F485106
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 899 | 356 | 866 | 436 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10002924|Ga0157370_100029249 |
| Length | 503 |
| Sequence | VRVILKVKDEGKKKGLFVCLLKNLLFYFNFPCAFIYCFFIFIQWLGNLPRFGNLSLKINTMNSRRKFLQNSAVMLGGSILASSVSNPVFAIFNNRVAPSDQLNIGAIGVNGMGWADVMAALKIPGVNLVAICDVDKNVIDKRLKDLAKMNKDTSKVKTYGDYRQLLDDKDVDAVVIGTPDHWHALIMMDACAAGKDVYCEKPVGNSIGECRAMVAAQQRYNKAVQCGQWQRSQQHFKDAVDYVQTGVLGNIRTVKVWCYQGWMKPGPVVPDTAPPAGVDYTMWLGPAPKRAFNASRFHFNFRWFWDYAGGLMTDWGVHLLDYGLLGMKSPTPKSVSALGGRFAYPDLYEETPDTLTTLYEFDGFNMVWDSAMGIDNGSYNRDHGIAYIGNNGTLILNRGGWEVIEEKQSKNKVSKPFAPSTDNGVEKHWENFVSVVKSRKMEDLHCPIQAGAHVATVAQMGNIAYHSGKKLEWDAAKEQFTDNAVNKEYFMKEYHNGYKLAKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 4 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 5 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 6 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 7 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 8 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 9 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 10 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 11 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 12 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 13 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 14 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 15 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 16 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 17 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 18 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 19 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 20 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 21 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 22 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 23 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 24 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 25 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 26 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 27 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 28 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 29 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 30 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 31 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 32 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 33 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 34 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 35 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 36 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 39 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 40 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 41 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 42 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 43 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 52 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 62 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 224 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 225 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 226 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 227 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 228 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 240 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 241 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 251 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 252 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 253 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 256 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 257 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 260 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 261 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 266 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 299 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 303 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 318 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 319 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 320 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 321 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 325 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 326 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 327 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 328 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 329 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 334 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 341 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 342 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 343 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 344 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 345 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 346 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 347 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 349 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 352 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 356 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.11 |
| Metatranscriptomes | 0.22 |
| Isolates | 3.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.67 |
| Nodule | 0 |
| Rhizoplane | 0.67 |
| Rhizosphere | 86.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2061135 | 2162886007 | Bacteria | 1796 |
| 2 | JGI24739J22299_10006165 | 3300001989 | Bacteria | 4528 |
| 3 | JGI24737J22298_10012446 | 3300001990 | Bacteria | 2774 |
| 4 | JGI25154J39366_1000179 | 3300002738 | Bacteria | 49600 |
| 5 | JGI25164J39214_1000820 | 3300002772 | Bacteria | 10880 |
| 6 | JGI25152J39213_1001701 | 3300002773 | Bacteria | 9036 |
| 7 | JGI25150J39212_1000030 | 3300002774 | Bacteria | 101822 |
| 8 | JGI25151J46595_10000129 | 3300003187 | Bacteria | 101822 |
| 9 | JGI25165J46597_1000655 | 3300003214 | Bacteria | 28353 |
| 10 | JGI25153J46596_10000096 | 3300003215 | Bacteria | 101822 |
| 11 | rootH1_10066410 | 3300003316 | Bacteria | 3887 |
| 12 | rootH2_10002127 | 3300003320 | Bacteria | 66384 |
| 13 | rootH2_10103944 | 3300003320 | Bacteria | 4561 |
| 14 | rootL2_10056273 | 3300003322 | Bacteria | 5811 |
| 15 | rootL2_10101507 | 3300003322 | Bacteria | 4567 |
| 16 | rootL2_10180035 | 3300003322 | Bacteria | 2645 |
| 17 | rootL2_10212594 | 3300003322 | Bacteria | 2143 |
| 18 | rootH1_10004576 | 3300003323 | Bacteria | 68064 |
| 19 | rootH1_10026336 | 3300003323 | Bacteria | 2748 |
| 20 | rootH1_10190967 | 3300003323 | Bacteria | 6418 |
| 21 | JGI25160J50197_1003411 | 3300003354 | Bacteria | 7115 |
| 22 | JGI25160J50197_1011032 | 3300003354 | Bacteria | 3230 |
| 23 | Ga0055542_1006065 | 3300003762 | Bacteria | 2632 |
| 24 | Ga0055536_1001818 | 3300003781 | Bacteria | 12513 |
| 25 | Ga0055536_1007187 | 3300003781 | Bacteria | 5031 |
| 26 | Ga0055528_1003675 | 3300003790 | Bacteria | 7610 |
| 27 | Ga0055531_10000061 | 3300003794 | Bacteria | 120535 |
| 28 | Ga0055531_10000122 | 3300003794 | Bacteria | 86804 |
| 29 | Ga0058862_12292963 | 3300004803 | Bacteria | 4249 |
| 30 | Ga0065165_1000032 | 3300005262 | Bacteria | 216051 |
| 31 | Ga0065165_1000038 | 3300005262 | Bacteria | 211664 |
| 32 | Ga0065165_1000259 | 3300005262 | Bacteria | 91800 |
| 33 | Ga0065165_1010235 | 3300005262 | Bacteria | 4085 |
| 34 | Ga0065165_1037409 | 3300005262 | Bacteria | 1471 |
| 35 | Ga0065714_10086418 | 3300005288 | Bacteria | 2102 |
| 36 | Ga0065714_10109159 | 3300005288 | Bacteria | 1504 |
| 37 | Ga0065704_10000361 | 3300005289 | Bacteria | 27784 |
| 38 | Ga0065704_10072305 | 3300005289 | Bacteria | 8768 |
| 39 | Ga0065712_10003244 | 3300005290 | Bacteria | 4324 |
| 40 | Ga0065712_10004111 | 3300005290 | Bacteria | 3556 |
| 41 | Ga0065712_10004771 | 3300005290 | Bacteria | 3806 |
| 42 | Ga0065712_10070396 | 3300005290 | Bacteria | 6047 |
| 43 | Ga0065715_10006829 | 3300005293 | Bacteria | 3060 |
| 44 | Ga0070658_10002733 | 3300005327 | Bacteria | 14690 |
| 45 | Ga0070658_10051061 | 3300005327 | Bacteria | 3351 |
| 46 | Ga0070658_10056185 | 3300005327 | Bacteria | 3199 |
| 47 | Ga0070676_10000375 | 3300005328 | Bacteria | 20682 |
| 48 | Ga0070676_10043662 | 3300005328 | Bacteria | 2606 |
| 49 | Ga0070683_100015621 | 3300005329 | Bacteria | 6673 |
| 50 | Ga0070683_100063721 | 3300005329 | Bacteria | 3430 |
| 51 | Ga0070683_100161545 | 3300005329 | Bacteria | 2126 |
| 52 | Ga0070683_100227021 | 3300005329 | Bacteria | 1775 |
| 53 | Ga0070690_100006298 | 3300005330 | Bacteria | 6730 |
| 54 | Ga0070670_100014394 | 3300005331 | Bacteria | 6787 |
| 55 | Ga0070670_100042609 | 3300005331 | Bacteria | 3902 |
| 56 | Ga0070670_100077448 | 3300005331 | Unclassified | 2857 |
| 57 | Ga0070670_100110524 | 3300005331 | Bacteria | 2368 |
| 58 | Ga0068869_100003479 | 3300005334 | Bacteria | 9633 |
| 59 | Ga0068869_100008042 | 3300005334 | Bacteria | 6774 |
| 60 | Ga0068869_100036630 | 3300005334 | Bacteria | 3484 |
| 61 | Ga0068869_100082498 | 3300005334 | Bacteria | 2403 |
| 62 | Ga0068869_100085972 | 3300005334 | Bacteria | 2356 |
| 63 | Ga0070666_10000030 | 3300005335 | Bacteria | 137543 |
| 64 | Ga0070666_10025874 | 3300005335 | Bacteria | 3828 |
| 65 | Ga0070666_10031202 | 3300005335 | Bacteria | 3517 |
| 66 | Ga0070666_10122148 | 3300005335 | Bacteria | 1807 |
| 67 | Ga0070682_100084379 | 3300005337 | Bacteria | 2064 |
| 68 | Ga0068868_100033422 | 3300005338 | Bacteria | 3964 |
| 69 | Ga0068868_100035467 | 3300005338 | Bacteria | 3856 |
| 70 | Ga0068868_100043561 | 3300005338 | Bacteria | 3506 |
| 71 | Ga0068868_100050675 | 3300005338 | Bacteria | 3261 |
| 72 | Ga0068868_100060702 | 3300005338 | Bacteria | 2994 |
| 73 | Ga0070660_100026775 | 3300005339 | Bacteria | 4296 |
| 74 | Ga0070660_100033516 | 3300005339 | Bacteria | 3871 |
| 75 | Ga0070660_100106424 | 3300005339 | Bacteria | 2227 |
| 76 | Ga0070689_100010923 | 3300005340 | Bacteria | 6489 |
| 77 | Ga0070689_100082955 | 3300005340 | Bacteria | 2519 |
| 78 | Ga0070687_100023265 | 3300005343 | Bacteria | 2943 |
| 79 | Ga0070661_100001902 | 3300005344 | Bacteria | 14468 |
| 80 | Ga0070661_100013862 | 3300005344 | Bacteria | 5664 |
| 81 | Ga0070668_100003881 | 3300005347 | Bacteria | 11039 |
| 82 | Ga0070668_100010496 | 3300005347 | Bacteria | 6885 |
| 83 | Ga0070668_100069889 | 3300005347 | Bacteria | 2733 |
| 84 | Ga0070669_100019917 | 3300005353 | Bacteria | 4792 |
| 85 | Ga0070669_100102087 | 3300005353 | Unclassified | 2165 |
| 86 | Ga0070675_100020974 | 3300005354 | Bacteria | 5218 |
| 87 | Ga0070675_100043197 | 3300005354 | Bacteria | 3683 |
| 88 | Ga0070675_100064163 | 3300005354 | Bacteria | 3037 |
| 89 | Ga0070675_100079654 | 3300005354 | Bacteria | 2730 |
| 90 | Ga0070675_100112565 | 3300005354 | Bacteria | 2304 |
| 91 | Ga0070675_100244487 | 3300005354 | Bacteria | 1569 |
| 92 | Ga0070671_100006460 | 3300005355 | Bacteria | 9371 |
| 93 | Ga0070671_100024337 | 3300005355 | Bacteria | 4956 |
| 94 | Ga0070671_100069058 | 3300005355 | Bacteria | 2947 |
| 95 | Ga0070674_100032111 | 3300005356 | Bacteria | 3485 |
| 96 | Ga0070673_100015236 | 3300005364 | Bacteria | 5393 |
| 97 | Ga0070673_100038431 | 3300005364 | Bacteria | 3655 |
| 98 | Ga0070673_100083696 | 3300005364 | Bacteria | 2592 |
| 99 | Ga0070673_100199907 | 3300005364 | Bacteria | 1721 |
| 100 | Ga0070688_100006850 | 3300005365 | Bacteria | 6115 |
| 101 | Ga0070688_100022637 | 3300005365 | Bacteria | 3686 |
| 102 | Ga0070688_100039392 | 3300005365 | Bacteria | 2891 |
| 103 | Ga0070659_100003883 | 3300005366 | Bacteria | 10646 |
| 104 | Ga0070659_100130681 | 3300005366 | Bacteria | 2039 |
| 105 | Ga0070667_100000482 | 3300005367 | Bacteria | 40557 |
| 106 | Ga0070667_100001675 | 3300005367 | Bacteria | 19809 |
| 107 | Ga0070667_100015893 | 3300005367 | Bacteria | 6227 |
| 108 | Ga0070667_100019741 | 3300005367 | Bacteria | 5591 |
| 109 | Ga0070667_100102353 | 3300005367 | Bacteria | 2475 |
| 110 | Ga0070678_100022468 | 3300005456 | Bacteria | 4181 |
| 111 | Ga0070678_100027160 | 3300005456 | Bacteria | 3883 |
| 112 | Ga0070678_100043920 | 3300005456 | Bacteria | 3187 |
| 113 | Ga0070662_100000311 | 3300005457 | Bacteria | 28977 |
| 114 | Ga0070662_100010886 | 3300005457 | Bacteria | 5992 |
| 115 | Ga0070662_100051531 | 3300005457 | Unclassified | 2973 |
| 116 | Ga0070662_100073666 | 3300005457 | Bacteria | 2524 |
| 117 | Ga0070662_100100205 | 3300005457 | Bacteria | 2191 |
| 118 | Ga0070662_100131647 | 3300005457 | Unclassified | 1929 |
| 119 | Ga0070681_10057046 | 3300005458 | Bacteria | 3886 |
| 120 | Ga0068867_100030855 | 3300005459 | Bacteria | 3867 |
| 121 | Ga0068867_100041721 | 3300005459 | Bacteria | 3353 |
| 122 | Ga0068867_100092285 | 3300005459 | Bacteria | 2299 |
| 123 | Ga0070685_10014893 | 3300005466 | Bacteria | 4126 |
| 124 | Ga0070685_10025212 | 3300005466 | Bacteria | 3273 |
| 125 | Ga0070698_100003501 | 3300005471 | Bacteria | 17268 |
| 126 | Ga0070698_100004308 | 3300005471 | Bacteria | 15657 |
| 127 | Ga0070698_100008096 | 3300005471 | Bacteria | 11367 |
| 128 | Ga0070699_100049932 | 3300005518 | Bacteria | 3621 |
| 129 | Ga0070679_100001547 | 3300005530 | Bacteria | 20544 |
| 130 | Ga0070679_100003672 | 3300005530 | Bacteria | 14053 |
| 131 | Ga0070684_100004405 | 3300005535 | Bacteria | 10715 |
| 132 | Ga0068853_100000250 | 3300005539 | Bacteria | 37737 |
| 133 | Ga0068853_100008940 | 3300005539 | Bacteria | 8065 |
| 134 | Ga0068853_100019481 | 3300005539 | Bacteria | 5625 |
| 135 | Ga0068853_100085121 | 3300005539 | Bacteria | 2771 |
| 136 | Ga0068853_100096681 | 3300005539 | Bacteria | 2606 |
| 137 | Ga0068853_100100047 | 3300005539 | Bacteria | 2562 |
| 138 | Ga0068853_100113912 | 3300005539 | Bacteria | 2405 |
| 139 | Ga0068853_100181125 | 3300005539 | Bacteria | 1911 |
| 140 | Ga0070672_100000361 | 3300005543 | Bacteria | 26202 |
| 141 | Ga0070672_100058066 | 3300005543 | Bacteria | 3040 |
| 142 | Ga0070672_100163286 | 3300005543 | Bacteria | 1849 |
| 143 | Ga0070672_100213858 | 3300005543 | Bacteria | 1615 |
| 144 | Ga0070696_100004704 | 3300005546 | Bacteria | 9124 |
| 145 | Ga0070693_100114148 | 3300005547 | Bacteria | 1666 |
| 146 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 147 | Ga0070665_100057751 | 3300005548 | Bacteria | 3890 |
| 148 | Ga0070665_100204264 | 3300005548 | Bacteria | 1976 |
| 149 | Ga0070704_100027391 | 3300005549 | Bacteria | 3780 |
| 150 | Ga0068855_100000393 | 3300005563 | Bacteria | 53897 |
| 151 | Ga0068855_100000463 | 3300005563 | Bacteria | 50000 |
| 152 | Ga0068855_100001155 | 3300005563 | Bacteria | 32713 |
| 153 | Ga0068855_100002947 | 3300005563 | Bacteria | 20801 |
| 154 | Ga0068855_100006289 | 3300005563 | Bacteria | 14477 |
| 155 | Ga0068855_100035606 | 3300005563 | Bacteria | 5929 |
| 156 | Ga0068855_100074258 | 3300005563 | Bacteria | 3950 |
| 157 | Ga0068855_100102479 | 3300005563 | Bacteria | 3295 |
| 158 | Ga0068855_100265849 | 3300005563 | Bacteria | 1909 |
| 159 | Ga0068855_100336613 | 3300005563 | Bacteria | 1665 |
| 160 | Ga0070664_100025631 | 3300005564 | Bacteria | 4890 |
| 161 | Ga0068857_100007688 | 3300005577 | Bacteria | 9285 |
| 162 | Ga0068857_100032480 | 3300005577 | Bacteria | 4615 |
| 163 | Ga0068857_100036112 | 3300005577 | Bacteria | 4379 |
| 164 | Ga0068857_100044712 | 3300005577 | Unclassified | 3929 |
| 165 | Ga0068857_100082949 | 3300005577 | Bacteria | 2864 |
| 166 | Ga0068854_100046447 | 3300005578 | Bacteria | 3091 |
| 167 | Ga0068854_100149273 | 3300005578 | Bacteria | 1801 |
| 168 | Ga0068856_100000976 | 3300005614 | Bacteria | 30515 |
| 169 | Ga0068856_100010242 | 3300005614 | Bacteria | 9115 |
| 170 | Ga0068856_100018743 | 3300005614 | Bacteria | 6709 |
| 171 | Ga0068856_100027819 | 3300005614 | Bacteria | 5516 |
| 172 | Ga0068856_100033380 | 3300005614 | Bacteria | 5039 |
| 173 | Ga0068856_100109193 | 3300005614 | Bacteria | 2763 |
| 174 | Ga0068856_100136587 | 3300005614 | Bacteria | 2457 |
| 175 | Ga0068856_100256661 | 3300005614 | Bacteria | 1763 |
| 176 | Ga0068852_100000242 | 3300005616 | Bacteria | 37066 |
| 177 | Ga0068852_100000336 | 3300005616 | Bacteria | 31871 |
| 178 | Ga0068852_100000842 | 3300005616 | Bacteria | 20355 |
| 179 | Ga0068852_100004228 | 3300005616 | Bacteria | 10134 |
| 180 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 181 | Ga0068859_100013814 | 3300005617 | Bacteria | 8097 |
| 182 | Ga0068859_100043651 | 3300005617 | Bacteria | 4506 |
| 183 | Ga0068859_100053979 | 3300005617 | Bacteria | 4041 |
| 184 | Ga0068859_100167398 | 3300005617 | Bacteria | 2278 |
| 185 | Ga0068864_100000785 | 3300005618 | Bacteria | 26636 |
| 186 | Ga0068864_100006709 | 3300005618 | Bacteria | 9431 |
| 187 | Ga0068864_100022225 | 3300005618 | Bacteria | 5317 |
| 188 | Ga0068864_100041076 | 3300005618 | Bacteria | 3956 |
| 189 | Ga0068866_10022853 | 3300005718 | Bacteria | 2900 |
| 190 | Ga0068861_100000424 | 3300005719 | Bacteria | 24519 |
| 191 | Ga0068861_100027169 | 3300005719 | Bacteria | 4166 |
| 192 | Ga0068861_100048849 | 3300005719 | Bacteria | 3201 |
| 193 | Ga0068861_100111406 | 3300005719 | Bacteria | 2193 |
| 194 | Ga0068861_100207861 | 3300005719 | Bacteria | 1647 |
| 195 | Ga0068851_10002845 | 3300005834 | Bacteria | 7638 |
| 196 | Ga0068851_10004750 | 3300005834 | Bacteria | 6153 |
| 197 | Ga0068870_10030849 | 3300005840 | Bacteria | 2712 |
| 198 | Ga0068870_10034123 | 3300005840 | Bacteria | 2602 |
| 199 | Ga0068863_100004269 | 3300005841 | Bacteria | 14090 |
| 200 | Ga0068863_100006964 | 3300005841 | Bacteria | 11087 |
| 201 | Ga0068863_100015248 | 3300005841 | Bacteria | 7386 |
| 202 | Ga0068863_100027774 | 3300005841 | Bacteria | 5400 |
| 203 | Ga0068863_100033321 | 3300005841 | Bacteria | 4907 |
| 204 | Ga0068863_100053225 | 3300005841 | Bacteria | 3836 |
| 205 | Ga0068863_100224267 | 3300005841 | Bacteria | 1811 |
| 206 | Ga0068858_100003593 | 3300005842 | Bacteria | 15347 |
| 207 | Ga0068858_100030266 | 3300005842 | Bacteria | 5027 |
| 208 | Ga0068858_100088396 | 3300005842 | Bacteria | 2883 |
| 209 | Ga0068860_100000097 | 3300005843 | Bacteria | 146573 |
| 210 | Ga0068860_100002301 | 3300005843 | Bacteria | 20084 |
| 211 | Ga0068860_100002474 | 3300005843 | Bacteria | 19388 |
| 212 | Ga0068860_100006909 | 3300005843 | Bacteria | 11379 |
| 213 | Ga0068860_100010870 | 3300005843 | Bacteria | 8978 |
| 214 | Ga0068860_100168485 | 3300005843 | Bacteria | 2115 |
| 215 | Ga0068860_100312667 | 3300005843 | Bacteria | 1541 |
| 216 | Ga0068862_100017277 | 3300005844 | Bacteria | 6005 |
| 217 | Ga0068862_100098698 | 3300005844 | Bacteria | 2551 |
| 218 | Ga0068862_100137800 | 3300005844 | Bacteria | 2164 |
| 219 | Ga0081539_10000622 | 3300005985 | Bacteria | 71778 |
| 220 | Ga0070715_10056215 | 3300006163 | Bacteria | 1711 |
| 221 | Ga0097621_100000626 | 3300006237 | Bacteria | 24907 |
| 222 | Ga0097621_100000681 | 3300006237 | Bacteria | 23791 |
| 223 | Ga0097621_100005463 | 3300006237 | Bacteria | 8948 |
| 224 | Ga0097621_100009274 | 3300006237 | Bacteria | 7141 |
| 225 | Ga0097621_100027606 | 3300006237 | Bacteria | 4466 |
| 226 | Ga0097621_100257459 | 3300006237 | Bacteria | 1530 |
| 227 | Ga0068871_100000790 | 3300006358 | Bacteria | 21264 |
| 228 | Ga0068871_100001337 | 3300006358 | Bacteria | 16499 |
| 229 | Ga0068871_100004687 | 3300006358 | Bacteria | 9556 |
| 230 | Ga0075428_100004166 | 3300006844 | Bacteria | 15919 |
| 231 | Ga0075431_100009982 | 3300006847 | Bacteria | 9538 |
| 232 | Ga0075429_100047835 | 3300006880 | Bacteria | 3720 |
| 233 | Ga0068865_100000110 | 3300006881 | Bacteria | 42375 |
| 234 | Ga0068865_100012625 | 3300006881 | Bacteria | 5321 |
| 235 | Ga0068865_100026788 | 3300006881 | Bacteria | 3803 |
| 236 | Ga0068865_100034237 | 3300006881 | Bacteria | 3407 |
| 237 | Ga0068865_100045912 | 3300006881 | Unclassified | 2996 |
| 238 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 239 | Ga0097620_100013814 | 3300006931 | Bacteria | 8097 |
| 240 | Ga0097620_100043651 | 3300006931 | Bacteria | 4506 |
| 241 | Ga0097620_100053979 | 3300006931 | Bacteria | 4041 |
| 242 | Ga0097620_100167391 | 3300006931 | Bacteria | 2278 |
| 243 | Ga0105240_10000754 | 3300009093 | Bacteria | 59023 |
| 244 | Ga0105240_10000862 | 3300009093 | Bacteria | 54716 |
| 245 | Ga0105240_10002072 | 3300009093 | Bacteria | 32853 |
| 246 | Ga0105240_10002236 | 3300009093 | Bacteria | 31491 |
| 247 | Ga0105240_10003850 | 3300009093 | Bacteria | 23179 |
| 248 | Ga0105240_10045116 | 3300009093 | Bacteria | 5594 |
| 249 | Ga0105240_10059908 | 3300009093 | Bacteria | 4748 |
| 250 | Ga0105240_10080849 | 3300009093 | Bacteria | 3995 |
| 251 | Ga0105240_10092636 | 3300009093 | Bacteria | 3689 |
| 252 | Ga0105240_10099383 | 3300009093 | Bacteria | 3541 |
| 253 | Ga0105240_10110486 | 3300009093 | Bacteria | 3327 |
| 254 | Ga0105240_10142492 | 3300009093 | Bacteria | 2864 |
| 255 | Ga0105240_10354069 | 3300009093 | Bacteria | 1665 |
| 256 | Ga0111539_10006292 | 3300009094 | Bacteria | 15323 |
| 257 | Ga0111539_10012048 | 3300009094 | Bacteria | 10846 |
| 258 | Ga0111539_10076468 | 3300009094 | Bacteria | 3941 |
| 259 | Ga0111539_10091864 | 3300009094 | Bacteria | 3567 |
| 260 | Ga0105247_10000703 | 3300009101 | Bacteria | 26102 |
| 261 | Ga0105247_10001011 | 3300009101 | Bacteria | 21244 |
| 262 | Ga0105247_10012786 | 3300009101 | Bacteria | 5037 |
| 263 | Ga0114129_10000267 | 3300009147 | Bacteria | 59005 |
| 264 | Ga0114129_10126572 | 3300009147 | Bacteria | 3512 |
| 265 | Ga0114129_10180236 | 3300009147 | Bacteria | 2875 |
| 266 | Ga0105243_10000002 | 3300009148 | Bacteria | 856281 |
| 267 | Ga0105241_10000612 | 3300009174 | Bacteria | 26845 |
| 268 | Ga0105241_10003226 | 3300009174 | Bacteria | 12137 |
| 269 | Ga0105241_10004704 | 3300009174 | Bacteria | 10072 |
| 270 | Ga0105241_10009184 | 3300009174 | Bacteria | 7277 |
| 271 | Ga0105241_10026016 | 3300009174 | Bacteria | 4353 |
| 272 | Ga0105242_10010916 | 3300009176 | Bacteria | 6978 |
| 273 | Ga0105242_10014682 | 3300009176 | Bacteria | 6065 |
| 274 | Ga0105242_10028204 | 3300009176 | Bacteria | 4467 |
| 275 | Ga0105242_10059536 | 3300009176 | Bacteria | 3134 |
| 276 | Ga0105242_10100421 | 3300009176 | Bacteria | 2451 |
| 277 | Ga0105242_10105879 | 3300009176 | Bacteria | 2389 |
| 278 | Ga0105248_10012794 | 3300009177 | Bacteria | 9256 |
| 279 | Ga0105237_10001136 | 3300009545 | Bacteria | 35738 |
| 280 | Ga0105237_10001588 | 3300009545 | Bacteria | 29579 |
| 281 | Ga0105237_10002905 | 3300009545 | Bacteria | 20779 |
| 282 | Ga0105237_10006929 | 3300009545 | Bacteria | 12495 |
| 283 | Ga0105237_10008019 | 3300009545 | Bacteria | 11494 |
| 284 | Ga0105237_10017466 | 3300009545 | Bacteria | 7437 |
| 285 | Ga0105237_10028155 | 3300009545 | Bacteria | 5726 |
| 286 | Ga0105237_10035471 | 3300009545 | Bacteria | 5047 |
| 287 | Ga0105237_10035606 | 3300009545 | Bacteria | 5037 |
| 288 | Ga0105238_10001868 | 3300009551 | Bacteria | 21117 |
| 289 | Ga0105238_10016135 | 3300009551 | Bacteria | 7556 |
| 290 | Ga0105238_10022101 | 3300009551 | Bacteria | 6486 |
| 291 | Ga0105238_10175495 | 3300009551 | Bacteria | 2120 |
| 292 | Ga0105238_10318915 | 3300009551 | Bacteria | 1540 |
| 293 | Ga0105249_10001259 | 3300009553 | Bacteria | 22224 |
| 294 | Ga0105249_10001349 | 3300009553 | Bacteria | 21433 |
| 295 | Ga0105249_10003433 | 3300009553 | Bacteria | 13723 |
| 296 | Ga0105249_10004604 | 3300009553 | Bacteria | 11918 |
| 297 | Ga0105249_10019531 | 3300009553 | Bacteria | 6047 |
| 298 | Ga0105249_10029300 | 3300009553 | Bacteria | 4971 |
| 299 | Ga0105249_10030283 | 3300009553 | Bacteria | 4892 |
| 300 | Ga0105249_10030611 | 3300009553 | Bacteria | 4866 |
| 301 | Ga0105249_10043048 | 3300009553 | Bacteria | 4107 |
| 302 | Ga0105249_10093405 | 3300009553 | Bacteria | 2818 |
| 303 | Ga0105249_10154209 | 3300009553 | Bacteria | 2214 |
| 304 | Ga0105249_10217876 | 3300009553 | Bacteria | 1877 |
| 305 | Ga0105239_10000009 | 3300010375 | Bacteria | 361182 |
| 306 | Ga0105239_10000529 | 3300010375 | Bacteria | 55233 |
| 307 | Ga0105239_10001186 | 3300010375 | Bacteria | 35727 |
| 308 | Ga0105239_10003433 | 3300010375 | Bacteria | 19410 |
| 309 | Ga0105239_10009700 | 3300010375 | Bacteria | 10826 |
| 310 | Ga0105239_10011094 | 3300010375 | Bacteria | 10055 |
| 311 | Ga0105239_10015004 | 3300010375 | Bacteria | 8588 |
| 312 | Ga0105239_10041585 | 3300010375 | Bacteria | 5037 |
| 313 | Ga0105239_10047274 | 3300010375 | Bacteria | 4716 |
| 314 | Ga0105239_10064979 | 3300010375 | Bacteria | 4006 |
| 315 | Ga0105239_10143333 | 3300010375 | Bacteria | 2663 |
| 316 | Ga0105239_10190018 | 3300010375 | Bacteria | 2299 |
| 317 | Ga0105239_10217707 | 3300010375 | Bacteria | 2141 |
| 318 | Ga0105246_10011910 | 3300011119 | Bacteria | 5411 |
| 319 | Ga0105246_10091152 | 3300011119 | Bacteria | 2196 |
| 320 | Ga0105246_10195640 | 3300011119 | Bacteria | 1568 |
| 321 | Ga0157373_10003187 | 3300013100 | Bacteria | 12405 |
| 322 | Ga0157373_10023103 | 3300013100 | Bacteria | 4509 |
| 323 | Ga0157373_10065628 | 3300013100 | Bacteria | 2568 |
| 324 | Ga0157371_10000139 | 3300013102 | Bacteria | 104697 |
| 325 | Ga0157371_10000178 | 3300013102 | Bacteria | 92872 |
| 326 | Ga0157371_10018612 | 3300013102 | Bacteria | 5131 |
| 327 | Ga0157371_10027291 | 3300013102 | Bacteria | 4143 |
| 328 | Ga0157371_10029728 | 3300013102 | Bacteria | 3947 |
| 329 | Ga0157371_10038237 | 3300013102 | Bacteria | 3434 |
| 330 | Ga0157371_10038710 | 3300013102 | Unclassified | 3411 |
| 331 | Ga0157371_10153392 | 3300013102 | Bacteria | 1643 |
| 332 | Ga0157370_10000463 | 3300013104 | Bacteria | 50658 |
| 333 | Ga0157370_10002924 | 3300013104 | Bacteria | 20338 |
| 334 | Ga0157370_10070048 | 3300013104 | Bacteria | 3311 |
| 335 | Ga0157369_10000002 | 3300013105 | Bacteria | 524510 |
| 336 | Ga0157369_10012756 | 3300013105 | Bacteria | 9530 |
| 337 | Ga0157369_10040076 | 3300013105 | Bacteria | 5116 |
| 338 | Ga0157369_10040305 | 3300013105 | Bacteria | 5099 |
| 339 | Ga0157369_10056903 | 3300013105 | Bacteria | 4220 |
| 340 | Ga0157369_10067826 | 3300013105 | Bacteria | 3834 |
| 341 | Ga0157369_10078615 | 3300013105 | Bacteria | 3534 |
| 342 | Ga0157374_10000715 | 3300013296 | Bacteria | 29082 |
| 343 | Ga0157374_10000740 | 3300013296 | Bacteria | 28504 |
| 344 | Ga0157374_10001929 | 3300013296 | Bacteria | 17404 |
| 345 | Ga0157374_10005551 | 3300013296 | Bacteria | 10617 |
| 346 | Ga0157374_10008313 | 3300013296 | Bacteria | 8855 |
| 347 | Ga0157374_10009761 | 3300013296 | Bacteria | 8242 |
| 348 | Ga0157374_10158014 | 3300013296 | Bacteria | 2207 |
| 349 | Ga0157374_10175980 | 3300013296 | Bacteria | 2089 |
| 350 | Ga0157378_10015389 | 3300013297 | Bacteria | 6700 |
| 351 | Ga0157378_10020701 | 3300013297 | Bacteria | 5785 |
| 352 | Ga0157378_10026283 | 3300013297 | Bacteria | 5131 |
| 353 | Ga0157378_10037755 | 3300013297 | Bacteria | 4281 |
| 354 | Ga0157378_10038211 | 3300013297 | Bacteria | 4253 |
| 355 | Ga0157378_10050978 | 3300013297 | Bacteria | 3683 |
| 356 | Ga0157378_10051934 | 3300013297 | Bacteria | 3648 |
| 357 | Ga0163162_10000555 | 3300013306 | Bacteria | 34535 |
| 358 | Ga0163162_10000773 | 3300013306 | Bacteria | 29793 |
| 359 | Ga0163162_10002336 | 3300013306 | Bacteria | 17807 |
| 360 | Ga0163162_10003753 | 3300013306 | Bacteria | 14553 |
| 361 | Ga0163162_10004022 | 3300013306 | Bacteria | 14112 |
| 362 | Ga0163162_10004535 | 3300013306 | Bacteria | 13380 |
| 363 | Ga0163162_10010522 | 3300013306 | Bacteria | 8997 |
| 364 | Ga0163162_10011151 | 3300013306 | Bacteria | 8755 |
| 365 | Ga0163162_10020542 | 3300013306 | Bacteria | 6488 |
| 366 | Ga0163162_10020649 | 3300013306 | Bacteria | 6473 |
| 367 | Ga0163162_10028214 | 3300013306 | Bacteria | 5552 |
| 368 | Ga0163162_10110737 | 3300013306 | Bacteria | 2843 |
| 369 | Ga0163162_10230942 | 3300013306 | Bacteria | 1981 |
| 370 | Ga0163162_10241516 | 3300013306 | Bacteria | 1937 |
| 371 | Ga0157372_10001004 | 3300013307 | Bacteria | 30814 |
| 372 | Ga0157372_10039240 | 3300013307 | Bacteria | 5226 |
| 373 | Ga0157372_10064471 | 3300013307 | Bacteria | 4111 |
| 374 | Ga0157372_10071929 | 3300013307 | Bacteria | 3897 |
| 375 | Ga0157372_10072185 | 3300013307 | Bacteria | 3889 |
| 376 | Ga0157372_10127834 | 3300013307 | Bacteria | 2922 |
| 377 | Ga0157372_10218925 | 3300013307 | Bacteria | 2207 |
| 378 | Ga0157372_10230196 | 3300013307 | Bacteria | 2148 |
| 379 | Ga0157372_10243763 | 3300013307 | Bacteria | 2085 |
| 380 | Ga0157372_10260480 | 3300013307 | Bacteria | 2014 |
| 381 | Ga0157372_10283480 | 3300013307 | Bacteria | 1926 |
| 382 | Ga0157375_10000735 | 3300013308 | Bacteria | 28891 |
| 383 | Ga0157375_10003367 | 3300013308 | Bacteria | 13855 |
| 384 | Ga0157375_10006134 | 3300013308 | Bacteria | 10472 |
| 385 | Ga0157375_10008017 | 3300013308 | Bacteria | 9247 |
| 386 | Ga0157375_10013609 | 3300013308 | Bacteria | 7249 |
| 387 | Ga0157375_10089287 | 3300013308 | Bacteria | 3138 |
| 388 | Ga0157375_10161340 | 3300013308 | Bacteria | 2383 |
| 389 | Ga0157375_10254302 | 3300013308 | Bacteria | 1918 |
| 390 | Ga0163163_10000218 | 3300014325 | Bacteria | 59659 |
| 391 | Ga0163163_10002339 | 3300014325 | Bacteria | 16032 |
| 392 | Ga0163163_10011675 | 3300014325 | Bacteria | 7978 |
| 393 | Ga0163163_10034510 | 3300014325 | Bacteria | 4900 |
| 394 | Ga0163163_10084163 | 3300014325 | Bacteria | 3186 |
| 395 | Ga0163163_10105980 | 3300014325 | Bacteria | 2837 |
| 396 | Ga0163163_10117213 | 3300014325 | Bacteria | 2694 |
| 397 | Ga0157380_10024047 | 3300014326 | Bacteria | 4605 |
| 398 | Ga0157380_10074105 | 3300014326 | Bacteria | 2762 |
| 399 | Ga0182008_10026498 | 3300014497 | Bacteria | 2940 |
| 400 | Ga0157377_10004540 | 3300014745 | Bacteria | 6410 |
| 401 | Ga0157379_10004638 | 3300014968 | Bacteria | 11792 |
| 402 | Ga0157379_10030074 | 3300014968 | Bacteria | 4831 |
| 403 | Ga0157379_10041030 | 3300014968 | Unclassified | 4131 |
| 404 | Ga0157379_10047298 | 3300014968 | Bacteria | 3838 |
| 405 | Ga0157379_10098063 | 3300014968 | Bacteria | 2631 |
| 406 | Ga0157376_10003188 | 3300014969 | Bacteria | 11278 |
| 407 | Ga0157376_10003813 | 3300014969 | Bacteria | 10426 |
| 408 | Ga0157376_10006082 | 3300014969 | Bacteria | 8488 |
| 409 | Ga0157376_10007905 | 3300014969 | Bacteria | 7630 |
| 410 | Ga0157376_10017500 | 3300014969 | Bacteria | 5469 |
| 411 | Ga0157376_10062423 | 3300014969 | Unclassified | 3135 |
| 412 | Ga0157376_10064348 | 3300014969 | Bacteria | 3093 |
| 413 | Ga0182006_1000110 | 3300015261 | Bacteria | 88392 |
| 414 | Ga0182006_1000868 | 3300015261 | Bacteria | 20280 |
| 415 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 416 | Ga0182007_10004091 | 3300015262 | Bacteria | 6712 |
| 417 | Ga0182007_10008190 | 3300015262 | Unclassified | 4309 |
| 418 | Ga0163161_10000617 | 3300017792 | Bacteria | 28499 |
| 419 | Ga0163161_10001132 | 3300017792 | Bacteria | 20100 |
| 420 | Ga0163161_10003565 | 3300017792 | Bacteria | 10900 |
| 421 | Ga0163161_10015902 | 3300017792 | Bacteria | 5250 |
| 422 | Ga0163161_10020081 | 3300017792 | Bacteria | 4687 |
| 423 | Ga0163161_10024980 | 3300017792 | Bacteria | 4224 |
| 424 | Ga0163161_10055284 | 3300017792 | Unclassified | 2881 |
| 425 | Ga0206352_11067900 | 3300020078 | Bacteria | 1477 |
| 426 | Ga0213872_10005681 | 3300021361 | Bacteria | 6357 |
| 427 | Ga0207427_101087 | 3300025231 | Bacteria | 11112 |
| 428 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 429 | Ga0209258_100295 | 3300025242 | Bacteria | 81736 |
| 430 | Ga0207425_1000004 | 3300025245 | Bacteria | 1092421 |
| 431 | Ga0209646_1000037 | 3300025246 | Bacteria | 355116 |
| 432 | Ga0209026_1001866 | 3300025250 | Bacteria | 8591 |
| 433 | Ga0209148_1000242 | 3300025254 | Bacteria | 87005 |
| 434 | Ga0209129_1000005 | 3300025258 | Bacteria | 777812 |
| 435 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 436 | Ga0209673_1000130 | 3300025273 | Bacteria | 163870 |
| 437 | Ga0209130_1002095 | 3300025284 | Bacteria | 10683 |
| 438 | Ga0209676_1000686 | 3300025292 | Bacteria | 47720 |
| 439 | Ga0209676_1001398 | 3300025292 | Bacteria | 23345 |
| 440 | Ga0209025_1000009 | 3300025294 | Bacteria | 1092561 |
| 441 | Ga0209564_1009916 | 3300025295 | Bacteria | 4460 |
| 442 | Ga0209564_1020641 | 3300025295 | Bacteria | 2405 |
| 443 | Ga0209758_1000010 | 3300025297 | Bacteria | 1092782 |
| 444 | Ga0209758_1018343 | 3300025297 | Bacteria | 3433 |
| 445 | Ga0209050_1025214 | 3300025298 | Bacteria | 2029 |
| 446 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 447 | Ga0207426_1000134 | 3300025302 | Bacteria | 202226 |
| 448 | Ga0207426_1001093 | 3300025302 | Bacteria | 25077 |
| 449 | Ga0209051_1024026 | 3300025303 | Bacteria | 2520 |
| 450 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 451 | Ga0209257_1000008 | 3300025304 | Bacteria | 1294570 |
| 452 | Ga0209257_1002828 | 3300025304 | Bacteria | 16296 |
| 453 | Ga0207642_10080968 | 3300025899 | Bacteria | 1577 |
| 454 | Ga0207710_10002539 | 3300025900 | Bacteria | 8443 |
| 455 | Ga0207710_10024054 | 3300025900 | Bacteria | 2621 |
| 456 | Ga0207680_10000014 | 3300025903 | Bacteria | 179035 |
| 457 | Ga0207680_10062876 | 3300025903 | Bacteria | 2270 |
| 458 | Ga0207680_10080420 | 3300025903 | Bacteria | 2046 |
| 459 | Ga0207680_10118071 | 3300025903 | Bacteria | 1731 |
| 460 | Ga0207647_10000563 | 3300025904 | Bacteria | 29190 |
| 461 | Ga0207647_10042531 | 3300025904 | Bacteria | 2850 |
| 462 | Ga0207647_10046454 | 3300025904 | Bacteria | 2706 |
| 463 | Ga0207647_10055996 | 3300025904 | Bacteria | 2421 |
| 464 | Ga0207645_10000298 | 3300025907 | Bacteria | 41845 |
| 465 | Ga0207645_10000979 | 3300025907 | Bacteria | 23614 |
| 466 | Ga0207645_10002593 | 3300025907 | Bacteria | 14098 |
| 467 | Ga0207645_10009555 | 3300025907 | Bacteria | 6702 |
| 468 | Ga0207645_10034290 | 3300025907 | Bacteria | 3261 |
| 469 | Ga0207645_10069066 | 3300025907 | Bacteria | 2260 |
| 470 | Ga0207643_10020394 | 3300025908 | Bacteria | 3637 |
| 471 | Ga0207705_10004298 | 3300025909 | Bacteria | 10784 |
| 472 | Ga0207705_10015164 | 3300025909 | Bacteria | 5538 |
| 473 | Ga0207705_10019756 | 3300025909 | Bacteria | 4817 |
| 474 | Ga0207705_10062536 | 3300025909 | Bacteria | 2689 |
| 475 | Ga0207705_10152710 | 3300025909 | Bacteria | 1731 |
| 476 | Ga0207654_10004369 | 3300025911 | Bacteria | 7125 |
| 477 | Ga0207707_10002312 | 3300025912 | Bacteria | 17183 |
| 478 | Ga0207707_10073724 | 3300025912 | Bacteria | 2977 |
| 479 | Ga0207707_10124166 | 3300025912 | Bacteria | 2257 |
| 480 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 481 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 482 | Ga0207695_10000515 | 3300025913 | Bacteria | 82285 |
| 483 | Ga0207695_10001197 | 3300025913 | Bacteria | 44626 |
| 484 | Ga0207695_10007302 | 3300025913 | Bacteria | 14106 |
| 485 | Ga0207695_10018108 | 3300025913 | Bacteria | 8152 |
| 486 | Ga0207695_10043598 | 3300025913 | Bacteria | 4781 |
| 487 | Ga0207695_10055384 | 3300025913 | Bacteria | 4133 |
| 488 | Ga0207695_10069983 | 3300025913 | Bacteria | 3589 |
| 489 | Ga0207695_10213272 | 3300025913 | Bacteria | 1840 |
| 490 | Ga0207671_10002536 | 3300025914 | Bacteria | 19453 |
| 491 | Ga0207671_10002992 | 3300025914 | Bacteria | 17322 |
| 492 | Ga0207671_10003129 | 3300025914 | Bacteria | 16809 |
| 493 | Ga0207671_10007505 | 3300025914 | Bacteria | 9458 |
| 494 | Ga0207671_10008601 | 3300025914 | Bacteria | 8629 |
| 495 | Ga0207671_10038512 | 3300025914 | Bacteria | 3543 |
| 496 | Ga0207671_10056877 | 3300025914 | Bacteria | 2898 |
| 497 | Ga0207662_10049139 | 3300025918 | Bacteria | 2502 |
| 498 | Ga0207657_10037840 | 3300025919 | Bacteria | 4304 |
| 499 | Ga0207657_10108147 | 3300025919 | Bacteria | 2299 |
| 500 | Ga0207657_10124693 | 3300025919 | Bacteria | 2116 |
| 501 | Ga0207649_10039990 | 3300025920 | Bacteria | 2846 |
| 502 | Ga0207652_10000301 | 3300025921 | Bacteria | 50969 |
| 503 | Ga0207652_10001364 | 3300025921 | Bacteria | 21700 |
| 504 | Ga0207652_10028149 | 3300025921 | Bacteria | 4687 |
| 505 | Ga0207652_10132924 | 3300025921 | Bacteria | 2220 |
| 506 | Ga0207681_10034029 | 3300025923 | Bacteria | 3347 |
| 507 | Ga0207681_10169649 | 3300025923 | Unclassified | 1653 |
| 508 | Ga0207694_10028164 | 3300025924 | Bacteria | 4282 |
| 509 | Ga0207694_10195329 | 3300025924 | Bacteria | 1645 |
| 510 | Ga0207650_10061745 | 3300025925 | Unclassified | 2798 |
| 511 | Ga0207650_10106669 | 3300025925 | Bacteria | 2164 |
| 512 | Ga0207650_10170484 | 3300025925 | Bacteria | 1729 |
| 513 | Ga0207659_10021177 | 3300025926 | Bacteria | 4311 |
| 514 | Ga0207659_10033668 | 3300025926 | Bacteria | 3529 |
| 515 | Ga0207659_10040100 | 3300025926 | Bacteria | 3272 |
| 516 | Ga0207659_10154982 | 3300025926 | Unclassified | 1792 |
| 517 | Ga0207644_10017737 | 3300025931 | Bacteria | 4812 |
| 518 | Ga0207690_10015276 | 3300025932 | Bacteria | 4649 |
| 519 | Ga0207690_10126486 | 3300025932 | Bacteria | 1864 |
| 520 | Ga0207706_10000246 | 3300025933 | Bacteria | 59254 |
| 521 | Ga0207706_10011242 | 3300025933 | Bacteria | 8163 |
| 522 | Ga0207706_10033205 | 3300025933 | Bacteria | 4594 |
| 523 | Ga0207706_10033206 | 3300025933 | Bacteria | 4594 |
| 524 | Ga0207706_10063906 | 3300025933 | Bacteria | 3240 |
| 525 | Ga0207706_10073160 | 3300025933 | Bacteria | 3014 |
| 526 | Ga0207706_10161498 | 3300025933 | Unclassified | 1969 |
| 527 | Ga0207686_10001493 | 3300025934 | Bacteria | 13195 |
| 528 | Ga0207686_10066224 | 3300025934 | Bacteria | 2306 |
| 529 | Ga0207686_10136787 | 3300025934 | Bacteria | 1688 |
| 530 | Ga0207709_10000003 | 3300025935 | Bacteria | 1050072 |
| 531 | Ga0207670_10004542 | 3300025936 | Bacteria | 7493 |
| 532 | Ga0207670_10062112 | 3300025936 | Bacteria | 2552 |
| 533 | Ga0207704_10000011 | 3300025938 | Bacteria | 180140 |
| 534 | Ga0207704_10006675 | 3300025938 | Bacteria | 5403 |
| 535 | Ga0207704_10048200 | 3300025938 | Bacteria | 2553 |
| 536 | Ga0207691_10001273 | 3300025940 | Bacteria | 25203 |
| 537 | Ga0207691_10004645 | 3300025940 | Bacteria | 13298 |
| 538 | Ga0207691_10012876 | 3300025940 | Bacteria | 8007 |
| 539 | Ga0207691_10021514 | 3300025940 | Bacteria | 6090 |
| 540 | Ga0207691_10026811 | 3300025940 | Bacteria | 5407 |
| 541 | Ga0207691_10140235 | 3300025940 | Bacteria | 2131 |
| 542 | Ga0207711_10085185 | 3300025941 | Bacteria | 2768 |
| 543 | Ga0207689_10002295 | 3300025942 | Bacteria | 17907 |
| 544 | Ga0207689_10005981 | 3300025942 | Bacteria | 10761 |
| 545 | Ga0207689_10011619 | 3300025942 | Bacteria | 7546 |
| 546 | Ga0207689_10025097 | 3300025942 | Bacteria | 4997 |
| 547 | Ga0207689_10033598 | 3300025942 | Bacteria | 4261 |
| 548 | Ga0207689_10037526 | 3300025942 | Bacteria | 4019 |
| 549 | Ga0207661_10009033 | 3300025944 | Bacteria | 7140 |
| 550 | Ga0207679_10012320 | 3300025945 | Bacteria | 5573 |
| 551 | Ga0207679_10022977 | 3300025945 | Bacteria | 4256 |
| 552 | Ga0207679_10079105 | 3300025945 | Bacteria | 2506 |
| 553 | Ga0207667_10000117 | 3300025949 | Bacteria | 127391 |
| 554 | Ga0207667_10000197 | 3300025949 | Bacteria | 87987 |
| 555 | Ga0207667_10000209 | 3300025949 | Bacteria | 83277 |
| 556 | Ga0207667_10003048 | 3300025949 | Bacteria | 20784 |
| 557 | Ga0207667_10009393 | 3300025949 | Bacteria | 11523 |
| 558 | Ga0207667_10009844 | 3300025949 | Bacteria | 11231 |
| 559 | Ga0207667_10015074 | 3300025949 | Bacteria | 8790 |
| 560 | Ga0207667_10148600 | 3300025949 | Bacteria | 2412 |
| 561 | Ga0207651_10005874 | 3300025960 | Bacteria | 6348 |
| 562 | Ga0207651_10015179 | 3300025960 | Bacteria | 4469 |
| 563 | Ga0207651_10023804 | 3300025960 | Bacteria | 3776 |
| 564 | Ga0207651_10025737 | 3300025960 | Bacteria | 3662 |
| 565 | Ga0207651_10075319 | 3300025960 | Bacteria | 2408 |
| 566 | Ga0207651_10091926 | 3300025960 | Bacteria | 2223 |
| 567 | Ga0207651_10134748 | 3300025960 | Bacteria | 1898 |
| 568 | Ga0207712_10000482 | 3300025961 | Bacteria | 33330 |
| 569 | Ga0207712_10002038 | 3300025961 | Bacteria | 13255 |
| 570 | Ga0207712_10010801 | 3300025961 | Bacteria | 5808 |
| 571 | Ga0207712_10019928 | 3300025961 | Bacteria | 4386 |
| 572 | Ga0207712_10047892 | 3300025961 | Bacteria | 2971 |
| 573 | Ga0207712_10059931 | 3300025961 | Bacteria | 2696 |
| 574 | Ga0207712_10068830 | 3300025961 | Bacteria | 2538 |
| 575 | Ga0207712_10116532 | 3300025961 | Bacteria | 2013 |
| 576 | Ga0207668_10000617 | 3300025972 | Bacteria | 22106 |
| 577 | Ga0207668_10010482 | 3300025972 | Bacteria | 5601 |
| 578 | Ga0207640_10035597 | 3300025981 | Bacteria | 3117 |
| 579 | Ga0207658_10006444 | 3300025986 | Bacteria | 8013 |
| 580 | Ga0207677_10010708 | 3300026023 | Bacteria | 5198 |
| 581 | Ga0207677_10018744 | 3300026023 | Bacteria | 4160 |
| 582 | Ga0207677_10025054 | 3300026023 | Bacteria | 3717 |
| 583 | Ga0207677_10155314 | 3300026023 | Bacteria | 1771 |
| 584 | Ga0207677_10155500 | 3300026023 | Bacteria | 1770 |
| 585 | Ga0207677_10163501 | 3300026023 | Bacteria | 1732 |
| 586 | Ga0207703_10001353 | 3300026035 | Bacteria | 22448 |
| 587 | Ga0207703_10005312 | 3300026035 | Bacteria | 10378 |
| 588 | Ga0207703_10143527 | 3300026035 | Unclassified | 2074 |
| 589 | Ga0207703_10146961 | 3300026035 | Bacteria | 2051 |
| 590 | Ga0207703_10243883 | 3300026035 | Bacteria | 1616 |
| 591 | Ga0207639_10013965 | 3300026041 | Bacteria | 5635 |
| 592 | Ga0207639_10022389 | 3300026041 | Bacteria | 4552 |
| 593 | Ga0207639_10087962 | 3300026041 | Bacteria | 2478 |
| 594 | Ga0207708_10027777 | 3300026075 | Bacteria | 4285 |
| 595 | Ga0207708_10117390 | 3300026075 | Bacteria | 2071 |
| 596 | Ga0207702_10000402 | 3300026078 | Bacteria | 49308 |
| 597 | Ga0207702_10007706 | 3300026078 | Bacteria | 9145 |
| 598 | Ga0207702_10058598 | 3300026078 | Bacteria | 3277 |
| 599 | Ga0207702_10082943 | 3300026078 | Bacteria | 2788 |
| 600 | Ga0207702_10209872 | 3300026078 | Bacteria | 1810 |
| 601 | Ga0207641_10000015 | 3300026088 | Bacteria | 321332 |
| 602 | Ga0207641_10000088 | 3300026088 | Bacteria | 131959 |
| 603 | Ga0207641_10003713 | 3300026088 | Bacteria | 13451 |
| 604 | Ga0207641_10005384 | 3300026088 | Bacteria | 10932 |
| 605 | Ga0207641_10060038 | 3300026088 | Bacteria | 3240 |
| 606 | Ga0207641_10288087 | 3300026088 | Bacteria | 1547 |
| 607 | Ga0207648_10004907 | 3300026089 | Bacteria | 13620 |
| 608 | Ga0207648_10013902 | 3300026089 | Bacteria | 7465 |
| 609 | Ga0207648_10015205 | 3300026089 | Bacteria | 7082 |
| 610 | Ga0207648_10028250 | 3300026089 | Bacteria | 4974 |
| 611 | Ga0207648_10035635 | 3300026089 | Bacteria | 4384 |
| 612 | Ga0207648_10104941 | 3300026089 | Bacteria | 2479 |
| 613 | Ga0207676_10015212 | 3300026095 | Bacteria | 5549 |
| 614 | Ga0207676_10016815 | 3300026095 | Bacteria | 5296 |
| 615 | Ga0207676_10259282 | 3300026095 | Bacteria | 1569 |
| 616 | Ga0207674_10001258 | 3300026116 | Bacteria | 33135 |
| 617 | Ga0207674_10010597 | 3300026116 | Bacteria | 10429 |
| 618 | Ga0207674_10025124 | 3300026116 | Bacteria | 6357 |
| 619 | Ga0207674_10028727 | 3300026116 | Bacteria | 5866 |
| 620 | Ga0207674_10082272 | 3300026116 | Bacteria | 3221 |
| 621 | Ga0207674_10130099 | 3300026116 | Bacteria | 2481 |
| 622 | Ga0207674_10136072 | 3300026116 | Bacteria | 2419 |
| 623 | Ga0207674_10264265 | 3300026116 | Bacteria | 1668 |
| 624 | Ga0207675_100000496 | 3300026118 | Bacteria | 38204 |
| 625 | Ga0207675_100029111 | 3300026118 | Bacteria | 5147 |
| 626 | Ga0207675_100036217 | 3300026118 | Bacteria | 4603 |
| 627 | Ga0207675_100050055 | 3300026118 | Bacteria | 3899 |
| 628 | Ga0207675_100097964 | 3300026118 | Bacteria | 2762 |
| 629 | Ga0207683_10004452 | 3300026121 | Bacteria | 12100 |
| 630 | Ga0207683_10031923 | 3300026121 | Bacteria | 4573 |
| 631 | Ga0207683_10032833 | 3300026121 | Bacteria | 4509 |
| 632 | Ga0207683_10066895 | 3300026121 | Bacteria | 3169 |
| 633 | Ga0207698_10000781 | 3300026142 | Bacteria | 18499 |
| 634 | Ga0207698_10003383 | 3300026142 | Bacteria | 9602 |
| 635 | Ga0207698_10023497 | 3300026142 | Bacteria | 4308 |
| 636 | Ga0207698_10043756 | 3300026142 | Bacteria | 3358 |
| 637 | Ga0207698_10067557 | 3300026142 | Bacteria | 2819 |
| 638 | Ga0268266_10000038 | 3300028379 | Bacteria | 325729 |
| 639 | Ga0268266_10002407 | 3300028379 | Bacteria | 20167 |
| 640 | Ga0268266_10006486 | 3300028379 | Bacteria | 10709 |
| 641 | Ga0268266_10123418 | 3300028379 | Bacteria | 2307 |
| 642 | Ga0268265_10024985 | 3300028380 | Bacteria | 4234 |
| 643 | Ga0268265_10038092 | 3300028380 | Bacteria | 3534 |
| 644 | Ga0268264_10000167 | 3300028381 | Bacteria | 146190 |
| 645 | Ga0268264_10001730 | 3300028381 | Bacteria | 20054 |
| 646 | Ga0268264_10003170 | 3300028381 | Bacteria | 14246 |
| 647 | Ga0268264_10010792 | 3300028381 | Bacteria | 7547 |
| 648 | Ga0268264_10016685 | 3300028381 | Bacteria | 6013 |
| 649 | Ga0268264_10146204 | 3300028381 | Bacteria | 2114 |
| 650 | Ga0265337_1004886 | 3300028556 | Bacteria | 5460 |
| 651 | Ga0265337_1021708 | 3300028556 | Bacteria | 1998 |
| 652 | Ga0307517_10002284 | 3300028786 | Bacteria | 30925 |
| 653 | Ga0307517_10039015 | 3300028786 | Bacteria | 5233 |
| 654 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 655 | Ga0307515_10000118 | 3300028794 | Bacteria | 190444 |
| 656 | Ga0265338_10029424 | 3300028800 | Bacteria | 5446 |
| 657 | Ga0307511_10004978 | 3300030521 | Bacteria | 13548 |
| 658 | Ga0316177_1089841 | 3300030731 | Bacteria | 3523 |
| 659 | Ga0316176_1068370 | 3300030732 | Bacteria | 20672 |
| 660 | Ga0316183_1006105 | 3300030742 | Bacteria | 90612 |
| 661 | Ga0316181_1099963 | 3300030744 | Bacteria | 35143 |
| 662 | Ga0265327_10000048 | 3300031251 | Bacteria | 269173 |
| 663 | Ga0265327_10000087 | 3300031251 | Bacteria | 198174 |
| 664 | Ga0265327_10006000 | 3300031251 | Bacteria | 9881 |
| 665 | Ga0265327_10027369 | 3300031251 | Bacteria | 3284 |
| 666 | Ga0265327_10040674 | 3300031251 | Bacteria | 2512 |
| 667 | Ga0265316_10052175 | 3300031344 | Bacteria | 3209 |
| 668 | Ga0307513_10043230 | 3300031456 | Bacteria | 4952 |
| 669 | Ga0307509_10011639 | 3300031507 | Bacteria | 10631 |
| 670 | Ga0307509_10034066 | 3300031507 | Bacteria | 5599 |
| 671 | Ga0307508_10004344 | 3300031616 | Bacteria | 13864 |
| 672 | Ga0265314_10000692 | 3300031711 | Bacteria | 40918 |
| 673 | Ga0307516_10000656 | 3300031730 | Bacteria | 46771 |
| 674 | Ga0307405_10000019 | 3300031731 | Bacteria | 167960 |
| 675 | Ga0307405_10032487 | 3300031731 | Bacteria | 3086 |
| 676 | Ga0307407_10000019 | 3300031903 | Bacteria | 129701 |
| 677 | Ga0307407_10010507 | 3300031903 | Bacteria | 4371 |
| 678 | Ga0307416_100000043 | 3300032002 | Bacteria | 130035 |
| 679 | Ga0307416_100000341 | 3300032002 | Bacteria | 24168 |
| 680 | Ga0307414_10003747 | 3300032004 | Bacteria | 8163 |
| 681 | Ga0307414_10020378 | 3300032004 | Bacteria | 4132 |
| 682 | Ga0307414_10021936 | 3300032004 | Bacteria | 4019 |
| 683 | Ga0307414_10047697 | 3300032004 | Bacteria | 2950 |
| 684 | Ga0307414_10071634 | 3300032004 | Bacteria | 2501 |
| 685 | Ga0307415_100048082 | 3300032126 | Bacteria | 2876 |
| 686 | Ga0307510_10000366 | 3300033180 | Bacteria | 42784 |
| 687 | Ga0307510_10000584 | 3300033180 | Bacteria | 36797 |
| 688 | Ga0373941_0026539 | 3300035115 | Bacteria | 1683 |
| 689 | Ga0373955_0017629 | 3300035172 | Bacteria | 3538 |
| 690 | Ga0373937_0075722 | 3300036401 | Bacteria | 3107 |
| 691 | Ga0316584_0135970 | 3300036712 | Bacteria | 1835 |
| 692 | Ga0395899_0000199 | 3300037312 | Bacteria | 87960 |
| 693 | Ga0395899_0029905 | 3300037312 | Bacteria | 4099 |
| 694 | Ga0395899_0035871 | 3300037312 | Bacteria | 3721 |
| 695 | Ga0395900_0000157 | 3300037418 | Bacteria | 112131 |
| 696 | Ga0395900_0001198 | 3300037418 | Bacteria | 32072 |
| 697 | Ga0395900_0018750 | 3300037418 | Bacteria | 7056 |
| 698 | Ga0395900_0072094 | 3300037418 | Bacteria | 3551 |
| 699 | Ga0395900_0282851 | 3300037418 | Bacteria | 1650 |
| 700 | Ga0395898_0002190 | 3300037466 | Bacteria | 23869 |
| 701 | Ga0395898_0154401 | 3300037466 | Bacteria | 2196 |
| 702 | Ga0395905_0000195 | 3300037471 | Bacteria | 95130 |
| 703 | Ga0395905_0000405 | 3300037471 | Bacteria | 60956 |
| 704 | Ga0395905_0186841 | 3300037471 | Bacteria | 1945 |
| 705 | Ga0395901_0000283 | 3300038443 | Bacteria | 62908 |
| 706 | Ga0395901_0083896 | 3300038443 | Bacteria | 3331 |
| 707 | Ga0395901_0335020 | 3300038443 | Bacteria | 1563 |
| 708 | Ga0436365_0040113 | 3300039437 | Bacteria | 10715 |
| 709 | Ga0436365_0486460 | 3300039437 | Bacteria | 2515 |
| 710 | Ga0436361_1176719 | 3300039447 | Bacteria | 6431 |
| 711 | Ga0439436_0013968 | 3300041404 | Bacteria | 2426 |
| 712 | Ga0439439_0002323 | 3300041406 | Bacteria | 4021 |
| 713 | Ga0451853_4091274 | 3300041512 | Bacteria | 5076 |
| 714 | Ga0439449_0023565 | 3300042007 | Bacteria | 2301 |
| 715 | Ga0439449_0043570 | 3300042007 | Bacteria | 1666 |
| 716 | Ga0439457_000443 | 3300042014 | Bacteria | 11952 |
| 717 | Ga0439462_0017135 | 3300042015 | Bacteria | 1876 |
| 718 | Ga0451577_0012835 | 3300042876 | Bacteria | 7863 |
| 719 | Ga0451577_0048296 | 3300042876 | Bacteria | 3802 |
| 720 | Ga0451577_0090655 | 3300042876 | Bacteria | 2729 |
| 721 | Ga0451577_0126817 | 3300042876 | Bacteria | 2287 |
| 722 | Ga0451577_0286797 | 3300042876 | Bacteria | 1492 |
| 723 | Ga0466969_0000580 | 3300044656 | Bacteria | 19895 |
| 724 | Ga0466972_0000009 | 3300044658 | Bacteria | 256374 |
| 725 | Ga0466972_0000112 | 3300044658 | Bacteria | 70349 |
| 726 | Ga0466972_0022719 | 3300044658 | Bacteria | 3121 |
| 727 | Ga0466972_0078419 | 3300044658 | Bacteria | 1573 |
| 728 | Ga0453683_0000181 | 3300044673 | Bacteria | 87343 |
| 729 | Ga0453683_0002130 | 3300044673 | Bacteria | 15772 |
| 730 | Ga0453683_0104499 | 3300044673 | Bacteria | 1779 |
| 731 | Ga0466966_0000144 | 3300044684 | Bacteria | 45151 |
| 732 | Ga0466961_0009435 | 3300044693 | Bacteria | 6212 |
| 733 | Ga0453684_0002765 | 3300044712 | Bacteria | 41523 |
| 734 | Ga0453684_0027906 | 3300044712 | Bacteria | 8076 |
| 735 | Ga0453684_0055338 | 3300044712 | Bacteria | 5159 |
| 736 | Ga0453684_0080395 | 3300044712 | Bacteria | 4070 |
| 737 | Ga0453684_0087982 | 3300044712 | Bacteria | 3848 |
| 738 | Ga0453684_0121940 | 3300044712 | Bacteria | 3145 |
| 739 | Ga0453684_0154856 | 3300044712 | Bacteria | 2719 |
| 740 | Ga0466970_0000219 | 3300044765 | Bacteria | 28141 |
| 741 | Ga0466957_0004511 | 3300044842 | Bacteria | 7771 |
| 742 | Ga0466957_0007656 | 3300044842 | Bacteria | 6109 |
| 743 | Ga0466959_0000097 | 3300045049 | Bacteria | 55620 |
| 744 | Ga0466959_0006121 | 3300045049 | Bacteria | 8313 |
| 745 | Ga0466959_0009178 | 3300045049 | Bacteria | 7024 |
| 746 | Ga0451576_0000513 | 3300045051 | Bacteria | 85081 |
| 747 | Ga0451576_0001538 | 3300045051 | Bacteria | 38821 |
| 748 | Ga0451576_0013570 | 3300045051 | Bacteria | 9110 |
| 749 | Ga0451576_0029508 | 3300045051 | Bacteria | 5868 |
| 750 | Ga0451576_0129800 | 3300045051 | Bacteria | 2627 |
| 751 | Ga0451576_0289011 | 3300045051 | Bacteria | 1714 |
| 752 | Ga0451576_0329310 | 3300045051 | Bacteria | 1599 |
| 753 | Ga0451576_0393376 | 3300045051 | Bacteria | 1453 |
| 754 | Ga0495627_004188 | 3300046453 | Bacteria | 6113 |
| 755 | Ga0495638_0065701 | 3300046460 | Bacteria | 2232 |
| 756 | Ga0495606_0003054 | 3300046507 | Bacteria | 18247 |
| 757 | Ga0495628_0045889 | 3300046516 | Bacteria | 3473 |
| 758 | Ga0495630_0067282 | 3300046517 | Bacteria | 2693 |
| 759 | Ga0495630_0111568 | 3300046517 | Bacteria | 2071 |
| 760 | Ga0495631_0001845 | 3300046518 | Bacteria | 12502 |
| 761 | Ga0495652_0042929 | 3300046529 | Bacteria | 3898 |
| 762 | Ga0495586_0000034 | 3300046535 | Bacteria | 89391 |
| 763 | Ga0495587_0062899 | 3300046536 | Bacteria | 2172 |
| 764 | Ga0495633_0000159 | 3300046558 | Bacteria | 88400 |
| 765 | Ga0495668_0000354 | 3300046616 | Bacteria | 60932 |
| 766 | Ga0495668_0079637 | 3300046616 | Bacteria | 1798 |
| 767 | Ga0495634_0094944 | 3300046642 | Bacteria | 1932 |
| 768 | Ga0495611_0000575 | 3300046648 | Bacteria | 21197 |
| 769 | Ga0495625_0078642 | 3300046660 | Bacteria | 2302 |
| 770 | Ga0495613_0039614 | 3300046689 | Unclassified | 3494 |
| 771 | Ga0495674_0000976 | 3300047319 | Bacteria | 27458 |
| 772 | Ga0495672_0020427 | 3300047320 | Bacteria | 4342 |
| 773 | Ga0495676_0009484 | 3300047321 | Bacteria | 8867 |
| 774 | Ga0495676_0098157 | 3300047321 | Bacteria | 2174 |
| 775 | Ga0495687_001403 | 3300047443 | Bacteria | 22225 |
| 776 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 777 | Ga0496100_0064183 | 3300048903 | Bacteria | 2429 |
| 778 | Ga0496107_0026080 | 3300048910 | Bacteria | 4142 |
| 779 | Ga0496108_0266551 | 3300048911 | Bacteria | 1491 |
| 780 | Ga0496109_0033911 | 3300048912 | Bacteria | 4595 |
| 781 | Ga0496110_0102393 | 3300048913 | Bacteria | 2568 |
| 782 | Ga0496114_0045581 | 3300048917 | Bacteria | 3644 |
| 783 | Ga0496116_0009315 | 3300048919 | Bacteria | 8388 |
| 784 | Ga0496117_0000938 | 3300048920 | Bacteria | 44676 |
| 785 | Ga0496117_0004744 | 3300048920 | Bacteria | 14761 |
| 786 | Ga0496121_0000011 | 3300048924 | Bacteria | 792193 |
| 787 | Ga0496122_0003582 | 3300048925 | Bacteria | 20269 |
| 788 | Ga0496122_0007600 | 3300048925 | Bacteria | 11978 |
| 789 | Ga0496122_0012699 | 3300048925 | Bacteria | 8343 |
| 790 | Ga0496123_0005589 | 3300048926 | Bacteria | 12567 |
| 791 | Ga0496123_0030795 | 3300048926 | Bacteria | 3920 |
| 792 | Ga0496125_0138933 | 3300048928 | Bacteria | 1693 |
| 793 | Ga0496126_0058412 | 3300048929 | Bacteria | 3477 |
| 794 | Ga0501298_001859 | 3300049521 | Bacteria | 3130 |
| 795 | Ga0501300_004413 | 3300049523 | Bacteria | 2086 |
| 796 | Ga0501032_0005075 | 3300049569 | Bacteria | 9834 |
| 797 | Ga0501032_0052328 | 3300049569 | Bacteria | 2751 |
| 798 | Ga0501033_0144786 | 3300049570 | Bacteria | 1717 |
| 799 | Ga0501034_0002417 | 3300049571 | Bacteria | 22602 |
| 800 | Ga0501034_0009516 | 3300049571 | Bacteria | 10172 |
| 801 | Ga0501034_0068233 | 3300049571 | Bacteria | 3567 |
| 802 | Ga0501034_0328059 | 3300049571 | Bacteria | 1462 |
| 803 | Ga0501036_0022474 | 3300049572 | Bacteria | 5305 |
| 804 | Ga0501037_0069343 | 3300049573 | Bacteria | 2567 |
| 805 | Ga0501038_0003726 | 3300049574 | Bacteria | 14200 |
| 806 | Ga0501043_0003522 | 3300049579 | Bacteria | 12873 |
| 807 | Ga0501043_0013663 | 3300049579 | Bacteria | 6355 |
| 808 | Ga0501046_0124022 | 3300049580 | Bacteria | 1964 |
| 809 | Ga0501046_0127689 | 3300049580 | Bacteria | 1930 |
| 810 | Ga0501046_0159741 | 3300049580 | Bacteria | 1696 |
| 811 | Ga0501047_0014683 | 3300049581 | Bacteria | 7453 |
| 812 | Ga0501047_0041126 | 3300049581 | Bacteria | 4467 |
| 813 | Ga0501047_0046945 | 3300049581 | Bacteria | 4173 |
| 814 | Ga0501067_0073249 | 3300049583 | Bacteria | 1898 |
| 815 | Ga0501069_0056045 | 3300049585 | Bacteria | 2195 |
| 816 | Ga0501073_0001563 | 3300049589 | Bacteria | 16973 |
| 817 | Ga0501074_0016152 | 3300049590 | Bacteria | 5425 |
| 818 | Ga0501201_001583 | 3300049651 | Bacteria | 2116 |
| 819 | Ga0501202_001201 | 3300049652 | Bacteria | 4081 |
| 820 | Ga0501207_003077 | 3300049654 | Bacteria | 2194 |
| 821 | Ga0501217_001912 | 3300049661 | Bacteria | 4001 |
| 822 | Ga0501223_004327 | 3300049663 | Bacteria | 3050 |
| 823 | Ga0501233_001105 | 3300049668 | Bacteria | 4570 |
| 824 | Ga0501235_000216 | 3300049669 | Bacteria | 10374 |
| 825 | Ga0501249_008146 | 3300049679 | Bacteria | 2174 |
| 826 | Ga0501252_000189 | 3300049682 | Bacteria | 4021 |
| 827 | Ga0501259_002702 | 3300049688 | Bacteria | 2853 |
| 828 | Ga0501221_001496 | 3300049704 | Bacteria | 3871 |
| 829 | Ga0501225_0010736 | 3300049705 | Bacteria | 2590 |
| 830 | Ga0501080_0009971 | 3300049742 | Bacteria | 8682 |
| 831 | Ga0501280_001371 | 3300049776 | Bacteria | 4569 |
| 832 | Ga0501035_0006202 | 3300049822 | Bacteria | 11248 |
| 833 | Ga0501035_0103845 | 3300049822 | Bacteria | 2493 |
| 834 | Ga0501035_0191524 | 3300049822 | Bacteria | 1758 |
| 835 | Ga0501044_0014709 | 3300049823 | Bacteria | 8437 |
| 836 | Ga0501044_0087201 | 3300049823 | Bacteria | 3153 |
| 837 | nmdc:mga0k408_46307_c1 | 3300050493 | Bacteria | 2511 |
| 838 | nmdc:mga05p37_13392_c1 | 3300050507 | Bacteria | 9830 |
| 839 | nmdc:mga05p37_159810_c1 | 3300050507 | Bacteria | 2752 |
| 840 | nmdc:mga05p37_186185_c1 | 3300050507 | Bacteria | 2524 |
| 841 | nmdc:mga09592_7424_c1 | 3300050508 | Bacteria | 8911 |
| 842 | nmdc:mga06r32_170525_c1 | 3300050510 | Unclassified | 2160 |
| 843 | nmdc:mga08y16_17603_c1 | 3300050511 | Bacteria | 7525 |
| 844 | nmdc:mga08y16_256981_c1 | 3300050511 | Bacteria | 1804 |
| 845 | nmdc:mga08y16_59548_c1 | 3300050511 | Bacteria | 3988 |
| 846 | nmdc:mga08y16_64265_c1 | 3300050511 | Bacteria | 3832 |
| 847 | nmdc:mga0a205_153495_c1 | 3300050515 | Bacteria | 2201 |
| 848 | Ga0495619_0111335 | 3300053085 | Bacteria | 1871 |
| 849 | Ga0500646_0001432 | 3300053090 | Bacteria | 6330 |
| 850 | Ga0500646_0009704 | 3300053090 | Bacteria | 2464 |
| 851 | Ga0500583_0000078 | 3300053092 | Bacteria | 58451 |
| 852 | Ga0500651_0032856 | 3300053093 | Bacteria | 3272 |
| 853 | Ga0500607_010270 | 3300053121 | Bacteria | 5590 |
| 854 | Ga0500608_000548 | 3300053122 | Bacteria | 14063 |
| 855 | Ga0500642_0027173 | 3300053130 | Bacteria | 2346 |
| 856 | Ga0500652_010637 | 3300053131 | Bacteria | 3161 |
| 857 | Ga0500559_0022676 | 3300053136 | Bacteria | 2663 |
| 858 | Ga0500568_0003925 | 3300053139 | Bacteria | 8097 |
| 859 | Ga0500568_0004057 | 3300053139 | Bacteria | 7928 |
| 860 | Ga0500577_0001866 | 3300053142 | Bacteria | 5400 |
| 861 | Ga0500616_0011098 | 3300053153 | Bacteria | 5350 |
| 862 | Ga0500622_0000072 | 3300053156 | Bacteria | 112062 |
| 863 | Ga0500622_0002480 | 3300053156 | Bacteria | 13283 |
| 864 | Ga0500636_0005328 | 3300053177 | Bacteria | 7329 |
| 865 | Ga0501084_0119351 | 3300054114 | Bacteria | 2216 |
| 866 | Ga0501082_0037498 | 3300060353 | Bacteria | 4178 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028381 | Ga0268264_10016685 | Ga0268264_100166852 | 368 |
| 2 | 3300042876 | Ga0451577_0090655 | Ga0451577_0090655_1424_2590 | 378 |
| 3 | 3300042876 | Ga0451577_0126817 | Ga0451577_0126817_1004_2170 | 378 |
| 4 | 3300046535 | Ga0495586_0000034 | Ga0495586_0000034_75708_76868 | 378 |
| 5 | 3300046642 | Ga0495634_0094944 | Ga0495634_0094944_570_1730 | 378 |
| 6 | 3300046689 | Ga0495613_0039614 | Ga0495613_0039614_333_1493 | 378 |
| 7 | 3300047319 | Ga0495674_0000976 | Ga0495674_0000976_19679_20839 | 378 |
| 8 | 3300047321 | Ga0495676_0009484 | Ga0495676_0009484_6476_7636 | 378 |
| 9 | 3300025936 | Ga0207670_10004542 | Ga0207670_100045428 | 386 |
| 10 | 3300025972 | Ga0207668_10010482 | Ga0207668_100104824 | 386 |
| 11 | 3300005339 | Ga0070660_100026775 | Ga0070660_1000267753 | 387 |
| 12 | 3300025919 | Ga0207657_10037840 | Ga0207657_100378403 | 387 |
| 13 | 3300005459 | Ga0068867_100092285 | Ga0068867_1000922852 | 388 |
| 14 | 3300005471 | Ga0070698_100003501 | Ga0070698_1000035015 | 389 |
| 15 | 3300042007 | Ga0439449_0043570 | Ga0439449_0043570_294_1601 | 392 |
| 16 | 3300005577 | Ga0068857_100036112 | Ga0068857_1000361122 | 393 |
| 17 | 3300005618 | Ga0068864_100041076 | Ga0068864_1000410764 | 393 |
| 18 | 3300026116 | Ga0207674_10028727 | Ga0207674_100287276 | 393 |
| 19 | 3300044658 | Ga0466972_0078419 | Ga0466972_0078419_30_1226 | 394 |
| 20 | 3300045051 | Ga0451576_0289011 | Ga0451576_0289011_500_1684 | 394 |
| 21 | 3300006880 | Ga0075429_100047835 | Ga0075429_1000478351 | 396 |
| 22 | 3300009093 | Ga0105240_10110486 | Ga0105240_101104862 | 396 |
| 23 | 3300010375 | Ga0105239_10000529 | Ga0105239_100005293 | 396 |
| 24 | 3300053085 | Ga0495619_0111335 | Ga0495619_0111335_596_1816 | 396 |
| 25 | 3300053131 | Ga0500652_010637 | Ga0500652_010637_589_1818 | 396 |
| 26 | 3300005471 | Ga0070698_100008096 | Ga0070698_1000080967 | 397 |
| 27 | 3300025914 | Ga0207671_10056877 | Ga0207671_100568772 | 397 |
| 28 | 3300025949 | Ga0207667_10015074 | Ga0207667_100150742 | 397 |
| 29 | 3300053142 | Ga0500577_0001866 | Ga0500577_0001866_1321_2526 | 397 |
| 30 | 3300003322 | rootL2_10056273 | rootL2_100562733 | 398 |
| 31 | 3300005334 | Ga0068869_100085972 | Ga0068869_1000859723 | 398 |
| 32 | 3300005347 | Ga0070668_100010496 | Ga0070668_1000104968 | 398 |
| 33 | 3300005354 | Ga0070675_100244487 | Ga0070675_1002444871 | 398 |
| 34 | 3300005367 | Ga0070667_100102353 | Ga0070667_1001023532 | 398 |
| 35 | 3300005456 | Ga0070678_100022468 | Ga0070678_1000224683 | 398 |
| 36 | 3300005457 | Ga0070662_100100205 | Ga0070662_1001002054 | 398 |
| 37 | 3300005459 | Ga0068867_100041721 | Ga0068867_1000417213 | 398 |
| 38 | 3300005539 | Ga0068853_100181125 | Ga0068853_1001811252 | 398 |
| 39 | 3300005543 | Ga0070672_100213858 | Ga0070672_1002138582 | 398 |
| 40 | 3300005548 | Ga0070665_100057751 | Ga0070665_1000577512 | 398 |
| 41 | 3300005563 | Ga0068855_100035606 | Ga0068855_1000356066 | 398 |
| 42 | 3300005617 | Ga0068859_100053979 | Ga0068859_1000539792 | 398 |
| 43 | 3300006237 | Ga0097621_100027606 | Ga0097621_1000276067 | 398 |
| 44 | 3300006881 | Ga0068865_100012625 | Ga0068865_1000126256 | 398 |
| 45 | 3300006931 | Ga0097620_100053979 | Ga0097620_1000539792 | 398 |
| 46 | 3300009093 | Ga0105240_10059908 | Ga0105240_100599086 | 398 |
| 47 | 3300009147 | Ga0114129_10126572 | Ga0114129_101265723 | 398 |
| 48 | 3300009176 | Ga0105242_10100421 | Ga0105242_101004211 | 398 |
| 49 | 3300009551 | Ga0105238_10022101 | Ga0105238_100221014 | 398 |
| 50 | 3300009553 | Ga0105249_10217876 | Ga0105249_102178762 | 398 |
| 51 | 3300011119 | Ga0105246_10091152 | Ga0105246_100911521 | 398 |
| 52 | 3300013105 | Ga0157369_10040305 | Ga0157369_100403054 | 398 |
| 53 | 3300013307 | Ga0157372_10001004 | Ga0157372_1000100417 | 398 |
| 54 | 3300020078 | Ga0206352_11067900 | Ga0206352_110679002 | 398 |
| 55 | 3300025899 | Ga0207642_10080968 | Ga0207642_100809682 | 398 |
| 56 | 3300025903 | Ga0207680_10080420 | Ga0207680_100804202 | 398 |
| 57 | 3300025907 | Ga0207645_10000979 | Ga0207645_100009793 | 398 |
| 58 | 3300025913 | Ga0207695_10018108 | Ga0207695_100181086 | 398 |
| 59 | 3300025933 | Ga0207706_10033205 | Ga0207706_100332051 | 398 |
| 60 | 3300025940 | Ga0207691_10012876 | Ga0207691_100128765 | 398 |
| 61 | 3300025942 | Ga0207689_10011619 | Ga0207689_100116191 | 398 |
| 62 | 3300025960 | Ga0207651_10075319 | Ga0207651_100753193 | 398 |
| 63 | 3300026089 | Ga0207648_10028250 | Ga0207648_100282502 | 398 |
| 64 | 3300026121 | Ga0207683_10004452 | Ga0207683_100044524 | 398 |
| 65 | 3300028379 | Ga0268266_10123418 | Ga0268266_101234181 | 398 |
| 66 | 3300031251 | Ga0265327_10040674 | Ga0265327_100406742 | 398 |
| 67 | 3300049523 | Ga0501300_004413 | Ga0501300_004413_72_1295 | 398 |
| 68 | 3300050507 | nmdc:mga05p37_186185_c1 | nmdc:mga05p37_186185_c1_367_1713 | 398 |
| 69 | iso_pu_bacteria | 3003233435 | 3003235520 | 398 |
| 70 | 3300042876 | Ga0451577_0012835 | Ga0451577_0012835_5381_6649 | 401 |
| 71 | 3300044712 | Ga0453684_0080395 | Ga0453684_0080395_1225_2493 | 401 |
| 72 | 3300013105 | Ga0157369_10012756 | Ga0157369_100127562 | 402 |
| 73 | 3300014325 | Ga0163163_10034510 | Ga0163163_100345103 | 402 |
| 74 | 3300046616 | Ga0495668_0000354 | Ga0495668_0000354_13140_14471 | 402 |
| 75 | 3300013105 | Ga0157369_10078615 | Ga0157369_100786152 | 403 |
| 76 | 3300050515 | nmdc:mga0a205_153495_c1 | nmdc:mga0a205_153495_c1_838_2184 | 403 |
| 77 | 3300026089 | Ga0207648_10104941 | Ga0207648_101049412 | 405 |
| 78 | 3300028556 | Ga0265337_1004886 | Ga0265337_10048864 | 406 |
| 79 | 3300042876 | Ga0451577_0286797 | Ga0451577_0286797_105_1391 | 406 |
| 80 | 3300009093 | Ga0105240_10003850 | Ga0105240_100038509 | 407 |
| 81 | 3300009093 | Ga0105240_10080849 | Ga0105240_100808494 | 407 |
| 82 | 3300009545 | Ga0105237_10017466 | Ga0105237_100174662 | 407 |
| 83 | 3300010375 | Ga0105239_10001186 | Ga0105239_1000118615 | 407 |
| 84 | 3300014325 | Ga0163163_10105980 | Ga0163163_101059803 | 407 |
| 85 | 3300025303 | Ga0209051_1024026 | Ga0209051_10240261 | 407 |
| 86 | 3300025913 | Ga0207695_10007302 | Ga0207695_100073028 | 407 |
| 87 | 3300025913 | Ga0207695_10213272 | Ga0207695_102132722 | 407 |
| 88 | 3300046529 | Ga0495652_0042929 | Ga0495652_0042929_1560_2891 | 407 |
| 89 | 3300047320 | Ga0495672_0020427 | Ga0495672_0020427_1886_3214 | 407 |
| 90 | 3300005334 | Ga0068869_100082498 | Ga0068869_1000824981 | 408 |
| 91 | 3300005340 | Ga0070689_100082955 | Ga0070689_1000829551 | 408 |
| 92 | 3300005347 | Ga0070668_100069889 | Ga0070668_1000698894 | 408 |
| 93 | 3300005353 | Ga0070669_100019917 | Ga0070669_1000199174 | 408 |
| 94 | 3300005354 | Ga0070675_100079654 | Ga0070675_1000796541 | 408 |
| 95 | 3300005364 | Ga0070673_100038431 | Ga0070673_1000384313 | 408 |
| 96 | 3300005365 | Ga0070688_100006850 | Ga0070688_1000068503 | 408 |
| 97 | 3300005457 | Ga0070662_100051531 | Ga0070662_1000515313 | 408 |
| 98 | 3300005546 | Ga0070696_100004704 | Ga0070696_1000047045 | 408 |
| 99 | 3300005718 | Ga0068866_10022853 | Ga0068866_100228532 | 408 |
| 100 | 3300005719 | Ga0068861_100000424 | Ga0068861_10000042422 | 408 |
| 101 | 3300005719 | Ga0068861_100111406 | Ga0068861_1001114062 | 408 |
| 102 | 3300005844 | Ga0068862_100137800 | Ga0068862_1001378002 | 408 |
| 103 | 3300006881 | Ga0068865_100026788 | Ga0068865_1000267882 | 408 |
| 104 | 3300009094 | Ga0111539_10012048 | Ga0111539_100120489 | 408 |
| 105 | 3300009176 | Ga0105242_10059536 | Ga0105242_100595364 | 408 |
| 106 | 3300009553 | Ga0105249_10029300 | Ga0105249_100293002 | 408 |
| 107 | 3300009553 | Ga0105249_10154209 | Ga0105249_101542092 | 408 |
| 108 | 3300013308 | Ga0157375_10013609 | Ga0157375_100136092 | 408 |
| 109 | 3300014326 | Ga0157380_10024047 | Ga0157380_100240475 | 408 |
| 110 | 3300025904 | Ga0207647_10042531 | Ga0207647_100425313 | 408 |
| 111 | 3300025907 | Ga0207645_10034290 | Ga0207645_100342902 | 408 |
| 112 | 3300025923 | Ga0207681_10034029 | Ga0207681_100340292 | 408 |
| 113 | 3300025933 | Ga0207706_10063906 | Ga0207706_100639062 | 408 |
| 114 | 3300025938 | Ga0207704_10048200 | Ga0207704_100482002 | 408 |
| 115 | 3300025961 | Ga0207712_10059931 | Ga0207712_100599312 | 408 |
| 116 | 3300026089 | Ga0207648_10015205 | Ga0207648_100152054 | 408 |
| 117 | 3300026089 | Ga0207648_10035635 | Ga0207648_100356353 | 408 |
| 118 | 3300026116 | Ga0207674_10025124 | Ga0207674_100251242 | 408 |
| 119 | 3300026118 | Ga0207675_100000496 | Ga0207675_10000049631 | 408 |
| 120 | 3300026118 | Ga0207675_100050055 | Ga0207675_1000500554 | 408 |
| 121 | 3300028380 | Ga0268265_10038092 | Ga0268265_100380922 | 408 |
| 122 | 3300046460 | Ga0495638_0065701 | Ga0495638_0065701_708_1985 | 408 |
| 123 | 3300050511 | nmdc:mga08y16_17603_c1 | nmdc:mga08y16_17603_c1_1294_2601 | 408 |
| 124 | 3300006847 | Ga0075431_100009982 | Ga0075431_10000998210 | 409 |
| 125 | 3300036712 | Ga0316584_0135970 | Ga0316584_0135970_140_1483 | 409 |
| 126 | 3300037312 | Ga0395899_0029905 | Ga0395899_0029905_137_1468 | 409 |
| 127 | 3300037471 | Ga0395905_0000405 | Ga0395905_0000405_50484_51815 | 409 |
| 128 | 3300038443 | Ga0395901_0335020 | Ga0395901_0335020_140_1471 | 409 |
| 129 | 3300044693 | Ga0466961_0009435 | Ga0466961_0009435_1276_2607 | 409 |
| 130 | 3300044712 | Ga0453684_0055338 | Ga0453684_0055338_1349_2689 | 409 |
| 131 | 3300045049 | Ga0466959_0009178 | Ga0466959_0009178_47_1378 | 409 |
| 132 | 3300002772 | JGI25164J39214_1000820 | JGI25164J39214_10008202 | 410 |
| 133 | 3300003214 | JGI25165J46597_1000655 | JGI25165J46597_10006555 | 410 |
| 134 | 3300003320 | rootH2_10103944 | rootH2_101039443 | 410 |
| 135 | 3300003323 | rootH1_10004576 | rootH1_1000457635 | 410 |
| 136 | 3300003323 | rootH1_10026336 | rootH1_100263363 | 410 |
| 137 | 3300005290 | Ga0065712_10004771 | Ga0065712_100047713 | 410 |
| 138 | 3300005327 | Ga0070658_10056185 | Ga0070658_100561852 | 410 |
| 139 | 3300005328 | Ga0070676_10000375 | Ga0070676_100003756 | 410 |
| 140 | 3300005331 | Ga0070670_100077448 | Ga0070670_1000774482 | 410 |
| 141 | 3300005335 | Ga0070666_10025874 | Ga0070666_100258743 | 410 |
| 142 | 3300005347 | Ga0070668_100003881 | Ga0070668_1000038816 | 410 |
| 143 | 3300005354 | Ga0070675_100064163 | Ga0070675_1000641633 | 410 |
| 144 | 3300005364 | Ga0070673_100015236 | Ga0070673_1000152362 | 410 |
| 145 | 3300005367 | Ga0070667_100000482 | Ga0070667_10000048215 | 410 |
| 146 | 3300005457 | Ga0070662_100010886 | Ga0070662_1000108865 | 410 |
| 147 | 3300005459 | Ga0068867_100030855 | Ga0068867_1000308552 | 410 |
| 148 | 3300005539 | Ga0068853_100019481 | Ga0068853_1000194812 | 410 |
| 149 | 3300005543 | Ga0070672_100000361 | Ga0070672_1000003618 | 410 |
| 150 | 3300005548 | Ga0070665_100204264 | Ga0070665_1002042642 | 410 |
| 151 | 3300005618 | Ga0068864_100000785 | Ga0068864_10000078518 | 410 |
| 152 | 3300005719 | Ga0068861_100048849 | Ga0068861_1000488493 | 410 |
| 153 | 3300005834 | Ga0068851_10004750 | Ga0068851_100047502 | 410 |
| 154 | 3300005841 | Ga0068863_100004269 | Ga0068863_1000042692 | 410 |
| 155 | 3300005842 | Ga0068858_100003593 | Ga0068858_1000035936 | 410 |
| 156 | 3300006881 | Ga0068865_100034237 | Ga0068865_1000342373 | 410 |
| 157 | 3300009093 | Ga0105240_10142492 | Ga0105240_101424922 | 410 |
| 158 | 3300009176 | Ga0105242_10105879 | Ga0105242_101058791 | 410 |
| 159 | 3300009553 | Ga0105249_10004604 | Ga0105249_1000460411 | 410 |
| 160 | 3300013296 | Ga0157374_10005551 | Ga0157374_100055513 | 410 |
| 161 | 3300013297 | Ga0157378_10037755 | Ga0157378_100377552 | 410 |
| 162 | 3300013306 | Ga0163162_10004022 | Ga0163162_100040221 | 410 |
| 163 | 3300013308 | Ga0157375_10003367 | Ga0157375_1000336715 | 410 |
| 164 | 3300014325 | Ga0163163_10002339 | Ga0163163_100023393 | 410 |
| 165 | 3300014326 | Ga0157380_10074105 | Ga0157380_100741053 | 410 |
| 166 | 3300014968 | Ga0157379_10004638 | Ga0157379_100046388 | 410 |
| 167 | 3300014969 | Ga0157376_10017500 | Ga0157376_100175002 | 410 |
| 168 | 3300025231 | Ga0207427_101087 | Ga0207427_1010877 | 410 |
| 169 | 3300025233 | Ga0209437_100048 | Ga0209437_100048156 | 410 |
| 170 | 3300025261 | Ga0209233_1000029 | Ga0209233_1000029221 | 410 |
| 171 | 3300025903 | Ga0207680_10062876 | Ga0207680_100628762 | 410 |
| 172 | 3300025907 | Ga0207645_10002593 | Ga0207645_100025932 | 410 |
| 173 | 3300025909 | Ga0207705_10015164 | Ga0207705_100151645 | 410 |
| 174 | 3300025925 | Ga0207650_10170484 | Ga0207650_101704842 | 410 |
| 175 | 3300025933 | Ga0207706_10011242 | Ga0207706_100112425 | 410 |
| 176 | 3300025938 | Ga0207704_10006675 | Ga0207704_100066753 | 410 |
| 177 | 3300025940 | Ga0207691_10001273 | Ga0207691_1000127319 | 410 |
| 178 | 3300025960 | Ga0207651_10005874 | Ga0207651_100058744 | 410 |
| 179 | 3300025961 | Ga0207712_10116532 | Ga0207712_101165321 | 410 |
| 180 | 3300025972 | Ga0207668_10000617 | Ga0207668_1000061719 | 410 |
| 181 | 3300026035 | Ga0207703_10005312 | Ga0207703_100053126 | 410 |
| 182 | 3300026041 | Ga0207639_10022389 | Ga0207639_100223893 | 410 |
| 183 | 3300026088 | Ga0207641_10005384 | Ga0207641_100053846 | 410 |
| 184 | 3300026089 | Ga0207648_10013902 | Ga0207648_100139026 | 410 |
| 185 | 3300026095 | Ga0207676_10015212 | Ga0207676_100152125 | 410 |
| 186 | 3300026118 | Ga0207675_100036217 | Ga0207675_1000362172 | 410 |
| 187 | 3300028379 | Ga0268266_10006486 | Ga0268266_100064861 | 410 |
| 188 | 3300031344 | Ga0265316_10052175 | Ga0265316_100521752 | 410 |
| 189 | 3300031711 | Ga0265314_10000692 | Ga0265314_100006923 | 410 |
| 190 | 3300046453 | Ga0495627_004188 | Ga0495627_004188_591_1889 | 410 |
| 191 | 3300046558 | Ga0495633_0000159 | Ga0495633_0000159_83446_84744 | 410 |
| 192 | 3300048912 | Ga0496109_0033911 | Ga0496109_0033911_3238_4563 | 410 |
| 193 | 3300050508 | nmdc:mga09592_7424_c1 | nmdc:mga09592_7424_c1_2142_3473 | 410 |
| 194 | 3300053093 | Ga0500651_0032856 | Ga0500651_0032856_1465_2763 | 410 |
| 195 | 3300005327 | Ga0070658_10002733 | Ga0070658_1000273310 | 411 |
| 196 | 3300005518 | Ga0070699_100049932 | Ga0070699_1000499322 | 411 |
| 197 | 3300009101 | Ga0105247_10012786 | Ga0105247_100127862 | 411 |
| 198 | 3300010375 | Ga0105239_10143333 | Ga0105239_101433332 | 411 |
| 199 | 3300013307 | Ga0157372_10260480 | Ga0157372_102604802 | 411 |
| 200 | 3300025909 | Ga0207705_10004298 | Ga0207705_100042983 | 411 |
| 201 | 3300026075 | Ga0207708_10117390 | Ga0207708_101173902 | 411 |
| 202 | 3300026078 | Ga0207702_10007706 | Ga0207702_100077065 | 411 |
| 203 | 3300049579 | Ga0501043_0013663 | Ga0501043_0013663_663_1991 | 411 |
| 204 | 3300050510 | nmdc:mga06r32_170525_c1 | nmdc:mga06r32_170525_c1_516_1847 | 411 |
| 205 | 3300003322 | rootL2_10212594 | rootL2_102125942 | 412 |
| 206 | 3300005290 | Ga0065712_10003244 | Ga0065712_100032443 | 412 |
| 207 | 3300005293 | Ga0065715_10006829 | Ga0065715_100068292 | 412 |
| 208 | 3300005343 | Ga0070687_100023265 | Ga0070687_1000232653 | 412 |
| 209 | 3300005364 | Ga0070673_100083696 | Ga0070673_1000836962 | 412 |
| 210 | 3300005365 | Ga0070688_100022637 | Ga0070688_1000226373 | 412 |
| 211 | 3300005466 | Ga0070685_10025212 | Ga0070685_100252123 | 412 |
| 212 | 3300005543 | Ga0070672_100058066 | Ga0070672_1000580663 | 412 |
| 213 | 3300005840 | Ga0068870_10034123 | Ga0068870_100341232 | 412 |
| 214 | 3300005841 | Ga0068863_100015248 | Ga0068863_1000152486 | 412 |
| 215 | 3300005844 | Ga0068862_100098698 | Ga0068862_1000986982 | 412 |
| 216 | 3300013100 | Ga0157373_10065628 | Ga0157373_100656281 | 412 |
| 217 | 3300013102 | Ga0157371_10018612 | Ga0157371_100186123 | 412 |
| 218 | 3300013308 | Ga0157375_10254302 | Ga0157375_102543021 | 412 |
| 219 | 3300025295 | Ga0209564_1009916 | Ga0209564_10099163 | 412 |
| 220 | 3300025295 | Ga0209564_1020641 | Ga0209564_10206412 | 412 |
| 221 | 3300025297 | Ga0209758_1018343 | Ga0209758_10183433 | 412 |
| 222 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002808 | 412 |
| 223 | 3300025304 | Ga0209257_1002828 | Ga0209257_10028283 | 412 |
| 224 | 3300025908 | Ga0207643_10020394 | Ga0207643_100203942 | 412 |
| 225 | 3300025918 | Ga0207662_10049139 | Ga0207662_100491392 | 412 |
| 226 | 3300025926 | Ga0207659_10033668 | Ga0207659_100336682 | 412 |
| 227 | 3300025940 | Ga0207691_10026811 | Ga0207691_100268114 | 412 |
| 228 | 3300025960 | Ga0207651_10091926 | Ga0207651_100919261 | 412 |
| 229 | 3300026088 | Ga0207641_10000088 | Ga0207641_1000008852 | 412 |
| 230 | 3300048929 | Ga0496126_0058412 | Ga0496126_0058412_2198_3463 | 412 |
| 231 | 3300049569 | Ga0501032_0052328 | Ga0501032_0052328_655_1983 | 412 |
| 232 | 3300049571 | Ga0501034_0009516 | Ga0501034_0009516_7034_8362 | 412 |
| 233 | 3300049572 | Ga0501036_0022474 | Ga0501036_0022474_1175_2503 | 412 |
| 234 | 3300049574 | Ga0501038_0003726 | Ga0501038_0003726_10785_12113 | 412 |
| 235 | 3300049580 | Ga0501046_0124022 | Ga0501046_0124022_623_1951 | 412 |
| 236 | 3300049581 | Ga0501047_0041126 | Ga0501047_0041126_1291_2619 | 412 |
| 237 | 3300049822 | Ga0501035_0006202 | Ga0501035_0006202_3203_4531 | 412 |
| 238 | 3300049823 | Ga0501044_0014709 | Ga0501044_0014709_5114_6442 | 412 |
| 239 | 3300006844 | Ga0075428_100004166 | Ga0075428_10000416612 | 413 |
| 240 | 3300009094 | Ga0111539_10076468 | Ga0111539_100764684 | 413 |
| 241 | 3300009147 | Ga0114129_10180236 | Ga0114129_101802362 | 413 |
| 242 | 3300009545 | Ga0105237_10035606 | Ga0105237_100356062 | 413 |
| 243 | 3300010375 | Ga0105239_10047274 | Ga0105239_100472742 | 413 |
| 244 | 3300026075 | Ga0207708_10027777 | Ga0207708_100277772 | 413 |
| 245 | 3300032004 | Ga0307414_10071634 | Ga0307414_100716342 | 413 |
| 246 | 3300037418 | Ga0395900_0018750 | Ga0395900_0018750_3283_4584 | 413 |
| 247 | 3300037418 | Ga0395900_0282851 | Ga0395900_0282851_337_1629 | 413 |
| 248 | 3300037466 | Ga0395898_0154401 | Ga0395898_0154401_152_1453 | 413 |
| 249 | 3300050507 | nmdc:mga05p37_159810_c1 | nmdc:mga05p37_159810_c1_988_2337 | 413 |
| 250 | 3300050511 | nmdc:mga08y16_59548_c1 | nmdc:mga08y16_59548_c1_2561_3910 | 413 |
| 251 | 3300053092 | Ga0500583_0000078 | Ga0500583_0000078_1819_3111 | 413 |
| 252 | 3300053136 | Ga0500559_0022676 | Ga0500559_0022676_1236_2567 | 413 |
| 253 | 3300003322 | rootL2_10101507 | rootL2_101015073 | 414 |
| 254 | 3300009553 | Ga0105249_10001259 | Ga0105249_1000125919 | 414 |
| 255 | 3300025903 | Ga0207680_10118071 | Ga0207680_101180711 | 414 |
| 256 | 3300025961 | Ga0207712_10000482 | Ga0207712_100004822 | 414 |
| 257 | 3300048910 | Ga0496107_0026080 | Ga0496107_0026080_2578_3894 | 414 |
| 258 | 3300053139 | Ga0500568_0004057 | Ga0500568_0004057_465_1856 | 414 |
| 259 | 3300005339 | Ga0070660_100106424 | Ga0070660_1001064242 | 415 |
| 260 | 3300005355 | Ga0070671_100006460 | Ga0070671_1000064606 | 415 |
| 261 | 3300005471 | Ga0070698_100004308 | Ga0070698_10000430815 | 415 |
| 262 | 3300005539 | Ga0068853_100100047 | Ga0068853_1001000473 | 415 |
| 263 | 3300005563 | Ga0068855_100006289 | Ga0068855_1000062894 | 415 |
| 264 | 3300005577 | Ga0068857_100082949 | Ga0068857_1000829492 | 415 |
| 265 | 3300013308 | Ga0157375_10006134 | Ga0157375_100061347 | 415 |
| 266 | 3300025909 | Ga0207705_10152710 | Ga0207705_101527102 | 415 |
| 267 | 3300025919 | Ga0207657_10124693 | Ga0207657_101246932 | 415 |
| 268 | 3300025924 | Ga0207694_10028164 | Ga0207694_100281643 | 415 |
| 269 | 3300025931 | Ga0207644_10017737 | Ga0207644_100177375 | 415 |
| 270 | 3300026116 | Ga0207674_10136072 | Ga0207674_101360722 | 415 |
| 271 | 3300044712 | Ga0453684_0027906 | Ga0453684_0027906_1035_2342 | 415 |
| 272 | 3300045051 | Ga0451576_0129800 | Ga0451576_0129800_30_1352 | 415 |
| 273 | 3300047443 | Ga0495687_001403 | Ga0495687_001403_16665_17996 | 415 |
| 274 | 3300049570 | Ga0501033_0144786 | Ga0501033_0144786_293_1702 | 415 |
| 275 | 3300049573 | Ga0501037_0069343 | Ga0501037_0069343_742_2073 | 415 |
| 276 | 3300049822 | Ga0501035_0191524 | Ga0501035_0191524_146_1555 | 415 |
| 277 | 3300050511 | nmdc:mga08y16_256981_c1 | nmdc:mga08y16_256981_c1_182_1522 | 415 |
| 278 | 3300005842 | Ga0068858_100030266 | Ga0068858_1000302666 | 416 |
| 279 | 3300006163 | Ga0070715_10056215 | Ga0070715_100562151 | 416 |
| 280 | 3300009176 | Ga0105242_10010916 | Ga0105242_100109166 | 416 |
| 281 | 3300013306 | Ga0163162_10110737 | Ga0163162_101107372 | 416 |
| 282 | 3300025934 | Ga0207686_10001493 | Ga0207686_1000149314 | 416 |
| 283 | 3300031616 | Ga0307508_10004344 | Ga0307508_100043444 | 416 |
| 284 | 3300044656 | Ga0466969_0000580 | Ga0466969_0000580_10496_11827 | 416 |
| 285 | 3300044684 | Ga0466966_0000144 | Ga0466966_0000144_3296_4627 | 416 |
| 286 | 3300044712 | Ga0453684_0121940 | Ga0453684_0121940_22_1344 | 416 |
| 287 | 3300045049 | Ga0466959_0000097 | Ga0466959_0000097_13577_14908 | 416 |
| 288 | 3300045051 | Ga0451576_0001538 | Ga0451576_0001538_17230_18552 | 416 |
| 289 | 3300045051 | Ga0451576_0013570 | Ga0451576_0013570_7006_8331 | 416 |
| 290 | 3300003322 | rootL2_10180035 | rootL2_101800352 | 417 |
| 291 | 3300005340 | Ga0070689_100010923 | Ga0070689_1000109232 | 417 |
| 292 | 3300005364 | Ga0070673_100199907 | Ga0070673_1001999071 | 417 |
| 293 | 3300005466 | Ga0070685_10014893 | Ga0070685_100148932 | 417 |
| 294 | 3300005617 | Ga0068859_100167398 | Ga0068859_1001673981 | 417 |
| 295 | 3300005841 | Ga0068863_100053225 | Ga0068863_1000532252 | 417 |
| 296 | 3300006931 | Ga0097620_100167391 | Ga0097620_1001673911 | 417 |
| 297 | 3300009553 | Ga0105249_10043048 | Ga0105249_100430484 | 417 |
| 298 | 3300013306 | Ga0163162_10020649 | Ga0163162_100206495 | 417 |
| 299 | 3300013308 | Ga0157375_10161340 | Ga0157375_101613402 | 417 |
| 300 | 3300025960 | Ga0207651_10134748 | Ga0207651_101347482 | 417 |
| 301 | 3300026035 | Ga0207703_10143527 | Ga0207703_101435272 | 417 |
| 302 | 3300026142 | Ga0207698_10043756 | Ga0207698_100437562 | 417 |
| 303 | 3300030521 | Ga0307511_10004978 | Ga0307511_100049786 | 417 |
| 304 | 3300031251 | Ga0265327_10006000 | Ga0265327_100060008 | 417 |
| 305 | 3300031730 | Ga0307516_10000656 | Ga0307516_1000065617 | 417 |
| 306 | 3300032004 | Ga0307414_10047697 | Ga0307414_100476972 | 417 |
| 307 | 3300046518 | Ga0495631_0001845 | Ga0495631_0001845_578_1909 | 417 |
| 308 | 3300048913 | Ga0496110_0102393 | Ga0496110_0102393_131_1465 | 417 |
| 309 | iso_pu_bacteria | 2883068021 | 2883072105 | 417 |
| 310 | iso_pu_bacteria | 2896085136 | 2896089266 | 417 |
| 311 | 3300005288 | Ga0065714_10109159 | Ga0065714_101091591 | 418 |
| 312 | 3300005563 | Ga0068855_100000393 | Ga0068855_10000039332 | 418 |
| 313 | 3300005614 | Ga0068856_100027819 | Ga0068856_1000278195 | 418 |
| 314 | 3300009094 | Ga0111539_10091864 | Ga0111539_100918642 | 418 |
| 315 | 3300013306 | Ga0163162_10011151 | Ga0163162_100111517 | 418 |
| 316 | 3300013308 | Ga0157375_10008017 | Ga0157375_100080179 | 418 |
| 317 | 3300017792 | Ga0163161_10015902 | Ga0163161_100159023 | 418 |
| 318 | 3300025949 | Ga0207667_10000117 | Ga0207667_10000117108 | 418 |
| 319 | 3300025961 | Ga0207712_10068830 | Ga0207712_100688302 | 418 |
| 320 | 3300044673 | Ga0453683_0000181 | Ga0453683_0000181_46718_48064 | 418 |
| 321 | 3300045051 | Ga0451576_0000513 | Ga0451576_0000513_46684_48030 | 418 |
| 322 | 3300045051 | Ga0451576_0393376 | Ga0451576_0393376_63_1394 | 418 |
| 323 | iso_pu_bacteria | 2896109856 | 2896111292 | 418 |
| 324 | 3300026088 | Ga0207641_10288087 | Ga0207641_102880871 | 419 |
| 325 | 3300028556 | Ga0265337_1021708 | Ga0265337_10217082 | 419 |
| 326 | 3300049571 | Ga0501034_0068233 | Ga0501034_0068233_1119_2402 | 419 |
| 327 | 3300050493 | nmdc:mga0k408_46307_c1 | nmdc:mga0k408_46307_c1_13_1323 | 419 |
| 328 | 3300053090 | Ga0500646_0001432 | Ga0500646_0001432_2436_3746 | 419 |
| 329 | iso_pu_bacteria | 2896344016 | 2896344947 | 419 |
| 330 | 3300010375 | Ga0105239_10041585 | Ga0105239_100415853 | 420 |
| 331 | 3300013306 | Ga0163162_10000773 | Ga0163162_100007733 | 420 |
| 332 | 3300005290 | Ga0065712_10004111 | Ga0065712_100041114 | 421 |
| 333 | 3300005329 | Ga0070683_100015621 | Ga0070683_1000156215 | 421 |
| 334 | 3300005329 | Ga0070683_100161545 | Ga0070683_1001615452 | 421 |
| 335 | 3300005331 | Ga0070670_100014394 | Ga0070670_1000143942 | 421 |
| 336 | 3300005331 | Ga0070670_100042609 | Ga0070670_1000426092 | 421 |
| 337 | 3300005338 | Ga0068868_100050675 | Ga0068868_1000506754 | 421 |
| 338 | 3300005339 | Ga0070660_100033516 | Ga0070660_1000335165 | 421 |
| 339 | 3300005366 | Ga0070659_100130681 | Ga0070659_1001306811 | 421 |
| 340 | 3300005457 | Ga0070662_100073666 | Ga0070662_1000736662 | 421 |
| 341 | 3300005539 | Ga0068853_100085121 | Ga0068853_1000851212 | 421 |
| 342 | 3300005549 | Ga0070704_100027391 | Ga0070704_1000273914 | 421 |
| 343 | 3300005563 | Ga0068855_100102479 | Ga0068855_1001024795 | 421 |
| 344 | 3300005564 | Ga0070664_100025631 | Ga0070664_1000256315 | 421 |
| 345 | 3300005577 | Ga0068857_100032480 | Ga0068857_1000324804 | 421 |
| 346 | 3300005578 | Ga0068854_100046447 | Ga0068854_1000464474 | 421 |
| 347 | 3300005614 | Ga0068856_100018743 | Ga0068856_1000187432 | 421 |
| 348 | 3300005616 | Ga0068852_100004228 | Ga0068852_1000042284 | 421 |
| 349 | 3300005618 | Ga0068864_100022225 | Ga0068864_1000222254 | 421 |
| 350 | 3300005842 | Ga0068858_100088396 | Ga0068858_1000883961 | 421 |
| 351 | 3300005985 | Ga0081539_10000622 | Ga0081539_1000062275 | 421 |
| 352 | 3300006237 | Ga0097621_100009274 | Ga0097621_1000092747 | 421 |
| 353 | 3300009553 | Ga0105249_10093405 | Ga0105249_100934053 | 421 |
| 354 | 3300013100 | Ga0157373_10003187 | Ga0157373_1000318714 | 421 |
| 355 | 3300013102 | Ga0157371_10027291 | Ga0157371_100272912 | 421 |
| 356 | 3300013105 | Ga0157369_10056903 | Ga0157369_100569035 | 421 |
| 357 | 3300013296 | Ga0157374_10009761 | Ga0157374_100097615 | 421 |
| 358 | 3300013297 | Ga0157378_10020701 | Ga0157378_100207014 | 421 |
| 359 | 3300013297 | Ga0157378_10050978 | Ga0157378_100509783 | 421 |
| 360 | 3300013306 | Ga0163162_10230942 | Ga0163162_102309421 | 421 |
| 361 | 3300013307 | Ga0157372_10230196 | Ga0157372_102301962 | 421 |
| 362 | 3300025912 | Ga0207707_10124166 | Ga0207707_101241661 | 421 |
| 363 | 3300025925 | Ga0207650_10061745 | Ga0207650_100617453 | 421 |
| 364 | 3300025926 | Ga0207659_10021177 | Ga0207659_100211772 | 421 |
| 365 | 3300025932 | Ga0207690_10126486 | Ga0207690_101264861 | 421 |
| 366 | 3300025933 | Ga0207706_10033206 | Ga0207706_100332062 | 421 |
| 367 | 3300025945 | Ga0207679_10079105 | Ga0207679_100791052 | 421 |
| 368 | 3300025960 | Ga0207651_10015179 | Ga0207651_100151792 | 421 |
| 369 | 3300025961 | Ga0207712_10047892 | Ga0207712_100478923 | 421 |
| 370 | 3300025981 | Ga0207640_10035597 | Ga0207640_100355973 | 421 |
| 371 | 3300026023 | Ga0207677_10163501 | Ga0207677_101635011 | 421 |
| 372 | 3300026035 | Ga0207703_10243883 | Ga0207703_102438832 | 421 |
| 373 | 3300026078 | Ga0207702_10082943 | Ga0207702_100829432 | 421 |
| 374 | 3300026095 | Ga0207676_10016815 | Ga0207676_100168153 | 421 |
| 375 | 3300026116 | Ga0207674_10010597 | Ga0207674_1001059710 | 421 |
| 376 | 3300031507 | Ga0307509_10011639 | Ga0307509_100116396 | 421 |
| 377 | 3300032004 | Ga0307414_10003747 | Ga0307414_100037475 | 421 |
| 378 | 3300037471 | Ga0395905_0186841 | Ga0395905_0186841_84_1391 | 421 |
| 379 | 3300039437 | Ga0436365_0040113 | Ga0436365_0040113_2215_3531 | 421 |
| 380 | 3300039437 | Ga0436365_0486460 | Ga0436365_0486460_1087_2394 | 421 |
| 381 | 3300044673 | Ga0453683_0002130 | Ga0453683_0002130_12010_13347 | 421 |
| 382 | 3300049571 | Ga0501034_0328059 | Ga0501034_0328059_34_1344 | 421 |
| 383 | 3300049823 | Ga0501044_0087201 | Ga0501044_0087201_1226_2536 | 421 |
| 384 | 3300002773 | JGI25152J39213_1001701 | JGI25152J39213_10017013 | 422 |
| 385 | 3300002774 | JGI25150J39212_1000030 | JGI25150J39212_10000303 | 422 |
| 386 | 3300003187 | JGI25151J46595_10000129 | JGI25151J46595_1000012991 | 422 |
| 387 | 3300003215 | JGI25153J46596_10000096 | JGI25153J46596_1000009691 | 422 |
| 388 | 3300005563 | Ga0068855_100000463 | Ga0068855_10000046311 | 422 |
| 389 | 3300005614 | Ga0068856_100033380 | Ga0068856_1000333801 | 422 |
| 390 | 3300005843 | Ga0068860_100006909 | Ga0068860_1000069097 | 422 |
| 391 | 3300009093 | Ga0105240_10002072 | Ga0105240_1000207218 | 422 |
| 392 | 3300013307 | Ga0157372_10072185 | Ga0157372_100721854 | 422 |
| 393 | 3300013307 | Ga0157372_10283480 | Ga0157372_102834801 | 422 |
| 394 | 3300014969 | Ga0157376_10003188 | Ga0157376_100031885 | 422 |
| 395 | 3300014969 | Ga0157376_10006082 | Ga0157376_100060828 | 422 |
| 396 | 3300014969 | Ga0157376_10062423 | Ga0157376_100624232 | 422 |
| 397 | 3300025245 | Ga0207425_1000004 | Ga0207425_1000004306 | 422 |
| 398 | 3300025258 | Ga0209129_1000005 | Ga0209129_1000005634 | 422 |
| 399 | 3300025294 | Ga0209025_1000009 | Ga0209025_1000009306 | 422 |
| 400 | 3300025297 | Ga0209758_1000010 | Ga0209758_1000010307 | 422 |
| 401 | 3300025912 | Ga0207707_10002312 | Ga0207707_100023122 | 422 |
| 402 | 3300025913 | Ga0207695_10000071 | Ga0207695_10000071130 | 422 |
| 403 | 3300025913 | Ga0207695_10069983 | Ga0207695_100699832 | 422 |
| 404 | 3300025921 | Ga0207652_10132924 | Ga0207652_101329242 | 422 |
| 405 | 3300025944 | Ga0207661_10009033 | Ga0207661_100090333 | 422 |
| 406 | 3300025949 | Ga0207667_10000209 | Ga0207667_1000020936 | 422 |
| 407 | 3300028381 | Ga0268264_10010792 | Ga0268264_100107922 | 422 |
| 408 | 3300046517 | Ga0495630_0111568 | Ga0495630_0111568_268_1593 | 422 |
| 409 | 3300049580 | Ga0501046_0159741 | Ga0501046_0159741_246_1571 | 422 |
| 410 | 3300049585 | Ga0501069_0056045 | Ga0501069_0056045_684_2009 | 422 |
| 411 | 3300054114 | Ga0501084_0119351 | Ga0501084_0119351_404_1729 | 422 |
| 412 | 3300060353 | Ga0501082_0037498 | Ga0501082_0037498_2123_3448 | 422 |
| 413 | iso_pu_bacteria | 2738541278 | 2738725251 | 422 |
| 414 | iso_pu_bacteria | 2738541283 | 2738757943 | 422 |
| 415 | iso_pu_bacteria | 2738541302 | 2738853285 | 422 |
| 416 | iso_pu_bacteria | 2842722452 | 2842723814 | 422 |
| 417 | iso_pu_bacteria | 2842909656 | 2842910319 | 422 |
| 418 | iso_pu_bacteria | 2857627736 | 2857628453 | 422 |
| 419 | iso_pu_bacteria | 2929239360 | 2929243919 | 422 |
| 420 | iso_pu_bacteria | 2929921140 | 2929925937 | 422 |
| 421 | iso_pu_bacteria | 2945997725 | 2946000652 | 422 |
| 422 | iso_pu_bacteria | 2954016120 | 2954017551 | 422 |
| 423 | iso_pu_bacteria | 8003151029 | 8003153105 | 422 |
| 424 | 3300005354 | Ga0070675_100020974 | Ga0070675_1000209742 | 423 |
| 425 | 3300009545 | Ga0105237_10035471 | Ga0105237_100354713 | 423 |
| 426 | 3300010375 | Ga0105239_10011094 | Ga0105239_1001109410 | 423 |
| 427 | 3300013102 | Ga0157371_10038237 | Ga0157371_100382372 | 423 |
| 428 | 3300013104 | Ga0157370_10070048 | Ga0157370_100700482 | 423 |
| 429 | 3300013296 | Ga0157374_10158014 | Ga0157374_101580142 | 423 |
| 430 | 3300025914 | Ga0207671_10038512 | Ga0207671_100385124 | 423 |
| 431 | 3300025926 | Ga0207659_10040100 | Ga0207659_100401004 | 423 |
| 432 | 3300050511 | nmdc:mga08y16_64265_c1 | nmdc:mga08y16_64265_c1_903_2231 | 423 |
| 433 | iso_pu_bacteria | 2522125168 | 2522548684 | 423 |
| 434 | iso_pu_bacteria | 2522125168 | 2522550596 | 423 |
| 435 | iso_pu_bacteria | 2721755487 | 2722729580 | 423 |
| 436 | iso_pu_bacteria | 2818991460 | 2819679808 | 423 |
| 437 | iso_pu_bacteria | 2884791551 | 2884794368 | 423 |
| 438 | iso_pu_bacteria | 2904780799 | 2904780882 | 423 |
| 439 | iso_pu_bacteria | 2904780799 | 2904781202 | 423 |
| 440 | iso_pu_bacteria | 2919177583 | 2919178805 | 423 |
| 441 | iso_pu_bacteria | 2919177583 | 2919180654 | 423 |
| 442 | iso_pu_bacteria | 2929177148 | 2929180079 | 423 |
| 443 | iso_pu_bacteria | 2945977869 | 2945982506 | 423 |
| 444 | iso_pu_bacteria | 2946013367 | 2946018109 | 423 |
| 445 | iso_pu_bacteria | 3003233435 | 3003235521 | 423 |
| 446 | 3300001990 | JGI24737J22298_10012446 | JGI24737J22298_100124462 | 424 |
| 447 | 3300002738 | JGI25154J39366_1000179 | JGI25154J39366_100017919 | 424 |
| 448 | 3300003320 | rootH2_10002127 | rootH2_1000212734 | 424 |
| 449 | 3300003323 | rootH1_10190967 | rootH1_101909675 | 424 |
| 450 | 3300003354 | JGI25160J50197_1003411 | JGI25160J50197_10034118 | 424 |
| 451 | 3300003762 | Ga0055542_1006065 | Ga0055542_10060653 | 424 |
| 452 | 3300003781 | Ga0055536_1001818 | Ga0055536_100181811 | 424 |
| 453 | 3300004803 | Ga0058862_12292963 | Ga0058862_122929632 | 424 |
| 454 | 3300005262 | Ga0065165_1000259 | Ga0065165_100025929 | 424 |
| 455 | 3300005262 | Ga0065165_1037409 | Ga0065165_10374091 | 424 |
| 456 | 3300005288 | Ga0065714_10086418 | Ga0065714_100864181 | 424 |
| 457 | 3300005290 | Ga0065712_10070396 | Ga0065712_100703964 | 424 |
| 458 | 3300005327 | Ga0070658_10051061 | Ga0070658_100510612 | 424 |
| 459 | 3300005329 | Ga0070683_100227021 | Ga0070683_1002270212 | 424 |
| 460 | 3300005331 | Ga0070670_100110524 | Ga0070670_1001105243 | 424 |
| 461 | 3300005334 | Ga0068869_100008042 | Ga0068869_1000080425 | 424 |
| 462 | 3300005335 | Ga0070666_10000030 | Ga0070666_1000003018 | 424 |
| 463 | 3300005335 | Ga0070666_10031202 | Ga0070666_100312022 | 424 |
| 464 | 3300005337 | Ga0070682_100084379 | Ga0070682_1000843791 | 424 |
| 465 | 3300005338 | Ga0068868_100035467 | Ga0068868_1000354672 | 424 |
| 466 | 3300005338 | Ga0068868_100060702 | Ga0068868_1000607023 | 424 |
| 467 | 3300005353 | Ga0070669_100102087 | Ga0070669_1001020872 | 424 |
| 468 | 3300005354 | Ga0070675_100043197 | Ga0070675_1000431973 | 424 |
| 469 | 3300005355 | Ga0070671_100024337 | Ga0070671_1000243372 | 424 |
| 470 | 3300005355 | Ga0070671_100069058 | Ga0070671_1000690582 | 424 |
| 471 | 3300005356 | Ga0070674_100032111 | Ga0070674_1000321111 | 424 |
| 472 | 3300005365 | Ga0070688_100039392 | Ga0070688_1000393923 | 424 |
| 473 | 3300005366 | Ga0070659_100003883 | Ga0070659_10000388312 | 424 |
| 474 | 3300005367 | Ga0070667_100001675 | Ga0070667_1000016758 | 424 |
| 475 | 3300005367 | Ga0070667_100015893 | Ga0070667_1000158932 | 424 |
| 476 | 3300005367 | Ga0070667_100019741 | Ga0070667_1000197415 | 424 |
| 477 | 3300005456 | Ga0070678_100027160 | Ga0070678_1000271604 | 424 |
| 478 | 3300005457 | Ga0070662_100000311 | Ga0070662_1000003117 | 424 |
| 479 | 3300005457 | Ga0070662_100131647 | Ga0070662_1001316471 | 424 |
| 480 | 3300005458 | Ga0070681_10057046 | Ga0070681_100570464 | 424 |
| 481 | 3300005530 | Ga0070679_100001547 | Ga0070679_1000015477 | 424 |
| 482 | 3300005530 | Ga0070679_100003672 | Ga0070679_1000036727 | 424 |
| 483 | 3300005539 | Ga0068853_100000250 | Ga0068853_10000025036 | 424 |
| 484 | 3300005539 | Ga0068853_100096681 | Ga0068853_1000966813 | 424 |
| 485 | 3300005539 | Ga0068853_100113912 | Ga0068853_1001139121 | 424 |
| 486 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001571 | 424 |
| 487 | 3300005563 | Ga0068855_100001155 | Ga0068855_1000011552 | 424 |
| 488 | 3300005563 | Ga0068855_100002947 | Ga0068855_10000294711 | 424 |
| 489 | 3300005563 | Ga0068855_100074258 | Ga0068855_1000742583 | 424 |
| 490 | 3300005563 | Ga0068855_100265849 | Ga0068855_1002658492 | 424 |
| 491 | 3300005563 | Ga0068855_100336613 | Ga0068855_1003366132 | 424 |
| 492 | 3300005578 | Ga0068854_100149273 | Ga0068854_1001492731 | 424 |
| 493 | 3300005614 | Ga0068856_100000976 | Ga0068856_10000097614 | 424 |
| 494 | 3300005614 | Ga0068856_100010242 | Ga0068856_1000102422 | 424 |
| 495 | 3300005614 | Ga0068856_100109193 | Ga0068856_1001091932 | 424 |
| 496 | 3300005614 | Ga0068856_100136587 | Ga0068856_1001365874 | 424 |
| 497 | 3300005614 | Ga0068856_100256661 | Ga0068856_1002566611 | 424 |
| 498 | 3300005616 | Ga0068852_100000242 | Ga0068852_10000024226 | 424 |
| 499 | 3300005616 | Ga0068852_100000336 | Ga0068852_1000003366 | 424 |
| 500 | 3300005616 | Ga0068852_100000842 | Ga0068852_1000008427 | 424 |
| 501 | 3300005617 | Ga0068859_100000003 | Ga0068859_100000003355 | 424 |
| 502 | 3300005617 | Ga0068859_100013814 | Ga0068859_1000138143 | 424 |
| 503 | 3300005617 | Ga0068859_100043651 | Ga0068859_1000436512 | 424 |
| 504 | 3300005618 | Ga0068864_100006709 | Ga0068864_1000067094 | 424 |
| 505 | 3300005719 | Ga0068861_100027169 | Ga0068861_1000271695 | 424 |
| 506 | 3300005834 | Ga0068851_10002845 | Ga0068851_100028455 | 424 |
| 507 | 3300005840 | Ga0068870_10030849 | Ga0068870_100308492 | 424 |
| 508 | 3300005841 | Ga0068863_100006964 | Ga0068863_1000069649 | 424 |
| 509 | 3300005841 | Ga0068863_100027774 | Ga0068863_1000277745 | 424 |
| 510 | 3300005841 | Ga0068863_100033321 | Ga0068863_1000333213 | 424 |
| 511 | 3300005843 | Ga0068860_100000097 | Ga0068860_100000097122 | 424 |
| 512 | 3300005843 | Ga0068860_100002301 | Ga0068860_10000230115 | 424 |
| 513 | 3300005843 | Ga0068860_100002474 | Ga0068860_10000247414 | 424 |
| 514 | 3300005843 | Ga0068860_100010870 | Ga0068860_10001087013 | 424 |
| 515 | 3300005843 | Ga0068860_100168485 | Ga0068860_1001684852 | 424 |
| 516 | 3300005844 | Ga0068862_100017277 | Ga0068862_1000172777 | 424 |
| 517 | 3300006237 | Ga0097621_100000626 | Ga0097621_10000062619 | 424 |
| 518 | 3300006237 | Ga0097621_100000681 | Ga0097621_10000068122 | 424 |
| 519 | 3300006237 | Ga0097621_100005463 | Ga0097621_1000054636 | 424 |
| 520 | 3300006358 | Ga0068871_100000790 | Ga0068871_1000007906 | 424 |
| 521 | 3300006358 | Ga0068871_100001337 | Ga0068871_1000013376 | 424 |
| 522 | 3300006358 | Ga0068871_100004687 | Ga0068871_1000046873 | 424 |
| 523 | 3300006881 | Ga0068865_100000110 | Ga0068865_10000011021 | 424 |
| 524 | 3300006931 | Ga0097620_100000003 | Ga0097620_100000003355 | 424 |
| 525 | 3300006931 | Ga0097620_100013814 | Ga0097620_1000138143 | 424 |
| 526 | 3300006931 | Ga0097620_100043651 | Ga0097620_1000436512 | 424 |
| 527 | 3300009093 | Ga0105240_10000754 | Ga0105240_1000075415 | 424 |
| 528 | 3300009093 | Ga0105240_10000862 | Ga0105240_1000086214 | 424 |
| 529 | 3300009093 | Ga0105240_10002236 | Ga0105240_1000223623 | 424 |
| 530 | 3300009093 | Ga0105240_10045116 | Ga0105240_100451167 | 424 |
| 531 | 3300009093 | Ga0105240_10092636 | Ga0105240_100926365 | 424 |
| 532 | 3300009093 | Ga0105240_10099383 | Ga0105240_100993833 | 424 |
| 533 | 3300009093 | Ga0105240_10354069 | Ga0105240_103540692 | 424 |
| 534 | 3300009101 | Ga0105247_10001011 | Ga0105247_1000101113 | 424 |
| 535 | 3300009147 | Ga0114129_10000267 | Ga0114129_1000026730 | 424 |
| 536 | 3300009174 | Ga0105241_10000612 | Ga0105241_100006125 | 424 |
| 537 | 3300009174 | Ga0105241_10003226 | Ga0105241_100032269 | 424 |
| 538 | 3300009174 | Ga0105241_10004704 | Ga0105241_100047042 | 424 |
| 539 | 3300009174 | Ga0105241_10009184 | Ga0105241_100091842 | 424 |
| 540 | 3300009174 | Ga0105241_10026016 | Ga0105241_100260162 | 424 |
| 541 | 3300009176 | Ga0105242_10014682 | Ga0105242_100146824 | 424 |
| 542 | 3300009177 | Ga0105248_10012794 | Ga0105248_100127945 | 424 |
| 543 | 3300009545 | Ga0105237_10001136 | Ga0105237_100011369 | 424 |
| 544 | 3300009545 | Ga0105237_10001588 | Ga0105237_1000158837 | 424 |
| 545 | 3300009545 | Ga0105237_10002905 | Ga0105237_1000290514 | 424 |
| 546 | 3300009545 | Ga0105237_10006929 | Ga0105237_100069296 | 424 |
| 547 | 3300009545 | Ga0105237_10008019 | Ga0105237_100080196 | 424 |
| 548 | 3300009545 | Ga0105237_10028155 | Ga0105237_100281554 | 424 |
| 549 | 3300009551 | Ga0105238_10001868 | Ga0105238_100018682 | 424 |
| 550 | 3300009551 | Ga0105238_10016135 | Ga0105238_100161353 | 424 |
| 551 | 3300009551 | Ga0105238_10175495 | Ga0105238_101754952 | 424 |
| 552 | 3300009551 | Ga0105238_10318915 | Ga0105238_103189151 | 424 |
| 553 | 3300009553 | Ga0105249_10003433 | Ga0105249_100034339 | 424 |
| 554 | 3300009553 | Ga0105249_10019531 | Ga0105249_100195315 | 424 |
| 555 | 3300010375 | Ga0105239_10000009 | Ga0105239_10000009241 | 424 |
| 556 | 3300010375 | Ga0105239_10003433 | Ga0105239_1000343314 | 424 |
| 557 | 3300010375 | Ga0105239_10009700 | Ga0105239_1000970011 | 424 |
| 558 | 3300010375 | Ga0105239_10015004 | Ga0105239_100150044 | 424 |
| 559 | 3300010375 | Ga0105239_10064979 | Ga0105239_100649794 | 424 |
| 560 | 3300010375 | Ga0105239_10217707 | Ga0105239_102177072 | 424 |
| 561 | 3300011119 | Ga0105246_10011910 | Ga0105246_100119103 | 424 |
| 562 | 3300011119 | Ga0105246_10195640 | Ga0105246_101956402 | 424 |
| 563 | 3300013100 | Ga0157373_10023103 | Ga0157373_100231032 | 424 |
| 564 | 3300013102 | Ga0157371_10000139 | Ga0157371_1000013957 | 424 |
| 565 | 3300013102 | Ga0157371_10000178 | Ga0157371_1000017885 | 424 |
| 566 | 3300013102 | Ga0157371_10029728 | Ga0157371_100297282 | 424 |
| 567 | 3300013102 | Ga0157371_10038710 | Ga0157371_100387104 | 424 |
| 568 | 3300013102 | Ga0157371_10153392 | Ga0157371_101533922 | 424 |
| 569 | 3300013104 | Ga0157370_10000463 | Ga0157370_100004639 | 424 |
| 570 | 3300013104 | Ga0157370_10002924 | Ga0157370_100029249 | 424 |
| 571 | 3300013105 | Ga0157369_10000002 | Ga0157369_10000002409 | 424 |
| 572 | 3300013105 | Ga0157369_10040076 | Ga0157369_100400762 | 424 |
| 573 | 3300013105 | Ga0157369_10067826 | Ga0157369_100678264 | 424 |
| 574 | 3300013296 | Ga0157374_10000715 | Ga0157374_100007157 | 424 |
| 575 | 3300013296 | Ga0157374_10000740 | Ga0157374_1000074013 | 424 |
| 576 | 3300013296 | Ga0157374_10175980 | Ga0157374_101759802 | 424 |
| 577 | 3300013297 | Ga0157378_10015389 | Ga0157378_100153893 | 424 |
| 578 | 3300013297 | Ga0157378_10026283 | Ga0157378_100262833 | 424 |
| 579 | 3300013297 | Ga0157378_10038211 | Ga0157378_100382111 | 424 |
| 580 | 3300013297 | Ga0157378_10051934 | Ga0157378_100519342 | 424 |
| 581 | 3300013306 | Ga0163162_10000555 | Ga0163162_1000055514 | 424 |
| 582 | 3300013306 | Ga0163162_10002336 | Ga0163162_100023368 | 424 |
| 583 | 3300013306 | Ga0163162_10004535 | Ga0163162_100045353 | 424 |
| 584 | 3300013306 | Ga0163162_10010522 | Ga0163162_100105226 | 424 |
| 585 | 3300013306 | Ga0163162_10020542 | Ga0163162_100205425 | 424 |
| 586 | 3300013306 | Ga0163162_10028214 | Ga0163162_100282143 | 424 |
| 587 | 3300013306 | Ga0163162_10241516 | Ga0163162_102415161 | 424 |
| 588 | 3300013307 | Ga0157372_10039240 | Ga0157372_100392401 | 424 |
| 589 | 3300013307 | Ga0157372_10064471 | Ga0157372_100644712 | 424 |
| 590 | 3300013307 | Ga0157372_10071929 | Ga0157372_100719293 | 424 |
| 591 | 3300013307 | Ga0157372_10127834 | Ga0157372_101278342 | 424 |
| 592 | 3300013307 | Ga0157372_10218925 | Ga0157372_102189252 | 424 |
| 593 | 3300013307 | Ga0157372_10243763 | Ga0157372_102437632 | 424 |
| 594 | 3300013308 | Ga0157375_10000735 | Ga0157375_1000073514 | 424 |
| 595 | 3300013308 | Ga0157375_10089287 | Ga0157375_100892873 | 424 |
| 596 | 3300014325 | Ga0163163_10011675 | Ga0163163_100116757 | 424 |
| 597 | 3300014325 | Ga0163163_10117213 | Ga0163163_101172132 | 424 |
| 598 | 3300014497 | Ga0182008_10026498 | Ga0182008_100264984 | 424 |
| 599 | 3300014745 | Ga0157377_10004540 | Ga0157377_100045402 | 424 |
| 600 | 3300014968 | Ga0157379_10030074 | Ga0157379_100300745 | 424 |
| 601 | 3300014968 | Ga0157379_10047298 | Ga0157379_100472982 | 424 |
| 602 | 3300014969 | Ga0157376_10003813 | Ga0157376_100038135 | 424 |
| 603 | 3300014969 | Ga0157376_10007905 | Ga0157376_100079056 | 424 |
| 604 | 3300015261 | Ga0182006_1000110 | Ga0182006_100011036 | 424 |
| 605 | 3300015261 | Ga0182006_1000868 | Ga0182006_100086814 | 424 |
| 606 | 3300015262 | Ga0182007_10000001 | Ga0182007_10000001373 | 424 |
| 607 | 3300015262 | Ga0182007_10004091 | Ga0182007_100040913 | 424 |
| 608 | 3300015262 | Ga0182007_10008190 | Ga0182007_100081902 | 424 |
| 609 | 3300017792 | Ga0163161_10000617 | Ga0163161_1000061718 | 424 |
| 610 | 3300017792 | Ga0163161_10001132 | Ga0163161_1000113215 | 424 |
| 611 | 3300017792 | Ga0163161_10003565 | Ga0163161_100035658 | 424 |
| 612 | 3300017792 | Ga0163161_10020081 | Ga0163161_100200815 | 424 |
| 613 | 3300021361 | Ga0213872_10005681 | Ga0213872_100056814 | 424 |
| 614 | 3300025242 | Ga0209258_100295 | Ga0209258_10029567 | 424 |
| 615 | 3300025246 | Ga0209646_1000037 | Ga0209646_1000037210 | 424 |
| 616 | 3300025250 | Ga0209026_1001866 | Ga0209026_10018666 | 424 |
| 617 | 3300025254 | Ga0209148_1000242 | Ga0209148_100024224 | 424 |
| 618 | 3300025292 | Ga0209676_1000686 | Ga0209676_100068611 | 424 |
| 619 | 3300025298 | Ga0209050_1025214 | Ga0209050_10252142 | 424 |
| 620 | 3300025302 | Ga0207426_1001093 | Ga0207426_10010933 | 424 |
| 621 | 3300025900 | Ga0207710_10024054 | Ga0207710_100240541 | 424 |
| 622 | 3300025903 | Ga0207680_10000014 | Ga0207680_1000001488 | 424 |
| 623 | 3300025904 | Ga0207647_10000563 | Ga0207647_1000056312 | 424 |
| 624 | 3300025904 | Ga0207647_10046454 | Ga0207647_100464542 | 424 |
| 625 | 3300025907 | Ga0207645_10000298 | Ga0207645_1000029820 | 424 |
| 626 | 3300025907 | Ga0207645_10009555 | Ga0207645_100095552 | 424 |
| 627 | 3300025909 | Ga0207705_10019756 | Ga0207705_100197562 | 424 |
| 628 | 3300025909 | Ga0207705_10062536 | Ga0207705_100625362 | 424 |
| 629 | 3300025911 | Ga0207654_10004369 | Ga0207654_100043697 | 424 |
| 630 | 3300025912 | Ga0207707_10073724 | Ga0207707_100737243 | 424 |
| 631 | 3300025913 | Ga0207695_10000084 | Ga0207695_1000008475 | 424 |
| 632 | 3300025913 | Ga0207695_10000515 | Ga0207695_1000051538 | 424 |
| 633 | 3300025913 | Ga0207695_10001197 | Ga0207695_100011972 | 424 |
| 634 | 3300025913 | Ga0207695_10043598 | Ga0207695_100435982 | 424 |
| 635 | 3300025913 | Ga0207695_10055384 | Ga0207695_100553843 | 424 |
| 636 | 3300025914 | Ga0207671_10002536 | Ga0207671_1000253618 | 424 |
| 637 | 3300025914 | Ga0207671_10002992 | Ga0207671_1000299212 | 424 |
| 638 | 3300025914 | Ga0207671_10003129 | Ga0207671_1000312911 | 424 |
| 639 | 3300025914 | Ga0207671_10007505 | Ga0207671_100075055 | 424 |
| 640 | 3300025914 | Ga0207671_10008601 | Ga0207671_100086015 | 424 |
| 641 | 3300025919 | Ga0207657_10108147 | Ga0207657_101081471 | 424 |
| 642 | 3300025921 | Ga0207652_10000301 | Ga0207652_1000030153 | 424 |
| 643 | 3300025921 | Ga0207652_10001364 | Ga0207652_100013646 | 424 |
| 644 | 3300025921 | Ga0207652_10028149 | Ga0207652_100281495 | 424 |
| 645 | 3300025923 | Ga0207681_10169649 | Ga0207681_101696491 | 424 |
| 646 | 3300025924 | Ga0207694_10195329 | Ga0207694_101953292 | 424 |
| 647 | 3300025925 | Ga0207650_10106669 | Ga0207650_101066692 | 424 |
| 648 | 3300025926 | Ga0207659_10154982 | Ga0207659_101549821 | 424 |
| 649 | 3300025932 | Ga0207690_10015276 | Ga0207690_100152764 | 424 |
| 650 | 3300025933 | Ga0207706_10000246 | Ga0207706_1000024618 | 424 |
| 651 | 3300025933 | Ga0207706_10161498 | Ga0207706_101614982 | 424 |
| 652 | 3300025934 | Ga0207686_10066224 | Ga0207686_100662242 | 424 |
| 653 | 3300025936 | Ga0207670_10062112 | Ga0207670_100621124 | 424 |
| 654 | 3300025938 | Ga0207704_10000011 | Ga0207704_10000011127 | 424 |
| 655 | 3300025940 | Ga0207691_10021514 | Ga0207691_100215142 | 424 |
| 656 | 3300025940 | Ga0207691_10140235 | Ga0207691_101402353 | 424 |
| 657 | 3300025941 | Ga0207711_10085185 | Ga0207711_100851853 | 424 |
| 658 | 3300025942 | Ga0207689_10002295 | Ga0207689_100022952 | 424 |
| 659 | 3300025949 | Ga0207667_10000197 | Ga0207667_100001973 | 424 |
| 660 | 3300025949 | Ga0207667_10003048 | Ga0207667_1000304810 | 424 |
| 661 | 3300025949 | Ga0207667_10009393 | Ga0207667_100093937 | 424 |
| 662 | 3300025949 | Ga0207667_10009844 | Ga0207667_100098445 | 424 |
| 663 | 3300025949 | Ga0207667_10148600 | Ga0207667_101486002 | 424 |
| 664 | 3300025960 | Ga0207651_10025737 | Ga0207651_100257373 | 424 |
| 665 | 3300025961 | Ga0207712_10002038 | Ga0207712_1000203816 | 424 |
| 666 | 3300025961 | Ga0207712_10010801 | Ga0207712_100108016 | 424 |
| 667 | 3300025986 | Ga0207658_10006444 | Ga0207658_100064442 | 424 |
| 668 | 3300026023 | Ga0207677_10010708 | Ga0207677_100107084 | 424 |
| 669 | 3300026023 | Ga0207677_10018744 | Ga0207677_100187443 | 424 |
| 670 | 3300026023 | Ga0207677_10025054 | Ga0207677_100250542 | 424 |
| 671 | 3300026023 | Ga0207677_10155500 | Ga0207677_101555001 | 424 |
| 672 | 3300026035 | Ga0207703_10001353 | Ga0207703_100013535 | 424 |
| 673 | 3300026041 | Ga0207639_10013965 | Ga0207639_100139651 | 424 |
| 674 | 3300026041 | Ga0207639_10087962 | Ga0207639_100879622 | 424 |
| 675 | 3300026078 | Ga0207702_10000402 | Ga0207702_1000040240 | 424 |
| 676 | 3300026078 | Ga0207702_10058598 | Ga0207702_100585983 | 424 |
| 677 | 3300026078 | Ga0207702_10209872 | Ga0207702_102098722 | 424 |
| 678 | 3300026088 | Ga0207641_10000015 | Ga0207641_10000015179 | 424 |
| 679 | 3300026088 | Ga0207641_10003713 | Ga0207641_100037134 | 424 |
| 680 | 3300026088 | Ga0207641_10060038 | Ga0207641_100600382 | 424 |
| 681 | 3300026089 | Ga0207648_10004907 | Ga0207648_100049076 | 424 |
| 682 | 3300026095 | Ga0207676_10259282 | Ga0207676_102592821 | 424 |
| 683 | 3300026116 | Ga0207674_10130099 | Ga0207674_101300992 | 424 |
| 684 | 3300026118 | Ga0207675_100029111 | Ga0207675_1000291115 | 424 |
| 685 | 3300026121 | Ga0207683_10031923 | Ga0207683_100319233 | 424 |
| 686 | 3300026121 | Ga0207683_10032833 | Ga0207683_100328332 | 424 |
| 687 | 3300026142 | Ga0207698_10000781 | Ga0207698_100007818 | 424 |
| 688 | 3300026142 | Ga0207698_10003383 | Ga0207698_100033836 | 424 |
| 689 | 3300026142 | Ga0207698_10023497 | Ga0207698_100234974 | 424 |
| 690 | 3300026142 | Ga0207698_10067557 | Ga0207698_100675573 | 424 |
| 691 | 3300028379 | Ga0268266_10000038 | Ga0268266_1000003869 | 424 |
| 692 | 3300028379 | Ga0268266_10002407 | Ga0268266_1000240712 | 424 |
| 693 | 3300028380 | Ga0268265_10024985 | Ga0268265_100249854 | 424 |
| 694 | 3300028381 | Ga0268264_10000167 | Ga0268264_1000016783 | 424 |
| 695 | 3300028381 | Ga0268264_10001730 | Ga0268264_100017307 | 424 |
| 696 | 3300028381 | Ga0268264_10003170 | Ga0268264_100031708 | 424 |
| 697 | 3300028381 | Ga0268264_10146204 | Ga0268264_101462042 | 424 |
| 698 | 3300028786 | Ga0307517_10002284 | Ga0307517_100022849 | 424 |
| 699 | 3300028786 | Ga0307517_10039015 | Ga0307517_100390155 | 424 |
| 700 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011519 | 424 |
| 701 | 3300028794 | Ga0307515_10000118 | Ga0307515_1000011817 | 424 |
| 702 | 3300028800 | Ga0265338_10029424 | Ga0265338_100294243 | 424 |
| 703 | 3300031251 | Ga0265327_10000048 | Ga0265327_10000048113 | 424 |
| 704 | 3300031251 | Ga0265327_10000087 | Ga0265327_1000008749 | 424 |
| 705 | 3300031251 | Ga0265327_10027369 | Ga0265327_100273693 | 424 |
| 706 | 3300031456 | Ga0307513_10043230 | Ga0307513_100432304 | 424 |
| 707 | 3300031507 | Ga0307509_10034066 | Ga0307509_100340666 | 424 |
| 708 | 3300031731 | Ga0307405_10000019 | Ga0307405_1000001919 | 424 |
| 709 | 3300031903 | Ga0307407_10000019 | Ga0307407_1000001974 | 424 |
| 710 | 3300032002 | Ga0307416_100000043 | Ga0307416_10000004316 | 424 |
| 711 | 3300032004 | Ga0307414_10020378 | Ga0307414_100203782 | 424 |
| 712 | 3300032004 | Ga0307414_10021936 | Ga0307414_100219364 | 424 |
| 713 | 3300033180 | Ga0307510_10000366 | Ga0307510_100003662 | 424 |
| 714 | 3300033180 | Ga0307510_10000584 | Ga0307510_1000058427 | 424 |
| 715 | 3300035115 | Ga0373941_0026539 | Ga0373941_0026539_313_1644 | 424 |
| 716 | 3300037312 | Ga0395899_0000199 | Ga0395899_0000199_18663_19994 | 424 |
| 717 | 3300037312 | Ga0395899_0035871 | Ga0395899_0035871_2201_3532 | 424 |
| 718 | 3300037418 | Ga0395900_0000157 | Ga0395900_0000157_90377_91708 | 424 |
| 719 | 3300037418 | Ga0395900_0001198 | Ga0395900_0001198_21570_22973 | 424 |
| 720 | 3300037418 | Ga0395900_0072094 | Ga0395900_0072094_1450_2781 | 424 |
| 721 | 3300037466 | Ga0395898_0002190 | Ga0395898_0002190_21698_23101 | 424 |
| 722 | 3300037471 | Ga0395905_0000195 | Ga0395905_0000195_20406_21737 | 424 |
| 723 | 3300038443 | Ga0395901_0000283 | Ga0395901_0000283_41157_42488 | 424 |
| 724 | 3300038443 | Ga0395901_0083896 | Ga0395901_0083896_610_2013 | 424 |
| 725 | 3300039447 | Ga0436361_1176719 | Ga0436361_1176719_3234_4565 | 424 |
| 726 | 3300041404 | Ga0439436_0013968 | Ga0439436_0013968_118_1449 | 424 |
| 727 | 3300041406 | Ga0439439_0002323 | Ga0439439_0002323_38_1369 | 424 |
| 728 | 3300041512 | Ga0451853_4091274 | Ga0451853_4091274_1294_2625 | 424 |
| 729 | 3300042007 | Ga0439449_0023565 | Ga0439449_0023565_680_2011 | 424 |
| 730 | 3300042014 | Ga0439457_000443 | Ga0439457_000443_7798_9129 | 424 |
| 731 | 3300042015 | Ga0439462_0017135 | Ga0439462_0017135_217_1548 | 424 |
| 732 | 3300044658 | Ga0466972_0000009 | Ga0466972_0000009_38295_39626 | 424 |
| 733 | 3300044658 | Ga0466972_0000112 | Ga0466972_0000112_65908_67239 | 424 |
| 734 | 3300044658 | Ga0466972_0022719 | Ga0466972_0022719_77_1408 | 424 |
| 735 | 3300044765 | Ga0466970_0000219 | Ga0466970_0000219_2945_4276 | 424 |
| 736 | 3300044842 | Ga0466957_0004511 | Ga0466957_0004511_849_2180 | 424 |
| 737 | 3300044842 | Ga0466957_0007656 | Ga0466957_0007656_1670_3001 | 424 |
| 738 | 3300046507 | Ga0495606_0003054 | Ga0495606_0003054_13895_15226 | 424 |
| 739 | 3300046616 | Ga0495668_0079637 | Ga0495668_0079637_201_1532 | 424 |
| 740 | 3300046648 | Ga0495611_0000575 | Ga0495611_0000575_5647_6978 | 424 |
| 741 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_273434_274765 | 424 |
| 742 | 3300048903 | Ga0496100_0064183 | Ga0496100_0064183_503_1837 | 424 |
| 743 | 3300048911 | Ga0496108_0266551 | Ga0496108_0266551_52_1383 | 424 |
| 744 | 3300048917 | Ga0496114_0045581 | Ga0496114_0045581_941_2275 | 424 |
| 745 | 3300048925 | Ga0496122_0007600 | Ga0496122_0007600_5199_6530 | 424 |
| 746 | 3300048926 | Ga0496123_0005589 | Ga0496123_0005589_8812_10143 | 424 |
| 747 | 3300048928 | Ga0496125_0138933 | Ga0496125_0138933_18_1349 | 424 |
| 748 | 3300049521 | Ga0501298_001859 | Ga0501298_001859_991_2322 | 424 |
| 749 | 3300049581 | Ga0501047_0046945 | Ga0501047_0046945_459_1790 | 424 |
| 750 | 3300049651 | Ga0501201_001583 | Ga0501201_001583_492_1823 | 424 |
| 751 | 3300049652 | Ga0501202_001201 | Ga0501202_001201_2516_3847 | 424 |
| 752 | 3300049654 | Ga0501207_003077 | Ga0501207_003077_705_2036 | 424 |
| 753 | 3300049661 | Ga0501217_001912 | Ga0501217_001912_1468_2799 | 424 |
| 754 | 3300049663 | Ga0501223_004327 | Ga0501223_004327_235_1566 | 424 |
| 755 | 3300049668 | Ga0501233_001105 | Ga0501233_001105_2575_3906 | 424 |
| 756 | 3300049669 | Ga0501235_000216 | Ga0501235_000216_1977_3308 | 424 |
| 757 | 3300049679 | Ga0501249_008146 | Ga0501249_008146_315_1646 | 424 |
| 758 | 3300049682 | Ga0501252_000189 | Ga0501252_000189_2056_3387 | 424 |
| 759 | 3300049688 | Ga0501259_002702 | Ga0501259_002702_512_1843 | 424 |
| 760 | 3300049704 | Ga0501221_001496 | Ga0501221_001496_1485_2816 | 424 |
| 761 | 3300049705 | Ga0501225_0010736 | Ga0501225_0010736_130_1461 | 424 |
| 762 | 3300049776 | Ga0501280_001371 | Ga0501280_001371_3109_4425 | 424 |
| 763 | 3300050507 | nmdc:mga05p37_13392_c1 | nmdc:mga05p37_13392_c1_8146_9477 | 424 |
| 764 | 3300053090 | Ga0500646_0009704 | Ga0500646_0009704_1042_2382 | 424 |
| 765 | 3300053122 | Ga0500608_000548 | Ga0500608_000548_3956_5287 | 424 |
| 766 | 3300053130 | Ga0500642_0027173 | Ga0500642_0027173_206_1537 | 424 |
| 767 | 3300053139 | Ga0500568_0003925 | Ga0500568_0003925_6725_8056 | 424 |
| 768 | 3300053153 | Ga0500616_0011098 | Ga0500616_0011098_3536_4867 | 424 |
| 769 | 3300053156 | Ga0500622_0002480 | Ga0500622_0002480_4285_5625 | 424 |
| 770 | iso_pu_bacteria | 2884634485 | 2884636377 | 424 |
| 771 | iso_pu_bacteria | 2896317667 | 2896319237 | 424 |
| 772 | 3300001989 | JGI24739J22299_10006165 | JGI24739J22299_100061655 | 425 |
| 773 | 3300003316 | rootH1_10066410 | rootH1_100664102 | 425 |
| 774 | 3300003354 | JGI25160J50197_1011032 | JGI25160J50197_10110322 | 425 |
| 775 | 3300003781 | Ga0055536_1007187 | Ga0055536_10071874 | 425 |
| 776 | 3300003790 | Ga0055528_1003675 | Ga0055528_10036757 | 425 |
| 777 | 3300003794 | Ga0055531_10000122 | Ga0055531_1000012229 | 425 |
| 778 | 3300005262 | Ga0065165_1000032 | Ga0065165_100003290 | 425 |
| 779 | 3300005262 | Ga0065165_1000038 | Ga0065165_100003813 | 425 |
| 780 | 3300005328 | Ga0070676_10043662 | Ga0070676_100436622 | 425 |
| 781 | 3300005329 | Ga0070683_100063721 | Ga0070683_1000637214 | 425 |
| 782 | 3300005330 | Ga0070690_100006298 | Ga0070690_1000062982 | 425 |
| 783 | 3300005334 | Ga0068869_100003479 | Ga0068869_1000034792 | 425 |
| 784 | 3300005334 | Ga0068869_100036630 | Ga0068869_1000366302 | 425 |
| 785 | 3300005335 | Ga0070666_10122148 | Ga0070666_101221481 | 425 |
| 786 | 3300005338 | Ga0068868_100033422 | Ga0068868_1000334223 | 425 |
| 787 | 3300005338 | Ga0068868_100043561 | Ga0068868_1000435611 | 425 |
| 788 | 3300005344 | Ga0070661_100001902 | Ga0070661_10000190210 | 425 |
| 789 | 3300005344 | Ga0070661_100013862 | Ga0070661_1000138622 | 425 |
| 790 | 3300005456 | Ga0070678_100043920 | Ga0070678_1000439202 | 425 |
| 791 | 3300005535 | Ga0070684_100004405 | Ga0070684_1000044057 | 425 |
| 792 | 3300005539 | Ga0068853_100008940 | Ga0068853_1000089406 | 425 |
| 793 | 3300005577 | Ga0068857_100007688 | Ga0068857_1000076884 | 425 |
| 794 | 3300005577 | Ga0068857_100044712 | Ga0068857_1000447122 | 425 |
| 795 | 3300005719 | Ga0068861_100207861 | Ga0068861_1002078612 | 425 |
| 796 | 3300005841 | Ga0068863_100224267 | Ga0068863_1002242671 | 425 |
| 797 | 3300005843 | Ga0068860_100312667 | Ga0068860_1003126671 | 425 |
| 798 | 3300006237 | Ga0097621_100257459 | Ga0097621_1002574592 | 425 |
| 799 | 3300006881 | Ga0068865_100045912 | Ga0068865_1000459122 | 425 |
| 800 | 3300009101 | Ga0105247_10000703 | Ga0105247_100007039 | 425 |
| 801 | 3300009176 | Ga0105242_10028204 | Ga0105242_100282041 | 425 |
| 802 | 3300009553 | Ga0105249_10001349 | Ga0105249_1000134921 | 425 |
| 803 | 3300009553 | Ga0105249_10030283 | Ga0105249_100302832 | 425 |
| 804 | 3300009553 | Ga0105249_10030611 | Ga0105249_100306115 | 425 |
| 805 | 3300010375 | Ga0105239_10190018 | Ga0105239_101900182 | 425 |
| 806 | 3300013296 | Ga0157374_10001929 | Ga0157374_1000192915 | 425 |
| 807 | 3300013296 | Ga0157374_10008313 | Ga0157374_100083139 | 425 |
| 808 | 3300013306 | Ga0163162_10003753 | Ga0163162_100037539 | 425 |
| 809 | 3300014325 | Ga0163163_10000218 | Ga0163163_1000021824 | 425 |
| 810 | 3300014325 | Ga0163163_10084163 | Ga0163163_100841632 | 425 |
| 811 | 3300014968 | Ga0157379_10041030 | Ga0157379_100410304 | 425 |
| 812 | 3300014968 | Ga0157379_10098063 | Ga0157379_100980632 | 425 |
| 813 | 3300014969 | Ga0157376_10064348 | Ga0157376_100643482 | 425 |
| 814 | 3300017792 | Ga0163161_10024980 | Ga0163161_100249802 | 425 |
| 815 | 3300017792 | Ga0163161_10055284 | Ga0163161_100552842 | 425 |
| 816 | 3300025273 | Ga0209673_1000130 | Ga0209673_1000130118 | 425 |
| 817 | 3300025284 | Ga0209130_1002095 | Ga0209130_10020959 | 425 |
| 818 | 3300025292 | Ga0209676_1001398 | Ga0209676_100139812 | 425 |
| 819 | 3300025302 | Ga0207426_1000134 | Ga0207426_1000134125 | 425 |
| 820 | 3300025304 | Ga0209257_1000008 | Ga0209257_1000008449 | 425 |
| 821 | 3300025900 | Ga0207710_10002539 | Ga0207710_100025394 | 425 |
| 822 | 3300025904 | Ga0207647_10055996 | Ga0207647_100559962 | 425 |
| 823 | 3300025907 | Ga0207645_10069066 | Ga0207645_100690662 | 425 |
| 824 | 3300025920 | Ga0207649_10039990 | Ga0207649_100399902 | 425 |
| 825 | 3300025933 | Ga0207706_10073160 | Ga0207706_100731602 | 425 |
| 826 | 3300025934 | Ga0207686_10136787 | Ga0207686_101367871 | 425 |
| 827 | 3300025942 | Ga0207689_10005981 | Ga0207689_100059818 | 425 |
| 828 | 3300025942 | Ga0207689_10025097 | Ga0207689_100250974 | 425 |
| 829 | 3300025942 | Ga0207689_10033598 | Ga0207689_100335983 | 425 |
| 830 | 3300025942 | Ga0207689_10037526 | Ga0207689_100375262 | 425 |
| 831 | 3300025945 | Ga0207679_10012320 | Ga0207679_100123206 | 425 |
| 832 | 3300025945 | Ga0207679_10022977 | Ga0207679_100229774 | 425 |
| 833 | 3300025961 | Ga0207712_10019928 | Ga0207712_100199283 | 425 |
| 834 | 3300026023 | Ga0207677_10155314 | Ga0207677_101553142 | 425 |
| 835 | 3300026116 | Ga0207674_10001258 | Ga0207674_100012584 | 425 |
| 836 | 3300026116 | Ga0207674_10082272 | Ga0207674_100822723 | 425 |
| 837 | 3300026116 | Ga0207674_10264265 | Ga0207674_102642652 | 425 |
| 838 | 3300026118 | Ga0207675_100097964 | Ga0207675_1000979642 | 425 |
| 839 | 3300026121 | Ga0207683_10066895 | Ga0207683_100668953 | 425 |
| 840 | 3300035172 | Ga0373955_0017629 | Ga0373955_0017629_250_1587 | 425 |
| 841 | 3300036401 | Ga0373937_0075722 | Ga0373937_0075722_464_1801 | 425 |
| 842 | 3300044673 | Ga0453683_0104499 | Ga0453683_0104499_438_1754 | 425 |
| 843 | 3300044712 | Ga0453684_0087982 | Ga0453684_0087982_1871_3187 | 425 |
| 844 | 3300045049 | Ga0466959_0006121 | Ga0466959_0006121_6842_8164 | 425 |
| 845 | 3300045051 | Ga0451576_0329310 | Ga0451576_0329310_123_1463 | 425 |
| 846 | 3300046516 | Ga0495628_0045889 | Ga0495628_0045889_1059_2396 | 425 |
| 847 | 3300046517 | Ga0495630_0067282 | Ga0495630_0067282_773_2110 | 425 |
| 848 | 3300046536 | Ga0495587_0062899 | Ga0495587_0062899_223_1560 | 425 |
| 849 | 3300047321 | Ga0495676_0098157 | Ga0495676_0098157_395_1729 | 425 |
| 850 | 3300049569 | Ga0501032_0005075 | Ga0501032_0005075_3553_4887 | 425 |
| 851 | 3300049571 | Ga0501034_0002417 | Ga0501034_0002417_13741_15075 | 425 |
| 852 | 3300049579 | Ga0501043_0003522 | Ga0501043_0003522_1410_2744 | 425 |
| 853 | 3300049580 | Ga0501046_0127689 | Ga0501046_0127689_11_1345 | 425 |
| 854 | 3300049581 | Ga0501047_0014683 | Ga0501047_0014683_4354_5658 | 425 |
| 855 | 3300049583 | Ga0501067_0073249 | Ga0501067_0073249_479_1813 | 425 |
| 856 | 3300049589 | Ga0501073_0001563 | Ga0501073_0001563_13641_14975 | 425 |
| 857 | 3300049590 | Ga0501074_0016152 | Ga0501074_0016152_144_1478 | 425 |
| 858 | 3300049742 | Ga0501080_0009971 | Ga0501080_0009971_6322_7656 | 425 |
| 859 | 3300049822 | Ga0501035_0103845 | Ga0501035_0103845_327_1631 | 425 |
| 860 | 3300053121 | Ga0500607_010270 | Ga0500607_010270_1554_2858 | 425 |
| 861 | 3300053156 | Ga0500622_0000072 | Ga0500622_0000072_56735_58036 | 425 |
| 862 | 3300053177 | Ga0500636_0005328 | Ga0500636_0005328_2980_4284 | 425 |
| 863 | iso_pu_bacteria | 2842903701 | 2842907241 | 425 |
| 864 | 3300005262 | Ga0065165_1010235 | Ga0065165_10102354 | 426 |
| 865 | 3300009094 | Ga0111539_10006292 | Ga0111539_100062925 | 426 |
| 866 | 3300026035 | Ga0207703_10146961 | Ga0207703_101469612 | 426 |
| 867 | 3300042876 | Ga0451577_0048296 | Ga0451577_0048296_746_2086 | 426 |
| 868 | 3300044712 | Ga0453684_0154856 | Ga0453684_0154856_1260_2588 | 426 |
| 869 | 3300048924 | Ga0496121_0000011 | Ga0496121_0000011_13956_15269 | 426 |
| 870 | 2162886007 | SwRhRL2b_contig_2061135 | SwRhRL2b_0637.00004210 | 427 |
| 871 | 3300003794 | Ga0055531_10000061 | Ga0055531_100000612 | 427 |
| 872 | 3300005289 | Ga0065704_10000361 | Ga0065704_100003615 | 427 |
| 873 | 3300005289 | Ga0065704_10072305 | Ga0065704_100723054 | 427 |
| 874 | 3300005354 | Ga0070675_100112565 | Ga0070675_1001125652 | 427 |
| 875 | 3300005543 | Ga0070672_100163286 | Ga0070672_1001632862 | 427 |
| 876 | 3300005547 | Ga0070693_100114148 | Ga0070693_1001141482 | 427 |
| 877 | 3300009148 | Ga0105243_10000002 | Ga0105243_10000002673 | 427 |
| 878 | 3300025304 | Ga0209257_1000006 | Ga0209257_1000006253 | 427 |
| 879 | 3300025935 | Ga0207709_10000003 | Ga0207709_10000003680 | 427 |
| 880 | 3300025940 | Ga0207691_10004645 | Ga0207691_100046454 | 427 |
| 881 | 3300025960 | Ga0207651_10023804 | Ga0207651_100238042 | 427 |
| 882 | 3300030731 | Ga0316177_1089841 | Ga0316177_10898411 | 427 |
| 883 | 3300030732 | Ga0316176_1068370 | Ga0316176_10683703 | 427 |
| 884 | 3300030742 | Ga0316183_1006105 | Ga0316183_100610515 | 427 |
| 885 | 3300030744 | Ga0316181_1099963 | Ga0316181_10999633 | 427 |
| 886 | 3300031731 | Ga0307405_10032487 | Ga0307405_100324874 | 427 |
| 887 | 3300031903 | Ga0307407_10010507 | Ga0307407_100105075 | 427 |
| 888 | 3300032002 | Ga0307416_100000341 | Ga0307416_10000034124 | 427 |
| 889 | 3300032126 | Ga0307415_100048082 | Ga0307415_1000480823 | 427 |
| 890 | 3300044712 | Ga0453684_0002765 | Ga0453684_0002765_36724_38040 | 427 |
| 891 | 3300045051 | Ga0451576_0029508 | Ga0451576_0029508_3400_4716 | 427 |
| 892 | 3300046660 | Ga0495625_0078642 | Ga0495625_0078642_469_1932 | 427 |
| 893 | 3300048919 | Ga0496116_0009315 | Ga0496116_0009315_299_1582 | 427 |
| 894 | 3300048920 | Ga0496117_0000938 | Ga0496117_0000938_918_2201 | 427 |
| 895 | 3300048920 | Ga0496117_0004744 | Ga0496117_0004744_12842_14125 | 427 |
| 896 | 3300048925 | Ga0496122_0003582 | Ga0496122_0003582_12991_14274 | 427 |
| 897 | 3300048925 | Ga0496122_0012699 | Ga0496122_0012699_6734_8017 | 427 |
| 898 | 3300048926 | Ga0496123_0030795 | Ga0496123_0030795_2053_3336 | 427 |
| 899 | iso_pu_bacteria | 8055588893 | 8055591946 | 427 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3evn-assembly1.cif.gz_A | crystal structure of putative oxidoreductase from streptococcus agalactiae 2603v/r | 0.8451 | 32 | 393 |
| 7bvj-assembly3.cif.gz_C | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) | 0.8402 | 32 | 392 |
| 7bvj-assembly4.cif.gz_D | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) | 0.8399 | 32 | 392 |
| 6o15-assembly1.cif.gz_B | crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with nad(h) | 0.8384 | 32 | 397 |
| 3q2k-assembly2.cif.gz_P | crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca | 0.8375 | 32 | 399 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3moiA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.932 | 32 | 154 | 3.40.50.720 |
| af_Q66GR2_10_139_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9292 | 33 | 154 | 3.40.50.720 |
| af_P42599_1_134_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9249 | 32 | 153 | 3.40.50.720 |
| 2ixbA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9207 | 30 | 153 | 3.40.50.720 |
| 4hktB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9149 | 32 | 154 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X8BRV8-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9807 | 35 | 427 |
GO:0000166
|
| AF-A0A3C0AG81-F1-model_v4 | Dehydrogenase | 0.9745 | 90 | 427 |
GO:0000166
|
| AF-A0A3C0AG81-F1-model_v4 | Dehydrogenase | 0.9687 | 90 | 427 |
GO:0000166
|
| AF-A0A356AZ50-F1-model_v4 | Oxidoreductase | 0.9538 | 229 | 427 |
|
| AF-A0A7C1YPV6-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9399 | 30 | 173 |
GO:0000166
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar