F485113

General Info

Members Datasets Scaffolds Average Seq Length
899 444 836 297

Family's Representative Sequence

Representative Sequence 3300038726|Ga0400490_19738|Ga0400490_19738_1550_2506
Length 318
Sequence LLRQSRSIHYNDGLLNKISIMATSPLLKTTISSLQLLHQGKVRDIYDVDDAHLLMVSSDRLSAFDVILPTGIDKKGAMLTQMANFWFEKLGHVVPNHLTGIDPSSVVKDPAEAAQLEGRAVVVKKLKPLPIEAIVRGYIVGSGWKEYQAKGTVCEIPLPAGLQLADKLPQPLFTPSSKADIGEHDENISIAQVEALIGKEMTEKVASVAIALYTQAAEYALTKGIIIADTKFEFGLDEHGVLHVMDEVLTPDSSRFWPLESYQVGSNPPSYDKQYVRDWLENSGWDKKPPAPALPPEVAKRTSEKYAEVYQKLTGKTL

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
7 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
8 2643221556 Massilia sp. Root1485 Isolate Unclassified
9 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
10 2643221638 Duganella sp. Root336D2 Isolate Unclassified
11 2643221645 Massilia sp. Root351 Isolate Unclassified
12 2643221664 Massilia sp. Root418 Isolate Unclassified
13 2643221684 Massilia sp. Root133 Isolate Unclassified
14 2738541280 Massilia sp. GV090 Isolate Unclassified
15 2738541297 Duganella sp. GV083 Isolate Unclassified
16 2738541300 Massilia sp. GV016 Isolate Unclassified
17 2738541357 Duganella sp. GV053 Isolate Unclassified
18 2738543003 Duganella sp. GV066 Isolate Unclassified
19 2738543018 Massilia sp. GV045 Isolate Unclassified
20 2738543026 Duganella sp. GV089 Isolate Unclassified
21 2738543029 Duganella sp. GV039 Isolate Unclassified
22 2738543030 Massilia sp. GV097 Isolate Unclassified
23 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
24 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
25 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
26 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
27 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
28 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
29 2818991436 Collimonas arenae 515 Isolate Unclassified
30 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
31 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
32 2821131069 Duganella sp. 1224 Isolate Unclassified
33 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
34 2842711865 Duganella sp. R-73148 Isolate Unclassified
35 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
36 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
37 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
38 2857553236 Duganella sp. R-74557 Isolate Unclassified
39 2857558681 Duganella sp. R-74565 Isolate Unclassified
40 2857564685 Duganella sp. R-74599 Isolate Unclassified
41 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
42 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
43 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
44 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
45 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
46 2904424332 Duganella sp. 1411 Isolate Rhizosphere
47 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
48 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
49 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
50 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
51 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
52 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
53 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
54 2919476304 Duganella sp. 3397 Isolate Unclassified
55 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
56 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
57 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
58 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
59 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
60 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
61 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
62 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
63 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
64 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
65 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
66 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
67 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
68 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
69 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
70 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
71 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
72 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
73 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
74 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
75 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
77 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
78 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
79 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
80 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
81 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
82 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
83 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
84 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
85 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
86 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
87 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
88 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
89 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
90 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
91 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
92 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
93 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
94 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
95 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
96 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
97 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
98 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
99 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
100 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
101 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
102 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
103 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
104 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
105 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
106 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
107 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
108 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
109 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
110 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
111 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
112 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
113 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
114 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
115 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
116 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
117 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
118 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
119 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
120 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
121 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
127 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
132 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
138 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
139 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
140 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
141 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
142 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
143 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
144 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
145 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
152 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
153 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
162 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
165 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
166 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
169 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
170 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
177 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
178 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
180 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
181 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
182 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
185 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
193 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
195 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
198 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
237 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
249 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
250 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
251 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
252 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
253 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
254 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
255 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
256 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
259 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
260 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
267 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
274 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
275 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
276 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
277 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
278 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
279 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
280 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
281 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
282 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
283 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
289 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
298 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
302 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
308 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
309 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
314 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
315 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
316 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
317 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
318 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
319 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
320 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
321 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
322 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
323 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
324 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
325 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
326 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
327 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
328 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
329 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
330 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
331 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
332 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
333 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
334 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
335 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
336 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
337 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
338 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
339 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
340 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
341 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
342 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
343 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
344 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
345 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
346 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
347 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
348 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
349 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
352 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
358 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
359 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
364 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
367 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
368 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
369 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
370 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
373 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
374 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
375 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
376 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
377 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
378 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
379 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
380 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
381 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
382 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
383 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
384 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
385 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
386 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
391 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
392 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
393 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
396 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
397 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
398 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
401 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
402 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
403 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
404 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
405 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
407 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
408 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
420 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
421 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
422 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
423 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
424 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
425 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
426 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
427 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
428 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
430 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
433 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
434 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
435 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
436 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
437 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
438 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
444 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.88
Metatranscriptomes 1.11
Isolates 7.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.57
Nodule 0.67
Rhizoplane 2
Rhizosphere 77.2
Stem 0
Stem Tuber 0
Unclassified 9.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000497 3300002705 Bacteria 23452
2 JGI25162J39368_1000284 3300002737 Bacteria 47815
3 JGI25162J39368_1001938 3300002737 Bacteria 9364
4 JGI25154J39366_1000269 3300002738 Bacteria 32398
5 JGI25154J39366_1000423 3300002738 Bacteria 22650
6 JGI25154J39366_1000432 3300002738 Bacteria 22245
7 JGI25158J39367_1004193 3300002739 Bacteria 2173
8 JGI25157J39369_1000158 3300002741 Bacteria 56328
9 JGI25157J39369_1000203 3300002741 Bacteria 49480
10 JGI25150J39212_1000958 3300002774 Bacteria 9153
11 JGI25159J45721_1005430 3300002987 Bacteria 4001
12 JGI25165J46597_1000384 3300003214 Bacteria 47815
13 JGI25153J46596_10013454 3300003215 Bacteria 3455
14 JGI25153J46596_10061407 3300003215 Bacteria 1018
15 rootL2_10100680 3300003322 Bacteria 9467
16 rootL2_10151808 3300003322 Bacteria 1107
17 rootL2_10211541 3300003322 Bacteria 1016
18 Ga0007410J51695_1033175 3300003574 Bacteria 4807
19 Ga0007409J51694_1011722 3300003575 Bacteria 2155
20 Ga0007416J51690_1019391 3300003577 Bacteria 4820
21 Ga0032354_1027536 3300003693 Bacteria 4985
22 Ga0055538_1000117 3300003751 Bacteria 60939
23 Ga0055538_1000149 3300003751 Bacteria 47815
24 Ga0055539_1000163 3300003752 Bacteria 60939
25 Ga0055539_1000199 3300003752 Bacteria 47773
26 Ga0055533_1000166 3300003756 Bacteria 60939
27 Ga0055533_1000200 3300003756 Bacteria 47815
28 Ga0055532_1000005 3300003758 Bacteria 458107
29 Ga0055525_1000009 3300003759 Bacteria 596899
30 Ga0055525_1000227 3300003759 Bacteria 60939
31 Ga0055525_1000276 3300003759 Bacteria 47773
32 Ga0055542_1007816 3300003762 Bacteria 2135
33 Ga0055529_1000283 3300003763 Bacteria 60275
34 Ga0055526_1000097 3300003771 Bacteria 79762
35 Ga0055526_1000130 3300003771 Bacteria 66677
36 Ga0055526_1000369 3300003771 Bacteria 36368
37 Ga0055526_1005622 3300003771 Bacteria 7137
38 Ga0055537_1000081 3300003773 Bacteria 69775
39 Ga0055524_1011808 3300003775 Bacteria 3388
40 Ga0055524_1021243 3300003775 Bacteria 2158
41 Ga0055534_1000316 3300003784 Bacteria 32097
42 Ga0055528_1000412 3300003790 Bacteria 34563
43 Ga0055528_1030916 3300003790 Bacteria 1406
44 Ga0055541_1000109 3300003841 Bacteria 60939
45 Ga0055541_1000130 3300003841 Bacteria 47815
46 Ga0055543_1015810 3300004625 Bacteria 1445
47 Ga0065165_1000298 3300005262 Bacteria 83243
48 Ga0065714_10113503 3300005288 Bacteria 1426
49 Ga0065704_10154170 3300005289 Bacteria 1396
50 Ga0065712_10110431 3300005290 Bacteria 1836
51 Ga0065707_10113521 3300005295 Bacteria 2325
52 Ga0070658_10076858 3300005327 Bacteria 2738
53 Ga0070658_10217964 3300005327 Bacteria 1613
54 Ga0070683_100002543 3300005329 Bacteria 14568
55 Ga0070683_100110531 3300005329 Bacteria 2593
56 Ga0070670_100002942 3300005331 Bacteria 14103
57 Ga0070677_10018795 3300005333 Bacteria 2494
58 Ga0070666_10026807 3300005335 Bacteria 3769
59 Ga0070682_100003713 3300005337 Bacteria 8483
60 Ga0068868_100000732 3300005338 Bacteria 22193
61 Ga0070660_100004159 3300005339 Bacteria 9994
62 Ga0070687_100000375 3300005343 Bacteria 15284
63 Ga0070661_100032092 3300005344 Bacteria 3800
64 Ga0070661_100072288 3300005344 Bacteria 2538
65 Ga0070661_100275727 3300005344 Bacteria 1303
66 Ga0070692_10200308 3300005345 Bacteria 1169
67 Ga0070675_100000909 3300005354 Bacteria 21059
68 Ga0070671_100000836 3300005355 Bacteria 22365
69 Ga0070673_100000415 3300005364 Bacteria 22516
70 Ga0070659_100065478 3300005366 Bacteria 2878
71 Ga0070659_100084873 3300005366 Bacteria 2532
72 Ga0070667_100032155 3300005367 Bacteria 4376
73 Ga0070710_10088524 3300005437 Bacteria 1822
74 Ga0070694_100000516 3300005444 Bacteria 21285
75 Ga0070694_100023548 3300005444 Bacteria 3963
76 Ga0070663_100039213 3300005455 Bacteria 3309
77 Ga0070678_100000308 3300005456 Bacteria 22695
78 Ga0070662_100094477 3300005457 Bacteria 2251
79 Ga0070662_100116959 3300005457 Bacteria 2039
80 Ga0068867_100055143 3300005459 Bacteria 2938
81 Ga0070698_100357184 3300005471 Bacteria 1393
82 Ga0070672_100000186 3300005543 Bacteria 34186
83 Ga0070695_100131676 3300005545 Bacteria 1724
84 Ga0070693_100030673 3300005547 Bacteria 2941
85 Ga0070693_100045122 3300005547 Bacteria 2497
86 Ga0070704_100000018 3300005549 Bacteria 54668
87 Ga0068855_100006550 3300005563 Bacteria 14154
88 Ga0068855_100356438 3300005563 Bacteria 1610
89 Ga0068854_100000468 3300005578 Bacteria 24905
90 Ga0068854_100153867 3300005578 Bacteria 1775
91 Ga0068852_100000221 3300005616 Bacteria 38665
92 Ga0068852_100540258 3300005616 Bacteria 1165
93 Ga0068864_100053179 3300005618 Bacteria 3493
94 Ga0068866_10203398 3300005718 Bacteria 1185
95 Ga0068861_100001180 3300005719 Bacteria 16253
96 Ga0068863_100300494 3300005841 Bacteria 1557
97 Ga0068858_100003083 3300005842 Bacteria 16679
98 Ga0068860_100001150 3300005843 Bacteria 29000
99 Ga0075368_10052551 3300006042 Bacteria 1621
100 Ga0075364_10241356 3300006051 Bacteria 1227
101 Ga0070716_100063273 3300006173 Bacteria 2148
102 Ga0070716_100070041 3300006173 Bacteria 2058
103 Ga0075362_10147164 3300006177 Bacteria 1128
104 Ga0097621_100000202 3300006237 Bacteria 38810
105 Ga0068871_100000840 3300006358 Bacteria 20567
106 Ga0075428_100002361 3300006844 Bacteria 20488
107 Ga0075434_100303159 3300006871 Bacteria 1618
108 Ga0075429_100016430 3300006880 Bacteria 6414
109 Ga0068865_100000995 3300006881 Bacteria 16253
110 Ga0075436_100019561 3300006914 Bacteria 4640
111 Ga0079104_1006538 3300006946 Bacteria 4384
112 Ga0079104_1011217 3300006946 Bacteria 2895
113 Ga0075435_100245874 3300007076 Bacteria 1522
114 Ga0105251_10056540 3300009011 Bacteria 1857
115 Ga0105244_10013324 3300009036 Bacteria 4813
116 Ga0105244_10020166 3300009036 Bacteria 3706
117 Ga0105244_10121984 3300009036 Bacteria 1262
118 Ga0105240_10143149 3300009093 Bacteria 2856
119 Ga0105240_10156199 3300009093 Bacteria 2713
120 Ga0111539_10002093 3300009094 Bacteria 26670
121 Ga0105245_10105175 3300009098 Bacteria 2618
122 Ga0105245_10118126 3300009098 Bacteria 2474
123 Ga0114129_10625744 3300009147 Bacteria 1392
124 Ga0105243_10554076 3300009148 Bacteria 1099
125 Ga0105242_10001129 3300009176 Bacteria 21023
126 Ga0105242_10016961 3300009176 Bacteria 5668
127 Ga0105242_10043759 3300009176 Bacteria 3624
128 Ga0105237_10120736 3300009545 Bacteria 2615
129 Ga0105237_10464231 3300009545 Bacteria 1272
130 Ga0105238_10000505 3300009551 Bacteria 41099
131 Ga0105238_10050112 3300009551 Bacteria 4204
132 Ga0105238_10078969 3300009551 Bacteria 3281
133 Ga0157373_10156712 3300013100 Bacteria 1602
134 Ga0157371_10000399 3300013102 Bacteria 54380
135 Ga0157370_10009913 3300013104 Bacteria 10094
136 Ga0157378_10002410 3300013297 Bacteria 16624
137 Ga0157378_10036498 3300013297 Bacteria 4349
138 Ga0163162_10003271 3300013306 Bacteria 15506
139 Ga0157372_10047926 3300013307 Bacteria 4749
140 Ga0157375_10007942 3300013308 Bacteria 9288
141 Ga0182008_10001399 3300014497 Bacteria 16252
142 Ga0182008_10041786 3300014497 Bacteria 2286
143 Ga0157377_10122419 3300014745 Bacteria 1578
144 Ga0157376_10004021 3300014969 Bacteria 10171
145 Ga0182006_1000010 3300015261 Bacteria 413414
146 Ga0182006_1000055 3300015261 Bacteria 173139
147 Ga0182007_10000030 3300015262 Bacteria 156866
148 Ga0182007_10008037 3300015262 Bacteria 4362
149 Ga0182007_10012398 3300015262 Bacteria 3279
150 Ga0182005_1000003 3300015265 Bacteria 683269
151 Ga0182005_1000009 3300015265 Bacteria 455334
152 Ga0182005_1000402 3300015265 Bacteria 23631
153 Ga0163161_10038295 3300017792 Bacteria 3439
154 Ga0213872_10000117 3300021361 Bacteria 73833
155 Ga0213872_10000205 3300021361 Bacteria 52617
156 Ga0213872_10001659 3300021361 Bacteria 14028
157 Ga0213872_10076759 3300021361 Bacteria 1502
158 Ga0209435_100004 3300025206 Bacteria 633417
159 Ga0209435_100214 3300025206 Bacteria 16487
160 Ga0209760_101321 3300025207 Bacteria 2686
161 Ga0209784_100153 3300025224 Bacteria 62664
162 Ga0209784_100191 3300025224 Bacteria 48497
163 Ga0209566_100195 3300025225 Bacteria 62664
164 Ga0209566_100252 3300025225 Bacteria 51250
165 Ga0209674_100069 3300025226 Bacteria 243948
166 Ga0209674_100198 3300025226 Bacteria 62664
167 Ga0209147_100011 3300025229 Bacteria 702140
168 Ga0209563_100015 3300025230 Bacteria 879901
169 Ga0209563_100157 3300025230 Bacteria 62664
170 Ga0209563_100167 3300025230 Bacteria 47867
171 Ga0207427_100317 3300025231 Bacteria 32881
172 Ga0209437_100084 3300025233 Bacteria 255423
173 Ga0209437_100091 3300025233 Bacteria 243344
174 Ga0209437_109387 3300025233 Bacteria 1527
175 Ga0209258_100560 3300025242 Bacteria 32331
176 Ga0207425_1000006 3300025245 Bacteria 808854
177 Ga0207425_1000177 3300025245 Bacteria 52401
178 Ga0207425_1001644 3300025245 Bacteria 8998
179 Ga0209646_1000032 3300025246 Bacteria 375315
180 Ga0209646_1000104 3300025246 Bacteria 163824
181 Ga0209646_1000283 3300025246 Bacteria 44163
182 Ga0209026_1000062 3300025250 Bacteria 213298
183 Ga0209026_1001071 3300025250 Bacteria 13234
184 Ga0209677_100039 3300025253 Bacteria 243974
185 Ga0209677_100156 3300025253 Bacteria 62664
186 Ga0209148_1000272 3300025254 Bacteria 81330
187 Ga0209148_1009034 3300025254 Bacteria 1968
188 Ga0209759_1000054 3300025256 Bacteria 211422
189 Ga0209759_1000548 3300025256 Bacteria 38674
190 Ga0209129_1000009 3300025258 Bacteria 633100
191 Ga0209233_1000115 3300025261 Bacteria 243344
192 Ga0209233_1034668 3300025261 Bacteria 1147
193 Ga0209565_1000006 3300025263 Bacteria 897294
194 Ga0209565_1001221 3300025263 Bacteria 12132
195 Ga0209455_1000063 3300025272 Bacteria 333019
196 Ga0209455_1001258 3300025272 Bacteria 11892
197 Ga0209673_1000004 3300025273 Bacteria 896155
198 Ga0209130_1000067 3300025284 Bacteria 184277
199 Ga0209675_1000006 3300025291 Bacteria 732267
200 Ga0209675_1003933 3300025291 Bacteria 6809
201 Ga0209675_1006468 3300025291 Bacteria 4689
202 Ga0209025_1015265 3300025294 Bacteria 4646
203 Ga0209564_1000006 3300025295 Bacteria 1100927
204 Ga0209564_1000026 3300025295 Bacteria 519154
205 Ga0209564_1000085 3300025295 Bacteria 251509
206 Ga0209564_1000087 3300025295 Bacteria 250787
207 Ga0209758_1000314 3300025297 Bacteria 93818
208 Ga0209758_1001155 3300025297 Bacteria 33795
209 Ga0209050_1000219 3300025298 Bacteria 128416
210 Ga0209050_1000816 3300025298 Bacteria 43506
211 Ga0209050_1029602 3300025298 Bacteria 1746
212 Ga0209256_1000037 3300025299 Bacteria 377661
213 Ga0209256_1000191 3300025299 Bacteria 117653
214 Ga0209256_1002450 3300025299 Bacteria 15133
215 Ga0209256_1007152 3300025299 Bacteria 5617
216 Ga0207426_1004561 3300025302 Bacteria 6695
217 Ga0207426_1037312 3300025302 Bacteria 1538
218 Ga0209257_1000010 3300025304 Bacteria 1158682
219 Ga0207656_10000761 3300025321 Bacteria 10564
220 Ga0207655_1000781 3300025728 Bacteria 34999
221 Ga0207655_1024227 3300025728 Bacteria 2980
222 Ga0207653_10008321 3300025885 Bacteria 3233
223 Ga0207682_10003314 3300025893 Bacteria 7030
224 Ga0207642_10002367 3300025899 Bacteria 5873
225 Ga0207642_10124604 3300025899 Bacteria 1335
226 Ga0207705_10003612 3300025909 Bacteria 11782
227 Ga0207654_10009376 3300025911 Bacteria 4971
228 Ga0207695_10001902 3300025913 Bacteria 32583
229 Ga0207695_10003295 3300025913 Bacteria 22928
230 Ga0207695_10078841 3300025913 Bacteria 3340
231 Ga0207671_10029222 3300025914 Bacteria 4117
232 Ga0207660_10008827 3300025917 Bacteria 6513
233 Ga0207657_10028170 3300025919 Bacteria 5130
234 Ga0207657_10064383 3300025919 Bacteria 3129
235 Ga0207657_10336368 3300025919 Bacteria 1192
236 Ga0207649_10037291 3300025920 Bacteria 2935
237 Ga0207694_10000392 3300025924 Bacteria 40819
238 Ga0207694_10060801 3300025924 Bacteria 2940
239 Ga0207650_10001199 3300025925 Bacteria 19021
240 Ga0207687_10219246 3300025927 Bacteria 1497
241 Ga0207644_10000365 3300025931 Bacteria 29528
242 Ga0207690_10046079 3300025932 Bacteria 2885
243 Ga0207690_10196722 3300025932 Bacteria 1528
244 Ga0207706_10081840 3300025933 Bacteria 2837
245 Ga0207706_10228689 3300025933 Bacteria 1628
246 Ga0207686_10001803 3300025934 Bacteria 11906
247 Ga0207709_10000662 3300025935 Bacteria 27921
248 Ga0207709_10020122 3300025935 Bacteria 3762
249 Ga0207670_10007832 3300025936 Bacteria 5995
250 Ga0207704_10000679 3300025938 Bacteria 15056
251 Ga0207665_10125949 3300025939 Bacteria 1814
252 Ga0207665_10247706 3300025939 Bacteria 1315
253 Ga0207691_10000276 3300025940 Bacteria 50778
254 Ga0207689_10187006 3300025942 Bacteria 1708
255 Ga0207689_10327404 3300025942 Bacteria 1272
256 Ga0207661_10138369 3300025944 Bacteria 2093
257 Ga0207661_10209893 3300025944 Bacteria 1716
258 Ga0207679_10011415 3300025945 Bacteria 5753
259 Ga0207667_10000019 3300025949 Bacteria 386233
260 Ga0207667_10000304 3300025949 Bacteria 68102
261 Ga0207667_10014829 3300025949 Bacteria 8865
262 Ga0207677_10010022 3300026023 Bacteria 5347
263 Ga0207703_10029929 3300026035 Bacteria 4299
264 Ga0207639_10028856 3300026041 Bacteria 4056
265 Ga0207702_10029243 3300026078 Bacteria 4584
266 Ga0207648_10044715 3300026089 Bacteria 3885
267 Ga0207648_10095259 3300026089 Bacteria 2604
268 Ga0207674_10063290 3300026116 Bacteria 3734
269 Ga0207675_100002627 3300026118 Bacteria 17768
270 Ga0207683_10001296 3300026121 Bacteria 22599
271 Ga0207698_10000451 3300026142 Bacteria 23736
272 Ga0207698_10152971 3300026142 Bacteria 2005
273 Ga0209281_1004617 3300027111 Bacteria 4069
274 Ga0209371_1002401 3300027312 Bacteria 10530
275 Ga0209967_1001999 3300027364 Bacteria 2630
276 Ga0210000_1000453 3300027462 Bacteria 5640
277 Ga0209995_1005769 3300027471 Bacteria 1990
278 Ga0209970_1005907 3300027614 Bacteria 2011
279 Ga0209983_1021243 3300027665 Bacteria 1356
280 Ga0209971_1014677 3300027682 Bacteria 1857
281 Ga0209974_10006355 3300027876 Bacteria 4127
282 Ga0207428_10002740 3300027907 Bacteria 17552
283 Ga0268266_10200785 3300028379 Bacteria 1825
284 Ga0268264_10001359 3300028381 Bacteria 22915
285 Ga0268256_1002137 3300030500 Bacteria 10530
286 Ga0265328_10000038 3300031239 Bacteria 91571
287 Ga0265328_10003136 3300031239 Bacteria 7365
288 Ga0265331_10000138 3300031250 Bacteria 96032
289 Ga0265331_10007132 3300031250 Bacteria 6503
290 Ga0265327_10000299 3300031251 Bacteria 96033
291 Ga0265327_10000596 3300031251 Bacteria 60242
292 Ga0265327_10001822 3300031251 Bacteria 24922
293 Ga0265327_10014184 3300031251 Bacteria 5228
294 Ga0265327_10072507 3300031251 Bacteria 1719
295 Ga0307408_100000180 3300031548 Bacteria 70740
296 Ga0307408_100000533 3300031548 Bacteria 32873
297 Ga0307408_100482095 3300031548 Bacteria 1082
298 Ga0316575_10003949 3300031665 Bacteria 5188
299 Ga0316579_10018724 3300031691 Bacteria 3050
300 Ga0316578_10151188 3300031728 Bacteria 1398
301 Ga0307518_10009169 3300031838 Bacteria 7063
302 Ga0307416_100222234 3300032002 Bacteria 1812
303 Ga0316583_10038198 3300032133 Bacteria 1702
304 Ga0373953_0030268 3300035117 Bacteria 2098
305 Ga0373954_0044214 3300035118 Bacteria 2078
306 Ga0373955_0024236 3300035172 Bacteria 3101
307 Ga0373924_0007425 3300035410 Bacteria 3959
308 Ga0373931_0237796 3300035691 Bacteria 1103
309 Ga0373933_0005227 3300035724 Bacteria 7081
310 Ga0373937_0056523 3300036401 Bacteria 3604
311 Ga0373937_0215897 3300036401 Bacteria 1805
312 Ga0316582_0044737 3300036647 Bacteria 2784
313 Ga0316582_0280702 3300036647 Bacteria 1143
314 Ga0316582_0342472 3300036647 Bacteria 1028
315 Ga0316584_0009596 3300036712 Bacteria 6726
316 Ga0395899_0000093 3300037312 Bacteria 153541
317 Ga0395899_0002578 3300037312 Bacteria 14617
318 Ga0395899_0010125 3300037312 Bacteria 7230
319 Ga0395899_0283124 3300037312 Bacteria 1127
320 Ga0395899_0283829 3300037312 Bacteria 1125
321 Ga0395900_0000267 3300037418 Bacteria 80920
322 Ga0395900_0040547 3300037418 Bacteria 4798
323 Ga0395900_0045762 3300037418 Bacteria 4507
324 Ga0395900_0214321 3300037418 Bacteria 1943
325 Ga0395900_0217458 3300037418 Bacteria 1927
326 Ga0395900_0374663 3300037418 Bacteria 1392
327 Ga0395900_0420226 3300037418 Bacteria 1298
328 Ga0395898_0123185 3300037466 Bacteria 2484
329 Ga0395898_0347908 3300037466 Bacteria 1413
330 Ga0395905_0000137 3300037471 Bacteria 120800
331 Ga0395905_0003859 3300037471 Bacteria 15810
332 Ga0395905_0009356 3300037471 Bacteria 9581
333 Ga0395905_0100043 3300037471 Bacteria 2722
334 Ga0395905_0245727 3300037471 Bacteria 1672
335 Ga0395905_0273789 3300037471 Bacteria 1574
336 Ga0395901_0004507 3300038443 Bacteria 14046
337 Ga0395901_0066463 3300038443 Bacteria 3755
338 Ga0395901_0083899 3300038443 Bacteria 3330
339 Ga0395901_0663565 3300038443 Bacteria 1044
340 Ga0395901_0726052 3300038443 Bacteria 988
341 Ga0400490_19738 3300038726 Bacteria 21312
342 Ga0436361_0108899 3300039447 Bacteria 37383
343 Ga0436361_0365472 3300039447 Bacteria 11020
344 Ga0436361_0421155 3300039447 Bacteria 12501
345 Ga0436361_0487158 3300039447 Bacteria 12381
346 Ga0436361_0527946 3300039447 Bacteria 1136
347 Ga0439437_005699 3300042000 Bacteria 1372
348 Ga0439448_0006541 3300042005 Bacteria 3355
349 Ga0439455_0008261 3300042012 Bacteria 2227
350 Ga0439456_001190 3300042013 Bacteria 5170
351 Ga0450911_000017 3300042115 Bacteria 104823
352 Ga0450904_000186 3300042139 Bacteria 13567
353 Ga0450904_001077 3300042139 Bacteria 4206
354 Ga0439446_0002588 3300042156 Bacteria 4362
355 Ga0450916_000123 3300042530 Bacteria 5284
356 Ga0450901_002686 3300042533 Bacteria 1897
357 Ga0451577_0000527 3300042876 Bacteria 63726
358 Ga0451577_0000587 3300042876 Bacteria 58386
359 Ga0451577_0002228 3300042876 Bacteria 23580
360 Ga0451577_0002821 3300042876 Bacteria 20040
361 Ga0466969_0048470 3300044656 Bacteria 2100
362 Ga0466965_0229810 3300044683 Bacteria 990
363 Ga0466965_0233089 3300044683 Bacteria 984
364 Ga0466966_0001804 3300044684 Bacteria 13879
365 Ga0466963_0280581 3300044694 Bacteria 1171
366 Ga0466964_0001091 3300044706 Bacteria 9090
367 Ga0466964_0037609 3300044706 Bacteria 1944
368 Ga0453684_0000107 3300044712 Bacteria 362864
369 Ga0453684_0002450 3300044712 Bacteria 45105
370 Ga0453684_0003037 3300044712 Bacteria 39031
371 Ga0453684_0003130 3300044712 Bacteria 38096
372 Ga0453684_0034693 3300044712 Bacteria 6993
373 Ga0453684_0053717 3300044712 Bacteria 5256
374 Ga0453684_0814936 3300044712 Bacteria 1006
375 Ga0466968_0005462 3300044735 Bacteria 4755
376 Ga0466968_0016377 3300044735 Bacteria 2951
377 Ga0466970_0003911 3300044765 Bacteria 7297
378 Ga0466957_0021820 3300044842 Bacteria 3774
379 Ga0466957_0064371 3300044842 Bacteria 2256
380 Ga0466959_0135357 3300045049 Bacteria 1744
381 Ga0451576_0000325 3300045051 Bacteria 115644
382 Ga0451576_0002559 3300045051 Bacteria 26842
383 Ga0451576_0003298 3300045051 Bacteria 22416
384 Ga0451576_0092791 3300045051 Bacteria 3140
385 Ga0451576_0109414 3300045051 Bacteria 2876
386 Ga0466967_0009867 3300045976 Bacteria 7120
387 Ga0466967_0164786 3300045976 Bacteria 2082
388 Ga0495617_000002 3300046452 Bacteria 710121
389 Ga0495617_000053 3300046452 Bacteria 103718
390 Ga0495617_000189 3300046452 Bacteria 38970
391 Ga0495617_001777 3300046452 Bacteria 9209
392 Ga0495627_000065 3300046453 Bacteria 132414
393 Ga0495627_000915 3300046453 Bacteria 20456
394 Ga0495627_002699 3300046453 Bacteria 8299
395 Ga0495592_0006738 3300046454 Bacteria 8569
396 Ga0495592_0011284 3300046454 Bacteria 6757
397 Ga0495592_0047786 3300046454 Bacteria 3186
398 Ga0495603_0020894 3300046455 Bacteria 3963
399 Ga0495603_0052336 3300046455 Bacteria 2424
400 Ga0495590_0000023 3300046457 Bacteria 196939
401 Ga0495590_0000423 3300046457 Bacteria 21352
402 Ga0495590_0007300 3300046457 Bacteria 4269
403 Ga0495591_000893 3300046458 Bacteria 20883
404 Ga0495629_0008060 3300046459 Bacteria 7754
405 Ga0495629_0044367 3300046459 Bacteria 3120
406 Ga0495638_0012727 3300046460 Bacteria 5753
407 Ga0495638_0025052 3300046460 Bacteria 3882
408 Ga0495638_0150819 3300046460 Bacteria 1348
409 Ga0495651_0017536 3300046462 Bacteria 5545
410 Ga0495651_0058119 3300046462 Bacteria 2967
411 Ga0495651_0207606 3300046462 Bacteria 1366
412 Ga0495653_0000007 3300046463 Bacteria 314281
413 Ga0495653_0034843 3300046463 Bacteria 3976
414 Ga0495653_0043318 3300046463 Bacteria 3499
415 Ga0495653_0043630 3300046463 Bacteria 3485
416 Ga0495653_0048598 3300046463 Bacteria 3273
417 Ga0495650_0000056 3300046471 Bacteria 307565
418 Ga0495650_0000263 3300046471 Bacteria 101749
419 Ga0495650_0000391 3300046471 Bacteria 74982
420 Ga0495650_0000513 3300046471 Bacteria 57517
421 Ga0495650_0001177 3300046471 Bacteria 27813
422 Ga0495650_0001570 3300046471 Bacteria 21478
423 Ga0495650_0003681 3300046471 Bacteria 10981
424 Ga0495582_0034143 3300046473 Bacteria 2796
425 Ga0495605_0000005 3300046474 Bacteria 376973
426 Ga0495605_0000276 3300046474 Bacteria 57745
427 Ga0495605_0000463 3300046474 Bacteria 36335
428 Ga0495605_0003780 3300046474 Bacteria 8982
429 Ga0495605_0015087 3300046474 Bacteria 4213
430 Ga0495605_0024736 3300046474 Bacteria 3138
431 Ga0495605_0078075 3300046474 Bacteria 1552
432 Ga0495664_0012870 3300046477 Bacteria 4740
433 Ga0495584_0000011 3300046491 Bacteria 208322
434 Ga0495584_0000407 3300046491 Bacteria 29756
435 Ga0495584_0011678 3300046491 Bacteria 4495
436 Ga0495584_0021406 3300046491 Bacteria 3285
437 Ga0495584_0023014 3300046491 Bacteria 3160
438 Ga0495584_0047462 3300046491 Bacteria 2165
439 Ga0495584_0076907 3300046491 Bacteria 1678
440 Ga0495584_0092902 3300046491 Bacteria 1522
441 Ga0495585_0000106 3300046492 Bacteria 89096
442 Ga0495585_0000231 3300046492 Bacteria 57572
443 Ga0495585_0000661 3300046492 Bacteria 31722
444 Ga0495585_0003484 3300046492 Bacteria 10619
445 Ga0495585_0008809 3300046492 Bacteria 6090
446 Ga0495585_0008946 3300046492 Bacteria 6039
447 Ga0495585_0018535 3300046492 Bacteria 4014
448 Ga0495585_0044513 3300046492 Bacteria 2479
449 Ga0495585_0044618 3300046492 Bacteria 2476
450 Ga0495585_0059809 3300046492 Bacteria 2098
451 Ga0495585_0067734 3300046492 Bacteria 1951
452 Ga0495585_0086479 3300046492 Bacteria 1693
453 Ga0495594_0020621 3300046499 Bacteria 3511
454 Ga0495594_0066322 3300046499 Bacteria 2002
455 Ga0495594_0129749 3300046499 Bacteria 1427
456 Ga0495594_0132564 3300046499 Bacteria 1411
457 Ga0495594_0177980 3300046499 Bacteria 1210
458 Ga0495596_0000167 3300046500 Bacteria 46189
459 Ga0495596_0014205 3300046500 Bacteria 3358
460 Ga0495596_0015538 3300046500 Bacteria 3184
461 Ga0495596_0020140 3300046500 Bacteria 2732
462 Ga0495596_0049083 3300046500 Bacteria 1654
463 Ga0495596_0074882 3300046500 Bacteria 1314
464 Ga0495607_0004161 3300046501 Bacteria 10763
465 Ga0495607_0007201 3300046501 Bacteria 7724
466 Ga0495607_0008583 3300046501 Bacteria 6976
467 Ga0495607_0045420 3300046501 Bacteria 2584
468 Ga0495607_0045876 3300046501 Bacteria 2568
469 Ga0495607_0074160 3300046501 Bacteria 1889
470 Ga0495583_0000004 3300046506 Bacteria 655287
471 Ga0495583_0000204 3300046506 Bacteria 99749
472 Ga0495583_0001039 3300046506 Bacteria 31364
473 Ga0495583_0001924 3300046506 Bacteria 19210
474 Ga0495583_0004914 3300046506 Bacteria 9296
475 Ga0495583_0009235 3300046506 Bacteria 5912
476 Ga0495583_0015642 3300046506 Bacteria 4114
477 Ga0495583_0060923 3300046506 Bacteria 1685
478 Ga0495606_0000007 3300046507 Bacteria 323713
479 Ga0495606_0000044 3300046507 Bacteria 212802
480 Ga0495606_0000135 3300046507 Bacteria 125830
481 Ga0495606_0004898 3300046507 Bacteria 13105
482 Ga0495606_0008217 3300046507 Bacteria 9122
483 Ga0495606_0012120 3300046507 Bacteria 6952
484 Ga0495606_0018285 3300046507 Bacteria 5263
485 Ga0495606_0022663 3300046507 Bacteria 4566
486 Ga0495608_0000970 3300046511 Bacteria 20268
487 Ga0495608_0003690 3300046511 Bacteria 11009
488 Ga0495608_0004043 3300046511 Bacteria 10528
489 Ga0495610_0000021 3300046512 Bacteria 336300
490 Ga0495610_0000670 3300046512 Bacteria 33331
491 Ga0495610_0009390 3300046512 Bacteria 6190
492 Ga0495610_0011329 3300046512 Bacteria 5458
493 Ga0495616_0000845 3300046513 Bacteria 22352
494 Ga0495616_0000954 3300046513 Bacteria 20790
495 Ga0495616_0024752 3300046513 Bacteria 3215
496 Ga0495616_0026767 3300046513 Bacteria 3065
497 Ga0495616_0046538 3300046513 Bacteria 2188
498 Ga0495616_0050953 3300046513 Bacteria 2067
499 Ga0495616_0054221 3300046513 Bacteria 1989
500 Ga0495618_0007057 3300046514 Bacteria 6798
501 Ga0495618_0022757 3300046514 Bacteria 3871
502 Ga0495618_0026265 3300046514 Bacteria 3619
503 Ga0495628_0005360 3300046516 Bacteria 11252
504 Ga0495628_0006429 3300046516 Bacteria 10265
505 Ga0495628_0042112 3300046516 Bacteria 3643
506 Ga0495628_0081330 3300046516 Bacteria 2516
507 Ga0495630_0012748 3300046517 Bacteria 6106
508 Ga0495631_0055086 3300046518 Bacteria 1732
509 Ga0495631_0055138 3300046518 Bacteria 1731
510 Ga0495632_0000236 3300046519 Bacteria 55200
511 Ga0495632_0002684 3300046519 Bacteria 13315
512 Ga0495632_0003478 3300046519 Bacteria 11139
513 Ga0495632_0073536 3300046519 Bacteria 1638
514 Ga0495637_0000049 3300046520 Bacteria 103081
515 Ga0495637_0001263 3300046520 Bacteria 15271
516 Ga0495637_0005037 3300046520 Bacteria 6790
517 Ga0495637_0005121 3300046520 Bacteria 6724
518 Ga0495643_0000250 3300046522 Bacteria 78905
519 Ga0495643_0000349 3300046522 Bacteria 62735
520 Ga0495643_0000400 3300046522 Bacteria 56861
521 Ga0495643_0001823 3300046522 Bacteria 18130
522 Ga0495643_0002736 3300046522 Bacteria 13571
523 Ga0495643_0013936 3300046522 Bacteria 4792
524 Ga0495643_0014196 3300046522 Bacteria 4743
525 Ga0495643_0016260 3300046522 Bacteria 4374
526 Ga0495643_0017918 3300046522 Bacteria 4129
527 Ga0495643_0107629 3300046522 Bacteria 1421
528 Ga0495644_0012255 3300046523 Bacteria 3296
529 Ga0495644_0071865 3300046523 Bacteria 1300
530 Ga0495648_0000008 3300046524 Bacteria 336584
531 Ga0495648_0000305 3300046524 Bacteria 54610
532 Ga0495648_0000666 3300046524 Bacteria 36662
533 Ga0495648_0001937 3300046524 Bacteria 19717
534 Ga0495648_0004977 3300046524 Bacteria 11165
535 Ga0495648_0022493 3300046524 Bacteria 4338
536 Ga0495648_0023837 3300046524 Bacteria 4180
537 Ga0495663_0001409 3300046525 Bacteria 7583
538 Ga0495666_0000409 3300046526 Bacteria 18954
539 Ga0495666_0001755 3300046526 Bacteria 10695
540 Ga0495666_0018256 3300046526 Bacteria 3493
541 Ga0495642_0000183 3300046528 Bacteria 37080
542 Ga0495642_0004033 3300046528 Bacteria 5732
543 Ga0495642_0004566 3300046528 Bacteria 5365
544 Ga0495642_0071506 3300046528 Bacteria 1451
545 Ga0495652_0028719 3300046529 Bacteria 4892
546 Ga0495652_0031001 3300046529 Bacteria 4685
547 Ga0495652_0036817 3300046529 Bacteria 4250
548 Ga0495652_0064033 3300046529 Bacteria 3094
549 Ga0495652_0096947 3300046529 Bacteria 2400
550 Ga0495654_0000005 3300046530 Bacteria 491381
551 Ga0495654_0004538 3300046530 Bacteria 8217
552 Ga0495654_0109730 3300046530 Bacteria 1260
553 Ga0495665_0029852 3300046531 Bacteria 2919
554 Ga0495640_0000613 3300046533 Bacteria 26252
555 Ga0495640_0019150 3300046533 Bacteria 5056
556 Ga0495586_0007641 3300046535 Bacteria 5766
557 Ga0495586_0143163 3300046535 Bacteria 1342
558 Ga0495587_0005037 3300046536 Bacteria 8646
559 Ga0495609_0000234 3300046538 Bacteria 52809
560 Ga0495609_0000287 3300046538 Bacteria 46542
561 Ga0495609_0001031 3300046538 Bacteria 19581
562 Ga0495609_0005567 3300046538 Bacteria 6575
563 Ga0495609_0012071 3300046538 Bacteria 4100
564 Ga0495609_0012258 3300046538 Bacteria 4066
565 Ga0495609_0021428 3300046538 Bacteria 2981
566 Ga0495609_0035191 3300046538 Bacteria 2267
567 Ga0495621_0072441 3300046539 Bacteria 1272
568 Ga0495597_0000413 3300046542 Bacteria 36843
569 Ga0495597_0000750 3300046542 Bacteria 25631
570 Ga0495597_0001696 3300046542 Bacteria 15257
571 Ga0495597_0002784 3300046542 Bacteria 10762
572 Ga0495597_0010977 3300046542 Bacteria 4403
573 Ga0495597_0027075 3300046542 Bacteria 2630
574 Ga0495597_0066169 3300046542 Bacteria 1566
575 Ga0495622_0000027 3300046557 Bacteria 135256
576 Ga0495622_0000392 3300046557 Bacteria 29644
577 Ga0495622_0081834 3300046557 Bacteria 1485
578 Ga0495633_0000226 3300046558 Bacteria 69863
579 Ga0495633_0000257 3300046558 Bacteria 62726
580 Ga0495633_0001596 3300046558 Bacteria 17189
581 Ga0495633_0010270 3300046558 Bacteria 5118
582 Ga0495633_0017041 3300046558 Bacteria 3726
583 Ga0495633_0036476 3300046558 Bacteria 2355
584 Ga0495633_0041829 3300046558 Bacteria 2178
585 Ga0495633_0066280 3300046558 Bacteria 1686
586 Ga0495667_0000672 3300046559 Bacteria 21886
587 Ga0495667_0040824 3300046559 Bacteria 3079
588 Ga0495667_0070613 3300046559 Bacteria 2278
589 Ga0495656_0007307 3300046615 Bacteria 3899
590 Ga0495668_0000008 3300046616 Bacteria 498364
591 Ga0495668_0000147 3300046616 Bacteria 106018
592 Ga0495668_0000347 3300046616 Bacteria 61748
593 Ga0495668_0000927 3300046616 Bacteria 32722
594 Ga0495668_0040921 3300046616 Bacteria 2583
595 Ga0495668_0118561 3300046616 Bacteria 1447
596 Ga0495668_0155486 3300046616 Bacteria 1252
597 Ga0495634_0001130 3300046642 Bacteria 24672
598 Ga0495634_0009521 3300046642 Bacteria 7163
599 Ga0495634_0024726 3300046642 Bacteria 4210
600 Ga0495611_0002392 3300046648 Bacteria 8633
601 Ga0495611_0008616 3300046648 Bacteria 4314
602 Ga0495611_0010484 3300046648 Bacteria 3920
603 Ga0495611_0015705 3300046648 Bacteria 3235
604 Ga0495611_0021017 3300046648 Bacteria 2815
605 Ga0495611_0021089 3300046648 Bacteria 2811
606 Ga0495611_0033320 3300046648 Bacteria 2272
607 Ga0495611_0080107 3300046648 Bacteria 1500
608 Ga0495625_0000378 3300046660 Bacteria 67950
609 Ga0495625_0001532 3300046660 Bacteria 27620
610 Ga0495625_0004513 3300046660 Bacteria 13131
611 Ga0495625_0005512 3300046660 Bacteria 11504
612 Ga0495625_0006440 3300046660 Bacteria 10452
613 Ga0495625_0022876 3300046660 Bacteria 4782
614 Ga0495625_0043139 3300046660 Bacteria 3273
615 Ga0495625_0105396 3300046660 Bacteria 1931
616 Ga0495625_0152866 3300046660 Bacteria 1550
617 Ga0495625_0301172 3300046660 Bacteria 1026
618 Ga0495635_0007345 3300046663 Bacteria 7690
619 Ga0495635_0012815 3300046663 Bacteria 5873
620 Ga0495659_0000146 3300046664 Bacteria 30932
621 Ga0495659_0001227 3300046664 Bacteria 8871
622 Ga0495661_0000862 3300046665 Bacteria 28269
623 Ga0495661_0001364 3300046665 Bacteria 20615
624 Ga0495661_0001624 3300046665 Bacteria 18413
625 Ga0495661_0002895 3300046665 Bacteria 12981
626 Ga0495661_0010766 3300046665 Bacteria 6225
627 Ga0495661_0070174 3300046665 Bacteria 2051
628 Ga0495661_0089403 3300046665 Bacteria 1755
629 Ga0495588_0000070 3300046674 Bacteria 227611
630 Ga0495588_0006477 3300046674 Bacteria 5277
631 Ga0495588_0015851 3300046674 Bacteria 3634
632 Ga0495588_0022714 3300046674 Bacteria 3101
633 Ga0495588_0073547 3300046674 Bacteria 1779
634 Ga0495588_0113648 3300046674 Bacteria 1426
635 Ga0495588_0124430 3300046674 Bacteria 1359
636 Ga0495599_0025359 3300046678 Bacteria 3710
637 Ga0495623_0039900 3300046679 Bacteria 2998
638 Ga0495623_0124209 3300046679 Bacteria 1551
639 Ga0495646_0002738 3300046680 Bacteria 10892
640 Ga0495646_0023938 3300046680 Bacteria 3845
641 Ga0495646_0105097 3300046680 Bacteria 1614
642 Ga0495658_0035167 3300046683 Bacteria 2754
643 Ga0495669_0000297 3300046684 Bacteria 27622
644 Ga0495669_0014223 3300046684 Bacteria 3402
645 Ga0495669_0117808 3300046684 Bacteria 1243
646 Ga0495613_0007452 3300046689 Bacteria 8156
647 Ga0495624_0050899 3300046690 Bacteria 2623
648 Ga0495624_0053059 3300046690 Bacteria 2560
649 Ga0495670_0008811 3300046691 Bacteria 4967
650 Ga0495670_0009767 3300046691 Bacteria 4716
651 Ga0495670_0019193 3300046691 Bacteria 3368
652 Ga0495670_0040744 3300046691 Bacteria 2316
653 Ga0495670_0063760 3300046691 Bacteria 1855
654 Ga0495671_0000024 3300046692 Bacteria 246812
655 Ga0495671_0000203 3300046692 Bacteria 52373
656 Ga0495671_0000919 3300046692 Bacteria 20872
657 Ga0495671_0020352 3300046692 Bacteria 3496
658 Ga0495671_0025245 3300046692 Bacteria 3090
659 Ga0495671_0041911 3300046692 Bacteria 2303
660 Ga0495671_0045238 3300046692 Bacteria 2204
661 Ga0495649_0000150 3300046694 Bacteria 60827
662 Ga0495649_0020292 3300046694 Bacteria 3729
663 Ga0495649_0045909 3300046694 Bacteria 2380
664 Ga0495649_0057105 3300046694 Bacteria 2105
665 Ga0495589_0000175 3300046794 Bacteria 57368
666 Ga0495589_0000218 3300046794 Bacteria 48625
667 Ga0495589_0068393 3300046794 Bacteria 1737
668 Ga0495589_0080356 3300046794 Bacteria 1586
669 Ga0495600_0050073 3300046809 Bacteria 2725
670 Ga0495660_0000113 3300046810 Bacteria 86593
671 Ga0495660_0001117 3300046810 Bacteria 19163
672 Ga0495660_0005782 3300046810 Bacteria 7389
673 Ga0495660_0018484 3300046810 Bacteria 4008
674 Ga0495660_0041108 3300046810 Bacteria 2561
675 Ga0495660_0080801 3300046810 Bacteria 1705
676 Ga0495660_0138423 3300046810 Bacteria 1214
677 Ga0495581_0008180 3300047315 Bacteria 6058
678 Ga0495581_0010305 3300047315 Bacteria 5406
679 Ga0495581_0015553 3300047315 Bacteria 4416
680 Ga0495604_0022452 3300047317 Bacteria 5038
681 Ga0495604_0066984 3300047317 Bacteria 2729
682 Ga0495636_0000463 3300047318 Bacteria 15005
683 Ga0495636_0008508 3300047318 Bacteria 4049
684 Ga0495636_0015151 3300047318 Bacteria 3071
685 Ga0495636_0032298 3300047318 Bacteria 2147
686 Ga0495674_0004779 3300047319 Bacteria 13028
687 Ga0495674_0072060 3300047319 Bacteria 2980
688 Ga0495672_0000035 3300047320 Bacteria 290329
689 Ga0495672_0000363 3300047320 Bacteria 58040
690 Ga0495672_0000533 3300047320 Bacteria 43150
691 Ga0495672_0000802 3300047320 Bacteria 33855
692 Ga0495672_0016919 3300047320 Bacteria 4888
693 Ga0495672_0021979 3300047320 Bacteria 4154
694 Ga0495672_0036911 3300047320 Bacteria 2995
695 Ga0495672_0041382 3300047320 Bacteria 2787
696 Ga0495672_0072717 3300047320 Bacteria 1941
697 Ga0495676_0000635 3300047321 Bacteria 29072
698 Ga0495676_0243828 3300047321 Bacteria 1229
699 Ga0495680_0000812 3300047322 Bacteria 34880
700 Ga0495680_0007985 3300047322 Bacteria 9647
701 Ga0495680_0056924 3300047322 Bacteria 3026
702 Ga0495683_0000088 3300047323 Bacteria 92118
703 Ga0495683_0002367 3300047323 Bacteria 11438
704 Ga0495683_0010816 3300047323 Bacteria 4812
705 Ga0495683_0024612 3300047323 Bacteria 3088
706 Ga0495683_0026176 3300047323 Bacteria 2985
707 Ga0495683_0073178 3300047323 Bacteria 1680
708 Ga0495683_0090424 3300047323 Bacteria 1483
709 Ga0495687_000186 3300047443 Bacteria 90747
710 Ga0495687_000256 3300047443 Bacteria 71778
711 Ga0495687_000288 3300047443 Bacteria 66346
712 Ga0495687_001033 3300047443 Bacteria 27654
713 Ga0495687_003432 3300047443 Bacteria 11495
714 Ga0495687_004752 3300047443 Bacteria 8979
715 Ga0495687_018142 3300047443 Bacteria 3485
716 Ga0495675_0010465 3300047444 Bacteria 5796
717 Ga0495675_0040886 3300047444 Bacteria 2955
718 Ga0495677_0000161 3300047445 Bacteria 32173
719 Ga0495677_0003275 3300047445 Bacteria 6310
720 Ga0495677_0005176 3300047445 Bacteria 4961
721 Ga0495677_0007072 3300047445 Bacteria 4201
722 Ga0495679_018839 3300047446 Bacteria 2440
723 Ga0495679_040441 3300047446 Bacteria 1449
724 Ga0495685_000004 3300047447 Bacteria 115775
725 Ga0495685_009748 3300047447 Bacteria 3214
726 Ga0495673_0000033 3300047469 Bacteria 354152
727 Ga0495673_0000034 3300047469 Bacteria 326920
728 Ga0495673_0000219 3300047469 Bacteria 84634
729 Ga0495681_0000601 3300047470 Bacteria 27490
730 Ga0495681_0027146 3300047470 Bacteria 2967
731 Ga0495686_0000167 3300047472 Bacteria 124849
732 Ga0495686_0000612 3300047472 Bacteria 49335
733 Ga0495686_0000722 3300047472 Bacteria 44277
734 Ga0495593_0002957 3300047673 Bacteria 10221
735 Ga0495593_0010066 3300047673 Bacteria 5476
736 Ga0495614_0002564 3300048089 Bacteria 8081
737 Ga0495614_0023062 3300048089 Bacteria 2684
738 Ga0495626_0000030 3300048091 Bacteria 202562
739 Ga0495626_0001606 3300048091 Bacteria 17620
740 Ga0495626_0002072 3300048091 Bacteria 14593
741 Ga0495626_0007245 3300048091 Bacteria 6195
742 Ga0495626_0008403 3300048091 Bacteria 5663
743 Ga0495626_0028196 3300048091 Bacteria 2724
744 Ga0495626_0091662 3300048091 Bacteria 1335
745 Ga0496100_0049502 3300048903 Bacteria 2718
746 Ga0496101_0231646 3300048904 Bacteria 1436
747 Ga0496102_0000105 3300048905 Bacteria 119523
748 Ga0496102_0000107 3300048905 Bacteria 118250
749 Ga0496102_0018743 3300048905 Bacteria 6086
750 Ga0496102_0131559 3300048905 Bacteria 2342
751 Ga0496103_0001686 3300048906 Bacteria 14449
752 Ga0496103_0117023 3300048906 Bacteria 1696
753 Ga0496106_0085869 3300048909 Bacteria 2423
754 Ga0496106_0440922 3300048909 Bacteria 1046
755 Ga0496108_0099642 3300048911 Bacteria 2477
756 Ga0496110_0000073 3300048913 Bacteria 51301
757 Ga0496110_0146736 3300048913 Bacteria 2134
758 Ga0496111_0184689 3300048914 Bacteria 1550
759 Ga0496114_0025774 3300048917 Bacteria 4809
760 Ga0496114_0026559 3300048917 Bacteria 4741
761 Ga0496115_0006825 3300048918 Bacteria 8377
762 Ga0496116_0013018 3300048919 Bacteria 6746
763 Ga0496116_0045394 3300048919 Bacteria 2975
764 Ga0496116_0048597 3300048919 Bacteria 2846
765 Ga0496117_0000010 3300048920 Bacteria 611954
766 Ga0496118_0000009 3300048921 Bacteria 611954
767 Ga0496121_0006620 3300048924 Bacteria 14278
768 Ga0496121_0047291 3300048924 Bacteria 3673
769 Ga0496121_0182475 3300048924 Bacteria 1513
770 Ga0496122_0000513 3300048925 Bacteria 80013
771 Ga0496122_0007032 3300048925 Bacteria 12652
772 Ga0496122_0016475 3300048925 Bacteria 6990
773 Ga0496122_0032257 3300048925 Bacteria 4336
774 Ga0496123_0000145 3300048926 Bacteria 144475
775 Ga0496123_0004593 3300048926 Bacteria 14378
776 Ga0496124_0219768 3300048927 Bacteria 1430
777 Ga0496124_0225892 3300048927 Bacteria 1404
778 Ga0496124_0316752 3300048927 Bacteria 1119
779 Ga0496125_0001146 3300048928 Bacteria 40202
780 Ga0496125_0001481 3300048928 Bacteria 33868
781 Ga0496125_0002429 3300048928 Bacteria 24227
782 Ga0496125_0089129 3300048928 Bacteria 2321
783 Ga0496125_0146323 3300048928 Bacteria 1632
784 Ga0496125_0245586 3300048928 Bacteria 1133
785 Ga0496126_0012107 3300048929 Bacteria 8855
786 Ga0501308_006927 3300049128 Bacteria 1175
787 Ga0495678_000001 3300049459 Bacteria 1060340
788 Ga0495678_000603 3300049459 Bacteria 33820
789 Ga0495678_001473 3300049459 Bacteria 18420
790 Ga0495678_003704 3300049459 Bacteria 9246
791 Ga0495678_005875 3300049459 Bacteria 6644
792 Ga0495678_007980 3300049459 Bacteria 5413
793 Ga0495678_038547 3300049459 Bacteria 1932
794 Ga0495682_0000518 3300049460 Bacteria 26647
795 Ga0495682_0003041 3300049460 Bacteria 7621
796 Ga0495682_0021545 3300049460 Bacteria 2414
797 Ga0501314_000393 3300049530 Bacteria 2677
798 Ga0501032_0030037 3300049569 Bacteria 3728
799 Ga0501034_0010412 3300049571 Bacteria 9692
800 Ga0501036_0006700 3300049572 Bacteria 9362
801 Ga0501037_0003283 3300049573 Bacteria 11747
802 Ga0501037_0031632 3300049573 Bacteria 3908
803 Ga0501039_0000283 3300049575 Bacteria 36268
804 Ga0501040_0012451 3300049576 Bacteria 5574
805 Ga0501043_0097550 3300049579 Bacteria 2311
806 Ga0501069_0029393 3300049585 Bacteria 3016
807 Ga0501070_0142183 3300049586 Bacteria 1981
808 Ga0501071_0009066 3300049587 Bacteria 6604
809 Ga0501076_0000603 3300049592 Bacteria 23033
810 Ga0501077_0097183 3300049593 Bacteria 1866
811 Ga0501079_0000776 3300049741 Bacteria 21901
812 Ga0501080_0007320 3300049742 Bacteria 9960
813 Ga0501080_0194747 3300049742 Bacteria 1862
814 Ga0501081_0000610 3300049743 Bacteria 20405
815 Ga0501083_0102967 3300049744 Bacteria 1882
816 Ga0501269_003128 3300049766 Bacteria 2008
817 Ga0501279_006410 3300049775 Bacteria 1553
818 Ga0501280_003301 3300049776 Bacteria 2501
819 Ga0501035_0009176 3300049822 Bacteria 9198
820 Ga0501226_000028 3300049853 Bacteria 88553
821 nmdc:mga03683_51223_c1 3300050489 Bacteria 1722
822 nmdc:mga0k408_13143_c1 3300050493 Bacteria 4536
823 nmdc:mga09592_4923_c1 3300050508 Bacteria 10828
824 nmdc:mga08y16_606132_c1 3300050511 Bacteria 1103
825 nmdc:mga08y16_7893_c1 3300050511 Bacteria 11137
826 Ga0495601_0003433 3300053077 Bacteria 9079
827 Ga0495619_0159829 3300053085 Bacteria 1556
828 Ga0500618_000699 3300053125 Bacteria 19697
829 Ga0500618_000954 3300053125 Bacteria 14768
830 Ga0500618_016744 3300053125 Bacteria 1830
831 Ga0500574_008828 3300053141 Bacteria 2163
832 Ga0587088_002031 3300059508 Bacteria 2227
833 Ga0587062_004949 3300059639 Bacteria 1447
834 Ga0587067_004268 3300059640 Bacteria 1850
835 Ga0587104_000425 3300059650 Bacteria 1774
836 Ga0501082_0000944 3300060353 Bacteria 25748

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_606132_c1 nmdc:mga08y16_606132_c1_289_1092 267
2 3300046535 Ga0495586_0143163 Ga0495586_0143163_514_1329 271
3 3300046542 Ga0495597_0066169 Ga0495597_0066169_596_1414 272
4 3300046530 Ga0495654_0109730 Ga0495654_0109730_15_860 273
5 3300042530 Ga0450916_000123 Ga0450916_000123_785_1654 277
6 3300042533 Ga0450901_002686 Ga0450901_002686_271_1140 277
7 3300049530 Ga0501314_000393 Ga0501314_000393_1691_2560 277
8 3300049853 Ga0501226_000028 Ga0501226_000028_25916_26785 277
9 3300042000 Ga0439437_005699 Ga0439437_005699_116_985 278
10 3300042012 Ga0439455_0008261 Ga0439455_0008261_851_1720 278
11 3300042013 Ga0439456_001190 Ga0439456_001190_4270_5139 278
12 3300042115 Ga0450911_000017 Ga0450911_000017_58060_58929 278
13 3300042156 Ga0439446_0002588 Ga0439446_0002588_2007_2876 278
14 3300042139 Ga0450904_000186 Ga0450904_000186_2706_3575 279
15 3300049569 Ga0501032_0030037 Ga0501032_0030037_2722_3591 279
16 3300049573 Ga0501037_0031632 Ga0501037_0031632_1337_2206 279
17 3300003322 rootL2_10100680 rootL2_101006809 280
18 3300046522 Ga0495643_0013936 Ga0495643_0013936_2745_3614 281
19 3300046522 Ga0495643_0017918 Ga0495643_0017918_1312_2181 281
20 3300046692 Ga0495671_0041911 Ga0495671_0041911_670_1539 281
21 3300046694 Ga0495649_0057105 Ga0495649_0057105_196_1065 281
22 3300050493 nmdc:mga0k408_13143_c1 nmdc:mga0k408_13143_c1_39_899 282
23 3300045049 Ga0466959_0135357 Ga0466959_0135357_588_1439 283
24 iso_pu_bacteria 3007252601 3007256378 284
25 iso_pu_bacteria 3007315729 3007319404 284
26 3300038443 Ga0395901_0663565 Ga0395901_0663565_33_890 285
27 3300046691 Ga0495670_0063760 Ga0495670_0063760_981_1838 285
28 iso_pu_bacteria 2808606373 2808907178 285
29 iso_pu_bacteria 2842805378 2842805523 285
30 iso_pu_bacteria 651053060 651176781 285
31 3300005547 Ga0070693_100030673 Ga0070693_1000306733 287
32 3300027312 Ga0209371_1002401 Ga0209371_10024016 288
33 3300030500 Ga0268256_1002137 Ga0268256_10021378 288
34 3300006042 Ga0075368_10052551 Ga0075368_100525512 289
35 3300006051 Ga0075364_10241356 Ga0075364_102413562 289
36 3300013104 Ga0157370_10009913 Ga0157370_1000991312 289
37 3300044712 Ga0453684_0003037 Ga0453684_0003037_19371_20252 291
38 3300045051 Ga0451576_0000325 Ga0451576_0000325_24122_25003 291
39 3300049776 Ga0501280_003301 Ga0501280_003301_546_1427 291
40 iso_pu_bacteria 2989392574 2989393514 291
41 3300005329 Ga0070683_100110531 Ga0070683_1001105312 292
42 3300005471 Ga0070698_100357184 Ga0070698_1003571842 292
43 3300005547 Ga0070693_100045122 Ga0070693_1000451222 292
44 3300006871 Ga0075434_100303159 Ga0075434_1003031592 292
45 3300007076 Ga0075435_100245874 Ga0075435_1002458741 292
46 3300009551 Ga0105238_10050112 Ga0105238_100501123 292
47 3300026078 Ga0207702_10029243 Ga0207702_100292433 292
48 3300027364 Ga0209967_1001999 Ga0209967_10019992 292
49 3300027462 Ga0210000_1000453 Ga0210000_10004533 292
50 3300027471 Ga0209995_1005769 Ga0209995_10057692 292
51 3300027614 Ga0209970_1005907 Ga0209970_10059073 292
52 3300027665 Ga0209983_1021243 Ga0209983_10212432 292
53 3300027682 Ga0209971_1014677 Ga0209971_10146772 292
54 3300027876 Ga0209974_10006355 Ga0209974_100063552 292
55 3300042876 Ga0451577_0000527 Ga0451577_0000527_50189_51070 292
56 3300044712 Ga0453684_0000107 Ga0453684_0000107_12644_13525 292
57 3300044712 Ga0453684_0003130 Ga0453684_0003130_7983_8870 292
58 3300045051 Ga0451576_0092791 Ga0451576_0092791_885_1775 292
59 3300049572 Ga0501036_0006700 Ga0501036_0006700_2913_3803 292
60 3300049573 Ga0501037_0003283 Ga0501037_0003283_3070_3960 292
61 3300049575 Ga0501039_0000283 Ga0501039_0000283_17689_18579 292
62 3300049576 Ga0501040_0012451 Ga0501040_0012451_4106_4996 292
63 3300049579 Ga0501043_0097550 Ga0501043_0097550_1397_2287 292
64 3300049587 Ga0501071_0009066 Ga0501071_0009066_1072_1962 292
65 3300049592 Ga0501076_0000603 Ga0501076_0000603_12947_13837 292
66 3300049593 Ga0501077_0097183 Ga0501077_0097183_226_1116 292
67 3300049741 Ga0501079_0000776 Ga0501079_0000776_12235_13125 292
68 3300049742 Ga0501080_0007320 Ga0501080_0007320_3793_4683 292
69 3300049743 Ga0501081_0000610 Ga0501081_0000610_12941_13831 292
70 3300049744 Ga0501083_0102967 Ga0501083_0102967_305_1195 292
71 3300060353 Ga0501082_0000944 Ga0501082_0000944_11696_12586 292
72 3300005295 Ga0065707_10113521 Ga0065707_101135212 293
73 3300005545 Ga0070695_100131676 Ga0070695_1001316762 293
74 3300006844 Ga0075428_100002361 Ga0075428_10000236116 293
75 3300006880 Ga0075429_100016430 Ga0075429_1000164301 293
76 3300009094 Ga0111539_10002093 Ga0111539_1000209316 293
77 3300027907 Ga0207428_10002740 Ga0207428_100027407 293
78 3300036647 Ga0316582_0280702 Ga0316582_0280702_48_935 293
79 3300042876 Ga0451577_0000587 Ga0451577_0000587_36401_37297 293
80 3300044712 Ga0453684_0002450 Ga0453684_0002450_403_1299 293
81 3300044712 Ga0453684_0034693 Ga0453684_0034693_5941_6831 293
82 3300044712 Ga0453684_0053717 Ga0453684_0053717_3906_4802 293
83 3300044712 Ga0453684_0814936 Ga0453684_0814936_24_920 293
84 3300045051 Ga0451576_0002559 Ga0451576_0002559_19705_20589 293
85 3300049571 Ga0501034_0010412 Ga0501034_0010412_3512_4399 293
86 3300049585 Ga0501069_0029393 Ga0501069_0029393_1322_2215 293
87 3300049586 Ga0501070_0142183 Ga0501070_0142183_969_1862 293
88 3300049742 Ga0501080_0194747 Ga0501080_0194747_23_916 293
89 3300050508 nmdc:mga09592_4923_c1 nmdc:mga09592_4923_c1_9883_10776 293
90 3300050511 nmdc:mga08y16_7893_c1 nmdc:mga08y16_7893_c1_4836_5729 293
91 iso_pu_bacteria 2600255292 2601670344 293
92 iso_pu_bacteria 2643221645 2644249443 293
93 iso_pu_bacteria 2643221664 2644359546 293
94 iso_pu_bacteria 2738541280 2738740860 293
95 iso_pu_bacteria 2738541300 2738845181 293
96 iso_pu_bacteria 2738543018 2739274776 293
97 iso_pu_bacteria 2738543030 2739343820 293
98 iso_pu_bacteria 2842711865 2842713755 293
99 iso_pu_bacteria 2857547612 2857548320 293
100 iso_pu_bacteria 2857558681 2857562277 293
101 iso_pu_bacteria 2885080285 2885083539 293
102 iso_pu_bacteria 2904424332 2904429800 293
103 iso_pu_bacteria 2932410948 2932412920 293
104 iso_pu_bacteria 2932416698 2932420435 293
105 3300005290 Ga0065712_10110431 Ga0065712_101104312 294
106 3300005327 Ga0070658_10076858 Ga0070658_100768582 294
107 3300005329 Ga0070683_100002543 Ga0070683_10000254314 294
108 3300005331 Ga0070670_100002942 Ga0070670_1000029422 294
109 3300005333 Ga0070677_10018795 Ga0070677_100187953 294
110 3300005335 Ga0070666_10026807 Ga0070666_100268072 294
111 3300005337 Ga0070682_100003713 Ga0070682_1000037132 294
112 3300005338 Ga0068868_100000732 Ga0068868_1000007325 294
113 3300005343 Ga0070687_100000375 Ga0070687_1000003752 294
114 3300005344 Ga0070661_100072288 Ga0070661_1000722881 294
115 3300005345 Ga0070692_10200308 Ga0070692_102003082 294
116 3300005354 Ga0070675_100000909 Ga0070675_1000009092 294
117 3300005355 Ga0070671_100000836 Ga0070671_10000083618 294
118 3300005364 Ga0070673_100000415 Ga0070673_1000004154 294
119 3300005367 Ga0070667_100032155 Ga0070667_1000321552 294
120 3300005437 Ga0070710_10088524 Ga0070710_100885242 294
121 3300005444 Ga0070694_100000516 Ga0070694_10000051613 294
122 3300005444 Ga0070694_100023548 Ga0070694_1000235481 294
123 3300005455 Ga0070663_100039213 Ga0070663_1000392133 294
124 3300005456 Ga0070678_100000308 Ga0070678_1000003085 294
125 3300005457 Ga0070662_100094477 Ga0070662_1000944772 294
126 3300005459 Ga0068867_100055143 Ga0068867_1000551433 294
127 3300005543 Ga0070672_100000186 Ga0070672_10000018614 294
128 3300005549 Ga0070704_100000018 Ga0070704_10000001819 294
129 3300005578 Ga0068854_100000468 Ga0068854_10000046819 294
130 3300005616 Ga0068852_100000221 Ga0068852_10000022118 294
131 3300005616 Ga0068852_100540258 Ga0068852_1005402582 294
132 3300005618 Ga0068864_100053179 Ga0068864_1000531793 294
133 3300005718 Ga0068866_10203398 Ga0068866_102033981 294
134 3300005719 Ga0068861_100001180 Ga0068861_1000011803 294
135 3300005841 Ga0068863_100300494 Ga0068863_1003004942 294
136 3300005842 Ga0068858_100003083 Ga0068858_1000030833 294
137 3300005843 Ga0068860_100001150 Ga0068860_10000115015 294
138 3300006173 Ga0070716_100070041 Ga0070716_1000700412 294
139 3300006237 Ga0097621_100000202 Ga0097621_10000020225 294
140 3300006358 Ga0068871_100000840 Ga0068871_1000008402 294
141 3300006881 Ga0068865_100000995 Ga0068865_1000009953 294
142 3300006914 Ga0075436_100019561 Ga0075436_1000195614 294
143 3300009098 Ga0105245_10105175 Ga0105245_101051754 294
144 3300009147 Ga0114129_10625744 Ga0114129_106257442 294
145 3300009148 Ga0105243_10554076 Ga0105243_105540761 294
146 3300009176 Ga0105242_10001129 Ga0105242_1000112918 294
147 3300009176 Ga0105242_10016961 Ga0105242_100169617 294
148 3300013297 Ga0157378_10002410 Ga0157378_1000241016 294
149 3300013297 Ga0157378_10036498 Ga0157378_100364983 294
150 3300013306 Ga0163162_10003271 Ga0163162_1000327113 294
151 3300013308 Ga0157375_10007942 Ga0157375_100079426 294
152 3300014745 Ga0157377_10122419 Ga0157377_101224191 294
153 3300014969 Ga0157376_10004021 Ga0157376_100040213 294
154 3300025321 Ga0207656_10000761 Ga0207656_1000076110 294
155 3300025885 Ga0207653_10008321 Ga0207653_100083212 294
156 3300025893 Ga0207682_10003314 Ga0207682_100033146 294
157 3300025899 Ga0207642_10002367 Ga0207642_100023676 294
158 3300025899 Ga0207642_10124604 Ga0207642_101246041 294
159 3300025917 Ga0207660_10008827 Ga0207660_100088273 294
160 3300025925 Ga0207650_10001199 Ga0207650_1000119917 294
161 3300025931 Ga0207644_10000365 Ga0207644_1000036510 294
162 3300025933 Ga0207706_10081840 Ga0207706_100818402 294
163 3300025935 Ga0207709_10000662 Ga0207709_100006625 294
164 3300025936 Ga0207670_10007832 Ga0207670_100078322 294
165 3300025938 Ga0207704_10000679 Ga0207704_1000067917 294
166 3300025939 Ga0207665_10247706 Ga0207665_102477062 294
167 3300025940 Ga0207691_10000276 Ga0207691_1000027627 294
168 3300025942 Ga0207689_10327404 Ga0207689_103274041 294
169 3300025944 Ga0207661_10138369 Ga0207661_101383691 294
170 3300026023 Ga0207677_10010022 Ga0207677_100100221 294
171 3300026035 Ga0207703_10029929 Ga0207703_100299293 294
172 3300026041 Ga0207639_10028856 Ga0207639_100288565 294
173 3300026089 Ga0207648_10044715 Ga0207648_100447153 294
174 3300026118 Ga0207675_100002627 Ga0207675_10000262715 294
175 3300026121 Ga0207683_10001296 Ga0207683_100012965 294
176 3300026142 Ga0207698_10000451 Ga0207698_1000045117 294
177 3300028379 Ga0268266_10200785 Ga0268266_102007852 294
178 3300028381 Ga0268264_10001359 Ga0268264_1000135913 294
179 3300031665 Ga0316575_10003949 Ga0316575_100039493 294
180 3300031691 Ga0316579_10018724 Ga0316579_100187243 294
181 3300031728 Ga0316578_10151188 Ga0316578_101511882 294
182 3300032133 Ga0316583_10038198 Ga0316583_100381982 294
183 3300035117 Ga0373953_0030268 Ga0373953_0030268_133_1017 294
184 3300035118 Ga0373954_0044214 Ga0373954_0044214_847_1731 294
185 3300035172 Ga0373955_0024236 Ga0373955_0024236_942_1826 294
186 3300035410 Ga0373924_0007425 Ga0373924_0007425_2927_3811 294
187 3300035724 Ga0373933_0005227 Ga0373933_0005227_1736_2620 294
188 3300036401 Ga0373937_0056523 Ga0373937_0056523_1925_2809 294
189 3300036401 Ga0373937_0215897 Ga0373937_0215897_726_1613 294
190 3300036647 Ga0316582_0044737 Ga0316582_0044737_1866_2759 294
191 3300046454 Ga0495592_0006738 Ga0495592_0006738_3540_4424 294
192 3300046511 Ga0495608_0000970 Ga0495608_0000970_15568_16452 294
193 3300046514 Ga0495618_0007057 Ga0495618_0007057_4186_5070 294
194 3300046516 Ga0495628_0081330 Ga0495628_0081330_1440_2324 294
195 3300046517 Ga0495630_0012748 Ga0495630_0012748_4067_4951 294
196 3300046529 Ga0495652_0096947 Ga0495652_0096947_1325_2209 294
197 3300046533 Ga0495640_0019150 Ga0495640_0019150_193_1077 294
198 3300046535 Ga0495586_0007641 Ga0495586_0007641_4138_5022 294
199 3300046539 Ga0495621_0072441 Ga0495621_0072441_129_1013 294
200 3300046559 Ga0495667_0000672 Ga0495667_0000672_3849_4733 294
201 3300046559 Ga0495667_0070613 Ga0495667_0070613_432_1316 294
202 3300046642 Ga0495634_0001130 Ga0495634_0001130_7087_7971 294
203 3300046679 Ga0495623_0124209 Ga0495623_0124209_348_1232 294
204 3300046683 Ga0495658_0035167 Ga0495658_0035167_1076_1960 294
205 3300046689 Ga0495613_0007452 Ga0495613_0007452_3195_4079 294
206 3300046690 Ga0495624_0050899 Ga0495624_0050899_848_1732 294
207 3300047317 Ga0495604_0066984 Ga0495604_0066984_848_1732 294
208 3300047322 Ga0495680_0000812 Ga0495680_0000812_13538_14422 294
209 3300047322 Ga0495680_0056924 Ga0495680_0056924_1761_2645 294
210 3300048904 Ga0496101_0231646 Ga0496101_0231646_431_1321 294
211 3300048909 Ga0496106_0440922 Ga0496106_0440922_117_1007 294
212 3300048911 Ga0496108_0099642 Ga0496108_0099642_1414_2304 294
213 3300048917 Ga0496114_0025774 Ga0496114_0025774_2917_3807 294
214 3300053077 Ga0495601_0003433 Ga0495601_0003433_4383_5267 294
215 3300053085 Ga0495619_0159829 Ga0495619_0159829_74_958 294
216 iso_pu_bacteria 2511231003 2511249150 294
217 iso_pu_bacteria 2511231026 2511387184 294
218 iso_pu_bacteria 2521172590 2521556693 294
219 iso_pu_bacteria 2548876994 2550692428 294
220 iso_pu_bacteria 2551306416 2553006714 294
221 iso_pu_bacteria 2643221554 2643790930 294
222 iso_pu_bacteria 2643221556 2643797590 294
223 iso_pu_bacteria 2643221603 2644026806 294
224 iso_pu_bacteria 2643221638 2644214922 294
225 iso_pu_bacteria 2643221684 2644470628 294
226 iso_pu_bacteria 2738541297 2738825734 294
227 iso_pu_bacteria 2738541357 2739149531 294
228 iso_pu_bacteria 2738543003 2739191450 294
229 iso_pu_bacteria 2738543026 2739317927 294
230 iso_pu_bacteria 2738543029 2739336168 294
231 iso_pu_bacteria 2765235838 2765567875 294
232 iso_pu_bacteria 2808606386 2808982758 294
233 iso_pu_bacteria 2808606415 2809130259 294
234 iso_pu_bacteria 2808606418 2809144086 294
235 iso_pu_bacteria 2808606419 2809150264 294
236 iso_pu_bacteria 2818991436 2819545321 294
237 iso_pu_bacteria 2818991445 2819592571 294
238 iso_pu_bacteria 2818991449 2819618059 294
239 iso_pu_bacteria 2821131069 2821134361 294
240 iso_pu_bacteria 2839094727 2839097838 294
241 iso_pu_bacteria 2852618963 2852621513 294
242 iso_pu_bacteria 2857553236 2857554891 294
243 iso_pu_bacteria 2857564685 2857566129 294
244 iso_pu_bacteria 2884811622 2884812358 294
245 iso_pu_bacteria 2884836552 2884838940 294
246 iso_pu_bacteria 2884852848 2884855232 294
247 iso_pu_bacteria 2896154374 2896156099 294
248 iso_pu_bacteria 2904439833 2904441924 294
249 iso_pu_bacteria 2904530477 2904533221 294
250 iso_pu_bacteria 2904584206 2904586168 294
251 iso_pu_bacteria 2904589729 2904592018 294
252 iso_pu_bacteria 2904601388 2904601820 294
253 iso_pu_bacteria 2919046199 2919049464 294
254 iso_pu_bacteria 2919079590 2919083853 294
255 iso_pu_bacteria 2919476304 2919479022 294
256 iso_pu_bacteria 2923510766 2923515286 294
257 iso_pu_bacteria 2928130867 2928132243 294
258 iso_pu_bacteria 8047673197 8047678884 294
259 3300013307 Ga0157372_10047926 Ga0157372_100479262 295
260 3300025944 Ga0207661_10209893 Ga0207661_102098932 295
261 3300036647 Ga0316582_0342472 Ga0316582_0342472_15_917 295
262 3300036712 Ga0316584_0009596 Ga0316584_0009596_3375_4277 295
263 3300038726 Ga0400490_19738 Ga0400490_19738_1550_2506 295
264 3300042876 Ga0451577_0002821 Ga0451577_0002821_18434_19324 295
265 3300045051 Ga0451576_0003298 Ga0451576_0003298_11344_12234 295
266 3300006173 Ga0070716_100063273 Ga0070716_1000632732 296
267 3300025939 Ga0207665_10125949 Ga0207665_101259492 296
268 3300035691 Ga0373931_0237796 Ga0373931_0237796_41_946 296
269 3300045051 Ga0451576_0109414 Ga0451576_0109414_190_1089 296
270 3300046454 Ga0495592_0047786 Ga0495592_0047786_592_1482 296
271 3300046459 Ga0495629_0044367 Ga0495629_0044367_970_1860 296
272 3300046462 Ga0495651_0207606 Ga0495651_0207606_141_1031 296
273 3300046463 Ga0495653_0048598 Ga0495653_0048598_466_1356 296
274 3300046477 Ga0495664_0012870 Ga0495664_0012870_2020_2910 296
275 3300046511 Ga0495608_0003690 Ga0495608_0003690_1603_2493 296
276 3300046514 Ga0495618_0026265 Ga0495618_0026265_897_1787 296
277 3300046516 Ga0495628_0042112 Ga0495628_0042112_1603_2493 296
278 3300046526 Ga0495666_0000409 Ga0495666_0000409_2965_3855 296
279 3300046529 Ga0495652_0064033 Ga0495652_0064033_583_1473 296
280 3300046531 Ga0495665_0029852 Ga0495665_0029852_1243_2133 296
281 3300046533 Ga0495640_0000613 Ga0495640_0000613_17513_18403 296
282 3300046559 Ga0495667_0040824 Ga0495667_0040824_1226_2116 296
283 3300046642 Ga0495634_0024726 Ga0495634_0024726_1071_1961 296
284 3300046663 Ga0495635_0007345 Ga0495635_0007345_1061_1951 296
285 3300046679 Ga0495623_0039900 Ga0495623_0039900_1433_2323 296
286 3300046690 Ga0495624_0053059 Ga0495624_0053059_1596_2486 296
287 3300047315 Ga0495581_0008180 Ga0495581_0008180_921_1811 296
288 3300047319 Ga0495674_0072060 Ga0495674_0072060_1269_2159 296
289 3300047444 Ga0495675_0010465 Ga0495675_0010465_3700_4590 296
290 3300047673 Ga0495593_0010066 Ga0495593_0010066_3700_4590 296
291 3300048089 Ga0495614_0002564 Ga0495614_0002564_2644_3534 296
292 3300002738 JGI25154J39366_1000269 JGI25154J39366_10002693 297
293 3300002774 JGI25150J39212_1000958 JGI25150J39212_10009585 297
294 3300003215 JGI25153J46596_10061407 JGI25153J46596_100614071 297
295 3300003771 Ga0055526_1000097 Ga0055526_100009775 297
296 3300003771 Ga0055526_1000130 Ga0055526_100013065 297
297 3300005288 Ga0065714_10113503 Ga0065714_101135032 297
298 3300006177 Ga0075362_10147164 Ga0075362_101471641 297
299 3300009036 Ga0105244_10013324 Ga0105244_100133245 297
300 3300009036 Ga0105244_10020166 Ga0105244_100201664 297
301 3300014497 Ga0182008_10001399 Ga0182008_1000139910 297
302 3300015261 Ga0182006_1000010 Ga0182006_1000010132 297
303 3300015262 Ga0182007_10000030 Ga0182007_10000030138 297
304 3300015265 Ga0182005_1000009 Ga0182005_1000009252 297
305 3300017792 Ga0163161_10038295 Ga0163161_100382952 297
306 3300021361 Ga0213872_10000117 Ga0213872_1000011717 297
307 3300021361 Ga0213872_10001659 Ga0213872_100016592 297
308 3300021361 Ga0213872_10076759 Ga0213872_100767592 297
309 3300025245 Ga0207425_1001644 Ga0207425_100164411 297
310 3300025246 Ga0209646_1000104 Ga0209646_100010413 297
311 3300025294 Ga0209025_1015265 Ga0209025_10152653 297
312 3300025295 Ga0209564_1000006 Ga0209564_1000006716 297
313 3300025295 Ga0209564_1000026 Ga0209564_1000026186 297
314 3300025297 Ga0209758_1000314 Ga0209758_100031482 297
315 3300025728 Ga0207655_1000781 Ga0207655_10007813 297
316 3300025728 Ga0207655_1024227 Ga0207655_10242272 297
317 3300031239 Ga0265328_10000038 Ga0265328_1000003871 297
318 3300031239 Ga0265328_10003136 Ga0265328_100031365 297
319 3300031250 Ga0265331_10000138 Ga0265331_1000013873 297
320 3300031250 Ga0265331_10007132 Ga0265331_100071322 297
321 3300031251 Ga0265327_10000299 Ga0265327_1000029921 297
322 3300031251 Ga0265327_10000596 Ga0265327_100005964 297
323 3300031251 Ga0265327_10001822 Ga0265327_1000182211 297
324 3300031251 Ga0265327_10014184 Ga0265327_100141846 297
325 3300031251 Ga0265327_10072507 Ga0265327_100725072 297
326 3300039447 Ga0436361_0108899 Ga0436361_0108899_34808_35701 297
327 3300039447 Ga0436361_0487158 Ga0436361_0487158_9224_10117 297
328 3300039447 Ga0436361_0527946 Ga0436361_0527946_65_958 297
329 3300042876 Ga0451577_0002228 Ga0451577_0002228_14874_15770 297
330 3300046452 Ga0495617_001777 Ga0495617_001777_719_1612 297
331 3300046457 Ga0495590_0000023 Ga0495590_0000023_131327_132220 297
332 3300046460 Ga0495638_0150819 Ga0495638_0150819_133_1026 297
333 3300046471 Ga0495650_0000263 Ga0495650_0000263_35690_36583 297
334 3300046471 Ga0495650_0001177 Ga0495650_0001177_626_1519 297
335 3300046471 Ga0495650_0001570 Ga0495650_0001570_12982_13875 297
336 3300046474 Ga0495605_0000005 Ga0495605_0000005_318372_319265 297
337 3300046491 Ga0495584_0021406 Ga0495584_0021406_1824_2717 297
338 3300046507 Ga0495606_0000044 Ga0495606_0000044_154989_155882 297
339 3300046507 Ga0495606_0004898 Ga0495606_0004898_10460_11353 297
340 3300046507 Ga0495606_0008217 Ga0495606_0008217_7637_8530 297
341 3300046507 Ga0495606_0022663 Ga0495606_0022663_3390_4283 297
342 3300046512 Ga0495610_0009390 Ga0495610_0009390_4783_5676 297
343 3300046512 Ga0495610_0011329 Ga0495610_0011329_3923_4816 297
344 3300046513 Ga0495616_0026767 Ga0495616_0026767_1464_2357 297
345 3300046520 Ga0495637_0005037 Ga0495637_0005037_948_1841 297
346 3300046522 Ga0495643_0000250 Ga0495643_0000250_76226_77119 297
347 3300046522 Ga0495643_0000349 Ga0495643_0000349_1787_2680 297
348 3300046524 Ga0495648_0000008 Ga0495648_0000008_66493_67386 297
349 3300046524 Ga0495648_0022493 Ga0495648_0022493_628_1521 297
350 3300046538 Ga0495609_0005567 Ga0495609_0005567_395_1288 297
351 3300046538 Ga0495609_0035191 Ga0495609_0035191_228_1121 297
352 3300046557 Ga0495622_0000027 Ga0495622_0000027_71434_72327 297
353 3300046557 Ga0495622_0000392 Ga0495622_0000392_563_1456 297
354 3300046558 Ga0495633_0000226 Ga0495633_0000226_18286_19179 297
355 3300046558 Ga0495633_0000257 Ga0495633_0000257_59894_60787 297
356 3300046558 Ga0495633_0001596 Ga0495633_0001596_15723_16616 297
357 3300046558 Ga0495633_0036476 Ga0495633_0036476_828_1721 297
358 3300046616 Ga0495668_0000147 Ga0495668_0000147_30848_31741 297
359 3300046616 Ga0495668_0000347 Ga0495668_0000347_49582_50475 297
360 3300046660 Ga0495625_0000378 Ga0495625_0000378_66463_67356 297
361 3300046660 Ga0495625_0005512 Ga0495625_0005512_4139_5032 297
362 3300046660 Ga0495625_0006440 Ga0495625_0006440_1022_1915 297
363 3300046660 Ga0495625_0152866 Ga0495625_0152866_506_1399 297
364 3300046664 Ga0495659_0000146 Ga0495659_0000146_530_1423 297
365 3300046692 Ga0495671_0000203 Ga0495671_0000203_51066_51959 297
366 3300046694 Ga0495649_0020292 Ga0495649_0020292_2063_2956 297
367 3300046694 Ga0495649_0045909 Ga0495649_0045909_720_1613 297
368 3300046810 Ga0495660_0001117 Ga0495660_0001117_17444_18337 297
369 3300047318 Ga0495636_0008508 Ga0495636_0008508_2588_3481 297
370 3300047320 Ga0495672_0000035 Ga0495672_0000035_185749_186642 297
371 3300047320 Ga0495672_0000363 Ga0495672_0000363_56541_57434 297
372 3300047443 Ga0495687_018142 Ga0495687_018142_1095_1988 297
373 3300047445 Ga0495677_0007072 Ga0495677_0007072_2064_2957 297
374 3300047447 Ga0495685_009748 Ga0495685_009748_774_1667 297
375 3300047469 Ga0495673_0000034 Ga0495673_0000034_21890_22783 297
376 3300047470 Ga0495681_0027146 Ga0495681_0027146_1008_1901 297
377 3300048906 Ga0496103_0001686 Ga0496103_0001686_598_1491 297
378 3300048914 Ga0496111_0184689 Ga0496111_0184689_187_1080 297
379 3300048919 Ga0496116_0045394 Ga0496116_0045394_861_1754 297
380 3300048919 Ga0496116_0048597 Ga0496116_0048597_1923_2816 297
381 3300048920 Ga0496117_0000010 Ga0496117_0000010_329565_330458 297
382 3300048921 Ga0496118_0000009 Ga0496118_0000009_281497_282390 297
383 3300048924 Ga0496121_0006620 Ga0496121_0006620_12788_13681 297
384 3300048926 Ga0496123_0004593 Ga0496123_0004593_8085_8978 297
385 3300048927 Ga0496124_0219768 Ga0496124_0219768_338_1231 297
386 3300048927 Ga0496124_0316752 Ga0496124_0316752_53_946 297
387 3300048928 Ga0496125_0146323 Ga0496125_0146323_528_1421 297
388 3300049128 Ga0501308_006927 Ga0501308_006927_135_1028 297
389 3300049459 Ga0495678_038547 Ga0495678_038547_414_1307 297
390 3300049460 Ga0495682_0021545 Ga0495682_0021545_111_1004 297
391 3300049766 Ga0501269_003128 Ga0501269_003128_625_1518 297
392 3300050489 nmdc:mga03683_51223_c1 nmdc:mga03683_51223_c1_558_1451 297
393 3300002737 JGI25162J39368_1000284 JGI25162J39368_100028411 298
394 3300002739 JGI25158J39367_1004193 JGI25158J39367_10041933 298
395 3300002987 JGI25159J45721_1005430 JGI25159J45721_10054302 298
396 3300003214 JGI25165J46597_1000384 JGI25165J46597_100038411 298
397 3300003215 JGI25153J46596_10013454 JGI25153J46596_100134543 298
398 3300003322 rootL2_10151808 rootL2_101518081 298
399 3300003322 rootL2_10211541 rootL2_102115411 298
400 3300003574 Ga0007410J51695_1033175 Ga0007410J51695_10331754 298
401 3300003575 Ga0007409J51694_1011722 Ga0007409J51694_10117222 298
402 3300003577 Ga0007416J51690_1019391 Ga0007416J51690_10193914 298
403 3300003693 Ga0032354_1027536 Ga0032354_10275364 298
404 3300003751 Ga0055538_1000117 Ga0055538_100011739 298
405 3300003751 Ga0055538_1000149 Ga0055538_100014911 298
406 3300003752 Ga0055539_1000163 Ga0055539_100016339 298
407 3300003752 Ga0055539_1000199 Ga0055539_100019938 298
408 3300003756 Ga0055533_1000166 Ga0055533_100016639 298
409 3300003756 Ga0055533_1000200 Ga0055533_100020011 298
410 3300003759 Ga0055525_1000009 Ga0055525_1000009513 298
411 3300003759 Ga0055525_1000227 Ga0055525_100022739 298
412 3300003759 Ga0055525_1000276 Ga0055525_100027638 298
413 3300003762 Ga0055542_1007816 Ga0055542_10078163 298
414 3300003763 Ga0055529_1000283 Ga0055529_100028326 298
415 3300003771 Ga0055526_1000369 Ga0055526_10003692 298
416 3300003771 Ga0055526_1005622 Ga0055526_10056222 298
417 3300003773 Ga0055537_1000081 Ga0055537_100008165 298
418 3300003775 Ga0055524_1011808 Ga0055524_10118082 298
419 3300003775 Ga0055524_1021243 Ga0055524_10212432 298
420 3300003784 Ga0055534_1000316 Ga0055534_100031630 298
421 3300003790 Ga0055528_1000412 Ga0055528_10004123 298
422 3300003790 Ga0055528_1030916 Ga0055528_10309162 298
423 3300003841 Ga0055541_1000109 Ga0055541_100010924 298
424 3300003841 Ga0055541_1000130 Ga0055541_100013011 298
425 3300004625 Ga0055543_1015810 Ga0055543_10158102 298
426 3300005262 Ga0065165_1000298 Ga0065165_100029862 298
427 3300005289 Ga0065704_10154170 Ga0065704_101541701 298
428 3300005327 Ga0070658_10217964 Ga0070658_102179642 298
429 3300005339 Ga0070660_100004159 Ga0070660_1000041592 298
430 3300005344 Ga0070661_100032092 Ga0070661_1000320923 298
431 3300005344 Ga0070661_100275727 Ga0070661_1002757272 298
432 3300005366 Ga0070659_100065478 Ga0070659_1000654783 298
433 3300005366 Ga0070659_100084873 Ga0070659_1000848732 298
434 3300005457 Ga0070662_100116959 Ga0070662_1001169593 298
435 3300005563 Ga0068855_100006550 Ga0068855_1000065502 298
436 3300005563 Ga0068855_100356438 Ga0068855_1003564382 298
437 3300005578 Ga0068854_100153867 Ga0068854_1001538671 298
438 3300006946 Ga0079104_1006538 Ga0079104_10065382 298
439 3300006946 Ga0079104_1011217 Ga0079104_10112173 298
440 3300009036 Ga0105244_10121984 Ga0105244_101219842 298
441 3300009098 Ga0105245_10118126 Ga0105245_101181263 298
442 3300009176 Ga0105242_10043759 Ga0105242_100437592 298
443 3300009545 Ga0105237_10120736 Ga0105237_101207363 298
444 3300009545 Ga0105237_10464231 Ga0105237_104642312 298
445 3300009551 Ga0105238_10000505 Ga0105238_1000050532 298
446 3300013100 Ga0157373_10156712 Ga0157373_101567121 298
447 3300013102 Ga0157371_10000399 Ga0157371_1000039915 298
448 3300014497 Ga0182008_10041786 Ga0182008_100417862 298
449 3300015261 Ga0182006_1000055 Ga0182006_100005538 298
450 3300015262 Ga0182007_10012398 Ga0182007_100123982 298
451 3300015265 Ga0182005_1000003 Ga0182005_1000003247 298
452 3300015265 Ga0182005_1000402 Ga0182005_100040213 298
453 3300021361 Ga0213872_10000205 Ga0213872_1000020544 298
454 3300025206 Ga0209435_100004 Ga0209435_100004204 298
455 3300025206 Ga0209435_100214 Ga0209435_1002141 298
456 3300025207 Ga0209760_101321 Ga0209760_1013213 298
457 3300025224 Ga0209784_100153 Ga0209784_10015326 298
458 3300025224 Ga0209784_100191 Ga0209784_10019112 298
459 3300025225 Ga0209566_100195 Ga0209566_10019526 298
460 3300025225 Ga0209566_100252 Ga0209566_10025215 298
461 3300025226 Ga0209674_100069 Ga0209674_10006912 298
462 3300025226 Ga0209674_100198 Ga0209674_10019826 298
463 3300025229 Ga0209147_100011 Ga0209147_100011302 298
464 3300025230 Ga0209563_100015 Ga0209563_100015629 298
465 3300025230 Ga0209563_100157 Ga0209563_10015726 298
466 3300025230 Ga0209563_100167 Ga0209563_10016711 298
467 3300025231 Ga0207427_100317 Ga0207427_1003174 298
468 3300025233 Ga0209437_100084 Ga0209437_100084145 298
469 3300025233 Ga0209437_100091 Ga0209437_10009111 298
470 3300025233 Ga0209437_109387 Ga0209437_1093872 298
471 3300025242 Ga0209258_100560 Ga0209258_10056010 298
472 3300025245 Ga0207425_1000006 Ga0207425_1000006500 298
473 3300025245 Ga0207425_1000177 Ga0207425_100017741 298
474 3300025246 Ga0209646_1000032 Ga0209646_1000032158 298
475 3300025250 Ga0209026_1000062 Ga0209026_100006217 298
476 3300025250 Ga0209026_1001071 Ga0209026_10010712 298
477 3300025253 Ga0209677_100039 Ga0209677_10003912 298
478 3300025253 Ga0209677_100156 Ga0209677_10015626 298
479 3300025254 Ga0209148_1000272 Ga0209148_100027251 298
480 3300025254 Ga0209148_1009034 Ga0209148_10090343 298
481 3300025256 Ga0209759_1000054 Ga0209759_10000542 298
482 3300025258 Ga0209129_1000009 Ga0209129_1000009329 298
483 3300025261 Ga0209233_1000115 Ga0209233_100011511 298
484 3300025261 Ga0209233_1034668 Ga0209233_10346682 298
485 3300025263 Ga0209565_1000006 Ga0209565_1000006516 298
486 3300025263 Ga0209565_1001221 Ga0209565_100122111 298
487 3300025272 Ga0209455_1000063 Ga0209455_100006354 298
488 3300025273 Ga0209673_1000004 Ga0209673_1000004313 298
489 3300025284 Ga0209130_1000067 Ga0209130_1000067140 298
490 3300025291 Ga0209675_1000006 Ga0209675_1000006515 298
491 3300025291 Ga0209675_1003933 Ga0209675_10039337 298
492 3300025291 Ga0209675_1006468 Ga0209675_10064685 298
493 3300025295 Ga0209564_1000085 Ga0209564_1000085240 298
494 3300025295 Ga0209564_1000087 Ga0209564_100008795 298
495 3300025297 Ga0209758_1001155 Ga0209758_10011559 298
496 3300025298 Ga0209050_1000219 Ga0209050_100021949 298
497 3300025298 Ga0209050_1000816 Ga0209050_100081616 298
498 3300025298 Ga0209050_1029602 Ga0209050_10296022 298
499 3300025299 Ga0209256_1000037 Ga0209256_1000037157 298
500 3300025299 Ga0209256_1000191 Ga0209256_100019180 298
501 3300025299 Ga0209256_1002450 Ga0209256_10024502 298
502 3300025299 Ga0209256_1007152 Ga0209256_10071522 298
503 3300025302 Ga0207426_1004561 Ga0207426_10045611 298
504 3300025302 Ga0207426_1037312 Ga0207426_10373122 298
505 3300025304 Ga0209257_1000010 Ga0209257_1000010331 298
506 3300025909 Ga0207705_10003612 Ga0207705_100036126 298
507 3300025911 Ga0207654_10009376 Ga0207654_100093763 298
508 3300025913 Ga0207695_10003295 Ga0207695_1000329520 298
509 3300025913 Ga0207695_10078841 Ga0207695_100788413 298
510 3300025914 Ga0207671_10029222 Ga0207671_100292223 298
511 3300025919 Ga0207657_10028170 Ga0207657_100281705 298
512 3300025919 Ga0207657_10064383 Ga0207657_100643832 298
513 3300025919 Ga0207657_10336368 Ga0207657_103363682 298
514 3300025920 Ga0207649_10037291 Ga0207649_100372913 298
515 3300025924 Ga0207694_10000392 Ga0207694_1000039232 298
516 3300025924 Ga0207694_10060801 Ga0207694_100608013 298
517 3300025927 Ga0207687_10219246 Ga0207687_102192462 298
518 3300025932 Ga0207690_10046079 Ga0207690_100460792 298
519 3300025932 Ga0207690_10196722 Ga0207690_101967222 298
520 3300025933 Ga0207706_10228689 Ga0207706_102286892 298
521 3300025934 Ga0207686_10001803 Ga0207686_1000180314 298
522 3300025935 Ga0207709_10020122 Ga0207709_100201223 298
523 3300025942 Ga0207689_10187006 Ga0207689_101870062 298
524 3300025945 Ga0207679_10011415 Ga0207679_100114153 298
525 3300025949 Ga0207667_10000019 Ga0207667_10000019194 298
526 3300025949 Ga0207667_10000304 Ga0207667_1000030460 298
527 3300025949 Ga0207667_10014829 Ga0207667_100148296 298
528 3300026089 Ga0207648_10095259 Ga0207648_100952592 298
529 3300026116 Ga0207674_10063290 Ga0207674_100632904 298
530 3300026142 Ga0207698_10152971 Ga0207698_101529711 298
531 3300027111 Ga0209281_1004617 Ga0209281_10046173 298
532 3300031548 Ga0307408_100000180 Ga0307408_10000018049 298
533 3300031548 Ga0307408_100000533 Ga0307408_10000053333 298
534 3300031548 Ga0307408_100482095 Ga0307408_1004820951 298
535 3300032002 Ga0307416_100222234 Ga0307416_1002222342 298
536 3300037312 Ga0395899_0002578 Ga0395899_0002578_2299_3195 298
537 3300037312 Ga0395899_0010125 Ga0395899_0010125_6257_7153 298
538 3300037312 Ga0395899_0283124 Ga0395899_0283124_97_993 298
539 3300037312 Ga0395899_0283829 Ga0395899_0283829_168_1064 298
540 3300037418 Ga0395900_0000267 Ga0395900_0000267_78709_79605 298
541 3300037418 Ga0395900_0040547 Ga0395900_0040547_1005_1901 298
542 3300037418 Ga0395900_0045762 Ga0395900_0045762_2899_3795 298
543 3300037418 Ga0395900_0214321 Ga0395900_0214321_239_1135 298
544 3300037418 Ga0395900_0217458 Ga0395900_0217458_391_1287 298
545 3300037418 Ga0395900_0374663 Ga0395900_0374663_457_1353 298
546 3300037418 Ga0395900_0420226 Ga0395900_0420226_61_957 298
547 3300037466 Ga0395898_0123185 Ga0395898_0123185_634_1530 298
548 3300037466 Ga0395898_0347908 Ga0395898_0347908_124_1020 298
549 3300037471 Ga0395905_0000137 Ga0395905_0000137_75978_76874 298
550 3300037471 Ga0395905_0003859 Ga0395905_0003859_14858_15754 298
551 3300037471 Ga0395905_0009356 Ga0395905_0009356_2809_3705 298
552 3300037471 Ga0395905_0100043 Ga0395905_0100043_1543_2439 298
553 3300037471 Ga0395905_0245727 Ga0395905_0245727_704_1600 298
554 3300037471 Ga0395905_0273789 Ga0395905_0273789_404_1300 298
555 3300038443 Ga0395901_0004507 Ga0395901_0004507_2275_3171 298
556 3300038443 Ga0395901_0066463 Ga0395901_0066463_2170_3066 298
557 3300038443 Ga0395901_0083899 Ga0395901_0083899_282_1178 298
558 3300038443 Ga0395901_0726052 Ga0395901_0726052_60_956 298
559 3300039447 Ga0436361_0365472 Ga0436361_0365472_4731_5627 298
560 3300039447 Ga0436361_0421155 Ga0436361_0421155_9746_10642 298
561 3300042005 Ga0439448_0006541 Ga0439448_0006541_569_1465 298
562 3300042139 Ga0450904_001077 Ga0450904_001077_1902_2798 298
563 3300044656 Ga0466969_0048470 Ga0466969_0048470_878_1777 298
564 3300044683 Ga0466965_0229810 Ga0466965_0229810_37_933 298
565 3300044683 Ga0466965_0233089 Ga0466965_0233089_59_955 298
566 3300044684 Ga0466966_0001804 Ga0466966_0001804_9996_10892 298
567 3300044694 Ga0466963_0280581 Ga0466963_0280581_188_1084 298
568 3300044706 Ga0466964_0001091 Ga0466964_0001091_6170_7066 298
569 3300044706 Ga0466964_0037609 Ga0466964_0037609_413_1309 298
570 3300044735 Ga0466968_0005462 Ga0466968_0005462_409_1305 298
571 3300044735 Ga0466968_0016377 Ga0466968_0016377_1177_2073 298
572 3300044765 Ga0466970_0003911 Ga0466970_0003911_682_1578 298
573 3300044842 Ga0466957_0021820 Ga0466957_0021820_1179_2075 298
574 3300044842 Ga0466957_0064371 Ga0466957_0064371_275_1171 298
575 3300045976 Ga0466967_0009867 Ga0466967_0009867_5797_6693 298
576 3300045976 Ga0466967_0164786 Ga0466967_0164786_437_1333 298
577 3300046452 Ga0495617_000002 Ga0495617_000002_17320_18216 298
578 3300046452 Ga0495617_000053 Ga0495617_000053_69252_70148 298
579 3300046452 Ga0495617_000189 Ga0495617_000189_18023_18919 298
580 3300046453 Ga0495627_000065 Ga0495627_000065_42103_42999 298
581 3300046453 Ga0495627_000915 Ga0495627_000915_16662_17558 298
582 3300046453 Ga0495627_002699 Ga0495627_002699_343_1239 298
583 3300046454 Ga0495592_0011284 Ga0495592_0011284_696_1592 298
584 3300046455 Ga0495603_0020894 Ga0495603_0020894_2561_3457 298
585 3300046455 Ga0495603_0052336 Ga0495603_0052336_781_1677 298
586 3300046457 Ga0495590_0000423 Ga0495590_0000423_5465_6361 298
587 3300046457 Ga0495590_0007300 Ga0495590_0007300_98_994 298
588 3300046458 Ga0495591_000893 Ga0495591_000893_1491_2387 298
589 3300046459 Ga0495629_0008060 Ga0495629_0008060_2776_3672 298
590 3300046460 Ga0495638_0012727 Ga0495638_0012727_2829_3725 298
591 3300046460 Ga0495638_0025052 Ga0495638_0025052_955_1851 298
592 3300046462 Ga0495651_0017536 Ga0495651_0017536_2832_3728 298
593 3300046462 Ga0495651_0058119 Ga0495651_0058119_706_1602 298
594 3300046463 Ga0495653_0000007 Ga0495653_0000007_40388_41284 298
595 3300046463 Ga0495653_0034843 Ga0495653_0034843_961_1857 298
596 3300046463 Ga0495653_0043318 Ga0495653_0043318_1488_2384 298
597 3300046463 Ga0495653_0043630 Ga0495653_0043630_723_1619 298
598 3300046471 Ga0495650_0000056 Ga0495650_0000056_45421_46317 298
599 3300046471 Ga0495650_0000391 Ga0495650_0000391_13668_14564 298
600 3300046471 Ga0495650_0000513 Ga0495650_0000513_2443_3339 298
601 3300046471 Ga0495650_0003681 Ga0495650_0003681_2581_3477 298
602 3300046473 Ga0495582_0034143 Ga0495582_0034143_1310_2206 298
603 3300046474 Ga0495605_0000276 Ga0495605_0000276_42977_43873 298
604 3300046474 Ga0495605_0000463 Ga0495605_0000463_33399_34295 298
605 3300046474 Ga0495605_0003780 Ga0495605_0003780_780_1676 298
606 3300046474 Ga0495605_0015087 Ga0495605_0015087_236_1132 298
607 3300046474 Ga0495605_0024736 Ga0495605_0024736_526_1422 298
608 3300046474 Ga0495605_0078075 Ga0495605_0078075_459_1355 298
609 3300046491 Ga0495584_0000011 Ga0495584_0000011_187212_188108 298
610 3300046491 Ga0495584_0000407 Ga0495584_0000407_1379_2275 298
611 3300046491 Ga0495584_0011678 Ga0495584_0011678_3184_4080 298
612 3300046491 Ga0495584_0023014 Ga0495584_0023014_535_1431 298
613 3300046491 Ga0495584_0047462 Ga0495584_0047462_581_1477 298
614 3300046491 Ga0495584_0076907 Ga0495584_0076907_370_1266 298
615 3300046491 Ga0495584_0092902 Ga0495584_0092902_445_1341 298
616 3300046492 Ga0495585_0000106 Ga0495585_0000106_734_1630 298
617 3300046492 Ga0495585_0000231 Ga0495585_0000231_20067_20963 298
618 3300046492 Ga0495585_0000661 Ga0495585_0000661_22232_23128 298
619 3300046492 Ga0495585_0003484 Ga0495585_0003484_8827_9723 298
620 3300046492 Ga0495585_0008809 Ga0495585_0008809_839_1735 298
621 3300046492 Ga0495585_0008946 Ga0495585_0008946_605_1501 298
622 3300046492 Ga0495585_0018535 Ga0495585_0018535_2646_3542 298
623 3300046492 Ga0495585_0044513 Ga0495585_0044513_1358_2254 298
624 3300046492 Ga0495585_0044618 Ga0495585_0044618_1277_2173 298
625 3300046492 Ga0495585_0059809 Ga0495585_0059809_84_980 298
626 3300046492 Ga0495585_0067734 Ga0495585_0067734_569_1465 298
627 3300046492 Ga0495585_0086479 Ga0495585_0086479_475_1371 298
628 3300046499 Ga0495594_0020621 Ga0495594_0020621_1000_1896 298
629 3300046499 Ga0495594_0066322 Ga0495594_0066322_1001_1897 298
630 3300046499 Ga0495594_0129749 Ga0495594_0129749_300_1196 298
631 3300046499 Ga0495594_0132564 Ga0495594_0132564_135_1031 298
632 3300046499 Ga0495594_0177980 Ga0495594_0177980_107_1003 298
633 3300046500 Ga0495596_0000167 Ga0495596_0000167_8393_9289 298
634 3300046500 Ga0495596_0014205 Ga0495596_0014205_15_911 298
635 3300046500 Ga0495596_0015538 Ga0495596_0015538_2213_3109 298
636 3300046500 Ga0495596_0020140 Ga0495596_0020140_410_1306 298
637 3300046500 Ga0495596_0049083 Ga0495596_0049083_241_1137 298
638 3300046500 Ga0495596_0074882 Ga0495596_0074882_12_908 298
639 3300046501 Ga0495607_0004161 Ga0495607_0004161_1867_2763 298
640 3300046501 Ga0495607_0007201 Ga0495607_0007201_4117_5013 298
641 3300046501 Ga0495607_0008583 Ga0495607_0008583_368_1264 298
642 3300046501 Ga0495607_0045420 Ga0495607_0045420_1050_1946 298
643 3300046501 Ga0495607_0045876 Ga0495607_0045876_176_1072 298
644 3300046501 Ga0495607_0074160 Ga0495607_0074160_870_1766 298
645 3300046506 Ga0495583_0000004 Ga0495583_0000004_333487_334383 298
646 3300046506 Ga0495583_0000204 Ga0495583_0000204_62008_62904 298
647 3300046506 Ga0495583_0001039 Ga0495583_0001039_17362_18258 298
648 3300046506 Ga0495583_0001924 Ga0495583_0001924_16271_17167 298
649 3300046506 Ga0495583_0004914 Ga0495583_0004914_7897_8793 298
650 3300046506 Ga0495583_0009235 Ga0495583_0009235_405_1301 298
651 3300046506 Ga0495583_0015642 Ga0495583_0015642_704_1600 298
652 3300046506 Ga0495583_0060923 Ga0495583_0060923_619_1515 298
653 3300046507 Ga0495606_0000007 Ga0495606_0000007_95123_96019 298
654 3300046507 Ga0495606_0000135 Ga0495606_0000135_34300_35196 298
655 3300046507 Ga0495606_0012120 Ga0495606_0012120_1573_2523 298
656 3300046507 Ga0495606_0018285 Ga0495606_0018285_2243_3139 298
657 3300046511 Ga0495608_0004043 Ga0495608_0004043_1668_2564 298
658 3300046512 Ga0495610_0000021 Ga0495610_0000021_306846_307742 298
659 3300046512 Ga0495610_0000670 Ga0495610_0000670_17100_17996 298
660 3300046513 Ga0495616_0000845 Ga0495616_0000845_490_1386 298
661 3300046513 Ga0495616_0000954 Ga0495616_0000954_17626_18522 298
662 3300046513 Ga0495616_0024752 Ga0495616_0024752_2299_3195 298
663 3300046513 Ga0495616_0046538 Ga0495616_0046538_89_985 298
664 3300046513 Ga0495616_0050953 Ga0495616_0050953_454_1350 298
665 3300046513 Ga0495616_0054221 Ga0495616_0054221_202_1098 298
666 3300046514 Ga0495618_0022757 Ga0495618_0022757_1332_2228 298
667 3300046516 Ga0495628_0005360 Ga0495628_0005360_7848_8744 298
668 3300046516 Ga0495628_0006429 Ga0495628_0006429_8575_9471 298
669 3300046518 Ga0495631_0055086 Ga0495631_0055086_517_1413 298
670 3300046518 Ga0495631_0055138 Ga0495631_0055138_530_1426 298
671 3300046519 Ga0495632_0000236 Ga0495632_0000236_2487_3383 298
672 3300046519 Ga0495632_0002684 Ga0495632_0002684_2147_3043 298
673 3300046519 Ga0495632_0003478 Ga0495632_0003478_9617_10513 298
674 3300046519 Ga0495632_0073536 Ga0495632_0073536_377_1273 298
675 3300046520 Ga0495637_0000049 Ga0495637_0000049_71817_72713 298
676 3300046520 Ga0495637_0001263 Ga0495637_0001263_14343_15239 298
677 3300046520 Ga0495637_0005121 Ga0495637_0005121_4679_5575 298
678 3300046522 Ga0495643_0000400 Ga0495643_0000400_55062_55958 298
679 3300046522 Ga0495643_0001823 Ga0495643_0001823_2103_2999 298
680 3300046522 Ga0495643_0002736 Ga0495643_0002736_1867_2763 298
681 3300046522 Ga0495643_0014196 Ga0495643_0014196_1845_2741 298
682 3300046522 Ga0495643_0016260 Ga0495643_0016260_2751_3647 298
683 3300046522 Ga0495643_0107629 Ga0495643_0107629_65_961 298
684 3300046523 Ga0495644_0012255 Ga0495644_0012255_2171_3067 298
685 3300046523 Ga0495644_0071865 Ga0495644_0071865_113_1009 298
686 3300046524 Ga0495648_0000305 Ga0495648_0000305_33732_34628 298
687 3300046524 Ga0495648_0000666 Ga0495648_0000666_603_1499 298
688 3300046524 Ga0495648_0001937 Ga0495648_0001937_18336_19232 298
689 3300046524 Ga0495648_0004977 Ga0495648_0004977_9545_10441 298
690 3300046524 Ga0495648_0023837 Ga0495648_0023837_2946_3842 298
691 3300046525 Ga0495663_0001409 Ga0495663_0001409_962_1858 298
692 3300046526 Ga0495666_0001755 Ga0495666_0001755_3907_4803 298
693 3300046526 Ga0495666_0018256 Ga0495666_0018256_439_1335 298
694 3300046528 Ga0495642_0000183 Ga0495642_0000183_27577_28473 298
695 3300046528 Ga0495642_0004033 Ga0495642_0004033_1361_2257 298
696 3300046528 Ga0495642_0004566 Ga0495642_0004566_1774_2670 298
697 3300046528 Ga0495642_0071506 Ga0495642_0071506_503_1399 298
698 3300046529 Ga0495652_0028719 Ga0495652_0028719_308_1204 298
699 3300046529 Ga0495652_0031001 Ga0495652_0031001_1863_2759 298
700 3300046529 Ga0495652_0036817 Ga0495652_0036817_1381_2277 298
701 3300046530 Ga0495654_0000005 Ga0495654_0000005_257908_258804 298
702 3300046530 Ga0495654_0004538 Ga0495654_0004538_5451_6347 298
703 3300046536 Ga0495587_0005037 Ga0495587_0005037_7738_8634 298
704 3300046538 Ga0495609_0000234 Ga0495609_0000234_1204_2100 298
705 3300046538 Ga0495609_0000287 Ga0495609_0000287_706_1602 298
706 3300046538 Ga0495609_0001031 Ga0495609_0001031_3463_4359 298
707 3300046538 Ga0495609_0012071 Ga0495609_0012071_2085_2981 298
708 3300046538 Ga0495609_0012258 Ga0495609_0012258_2942_3838 298
709 3300046538 Ga0495609_0021428 Ga0495609_0021428_701_1597 298
710 3300046542 Ga0495597_0000413 Ga0495597_0000413_35443_36339 298
711 3300046542 Ga0495597_0000750 Ga0495597_0000750_10146_11042 298
712 3300046542 Ga0495597_0001696 Ga0495597_0001696_9342_10238 298
713 3300046542 Ga0495597_0002784 Ga0495597_0002784_7042_7938 298
714 3300046542 Ga0495597_0010977 Ga0495597_0010977_2949_3845 298
715 3300046542 Ga0495597_0027075 Ga0495597_0027075_841_1737 298
716 3300046557 Ga0495622_0081834 Ga0495622_0081834_549_1445 298
717 3300046558 Ga0495633_0010270 Ga0495633_0010270_425_1321 298
718 3300046558 Ga0495633_0017041 Ga0495633_0017041_451_1347 298
719 3300046558 Ga0495633_0041829 Ga0495633_0041829_789_1685 298
720 3300046558 Ga0495633_0066280 Ga0495633_0066280_147_1043 298
721 3300046615 Ga0495656_0007307 Ga0495656_0007307_2637_3533 298
722 3300046616 Ga0495668_0000008 Ga0495668_0000008_203244_204140 298
723 3300046616 Ga0495668_0000927 Ga0495668_0000927_30981_31877 298
724 3300046616 Ga0495668_0040921 Ga0495668_0040921_888_1784 298
725 3300046616 Ga0495668_0118561 Ga0495668_0118561_302_1198 298
726 3300046616 Ga0495668_0155486 Ga0495668_0155486_13_909 298
727 3300046642 Ga0495634_0009521 Ga0495634_0009521_1408_2304 298
728 3300046648 Ga0495611_0002392 Ga0495611_0002392_819_1715 298
729 3300046648 Ga0495611_0008616 Ga0495611_0008616_730_1626 298
730 3300046648 Ga0495611_0010484 Ga0495611_0010484_760_1656 298
731 3300046648 Ga0495611_0015705 Ga0495611_0015705_2095_2991 298
732 3300046648 Ga0495611_0021017 Ga0495611_0021017_306_1202 298
733 3300046648 Ga0495611_0021089 Ga0495611_0021089_431_1327 298
734 3300046648 Ga0495611_0033320 Ga0495611_0033320_961_1857 298
735 3300046648 Ga0495611_0080107 Ga0495611_0080107_564_1460 298
736 3300046660 Ga0495625_0001532 Ga0495625_0001532_25970_26866 298
737 3300046660 Ga0495625_0022876 Ga0495625_0022876_254_1150 298
738 3300046660 Ga0495625_0043139 Ga0495625_0043139_2053_2949 298
739 3300046660 Ga0495625_0105396 Ga0495625_0105396_239_1135 298
740 3300046660 Ga0495625_0301172 Ga0495625_0301172_48_944 298
741 3300046663 Ga0495635_0012815 Ga0495635_0012815_4936_5832 298
742 3300046664 Ga0495659_0001227 Ga0495659_0001227_570_1466 298
743 3300046665 Ga0495661_0000862 Ga0495661_0000862_21535_22431 298
744 3300046665 Ga0495661_0001364 Ga0495661_0001364_448_1344 298
745 3300046665 Ga0495661_0001624 Ga0495661_0001624_450_1346 298
746 3300046665 Ga0495661_0002895 Ga0495661_0002895_9996_10892 298
747 3300046665 Ga0495661_0010766 Ga0495661_0010766_4324_5220 298
748 3300046665 Ga0495661_0070174 Ga0495661_0070174_766_1662 298
749 3300046665 Ga0495661_0089403 Ga0495661_0089403_531_1427 298
750 3300046674 Ga0495588_0000070 Ga0495588_0000070_203433_204329 298
751 3300046674 Ga0495588_0006477 Ga0495588_0006477_188_1084 298
752 3300046674 Ga0495588_0015851 Ga0495588_0015851_2405_3301 298
753 3300046674 Ga0495588_0022714 Ga0495588_0022714_444_1340 298
754 3300046674 Ga0495588_0073547 Ga0495588_0073547_288_1184 298
755 3300046674 Ga0495588_0113648 Ga0495588_0113648_490_1386 298
756 3300046674 Ga0495588_0124430 Ga0495588_0124430_252_1148 298
757 3300046678 Ga0495599_0025359 Ga0495599_0025359_1171_2067 298
758 3300046680 Ga0495646_0002738 Ga0495646_0002738_9170_10066 298
759 3300046680 Ga0495646_0023938 Ga0495646_0023938_889_1785 298
760 3300046680 Ga0495646_0105097 Ga0495646_0105097_378_1274 298
761 3300046684 Ga0495669_0000297 Ga0495669_0000297_2054_2950 298
762 3300046684 Ga0495669_0014223 Ga0495669_0014223_1959_2855 298
763 3300046684 Ga0495669_0117808 Ga0495669_0117808_255_1151 298
764 3300046691 Ga0495670_0008811 Ga0495670_0008811_3043_3939 298
765 3300046691 Ga0495670_0009767 Ga0495670_0009767_2551_3447 298
766 3300046691 Ga0495670_0019193 Ga0495670_0019193_2101_2997 298
767 3300046691 Ga0495670_0040744 Ga0495670_0040744_561_1457 298
768 3300046692 Ga0495671_0000024 Ga0495671_0000024_181213_182109 298
769 3300046692 Ga0495671_0000919 Ga0495671_0000919_18132_19028 298
770 3300046692 Ga0495671_0020352 Ga0495671_0020352_74_970 298
771 3300046692 Ga0495671_0025245 Ga0495671_0025245_1214_2110 298
772 3300046692 Ga0495671_0045238 Ga0495671_0045238_1287_2183 298
773 3300046694 Ga0495649_0000150 Ga0495649_0000150_59862_60758 298
774 3300046794 Ga0495589_0000175 Ga0495589_0000175_45920_46816 298
775 3300046794 Ga0495589_0000218 Ga0495589_0000218_42134_43030 298
776 3300046794 Ga0495589_0068393 Ga0495589_0068393_804_1700 298
777 3300046794 Ga0495589_0080356 Ga0495589_0080356_199_1095 298
778 3300046809 Ga0495600_0050073 Ga0495600_0050073_1642_2538 298
779 3300046810 Ga0495660_0000113 Ga0495660_0000113_48976_49872 298
780 3300046810 Ga0495660_0005782 Ga0495660_0005782_3495_4391 298
781 3300046810 Ga0495660_0018484 Ga0495660_0018484_1066_1962 298
782 3300046810 Ga0495660_0041108 Ga0495660_0041108_923_1819 298
783 3300046810 Ga0495660_0080801 Ga0495660_0080801_630_1526 298
784 3300046810 Ga0495660_0138423 Ga0495660_0138423_200_1096 298
785 3300047315 Ga0495581_0010305 Ga0495581_0010305_444_1340 298
786 3300047315 Ga0495581_0015553 Ga0495581_0015553_2678_3574 298
787 3300047317 Ga0495604_0022452 Ga0495604_0022452_1907_2803 298
788 3300047318 Ga0495636_0000463 Ga0495636_0000463_2432_3328 298
789 3300047318 Ga0495636_0015151 Ga0495636_0015151_270_1166 298
790 3300047318 Ga0495636_0032298 Ga0495636_0032298_1117_2013 298
791 3300047319 Ga0495674_0004779 Ga0495674_0004779_6612_7508 298
792 3300047320 Ga0495672_0000533 Ga0495672_0000533_1199_2095 298
793 3300047320 Ga0495672_0000802 Ga0495672_0000802_24215_25111 298
794 3300047320 Ga0495672_0016919 Ga0495672_0016919_2697_3593 298
795 3300047320 Ga0495672_0021979 Ga0495672_0021979_240_1136 298
796 3300047320 Ga0495672_0036911 Ga0495672_0036911_658_1554 298
797 3300047320 Ga0495672_0041382 Ga0495672_0041382_336_1232 298
798 3300047320 Ga0495672_0072717 Ga0495672_0072717_880_1776 298
799 3300047321 Ga0495676_0000635 Ga0495676_0000635_8718_9614 298
800 3300047321 Ga0495676_0243828 Ga0495676_0243828_236_1132 298
801 3300047322 Ga0495680_0007985 Ga0495680_0007985_4981_5877 298
802 3300047323 Ga0495683_0000088 Ga0495683_0000088_61862_62758 298
803 3300047323 Ga0495683_0002367 Ga0495683_0002367_10166_11062 298
804 3300047323 Ga0495683_0010816 Ga0495683_0010816_238_1134 298
805 3300047323 Ga0495683_0024612 Ga0495683_0024612_1939_2835 298
806 3300047323 Ga0495683_0026176 Ga0495683_0026176_732_1628 298
807 3300047323 Ga0495683_0073178 Ga0495683_0073178_652_1548 298
808 3300047323 Ga0495683_0090424 Ga0495683_0090424_51_947 298
809 3300047443 Ga0495687_000186 Ga0495687_000186_49340_50236 298
810 3300047443 Ga0495687_000256 Ga0495687_000256_49076_49972 298
811 3300047443 Ga0495687_000288 Ga0495687_000288_5596_6492 298
812 3300047443 Ga0495687_001033 Ga0495687_001033_25390_26286 298
813 3300047443 Ga0495687_003432 Ga0495687_003432_10254_11150 298
814 3300047443 Ga0495687_004752 Ga0495687_004752_1180_2076 298
815 3300047444 Ga0495675_0040886 Ga0495675_0040886_1890_2786 298
816 3300047445 Ga0495677_0000161 Ga0495677_0000161_25682_26578 298
817 3300047445 Ga0495677_0003275 Ga0495677_0003275_4440_5336 298
818 3300047445 Ga0495677_0005176 Ga0495677_0005176_3818_4714 298
819 3300047446 Ga0495679_018839 Ga0495679_018839_248_1144 298
820 3300047446 Ga0495679_040441 Ga0495679_040441_530_1426 298
821 3300047447 Ga0495685_000004 Ga0495685_000004_22432_23328 298
822 3300047469 Ga0495673_0000033 Ga0495673_0000033_285305_286201 298
823 3300047469 Ga0495673_0000219 Ga0495673_0000219_69686_70582 298
824 3300047470 Ga0495681_0000601 Ga0495681_0000601_2105_3001 298
825 3300047472 Ga0495686_0000167 Ga0495686_0000167_123582_124478 298
826 3300047472 Ga0495686_0000612 Ga0495686_0000612_38114_39010 298
827 3300047472 Ga0495686_0000722 Ga0495686_0000722_22928_23824 298
828 3300047673 Ga0495593_0002957 Ga0495593_0002957_3492_4388 298
829 3300048089 Ga0495614_0023062 Ga0495614_0023062_1438_2334 298
830 3300048091 Ga0495626_0000030 Ga0495626_0000030_20421_21317 298
831 3300048091 Ga0495626_0001606 Ga0495626_0001606_15240_16136 298
832 3300048091 Ga0495626_0002072 Ga0495626_0002072_1000_1896 298
833 3300048091 Ga0495626_0007245 Ga0495626_0007245_2932_3828 298
834 3300048091 Ga0495626_0008403 Ga0495626_0008403_937_1833 298
835 3300048091 Ga0495626_0028196 Ga0495626_0028196_192_1088 298
836 3300048091 Ga0495626_0091662 Ga0495626_0091662_305_1201 298
837 3300048903 Ga0496100_0049502 Ga0496100_0049502_1212_2108 298
838 3300048905 Ga0496102_0000105 Ga0496102_0000105_116538_117491 298
839 3300048905 Ga0496102_0000107 Ga0496102_0000107_23418_24314 298
840 3300048905 Ga0496102_0018743 Ga0496102_0018743_436_1332 298
841 3300048905 Ga0496102_0131559 Ga0496102_0131559_276_1172 298
842 3300048906 Ga0496103_0117023 Ga0496103_0117023_217_1113 298
843 3300048909 Ga0496106_0085869 Ga0496106_0085869_148_1044 298
844 3300048913 Ga0496110_0000073 Ga0496110_0000073_9597_10493 298
845 3300048913 Ga0496110_0146736 Ga0496110_0146736_475_1371 298
846 3300048917 Ga0496114_0026559 Ga0496114_0026559_1395_2291 298
847 3300048918 Ga0496115_0006825 Ga0496115_0006825_3126_4022 298
848 3300048924 Ga0496121_0047291 Ga0496121_0047291_542_1438 298
849 3300048924 Ga0496121_0182475 Ga0496121_0182475_65_961 298
850 3300048925 Ga0496122_0007032 Ga0496122_0007032_9399_10295 298
851 3300048925 Ga0496122_0016475 Ga0496122_0016475_5410_6306 298
852 3300048925 Ga0496122_0032257 Ga0496122_0032257_3408_4304 298
853 3300048927 Ga0496124_0225892 Ga0496124_0225892_316_1212 298
854 3300048928 Ga0496125_0001146 Ga0496125_0001146_38435_39331 298
855 3300048928 Ga0496125_0002429 Ga0496125_0002429_247_1143 298
856 3300048928 Ga0496125_0245586 Ga0496125_0245586_115_1011 298
857 3300048929 Ga0496126_0012107 Ga0496126_0012107_6033_6929 298
858 3300049459 Ga0495678_000001 Ga0495678_000001_901587_902483 298
859 3300049459 Ga0495678_000603 Ga0495678_000603_32490_33386 298
860 3300049459 Ga0495678_001473 Ga0495678_001473_1491_2387 298
861 3300049459 Ga0495678_003704 Ga0495678_003704_6167_7063 298
862 3300049459 Ga0495678_005875 Ga0495678_005875_5170_6066 298
863 3300049459 Ga0495678_007980 Ga0495678_007980_2707_3603 298
864 3300049460 Ga0495682_0000518 Ga0495682_0000518_865_1761 298
865 3300049460 Ga0495682_0003041 Ga0495682_0003041_127_1023 298
866 3300049775 Ga0501279_006410 Ga0501279_006410_504_1400 298
867 3300049822 Ga0501035_0009176 Ga0501035_0009176_528_1424 298
868 3300053125 Ga0500618_000699 Ga0500618_000699_2034_2930 298
869 3300053125 Ga0500618_000954 Ga0500618_000954_12090_12986 298
870 3300053125 Ga0500618_016744 Ga0500618_016744_743_1639 298
871 3300053141 Ga0500574_008828 Ga0500574_008828_1061_1957 298
872 3300059508 Ga0587088_002031 Ga0587088_002031_217_1113 298
873 3300059639 Ga0587062_004949 Ga0587062_004949_136_1032 298
874 3300059640 Ga0587067_004268 Ga0587067_004268_209_1123 298
875 3300059650 Ga0587104_000425 Ga0587104_000425_715_1629 298
876 3300037312 Ga0395899_0000093 Ga0395899_0000093_8856_9956 301
877 3300015262 Ga0182007_10008037 Ga0182007_100080373 302
878 3300002705 JGI25156J39149_1000497 JGI25156J39149_10004972 303
879 3300002737 JGI25162J39368_1001938 JGI25162J39368_10019382 303
880 3300002738 JGI25154J39366_1000423 JGI25154J39366_100042329 303
881 3300002738 JGI25154J39366_1000432 JGI25154J39366_10004322 303
882 3300002741 JGI25157J39369_1000158 JGI25157J39369_10001582 303
883 3300002741 JGI25157J39369_1000203 JGI25157J39369_100020317 303
884 3300003758 Ga0055532_1000005 Ga0055532_1000005130 303
885 3300009011 Ga0105251_10056540 Ga0105251_100565402 303
886 3300009093 Ga0105240_10143149 Ga0105240_101431493 303
887 3300009093 Ga0105240_10156199 Ga0105240_101561993 303
888 3300009551 Ga0105238_10078969 Ga0105238_100789693 303
889 3300025246 Ga0209646_1000283 Ga0209646_100028346 303
890 3300025256 Ga0209759_1000548 Ga0209759_10005482 303
891 3300025272 Ga0209455_1001258 Ga0209455_10012588 303
892 3300025913 Ga0207695_10001902 Ga0207695_100019024 303
893 3300031838 Ga0307518_10009169 Ga0307518_100091694 303
894 3300046660 Ga0495625_0004513 Ga0495625_0004513_1841_2752 303
895 3300048919 Ga0496116_0013018 Ga0496116_0013018_3989_4900 303
896 3300048925 Ga0496122_0000513 Ga0496122_0000513_1849_2760 303
897 3300048926 Ga0496123_0000145 Ga0496123_0000145_77270_78181 303
898 3300048928 Ga0496125_0001481 Ga0496125_0001481_4818_5729 303
899 3300048928 Ga0496125_0089129 Ga0496125_0089129_1294_2205 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

36

292

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1obg-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9391 8 303
3r9r-assembly1.cif.gz_A structure of a phosphoribosylaminoimidazole-succinocarboxamide synthase from mycobacterium abscessus atcc 19977 / dsm 44196 0.9292 8 300
1obd-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9234 8 300
2cnv-assembly1.cif.gz_A saicar-synthase from saccharomyces cerevisiae complexed saicar 0.9167 8 303
1obg-assembly1.cif.gz_A saicar-synthase complexed with atp 0.915 8 303
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.965 109 252 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9521 109 252 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9432 109 252 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9247 109 252 3.30.470.20
af_P9WHN1_1_93_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9151 17 108 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A4Q3HNI6-F1-model_v4 deleted 0.9963 6 201
AF-A0A3S4W3U4-F1-model_v4 deleted 0.9953 105 215
AF-A0A520HAQ3-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.995 6 110 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A356HJH1-F1-model_v4 deleted 0.9947 7 160
AF-A0A6I3H9W3-F1-model_v4 deleted 0.9927 7 232

Feature Viewer

pLDDT pTM Quality
93.78 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map