3300046558 | Ga0495633_0010270 | Ga0495633_0010270_425_1321 | 298 |
| 718 | 3300046558 | Ga0495633_0017041 | Ga0495633_0017041_451_1347 | 298 |
| 719 | 3300046558 | Ga0495633_0041829 | Ga0495633_0041829_789_1685 | 298 |
| 720 | 3300046558 | Ga0495633_0066280 | Ga0495633_0066280_147_1043 | 298 |
| 721 | 3300046615 | Ga0495656_0007307 | Ga0495656_0007307_2637_3533 | 298 |
| 722 | 3300046616 | Ga0495668_0000008 | Ga0495668_0000008_203244_204140 | 298 |
| 723 | 3300046616 | Ga0495668_0000927 | Ga0495668_0000927_30981_31877 | 298 |
| 724 | 3300046616 | Ga0495668_0040921 | Ga0495668_0040921_888_1784 | 298 |
| 725 | 3300046616 | Ga0495668_0118561 | Ga0495668_0118561_302_1198 | 298 |
| 726 | 3300046616 | Ga0495668_0155486 | Ga0495668_0155486_13_909 | 298 |
| 727 | 3300046642 | Ga0495634_0009521 | Ga0495634_0009521_1408_2304 | 298 |
| 728 | 3300046648 | Ga0495611_0002392 | Ga0495611_0002392_819_1715 | 298 |
| 729 | 3300046648 | Ga0495611_0008616 | Ga0495611_0008616_730_1626 | 298 |
| 730 | 3300046648 | Ga0495611_0010484 | Ga0495611_0010484_760_1656 | 298 |
| 731 | 3300046648 | Ga0495611_0015705 | Ga0495611_0015705_2095_2991 | 298 |
| 732 | 3300046648 | Ga0495611_0021017 | Ga0495611_0021017_306_1202 | 298 |
| 733 | 3300046648 | Ga0495611_0021089 | Ga0495611_0021089_431_1327 | 298 |
| 734 | 3300046648 | Ga0495611_0033320 | Ga0495611_0033320_961_1857 | 298 |
| 735 | 3300046648 | Ga0495611_0080107 | Ga0495611_0080107_564_1460 | 298 |
| 736 | 3300046660 | Ga0495625_0001532 | Ga0495625_0001532_25970_26866 | 298 |
| 737 | 3300046660 | Ga0495625_0022876 | Ga0495625_0022876_254_1150 | 298 |
| 738 | 3300046660 | Ga0495625_0043139 | Ga0495625_0043139_2053_2949 | 298 |
| 739 | 3300046660 | Ga0495625_0105396 | Ga0495625_0105396_239_1135 | 298 |
| 740 | 3300046660 | Ga0495625_0301172 | Ga0495625_0301172_48_944 | 298 |
| 741 | 3300046663 | Ga0495635_0012815 | Ga0495635_0012815_4936_5832 | 298 |
| 742 | 3300046664 | Ga0495659_0001227 | Ga0495659_0001227_570_1466 | 298 |
| 743 | 3300046665 | Ga0495661_0000862 | Ga0495661_0000862_21535_22431 | 298 |
| 744 | 3300046665 | Ga0495661_0001364 | Ga0495661_0001364_448_1344 | 298 |
| 745 | 3300046665 | Ga0495661_0001624 | Ga0495661_0001624_450_1346 | 298 |
| 746 | 3300046665 | Ga0495661_0002895 | Ga0495661_0002895_9996_10892 | 298 |
| 747 | 3300046665 | Ga0495661_0010766 | Ga0495661_0010766_4324_5220 | 298 |
| 748 | 3300046665 | Ga0495661_0070174 | Ga0495661_0070174_766_1662 | 298 |
| 749 | 3300046665 | Ga0495661_0089403 | Ga0495661_0089403_531_1427 | 298 |
| 750 | 3300046674 | Ga0495588_0000070 | Ga0495588_0000070_203433_204329 | 298 |
| 751 | 3300046674 | Ga0495588_0006477 | Ga0495588_0006477_188_1084 | 298 |
| 752 | 3300046674 | Ga0495588_0015851 | Ga0495588_0015851_2405_3301 | 298 |
| 753 | 3300046674 | Ga0495588_0022714 | Ga0495588_0022714_444_1340 | 298 |
| 754 | 3300046674 | Ga0495588_0073547 | Ga0495588_0073547_288_1184 | 298 |
| 755 | 3300046674 | Ga0495588_0113648 | Ga0495588_0113648_490_1386 | 298 |
| 756 | 3300046674 | Ga0495588_0124430 | Ga0495588_0124430_252_1148 | 298 |
| 757 | 3300046678 | Ga0495599_0025359 | Ga0495599_0025359_1171_2067 | 298 |
| 758 | 3300046680 | Ga0495646_0002738 | Ga0495646_0002738_9170_10066 | 298 |
| 759 | 3300046680 | Ga0495646_0023938 | Ga0495646_0023938_889_1785 | 298 |
| 760 | 3300046680 | Ga0495646_0105097 | Ga0495646_0105097_378_1274 | 298 |
| 761 | 3300046684 | Ga0495669_0000297 | Ga0495669_0000297_2054_2950 | 298 |
| 762 | 3300046684 | Ga0495669_0014223 | Ga0495669_0014223_1959_2855 | 298 |
| 763 | 3300046684 | Ga0495669_0117808 | Ga0495669_0117808_255_1151 | 298 |
| 764 | 3300046691 | Ga0495670_0008811 | Ga0495670_0008811_3043_3939 | 298 |
| 765 | 3300046691 | Ga0495670_0009767 | Ga0495670_0009767_2551_3447 | 298 |
| 766 | 3300046691 | Ga0495670_0019193 | Ga0495670_0019193_2101_2997 | 298 |
| 767 | 3300046691 | Ga0495670_0040744 | Ga0495670_0040744_561_1457 | 298 |
| 768 | 3300046692 | Ga0495671_0000024 | Ga0495671_0000024_181213_182109 | 298 |
| 769 | 3300046692 | Ga0495671_0000919 | Ga0495671_0000919_18132_19028 | 298 |
| 770 | 3300046692 | Ga0495671_0020352 | Ga0495671_0020352_74_970 | 298 |
| 771 | 3300046692 | Ga0495671_0025245 | Ga0495671_0025245_1214_2110 | 298 |
| 772 | 3300046692 | Ga0495671_0045238 | Ga0495671_0045238_1287_2183 | 298 |
| 773 | 3300046694 | Ga0495649_0000150 | Ga0495649_0000150_59862_60758 | 298 |
| 774 | 3300046794 | Ga0495589_0000175 | Ga0495589_0000175_45920_46816 | 298 |
| 775 | 3300046794 | Ga0495589_0000218 | Ga0495589_0000218_42134_43030 | 298 |
| 776 | 3300046794 | Ga0495589_0068393 | Ga0495589_0068393_804_1700 | 298 |
| 777 | 3300046794 | Ga0495589_0080356 | Ga0495589_0080356_199_1095 | 298 |
| 778 | 3300046809 | Ga0495600_0050073 | Ga0495600_0050073_1642_2538 | 298 |
| 779 | 3300046810 | Ga0495660_0000113 | Ga0495660_0000113_48976_49872 | 298 |
| 780 | 3300046810 | Ga0495660_0005782 | Ga0495660_0005782_3495_4391 | 298 |
| 781 | 3300046810 | Ga0495660_0018484 | Ga0495660_0018484_1066_1962 | 298 |
| 782 | 3300046810 | Ga0495660_0041108 | Ga0495660_0041108_923_1819 | 298 |
| 783 | 3300046810 | Ga0495660_0080801 | Ga0495660_0080801_630_1526 | 298 |
| 784 | 3300046810 | Ga0495660_0138423 | Ga0495660_0138423_200_1096 | 298 |
| 785 | 3300047315 | Ga0495581_0010305 | Ga0495581_0010305_444_1340 | 298 |
| 786 | 3300047315 | Ga0495581_0015553 | Ga0495581_0015553_2678_3574 | 298 |
| 787 | 3300047317 | Ga0495604_0022452 | Ga0495604_0022452_1907_2803 | 298 |
| 788 | 3300047318 | Ga0495636_0000463 | Ga0495636_0000463_2432_3328 | 298 |
| 789 | 3300047318 | Ga0495636_0015151 | Ga0495636_0015151_270_1166 | 298 |
| 790 | 3300047318 | Ga0495636_0032298 | Ga0495636_0032298_1117_2013 | 298 |
| 791 | 3300047319 | Ga0495674_0004779 | Ga0495674_0004779_6612_7508 | 298 |
| 792 | 3300047320 | Ga0495672_0000533 | Ga0495672_0000533_1199_2095 | 298 |
| 793 | 3300047320 | Ga0495672_0000802 | Ga0495672_0000802_24215_25111 | 298 |
| 794 | 3300047320 | Ga0495672_0016919 | Ga0495672_0016919_2697_3593 | 298 |
| 795 | 3300047320 | Ga0495672_0021979 | Ga0495672_0021979_240_1136 | 298 |
| 796 | 3300047320 | Ga0495672_0036911 | Ga0495672_0036911_658_1554 | 298 |
| 797 | 3300047320 | Ga0495672_0041382 | Ga0495672_0041382_336_1232 | 298 |
| 798 | 3300047320 | Ga0495672_0072717 | Ga0495672_0072717_880_1776 | 298 |
| 799 | 3300047321 | Ga0495676_0000635 | Ga0495676_0000635_8718_9614 | 298 |
| 800 | 3300047321 | Ga0495676_0243828 | Ga0495676_0243828_236_1132 | 298 |
| 801 | 3300047322 | Ga0495680_0007985 | Ga0495680_0007985_4981_5877 | 298 |
| 802 | 3300047323 | Ga0495683_0000088 | Ga0495683_0000088_61862_62758 | 298 |
| 803 | 3300047323 | Ga0495683_0002367 | Ga0495683_0002367_10166_11062 | 298 |
| 804 | 3300047323 | Ga0495683_0010816 | Ga0495683_0010816_238_1134 | 298 |
| 805 | 3300047323 | Ga0495683_0024612 | Ga0495683_0024612_1939_2835 | 298 |
| 806 | 3300047323 | Ga0495683_0026176 | Ga0495683_0026176_732_1628 | 298 |
| 807 | 3300047323 | Ga0495683_0073178 | Ga0495683_0073178_652_1548 | 298 |
| 808 | 3300047323 | Ga0495683_0090424 | Ga0495683_0090424_51_947 | 298 |
| 809 | 3300047443 | Ga0495687_000186 | Ga0495687_000186_49340_50236 | 298 |
| 810 | 3300047443 | Ga0495687_000256 | Ga0495687_000256_49076_49972 | 298 |
| 811 | 3300047443 | Ga0495687_000288 | Ga0495687_000288_5596_6492 | 298 |
| 812 | 3300047443 | Ga0495687_001033 | Ga0495687_001033_25390_26286 | 298 |
| 813 | 3300047443 | Ga0495687_003432 | Ga0495687_003432_10254_11150 | 298 |
| 814 | 3300047443 | Ga0495687_004752 | Ga0495687_004752_1180_2076 | 298 |
| 815 | 3300047444 | Ga0495675_0040886 | Ga0495675_0040886_1890_2786 | 298 |
| 816 | 3300047445 | Ga0495677_0000161 | Ga0495677_0000161_25682_26578 | 298 |
| 817 | 3300047445 | Ga0495677_0003275 | Ga0495677_0003275_4440_5336 | 298 |
| 818 | 3300047445 | Ga0495677_0005176 | Ga0495677_0005176_3818_4714 | 298 |
| 819 | 3300047446 | Ga0495679_018839 | Ga0495679_018839_248_1144 | 298 |
| 820 | 3300047446 | Ga0495679_040441 | Ga0495679_040441_530_1426 | 298 |
| 821 | 3300047447 | Ga0495685_000004 | Ga0495685_000004_22432_23328 | 298 |
| 822 | 3300047469 | Ga0495673_0000033 | Ga0495673_0000033_285305_286201 | 298 |
| 823 | 3300047469 | Ga0495673_0000219 | Ga0495673_0000219_69686_70582 | 298 |
| 824 | 3300047470 | Ga0495681_0000601 | Ga0495681_0000601_2105_3001 | 298 |
| 825 | 3300047472 | Ga0495686_0000167 | Ga0495686_0000167_123582_124478 | 298 |
| 826 | 3300047472 | Ga0495686_0000612 | Ga0495686_0000612_38114_39010 | 298 |
| 827 | 3300047472 | Ga0495686_0000722 | Ga0495686_0000722_22928_23824 | 298 |
| 828 | 3300047673 | Ga0495593_0002957 | Ga0495593_0002957_3492_4388 | 298 |
| 829 | 3300048089 | Ga0495614_0023062 | Ga0495614_0023062_1438_2334 | 298 |
| 830 | 3300048091 | Ga0495626_0000030 | Ga0495626_0000030_20421_21317 | 298 |
| 831 | 3300048091 | Ga0495626_0001606 | Ga0495626_0001606_15240_16136 | 298 |
| 832 | 3300048091 | Ga0495626_0002072 | Ga0495626_0002072_1000_1896 | 298 |
| 833 | 3300048091 | Ga0495626_0007245 | Ga0495626_0007245_2932_3828 | 298 |
| 834 | 3300048091 | Ga0495626_0008403 | Ga0495626_0008403_937_1833 | 298 |
| 835 | 3300048091 | Ga0495626_0028196 | Ga0495626_0028196_192_1088 | 298 |
| 836 | 3300048091 | Ga0495626_0091662 | Ga0495626_0091662_305_1201 | 298 |
| 837 | 3300048903 | Ga0496100_0049502 | Ga0496100_0049502_1212_2108 | 298 |
| 838 | 3300048905 | Ga0496102_0000105 | Ga0496102_0000105_116538_117491 | 298 |
| 839 | 3300048905 | Ga0496102_0000107 | Ga0496102_0000107_23418_24314 | 298 |
| 840 | 3300048905 | Ga0496102_0018743 | Ga0496102_0018743_436_1332 | 298 |
| 841 | 3300048905 | Ga0496102_0131559 | Ga0496102_0131559_276_1172 | 298 |
| 842 | 3300048906 | Ga0496103_0117023 | Ga0496103_0117023_217_1113 | 298 |
| 843 | 3300048909 | Ga0496106_0085869 | Ga0496106_0085869_148_1044 | 298 |
| 844 | 3300048913 | Ga0496110_0000073 | Ga0496110_0000073_9597_10493 | 298 |
| 845 | 3300048913 | Ga0496110_0146736 | Ga0496110_0146736_475_1371 | 298 |
| 846 | 3300048917 | Ga0496114_0026559 | Ga0496114_0026559_1395_2291 | 298 |
| 847 | 3300048918 | Ga0496115_0006825 | Ga0496115_0006825_3126_4022 | 298 |
| 848 | 3300048924 | Ga0496121_0047291 | Ga0496121_0047291_542_1438 | 298 |
| 849 | 3300048924 | Ga0496121_0182475 | Ga0496121_0182475_65_961 | 298 |
| 850 | 3300048925 | Ga0496122_0007032 | Ga0496122_0007032_9399_10295 | 298 |
| 851 | 3300048925 | Ga0496122_0016475 | Ga0496122_0016475_5410_6306 | 298 |
| 852 | 3300048925 | Ga0496122_0032257 | Ga0496122_0032257_3408_4304 | 298 |
| 853 | 3300048927 | Ga0496124_0225892 | Ga0496124_0225892_316_1212 | 298 |
| 854 | 3300048928 | Ga0496125_0001146 | Ga0496125_0001146_38435_39331 | 298 |
| 855 | 3300048928 | Ga0496125_0002429 | Ga0496125_0002429_247_1143 | 298 |
| 856 | 3300048928 | Ga0496125_0245586 | Ga0496125_0245586_115_1011 | 298 |
| 857 | 3300048929 | Ga0496126_0012107 | Ga0496126_0012107_6033_6929 | 298 |
| 858 | 3300049459 | Ga0495678_000001 | Ga0495678_000001_901587_902483 | 298 |
| 859 | 3300049459 | Ga0495678_000603 | Ga0495678_000603_32490_33386 | 298 |
| 860 | 3300049459 | Ga0495678_001473 | Ga0495678_001473_1491_2387 | 298 |
| 861 | 3300049459 | Ga0495678_003704 | Ga0495678_003704_6167_7063 | 298 |
| 862 | 3300049459 | Ga0495678_005875 | Ga0495678_005875_5170_6066 | 298 |
| 863 | 3300049459 | Ga0495678_007980 | Ga0495678_007980_2707_3603 | 298 |
| 864 | 3300049460 | Ga0495682_0000518 | Ga0495682_0000518_865_1761 | 298 |
| 865 | 3300049460 | Ga0495682_0003041 | Ga0495682_0003041_127_1023 | 298 |
| 866 | 3300049775 | Ga0501279_006410 | Ga0501279_006410_504_1400 | 298 |
| 867 | 3300049822 | Ga0501035_0009176 | Ga0501035_0009176_528_1424 | 298 |
| 868 | 3300053125 | Ga0500618_000699 | Ga0500618_000699_2034_2930 | 298 |
| 869 | 3300053125 | Ga0500618_000954 | Ga0500618_000954_12090_12986 | 298 |
| 870 | 3300053125 | Ga0500618_016744 | Ga0500618_016744_743_1639 | 298 |
| 871 | 3300053141 | Ga0500574_008828 | Ga0500574_008828_1061_1957 | 298 |
| 872 | 3300059508 | Ga0587088_002031 | Ga0587088_002031_217_1113 | 298 |
| 873 | 3300059639 | Ga0587062_004949 | Ga0587062_004949_136_1032 | 298 |
| 874 | 3300059640 | Ga0587067_004268 | Ga0587067_004268_209_1123 | 298 |
| 875 | 3300059650 | Ga0587104_000425 | Ga0587104_000425_715_1629 | 298 |
| 876 | 3300037312 | Ga0395899_0000093 | Ga0395899_0000093_8856_9956 | 301 |
| 877 | 3300015262 | Ga0182007_10008037 | Ga0182007_100080373 | 302 |
| 878 | 3300002705 | JGI25156J39149_1000497 | JGI25156J39149_10004972 | 303 |
| 879 | 3300002737 | JGI25162J39368_1001938 | JGI25162J39368_10019382 | 303 |
| 880 | 3300002738 | JGI25154J39366_1000423 | JGI25154J39366_100042329 | 303 |
| 881 | 3300002738 | JGI25154J39366_1000432 | JGI25154J39366_10004322 | 303 |
| 882 | 3300002741 | JGI25157J39369_1000158 | JGI25157J39369_10001582 | 303 |
| 883 | 3300002741 | JGI25157J39369_1000203 | JGI25157J39369_100020317 | 303 |
| 884 | 3300003758 | Ga0055532_1000005 | Ga0055532_1000005130 | 303 |
| 885 | 3300009011 | Ga0105251_10056540 | Ga0105251_100565402 | 303 |
| 886 | 3300009093 | Ga0105240_10143149 | Ga0105240_101431493 | 303 |
| 887 | 3300009093 | Ga0105240_10156199 | Ga0105240_101561993 | 303 |
| 888 | 3300009551 | Ga0105238_10078969 | Ga0105238_100789693 | 303 |
| 889 | 3300025246 | Ga0209646_1000283 | Ga0209646_100028346 | 303 |
| 890 | 3300025256 | Ga0209759_1000548 | Ga0209759_10005482 | 303 |
| 891 | 3300025272 | Ga0209455_1001258 | Ga0209455_10012588 | 303 |
| 892 | 3300025913 | Ga0207695_10001902 | Ga0207695_100019024 | 303 |
| 893 | 3300031838 | Ga0307518_10009169 | Ga0307518_100091694 | 303 |
| 894 | 3300046660 | Ga0495625_0004513 | Ga0495625_0004513_1841_2752 | 303 |
| 895 | 3300048919 | Ga0496116_0013018 | Ga0496116_0013018_3989_4900 | 303 |
| 896 | 3300048925 | Ga0496122_0000513 | Ga0496122_0000513_1849_2760 | 303 |
| 897 | 3300048926 | Ga0496123_0000145 | Ga0496123_0000145_77270_78181 | 303 |
| 898 | 3300048928 | Ga0496125_0001481 | Ga0496125_0001481_4818_5729 | 303 |
| 899 | 3300048928 | Ga0496125_0089129 | Ga0496125_0089129_1294_2205 | 303 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1obg-assembly1.cif.gz_A | saicar-synthase complexed with atp | 0.9391 | 8 | 303 |
| 3r9r-assembly1.cif.gz_A | structure of a phosphoribosylaminoimidazole-succinocarboxamide synthase from mycobacterium abscessus atcc 19977 / dsm 44196 | 0.9292 | 8 | 300 |
| 1obd-assembly1.cif.gz_A | saicar-synthase complexed with atp | 0.9234 | 8 | 300 |
| 2cnv-assembly1.cif.gz_A | saicar-synthase from saccharomyces cerevisiae complexed saicar | 0.9167 | 8 | 303 |
| 1obg-assembly1.cif.gz_A | saicar-synthase complexed with atp | 0.915 | 8 | 303 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r9rA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.965 | 109 | 252 | 3.30.470.20 |
| 3r9rA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9521 | 109 | 252 | 3.30.470.20 |
| 1obgA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9432 | 109 | 252 | 3.30.470.20 |
| 1obgA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9247 | 109 | 252 | 3.30.470.20 |
| af_P9WHN1_1_93_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.9151 | 17 | 108 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3HNI6-F1-model_v4 | deleted | 0.9963 | 6 | 201 |
|
| AF-A0A3S4W3U4-F1-model_v4 | deleted | 0.9953 | 105 | 215 |
|
| AF-A0A520HAQ3-F1-model_v4 | phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) | 0.995 | 6 | 110 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A356HJH1-F1-model_v4 | deleted | 0.9947 | 7 | 160 |
|
| AF-A0A6I3H9W3-F1-model_v4 | deleted | 0.9927 | 7 | 232 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar