F485106

General Info

Members Datasets Scaffolds Average Seq Length
899 356 866 436

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10002924|Ga0157370_100029249
Length 503
Sequence VRVILKVKDEGKKKGLFVCLLKNLLFYFNFPCAFIYCFFIFIQWLGNLPRFGNLSLKINTMNSRRKFLQNSAVMLGGSILASSVSNPVFAIFNNRVAPSDQLNIGAIGVNGMGWADVMAALKIPGVNLVAICDVDKNVIDKRLKDLAKMNKDTSKVKTYGDYRQLLDDKDVDAVVIGTPDHWHALIMMDACAAGKDVYCEKPVGNSIGECRAMVAAQQRYNKAVQCGQWQRSQQHFKDAVDYVQTGVLGNIRTVKVWCYQGWMKPGPVVPDTAPPAGVDYTMWLGPAPKRAFNASRFHFNFRWFWDYAGGLMTDWGVHLLDYGLLGMKSPTPKSVSALGGRFAYPDLYEETPDTLTTLYEFDGFNMVWDSAMGIDNGSYNRDHGIAYIGNNGTLILNRGGWEVIEEKQSKNKVSKPFAPSTDNGVEKHWENFVSVVKSRKMEDLHCPIQAGAHVATVAQMGNIAYHSGKKLEWDAAKEQFTDNAVNKEYFMKEYHNGYKLAKV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2738541278 Niastella sp. CF465 Isolate Unclassified
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
8 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
9 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
10 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
11 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
12 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
13 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
14 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
15 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
16 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
17 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
18 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
19 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
20 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
21 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
22 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
23 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
24 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
25 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
26 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
27 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
28 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
32 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
33 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
34 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
52 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
150 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
154 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
220 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
224 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
225 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
226 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
227 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
228 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
252 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
253 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
256 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
257 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
266 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
303 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
318 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
319 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
320 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
321 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
322 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
323 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
324 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
325 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
326 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
327 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
328 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
341 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
344 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
345 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
346 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
347 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
348 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
349 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
352 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
356 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 0.22
Isolates 3.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0
Rhizoplane 0.67
Rhizosphere 86.43
Stem 0
Stem Tuber 0
Unclassified 6.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2061135 2162886007 Bacteria 1796
2 JGI24739J22299_10006165 3300001989 Bacteria 4528
3 JGI24737J22298_10012446 3300001990 Bacteria 2774
4 JGI25154J39366_1000179 3300002738 Bacteria 49600
5 JGI25164J39214_1000820 3300002772 Bacteria 10880
6 JGI25152J39213_1001701 3300002773 Bacteria 9036
7 JGI25150J39212_1000030 3300002774 Bacteria 101822
8 JGI25151J46595_10000129 3300003187 Bacteria 101822
9 JGI25165J46597_1000655 3300003214 Bacteria 28353
10 JGI25153J46596_10000096 3300003215 Bacteria 101822
11 rootH1_10066410 3300003316 Bacteria 3887
12 rootH2_10002127 3300003320 Bacteria 66384
13 rootH2_10103944 3300003320 Bacteria 4561
14 rootL2_10056273 3300003322 Bacteria 5811
15 rootL2_10101507 3300003322 Bacteria 4567
16 rootL2_10180035 3300003322 Bacteria 2645
17 rootL2_10212594 3300003322 Bacteria 2143
18 rootH1_10004576 3300003323 Bacteria 68064
19 rootH1_10026336 3300003323 Bacteria 2748
20 rootH1_10190967 3300003323 Bacteria 6418
21 JGI25160J50197_1003411 3300003354 Bacteria 7115
22 JGI25160J50197_1011032 3300003354 Bacteria 3230
23 Ga0055542_1006065 3300003762 Bacteria 2632
24 Ga0055536_1001818 3300003781 Bacteria 12513
25 Ga0055536_1007187 3300003781 Bacteria 5031
26 Ga0055528_1003675 3300003790 Bacteria 7610
27 Ga0055531_10000061 3300003794 Bacteria 120535
28 Ga0055531_10000122 3300003794 Bacteria 86804
29 Ga0058862_12292963 3300004803 Bacteria 4249
30 Ga0065165_1000032 3300005262 Bacteria 216051
31 Ga0065165_1000038 3300005262 Bacteria 211664
32 Ga0065165_1000259 3300005262 Bacteria 91800
33 Ga0065165_1010235 3300005262 Bacteria 4085
34 Ga0065165_1037409 3300005262 Bacteria 1471
35 Ga0065714_10086418 3300005288 Bacteria 2102
36 Ga0065714_10109159 3300005288 Bacteria 1504
37 Ga0065704_10000361 3300005289 Bacteria 27784
38 Ga0065704_10072305 3300005289 Bacteria 8768
39 Ga0065712_10003244 3300005290 Bacteria 4324
40 Ga0065712_10004111 3300005290 Bacteria 3556
41 Ga0065712_10004771 3300005290 Bacteria 3806
42 Ga0065712_10070396 3300005290 Bacteria 6047
43 Ga0065715_10006829 3300005293 Bacteria 3060
44 Ga0070658_10002733 3300005327 Bacteria 14690
45 Ga0070658_10051061 3300005327 Bacteria 3351
46 Ga0070658_10056185 3300005327 Bacteria 3199
47 Ga0070676_10000375 3300005328 Bacteria 20682
48 Ga0070676_10043662 3300005328 Bacteria 2606
49 Ga0070683_100015621 3300005329 Bacteria 6673
50 Ga0070683_100063721 3300005329 Bacteria 3430
51 Ga0070683_100161545 3300005329 Bacteria 2126
52 Ga0070683_100227021 3300005329 Bacteria 1775
53 Ga0070690_100006298 3300005330 Bacteria 6730
54 Ga0070670_100014394 3300005331 Bacteria 6787
55 Ga0070670_100042609 3300005331 Bacteria 3902
56 Ga0070670_100077448 3300005331 Unclassified 2857
57 Ga0070670_100110524 3300005331 Bacteria 2368
58 Ga0068869_100003479 3300005334 Bacteria 9633
59 Ga0068869_100008042 3300005334 Bacteria 6774
60 Ga0068869_100036630 3300005334 Bacteria 3484
61 Ga0068869_100082498 3300005334 Bacteria 2403
62 Ga0068869_100085972 3300005334 Bacteria 2356
63 Ga0070666_10000030 3300005335 Bacteria 137543
64 Ga0070666_10025874 3300005335 Bacteria 3828
65 Ga0070666_10031202 3300005335 Bacteria 3517
66 Ga0070666_10122148 3300005335 Bacteria 1807
67 Ga0070682_100084379 3300005337 Bacteria 2064
68 Ga0068868_100033422 3300005338 Bacteria 3964
69 Ga0068868_100035467 3300005338 Bacteria 3856
70 Ga0068868_100043561 3300005338 Bacteria 3506
71 Ga0068868_100050675 3300005338 Bacteria 3261
72 Ga0068868_100060702 3300005338 Bacteria 2994
73 Ga0070660_100026775 3300005339 Bacteria 4296
74 Ga0070660_100033516 3300005339 Bacteria 3871
75 Ga0070660_100106424 3300005339 Bacteria 2227
76 Ga0070689_100010923 3300005340 Bacteria 6489
77 Ga0070689_100082955 3300005340 Bacteria 2519
78 Ga0070687_100023265 3300005343 Bacteria 2943
79 Ga0070661_100001902 3300005344 Bacteria 14468
80 Ga0070661_100013862 3300005344 Bacteria 5664
81 Ga0070668_100003881 3300005347 Bacteria 11039
82 Ga0070668_100010496 3300005347 Bacteria 6885
83 Ga0070668_100069889 3300005347 Bacteria 2733
84 Ga0070669_100019917 3300005353 Bacteria 4792
85 Ga0070669_100102087 3300005353 Unclassified 2165
86 Ga0070675_100020974 3300005354 Bacteria 5218
87 Ga0070675_100043197 3300005354 Bacteria 3683
88 Ga0070675_100064163 3300005354 Bacteria 3037
89 Ga0070675_100079654 3300005354 Bacteria 2730
90 Ga0070675_100112565 3300005354 Bacteria 2304
91 Ga0070675_100244487 3300005354 Bacteria 1569
92 Ga0070671_100006460 3300005355 Bacteria 9371
93 Ga0070671_100024337 3300005355 Bacteria 4956
94 Ga0070671_100069058 3300005355 Bacteria 2947
95 Ga0070674_100032111 3300005356 Bacteria 3485
96 Ga0070673_100015236 3300005364 Bacteria 5393
97 Ga0070673_100038431 3300005364 Bacteria 3655
98 Ga0070673_100083696 3300005364 Bacteria 2592
99 Ga0070673_100199907 3300005364 Bacteria 1721
100 Ga0070688_100006850 3300005365 Bacteria 6115
101 Ga0070688_100022637 3300005365 Bacteria 3686
102 Ga0070688_100039392 3300005365 Bacteria 2891
103 Ga0070659_100003883 3300005366 Bacteria 10646
104 Ga0070659_100130681 3300005366 Bacteria 2039
105 Ga0070667_100000482 3300005367 Bacteria 40557
106 Ga0070667_100001675 3300005367 Bacteria 19809
107 Ga0070667_100015893 3300005367 Bacteria 6227
108 Ga0070667_100019741 3300005367 Bacteria 5591
109 Ga0070667_100102353 3300005367 Bacteria 2475
110 Ga0070678_100022468 3300005456 Bacteria 4181
111 Ga0070678_100027160 3300005456 Bacteria 3883
112 Ga0070678_100043920 3300005456 Bacteria 3187
113 Ga0070662_100000311 3300005457 Bacteria 28977
114 Ga0070662_100010886 3300005457 Bacteria 5992
115 Ga0070662_100051531 3300005457 Unclassified 2973
116 Ga0070662_100073666 3300005457 Bacteria 2524
117 Ga0070662_100100205 3300005457 Bacteria 2191
118 Ga0070662_100131647 3300005457 Unclassified 1929
119 Ga0070681_10057046 3300005458 Bacteria 3886
120 Ga0068867_100030855 3300005459 Bacteria 3867
121 Ga0068867_100041721 3300005459 Bacteria 3353
122 Ga0068867_100092285 3300005459 Bacteria 2299
123 Ga0070685_10014893 3300005466 Bacteria 4126
124 Ga0070685_10025212 3300005466 Bacteria 3273
125 Ga0070698_100003501 3300005471 Bacteria 17268
126 Ga0070698_100004308 3300005471 Bacteria 15657
127 Ga0070698_100008096 3300005471 Bacteria 11367
128 Ga0070699_100049932 3300005518 Bacteria 3621
129 Ga0070679_100001547 3300005530 Bacteria 20544
130 Ga0070679_100003672 3300005530 Bacteria 14053
131 Ga0070684_100004405 3300005535 Bacteria 10715
132 Ga0068853_100000250 3300005539 Bacteria 37737
133 Ga0068853_100008940 3300005539 Bacteria 8065
134 Ga0068853_100019481 3300005539 Bacteria 5625
135 Ga0068853_100085121 3300005539 Bacteria 2771
136 Ga0068853_100096681 3300005539 Bacteria 2606
137 Ga0068853_100100047 3300005539 Bacteria 2562
138 Ga0068853_100113912 3300005539 Bacteria 2405
139 Ga0068853_100181125 3300005539 Bacteria 1911
140 Ga0070672_100000361 3300005543 Bacteria 26202
141 Ga0070672_100058066 3300005543 Bacteria 3040
142 Ga0070672_100163286 3300005543 Bacteria 1849
143 Ga0070672_100213858 3300005543 Bacteria 1615
144 Ga0070696_100004704 3300005546 Bacteria 9124
145 Ga0070693_100114148 3300005547 Bacteria 1666
146 Ga0070665_100000001 3300005548 Bacteria 1083363
147 Ga0070665_100057751 3300005548 Bacteria 3890
148 Ga0070665_100204264 3300005548 Bacteria 1976
149 Ga0070704_100027391 3300005549 Bacteria 3780
150 Ga0068855_100000393 3300005563 Bacteria 53897
151 Ga0068855_100000463 3300005563 Bacteria 50000
152 Ga0068855_100001155 3300005563 Bacteria 32713
153 Ga0068855_100002947 3300005563 Bacteria 20801
154 Ga0068855_100006289 3300005563 Bacteria 14477
155 Ga0068855_100035606 3300005563 Bacteria 5929
156 Ga0068855_100074258 3300005563 Bacteria 3950
157 Ga0068855_100102479 3300005563 Bacteria 3295
158 Ga0068855_100265849 3300005563 Bacteria 1909
159 Ga0068855_100336613 3300005563 Bacteria 1665
160 Ga0070664_100025631 3300005564 Bacteria 4890
161 Ga0068857_100007688 3300005577 Bacteria 9285
162 Ga0068857_100032480 3300005577 Bacteria 4615
163 Ga0068857_100036112 3300005577 Bacteria 4379
164 Ga0068857_100044712 3300005577 Unclassified 3929
165 Ga0068857_100082949 3300005577 Bacteria 2864
166 Ga0068854_100046447 3300005578 Bacteria 3091
167 Ga0068854_100149273 3300005578 Bacteria 1801
168 Ga0068856_100000976 3300005614 Bacteria 30515
169 Ga0068856_100010242 3300005614 Bacteria 9115
170 Ga0068856_100018743 3300005614 Bacteria 6709
171 Ga0068856_100027819 3300005614 Bacteria 5516
172 Ga0068856_100033380 3300005614 Bacteria 5039
173 Ga0068856_100109193 3300005614 Bacteria 2763
174 Ga0068856_100136587 3300005614 Bacteria 2457
175 Ga0068856_100256661 3300005614 Bacteria 1763
176 Ga0068852_100000242 3300005616 Bacteria 37066
177 Ga0068852_100000336 3300005616 Bacteria 31871
178 Ga0068852_100000842 3300005616 Bacteria 20355
179 Ga0068852_100004228 3300005616 Bacteria 10134
180 Ga0068859_100000003 3300005617 Bacteria 479218
181 Ga0068859_100013814 3300005617 Bacteria 8097
182 Ga0068859_100043651 3300005617 Bacteria 4506
183 Ga0068859_100053979 3300005617 Bacteria 4041
184 Ga0068859_100167398 3300005617 Bacteria 2278
185 Ga0068864_100000785 3300005618 Bacteria 26636
186 Ga0068864_100006709 3300005618 Bacteria 9431
187 Ga0068864_100022225 3300005618 Bacteria 5317
188 Ga0068864_100041076 3300005618 Bacteria 3956
189 Ga0068866_10022853 3300005718 Bacteria 2900
190 Ga0068861_100000424 3300005719 Bacteria 24519
191 Ga0068861_100027169 3300005719 Bacteria 4166
192 Ga0068861_100048849 3300005719 Bacteria 3201
193 Ga0068861_100111406 3300005719 Bacteria 2193
194 Ga0068861_100207861 3300005719 Bacteria 1647
195 Ga0068851_10002845 3300005834 Bacteria 7638
196 Ga0068851_10004750 3300005834 Bacteria 6153
197 Ga0068870_10030849 3300005840 Bacteria 2712
198 Ga0068870_10034123 3300005840 Bacteria 2602
199 Ga0068863_100004269 3300005841 Bacteria 14090
200 Ga0068863_100006964 3300005841 Bacteria 11087
201 Ga0068863_100015248 3300005841 Bacteria 7386
202 Ga0068863_100027774 3300005841 Bacteria 5400
203 Ga0068863_100033321 3300005841 Bacteria 4907
204 Ga0068863_100053225 3300005841 Bacteria 3836
205 Ga0068863_100224267 3300005841 Bacteria 1811
206 Ga0068858_100003593 3300005842 Bacteria 15347
207 Ga0068858_100030266 3300005842 Bacteria 5027
208 Ga0068858_100088396 3300005842 Bacteria 2883
209 Ga0068860_100000097 3300005843 Bacteria 146573
210 Ga0068860_100002301 3300005843 Bacteria 20084
211 Ga0068860_100002474 3300005843 Bacteria 19388
212 Ga0068860_100006909 3300005843 Bacteria 11379
213 Ga0068860_100010870 3300005843 Bacteria 8978
214 Ga0068860_100168485 3300005843 Bacteria 2115
215 Ga0068860_100312667 3300005843 Bacteria 1541
216 Ga0068862_100017277 3300005844 Bacteria 6005
217 Ga0068862_100098698 3300005844 Bacteria 2551
218 Ga0068862_100137800 3300005844 Bacteria 2164
219 Ga0081539_10000622 3300005985 Bacteria 71778
220 Ga0070715_10056215 3300006163 Bacteria 1711
221 Ga0097621_100000626 3300006237 Bacteria 24907
222 Ga0097621_100000681 3300006237 Bacteria 23791
223 Ga0097621_100005463 3300006237 Bacteria 8948
224 Ga0097621_100009274 3300006237 Bacteria 7141
225 Ga0097621_100027606 3300006237 Bacteria 4466
226 Ga0097621_100257459 3300006237 Bacteria 1530
227 Ga0068871_100000790 3300006358 Bacteria 21264
228 Ga0068871_100001337 3300006358 Bacteria 16499
229 Ga0068871_100004687 3300006358 Bacteria 9556
230 Ga0075428_100004166 3300006844 Bacteria 15919
231 Ga0075431_100009982 3300006847 Bacteria 9538
232 Ga0075429_100047835 3300006880 Bacteria 3720
233 Ga0068865_100000110 3300006881 Bacteria 42375
234 Ga0068865_100012625 3300006881 Bacteria 5321
235 Ga0068865_100026788 3300006881 Bacteria 3803
236 Ga0068865_100034237 3300006881 Bacteria 3407
237 Ga0068865_100045912 3300006881 Unclassified 2996
238 Ga0097620_100000003 3300006931 Bacteria 479218
239 Ga0097620_100013814 3300006931 Bacteria 8097
240 Ga0097620_100043651 3300006931 Bacteria 4506
241 Ga0097620_100053979 3300006931 Bacteria 4041
242 Ga0097620_100167391 3300006931 Bacteria 2278
243 Ga0105240_10000754 3300009093 Bacteria 59023
244 Ga0105240_10000862 3300009093 Bacteria 54716
245 Ga0105240_10002072 3300009093 Bacteria 32853
246 Ga0105240_10002236 3300009093 Bacteria 31491
247 Ga0105240_10003850 3300009093 Bacteria 23179
248 Ga0105240_10045116 3300009093 Bacteria 5594
249 Ga0105240_10059908 3300009093 Bacteria 4748
250 Ga0105240_10080849 3300009093 Bacteria 3995
251 Ga0105240_10092636 3300009093 Bacteria 3689
252 Ga0105240_10099383 3300009093 Bacteria 3541
253 Ga0105240_10110486 3300009093 Bacteria 3327
254 Ga0105240_10142492 3300009093 Bacteria 2864
255 Ga0105240_10354069 3300009093 Bacteria 1665
256 Ga0111539_10006292 3300009094 Bacteria 15323
257 Ga0111539_10012048 3300009094 Bacteria 10846
258 Ga0111539_10076468 3300009094 Bacteria 3941
259 Ga0111539_10091864 3300009094 Bacteria 3567
260 Ga0105247_10000703 3300009101 Bacteria 26102
261 Ga0105247_10001011 3300009101 Bacteria 21244
262 Ga0105247_10012786 3300009101 Bacteria 5037
263 Ga0114129_10000267 3300009147 Bacteria 59005
264 Ga0114129_10126572 3300009147 Bacteria 3512
265 Ga0114129_10180236 3300009147 Bacteria 2875
266 Ga0105243_10000002 3300009148 Bacteria 856281
267 Ga0105241_10000612 3300009174 Bacteria 26845
268 Ga0105241_10003226 3300009174 Bacteria 12137
269 Ga0105241_10004704 3300009174 Bacteria 10072
270 Ga0105241_10009184 3300009174 Bacteria 7277
271 Ga0105241_10026016 3300009174 Bacteria 4353
272 Ga0105242_10010916 3300009176 Bacteria 6978
273 Ga0105242_10014682 3300009176 Bacteria 6065
274 Ga0105242_10028204 3300009176 Bacteria 4467
275 Ga0105242_10059536 3300009176 Bacteria 3134
276 Ga0105242_10100421 3300009176 Bacteria 2451
277 Ga0105242_10105879 3300009176 Bacteria 2389
278 Ga0105248_10012794 3300009177 Bacteria 9256
279 Ga0105237_10001136 3300009545 Bacteria 35738
280 Ga0105237_10001588 3300009545 Bacteria 29579
281 Ga0105237_10002905 3300009545 Bacteria 20779
282 Ga0105237_10006929 3300009545 Bacteria 12495
283 Ga0105237_10008019 3300009545 Bacteria 11494
284 Ga0105237_10017466 3300009545 Bacteria 7437
285 Ga0105237_10028155 3300009545 Bacteria 5726
286 Ga0105237_10035471 3300009545 Bacteria 5047
287 Ga0105237_10035606 3300009545 Bacteria 5037
288 Ga0105238_10001868 3300009551 Bacteria 21117
289 Ga0105238_10016135 3300009551 Bacteria 7556
290 Ga0105238_10022101 3300009551 Bacteria 6486
291 Ga0105238_10175495 3300009551 Bacteria 2120
292 Ga0105238_10318915 3300009551 Bacteria 1540
293 Ga0105249_10001259 3300009553 Bacteria 22224
294 Ga0105249_10001349 3300009553 Bacteria 21433
295 Ga0105249_10003433 3300009553 Bacteria 13723
296 Ga0105249_10004604 3300009553 Bacteria 11918
297 Ga0105249_10019531 3300009553 Bacteria 6047
298 Ga0105249_10029300 3300009553 Bacteria 4971
299 Ga0105249_10030283 3300009553 Bacteria 4892
300 Ga0105249_10030611 3300009553 Bacteria 4866
301 Ga0105249_10043048 3300009553 Bacteria 4107
302 Ga0105249_10093405 3300009553 Bacteria 2818
303 Ga0105249_10154209 3300009553 Bacteria 2214
304 Ga0105249_10217876 3300009553 Bacteria 1877
305 Ga0105239_10000009 3300010375 Bacteria 361182
306 Ga0105239_10000529 3300010375 Bacteria 55233
307 Ga0105239_10001186 3300010375 Bacteria 35727
308 Ga0105239_10003433 3300010375 Bacteria 19410
309 Ga0105239_10009700 3300010375 Bacteria 10826
310 Ga0105239_10011094 3300010375 Bacteria 10055
311 Ga0105239_10015004 3300010375 Bacteria 8588
312 Ga0105239_10041585 3300010375 Bacteria 5037
313 Ga0105239_10047274 3300010375 Bacteria 4716
314 Ga0105239_10064979 3300010375 Bacteria 4006
315 Ga0105239_10143333 3300010375 Bacteria 2663
316 Ga0105239_10190018 3300010375 Bacteria 2299
317 Ga0105239_10217707 3300010375 Bacteria 2141
318 Ga0105246_10011910 3300011119 Bacteria 5411
319 Ga0105246_10091152 3300011119 Bacteria 2196
320 Ga0105246_10195640 3300011119 Bacteria 1568
321 Ga0157373_10003187 3300013100 Bacteria 12405
322 Ga0157373_10023103 3300013100 Bacteria 4509
323 Ga0157373_10065628 3300013100 Bacteria 2568
324 Ga0157371_10000139 3300013102 Bacteria 104697
325 Ga0157371_10000178 3300013102 Bacteria 92872
326 Ga0157371_10018612 3300013102 Bacteria 5131
327 Ga0157371_10027291 3300013102 Bacteria 4143
328 Ga0157371_10029728 3300013102 Bacteria 3947
329 Ga0157371_10038237 3300013102 Bacteria 3434
330 Ga0157371_10038710 3300013102 Unclassified 3411
331 Ga0157371_10153392 3300013102 Bacteria 1643
332 Ga0157370_10000463 3300013104 Bacteria 50658
333 Ga0157370_10002924 3300013104 Bacteria 20338
334 Ga0157370_10070048 3300013104 Bacteria 3311
335 Ga0157369_10000002 3300013105 Bacteria 524510
336 Ga0157369_10012756 3300013105 Bacteria 9530
337 Ga0157369_10040076 3300013105 Bacteria 5116
338 Ga0157369_10040305 3300013105 Bacteria 5099
339 Ga0157369_10056903 3300013105 Bacteria 4220
340 Ga0157369_10067826 3300013105 Bacteria 3834
341 Ga0157369_10078615 3300013105 Bacteria 3534
342 Ga0157374_10000715 3300013296 Bacteria 29082
343 Ga0157374_10000740 3300013296 Bacteria 28504
344 Ga0157374_10001929 3300013296 Bacteria 17404
345 Ga0157374_10005551 3300013296 Bacteria 10617
346 Ga0157374_10008313 3300013296 Bacteria 8855
347 Ga0157374_10009761 3300013296 Bacteria 8242
348 Ga0157374_10158014 3300013296 Bacteria 2207
349 Ga0157374_10175980 3300013296 Bacteria 2089
350 Ga0157378_10015389 3300013297 Bacteria 6700
351 Ga0157378_10020701 3300013297 Bacteria 5785
352 Ga0157378_10026283 3300013297 Bacteria 5131
353 Ga0157378_10037755 3300013297 Bacteria 4281
354 Ga0157378_10038211 3300013297 Bacteria 4253
355 Ga0157378_10050978 3300013297 Bacteria 3683
356 Ga0157378_10051934 3300013297 Bacteria 3648
357 Ga0163162_10000555 3300013306 Bacteria 34535
358 Ga0163162_10000773 3300013306 Bacteria 29793
359 Ga0163162_10002336 3300013306 Bacteria 17807
360 Ga0163162_10003753 3300013306 Bacteria 14553
361 Ga0163162_10004022 3300013306 Bacteria 14112
362 Ga0163162_10004535 3300013306 Bacteria 13380
363 Ga0163162_10010522 3300013306 Bacteria 8997
364 Ga0163162_10011151 3300013306 Bacteria 8755
365 Ga0163162_10020542 3300013306 Bacteria 6488
366 Ga0163162_10020649 3300013306 Bacteria 6473
367 Ga0163162_10028214 3300013306 Bacteria 5552
368 Ga0163162_10110737 3300013306 Bacteria 2843
369 Ga0163162_10230942 3300013306 Bacteria 1981
370 Ga0163162_10241516 3300013306 Bacteria 1937
371 Ga0157372_10001004 3300013307 Bacteria 30814
372 Ga0157372_10039240 3300013307 Bacteria 5226
373 Ga0157372_10064471 3300013307 Bacteria 4111
374 Ga0157372_10071929 3300013307 Bacteria 3897
375 Ga0157372_10072185 3300013307 Bacteria 3889
376 Ga0157372_10127834 3300013307 Bacteria 2922
377 Ga0157372_10218925 3300013307 Bacteria 2207
378 Ga0157372_10230196 3300013307 Bacteria 2148
379 Ga0157372_10243763 3300013307 Bacteria 2085
380 Ga0157372_10260480 3300013307 Bacteria 2014
381 Ga0157372_10283480 3300013307 Bacteria 1926
382 Ga0157375_10000735 3300013308 Bacteria 28891
383 Ga0157375_10003367 3300013308 Bacteria 13855
384 Ga0157375_10006134 3300013308 Bacteria 10472
385 Ga0157375_10008017 3300013308 Bacteria 9247
386 Ga0157375_10013609 3300013308 Bacteria 7249
387 Ga0157375_10089287 3300013308 Bacteria 3138
388 Ga0157375_10161340 3300013308 Bacteria 2383
389 Ga0157375_10254302 3300013308 Bacteria 1918
390 Ga0163163_10000218 3300014325 Bacteria 59659
391 Ga0163163_10002339 3300014325 Bacteria 16032
392 Ga0163163_10011675 3300014325 Bacteria 7978
393 Ga0163163_10034510 3300014325 Bacteria 4900
394 Ga0163163_10084163 3300014325 Bacteria 3186
395 Ga0163163_10105980 3300014325 Bacteria 2837
396 Ga0163163_10117213 3300014325 Bacteria 2694
397 Ga0157380_10024047 3300014326 Bacteria 4605
398 Ga0157380_10074105 3300014326 Bacteria 2762
399 Ga0182008_10026498 3300014497 Bacteria 2940
400 Ga0157377_10004540 3300014745 Bacteria 6410
401 Ga0157379_10004638 3300014968 Bacteria 11792
402 Ga0157379_10030074 3300014968 Bacteria 4831
403 Ga0157379_10041030 3300014968 Unclassified 4131
404 Ga0157379_10047298 3300014968 Bacteria 3838
405 Ga0157379_10098063 3300014968 Bacteria 2631
406 Ga0157376_10003188 3300014969 Bacteria 11278
407 Ga0157376_10003813 3300014969 Bacteria 10426
408 Ga0157376_10006082 3300014969 Bacteria 8488
409 Ga0157376_10007905 3300014969 Bacteria 7630
410 Ga0157376_10017500 3300014969 Bacteria 5469
411 Ga0157376_10062423 3300014969 Unclassified 3135
412 Ga0157376_10064348 3300014969 Bacteria 3093
413 Ga0182006_1000110 3300015261 Bacteria 88392
414 Ga0182006_1000868 3300015261 Bacteria 20280
415 Ga0182007_10000001 3300015262 Bacteria 1127301
416 Ga0182007_10004091 3300015262 Bacteria 6712
417 Ga0182007_10008190 3300015262 Unclassified 4309
418 Ga0163161_10000617 3300017792 Bacteria 28499
419 Ga0163161_10001132 3300017792 Bacteria 20100
420 Ga0163161_10003565 3300017792 Bacteria 10900
421 Ga0163161_10015902 3300017792 Bacteria 5250
422 Ga0163161_10020081 3300017792 Bacteria 4687
423 Ga0163161_10024980 3300017792 Bacteria 4224
424 Ga0163161_10055284 3300017792 Unclassified 2881
425 Ga0206352_11067900 3300020078 Bacteria 1477
426 Ga0213872_10005681 3300021361 Bacteria 6357
427 Ga0207427_101087 3300025231 Bacteria 11112
428 Ga0209437_100048 3300025233 Bacteria 405107
429 Ga0209258_100295 3300025242 Bacteria 81736
430 Ga0207425_1000004 3300025245 Bacteria 1092421
431 Ga0209646_1000037 3300025246 Bacteria 355116
432 Ga0209026_1001866 3300025250 Bacteria 8591
433 Ga0209148_1000242 3300025254 Bacteria 87005
434 Ga0209129_1000005 3300025258 Bacteria 777812
435 Ga0209233_1000029 3300025261 Bacteria 641642
436 Ga0209673_1000130 3300025273 Bacteria 163870
437 Ga0209130_1002095 3300025284 Bacteria 10683
438 Ga0209676_1000686 3300025292 Bacteria 47720
439 Ga0209676_1001398 3300025292 Bacteria 23345
440 Ga0209025_1000009 3300025294 Bacteria 1092561
441 Ga0209564_1009916 3300025295 Bacteria 4460
442 Ga0209564_1020641 3300025295 Bacteria 2405
443 Ga0209758_1000010 3300025297 Bacteria 1092782
444 Ga0209758_1018343 3300025297 Bacteria 3433
445 Ga0209050_1025214 3300025298 Bacteria 2029
446 Ga0207426_1000002 3300025302 Bacteria 1249660
447 Ga0207426_1000134 3300025302 Bacteria 202226
448 Ga0207426_1001093 3300025302 Bacteria 25077
449 Ga0209051_1024026 3300025303 Bacteria 2520
450 Ga0209257_1000006 3300025304 Bacteria 1570111
451 Ga0209257_1000008 3300025304 Bacteria 1294570
452 Ga0209257_1002828 3300025304 Bacteria 16296
453 Ga0207642_10080968 3300025899 Bacteria 1577
454 Ga0207710_10002539 3300025900 Bacteria 8443
455 Ga0207710_10024054 3300025900 Bacteria 2621
456 Ga0207680_10000014 3300025903 Bacteria 179035
457 Ga0207680_10062876 3300025903 Bacteria 2270
458 Ga0207680_10080420 3300025903 Bacteria 2046
459 Ga0207680_10118071 3300025903 Bacteria 1731
460 Ga0207647_10000563 3300025904 Bacteria 29190
461 Ga0207647_10042531 3300025904 Bacteria 2850
462 Ga0207647_10046454 3300025904 Bacteria 2706
463 Ga0207647_10055996 3300025904 Bacteria 2421
464 Ga0207645_10000298 3300025907 Bacteria 41845
465 Ga0207645_10000979 3300025907 Bacteria 23614
466 Ga0207645_10002593 3300025907 Bacteria 14098
467 Ga0207645_10009555 3300025907 Bacteria 6702
468 Ga0207645_10034290 3300025907 Bacteria 3261
469 Ga0207645_10069066 3300025907 Bacteria 2260
470 Ga0207643_10020394 3300025908 Bacteria 3637
471 Ga0207705_10004298 3300025909 Bacteria 10784
472 Ga0207705_10015164 3300025909 Bacteria 5538
473 Ga0207705_10019756 3300025909 Bacteria 4817
474 Ga0207705_10062536 3300025909 Bacteria 2689
475 Ga0207705_10152710 3300025909 Bacteria 1731
476 Ga0207654_10004369 3300025911 Bacteria 7125
477 Ga0207707_10002312 3300025912 Bacteria 17183
478 Ga0207707_10073724 3300025912 Bacteria 2977
479 Ga0207707_10124166 3300025912 Bacteria 2257
480 Ga0207695_10000071 3300025913 Bacteria 315568
481 Ga0207695_10000084 3300025913 Bacteria 282392
482 Ga0207695_10000515 3300025913 Bacteria 82285
483 Ga0207695_10001197 3300025913 Bacteria 44626
484 Ga0207695_10007302 3300025913 Bacteria 14106
485 Ga0207695_10018108 3300025913 Bacteria 8152
486 Ga0207695_10043598 3300025913 Bacteria 4781
487 Ga0207695_10055384 3300025913 Bacteria 4133
488 Ga0207695_10069983 3300025913 Bacteria 3589
489 Ga0207695_10213272 3300025913 Bacteria 1840
490 Ga0207671_10002536 3300025914 Bacteria 19453
491 Ga0207671_10002992 3300025914 Bacteria 17322
492 Ga0207671_10003129 3300025914 Bacteria 16809
493 Ga0207671_10007505 3300025914 Bacteria 9458
494 Ga0207671_10008601 3300025914 Bacteria 8629
495 Ga0207671_10038512 3300025914 Bacteria 3543
496 Ga0207671_10056877 3300025914 Bacteria 2898
497 Ga0207662_10049139 3300025918 Bacteria 2502
498 Ga0207657_10037840 3300025919 Bacteria 4304
499 Ga0207657_10108147 3300025919 Bacteria 2299
500 Ga0207657_10124693 3300025919 Bacteria 2116
501 Ga0207649_10039990 3300025920 Bacteria 2846
502 Ga0207652_10000301 3300025921 Bacteria 50969
503 Ga0207652_10001364 3300025921 Bacteria 21700
504 Ga0207652_10028149 3300025921 Bacteria 4687
505 Ga0207652_10132924 3300025921 Bacteria 2220
506 Ga0207681_10034029 3300025923 Bacteria 3347
507 Ga0207681_10169649 3300025923 Unclassified 1653
508 Ga0207694_10028164 3300025924 Bacteria 4282
509 Ga0207694_10195329 3300025924 Bacteria 1645
510 Ga0207650_10061745 3300025925 Unclassified 2798
511 Ga0207650_10106669 3300025925 Bacteria 2164
512 Ga0207650_10170484 3300025925 Bacteria 1729
513 Ga0207659_10021177 3300025926 Bacteria 4311
514 Ga0207659_10033668 3300025926 Bacteria 3529
515 Ga0207659_10040100 3300025926 Bacteria 3272
516 Ga0207659_10154982 3300025926 Unclassified 1792
517 Ga0207644_10017737 3300025931 Bacteria 4812
518 Ga0207690_10015276 3300025932 Bacteria 4649
519 Ga0207690_10126486 3300025932 Bacteria 1864
520 Ga0207706_10000246 3300025933 Bacteria 59254
521 Ga0207706_10011242 3300025933 Bacteria 8163
522 Ga0207706_10033205 3300025933 Bacteria 4594
523 Ga0207706_10033206 3300025933 Bacteria 4594
524 Ga0207706_10063906 3300025933 Bacteria 3240
525 Ga0207706_10073160 3300025933 Bacteria 3014
526 Ga0207706_10161498 3300025933 Unclassified 1969
527 Ga0207686_10001493 3300025934 Bacteria 13195
528 Ga0207686_10066224 3300025934 Bacteria 2306
529 Ga0207686_10136787 3300025934 Bacteria 1688
530 Ga0207709_10000003 3300025935 Bacteria 1050072
531 Ga0207670_10004542 3300025936 Bacteria 7493
532 Ga0207670_10062112 3300025936 Bacteria 2552
533 Ga0207704_10000011 3300025938 Bacteria 180140
534 Ga0207704_10006675 3300025938 Bacteria 5403
535 Ga0207704_10048200 3300025938 Bacteria 2553
536 Ga0207691_10001273 3300025940 Bacteria 25203
537 Ga0207691_10004645 3300025940 Bacteria 13298
538 Ga0207691_10012876 3300025940 Bacteria 8007
539 Ga0207691_10021514 3300025940 Bacteria 6090
540 Ga0207691_10026811 3300025940 Bacteria 5407
541 Ga0207691_10140235 3300025940 Bacteria 2131
542 Ga0207711_10085185 3300025941 Bacteria 2768
543 Ga0207689_10002295 3300025942 Bacteria 17907
544 Ga0207689_10005981 3300025942 Bacteria 10761
545 Ga0207689_10011619 3300025942 Bacteria 7546
546 Ga0207689_10025097 3300025942 Bacteria 4997
547 Ga0207689_10033598 3300025942 Bacteria 4261
548 Ga0207689_10037526 3300025942 Bacteria 4019
549 Ga0207661_10009033 3300025944 Bacteria 7140
550 Ga0207679_10012320 3300025945 Bacteria 5573
551 Ga0207679_10022977 3300025945 Bacteria 4256
552 Ga0207679_10079105 3300025945 Bacteria 2506
553 Ga0207667_10000117 3300025949 Bacteria 127391
554 Ga0207667_10000197 3300025949 Bacteria 87987
555 Ga0207667_10000209 3300025949 Bacteria 83277
556 Ga0207667_10003048 3300025949 Bacteria 20784
557 Ga0207667_10009393 3300025949 Bacteria 11523
558 Ga0207667_10009844 3300025949 Bacteria 11231
559 Ga0207667_10015074 3300025949 Bacteria 8790
560 Ga0207667_10148600 3300025949 Bacteria 2412
561 Ga0207651_10005874 3300025960 Bacteria 6348
562 Ga0207651_10015179 3300025960 Bacteria 4469
563 Ga0207651_10023804 3300025960 Bacteria 3776
564 Ga0207651_10025737 3300025960 Bacteria 3662
565 Ga0207651_10075319 3300025960 Bacteria 2408
566 Ga0207651_10091926 3300025960 Bacteria 2223
567 Ga0207651_10134748 3300025960 Bacteria 1898
568 Ga0207712_10000482 3300025961 Bacteria 33330
569 Ga0207712_10002038 3300025961 Bacteria 13255
570 Ga0207712_10010801 3300025961 Bacteria 5808
571 Ga0207712_10019928 3300025961 Bacteria 4386
572 Ga0207712_10047892 3300025961 Bacteria 2971
573 Ga0207712_10059931 3300025961 Bacteria 2696
574 Ga0207712_10068830 3300025961 Bacteria 2538
575 Ga0207712_10116532 3300025961 Bacteria 2013
576 Ga0207668_10000617 3300025972 Bacteria 22106
577 Ga0207668_10010482 3300025972 Bacteria 5601
578 Ga0207640_10035597 3300025981 Bacteria 3117
579 Ga0207658_10006444 3300025986 Bacteria 8013
580 Ga0207677_10010708 3300026023 Bacteria 5198
581 Ga0207677_10018744 3300026023 Bacteria 4160
582 Ga0207677_10025054 3300026023 Bacteria 3717
583 Ga0207677_10155314 3300026023 Bacteria 1771
584 Ga0207677_10155500 3300026023 Bacteria 1770
585 Ga0207677_10163501 3300026023 Bacteria 1732
586 Ga0207703_10001353 3300026035 Bacteria 22448
587 Ga0207703_10005312 3300026035 Bacteria 10378
588 Ga0207703_10143527 3300026035 Unclassified 2074
589 Ga0207703_10146961 3300026035 Bacteria 2051
590 Ga0207703_10243883 3300026035 Bacteria 1616
591 Ga0207639_10013965 3300026041 Bacteria 5635
592 Ga0207639_10022389 3300026041 Bacteria 4552
593 Ga0207639_10087962 3300026041 Bacteria 2478
594 Ga0207708_10027777 3300026075 Bacteria 4285
595 Ga0207708_10117390 3300026075 Bacteria 2071
596 Ga0207702_10000402 3300026078 Bacteria 49308
597 Ga0207702_10007706 3300026078 Bacteria 9145
598 Ga0207702_10058598 3300026078 Bacteria 3277
599 Ga0207702_10082943 3300026078 Bacteria 2788
600 Ga0207702_10209872 3300026078 Bacteria 1810
601 Ga0207641_10000015 3300026088 Bacteria 321332
602 Ga0207641_10000088 3300026088 Bacteria 131959
603 Ga0207641_10003713 3300026088 Bacteria 13451
604 Ga0207641_10005384 3300026088 Bacteria 10932
605 Ga0207641_10060038 3300026088 Bacteria 3240
606 Ga0207641_10288087 3300026088 Bacteria 1547
607 Ga0207648_10004907 3300026089 Bacteria 13620
608 Ga0207648_10013902 3300026089 Bacteria 7465
609 Ga0207648_10015205 3300026089 Bacteria 7082
610 Ga0207648_10028250 3300026089 Bacteria 4974
611 Ga0207648_10035635 3300026089 Bacteria 4384
612 Ga0207648_10104941 3300026089 Bacteria 2479
613 Ga0207676_10015212 3300026095 Bacteria 5549
614 Ga0207676_10016815 3300026095 Bacteria 5296
615 Ga0207676_10259282 3300026095 Bacteria 1569
616 Ga0207674_10001258 3300026116 Bacteria 33135
617 Ga0207674_10010597 3300026116 Bacteria 10429
618 Ga0207674_10025124 3300026116 Bacteria 6357
619 Ga0207674_10028727 3300026116 Bacteria 5866
620 Ga0207674_10082272 3300026116 Bacteria 3221
621 Ga0207674_10130099 3300026116 Bacteria 2481
622 Ga0207674_10136072 3300026116 Bacteria 2419
623 Ga0207674_10264265 3300026116 Bacteria 1668
624 Ga0207675_100000496 3300026118 Bacteria 38204
625 Ga0207675_100029111 3300026118 Bacteria 5147
626 Ga0207675_100036217 3300026118 Bacteria 4603
627 Ga0207675_100050055 3300026118 Bacteria 3899
628 Ga0207675_100097964 3300026118 Bacteria 2762
629 Ga0207683_10004452 3300026121 Bacteria 12100
630 Ga0207683_10031923 3300026121 Bacteria 4573
631 Ga0207683_10032833 3300026121 Bacteria 4509
632 Ga0207683_10066895 3300026121 Bacteria 3169
633 Ga0207698_10000781 3300026142 Bacteria 18499
634 Ga0207698_10003383 3300026142 Bacteria 9602
635 Ga0207698_10023497 3300026142 Bacteria 4308
636 Ga0207698_10043756 3300026142 Bacteria 3358
637 Ga0207698_10067557 3300026142 Bacteria 2819
638 Ga0268266_10000038 3300028379 Bacteria 325729
639 Ga0268266_10002407 3300028379 Bacteria 20167
640 Ga0268266_10006486 3300028379 Bacteria 10709
641 Ga0268266_10123418 3300028379 Bacteria 2307
642 Ga0268265_10024985 3300028380 Bacteria 4234
643 Ga0268265_10038092 3300028380 Bacteria 3534
644 Ga0268264_10000167 3300028381 Bacteria 146190
645 Ga0268264_10001730 3300028381 Bacteria 20054
646 Ga0268264_10003170 3300028381 Bacteria 14246
647 Ga0268264_10010792 3300028381 Bacteria 7547
648 Ga0268264_10016685 3300028381 Bacteria 6013
649 Ga0268264_10146204 3300028381 Bacteria 2114
650 Ga0265337_1004886 3300028556 Bacteria 5460
651 Ga0265337_1021708 3300028556 Bacteria 1998
652 Ga0307517_10002284 3300028786 Bacteria 30925
653 Ga0307517_10039015 3300028786 Bacteria 5233
654 Ga0307515_10000001 3300028794 Bacteria 4259510
655 Ga0307515_10000118 3300028794 Bacteria 190444
656 Ga0265338_10029424 3300028800 Bacteria 5446
657 Ga0307511_10004978 3300030521 Bacteria 13548
658 Ga0316177_1089841 3300030731 Bacteria 3523
659 Ga0316176_1068370 3300030732 Bacteria 20672
660 Ga0316183_1006105 3300030742 Bacteria 90612
661 Ga0316181_1099963 3300030744 Bacteria 35143
662 Ga0265327_10000048 3300031251 Bacteria 269173
663 Ga0265327_10000087 3300031251 Bacteria 198174
664 Ga0265327_10006000 3300031251 Bacteria 9881
665 Ga0265327_10027369 3300031251 Bacteria 3284
666 Ga0265327_10040674 3300031251 Bacteria 2512
667 Ga0265316_10052175 3300031344 Bacteria 3209
668 Ga0307513_10043230 3300031456 Bacteria 4952
669 Ga0307509_10011639 3300031507 Bacteria 10631
670 Ga0307509_10034066 3300031507 Bacteria 5599
671 Ga0307508_10004344 3300031616 Bacteria 13864
672 Ga0265314_10000692 3300031711 Bacteria 40918
673 Ga0307516_10000656 3300031730 Bacteria 46771
674 Ga0307405_10000019 3300031731 Bacteria 167960
675 Ga0307405_10032487 3300031731 Bacteria 3086
676 Ga0307407_10000019 3300031903 Bacteria 129701
677 Ga0307407_10010507 3300031903 Bacteria 4371
678 Ga0307416_100000043 3300032002 Bacteria 130035
679 Ga0307416_100000341 3300032002 Bacteria 24168
680 Ga0307414_10003747 3300032004 Bacteria 8163
681 Ga0307414_10020378 3300032004 Bacteria 4132
682 Ga0307414_10021936 3300032004 Bacteria 4019
683 Ga0307414_10047697 3300032004 Bacteria 2950
684 Ga0307414_10071634 3300032004 Bacteria 2501
685 Ga0307415_100048082 3300032126 Bacteria 2876
686 Ga0307510_10000366 3300033180 Bacteria 42784
687 Ga0307510_10000584 3300033180 Bacteria 36797
688 Ga0373941_0026539 3300035115 Bacteria 1683
689 Ga0373955_0017629 3300035172 Bacteria 3538
690 Ga0373937_0075722 3300036401 Bacteria 3107
691 Ga0316584_0135970 3300036712 Bacteria 1835
692 Ga0395899_0000199 3300037312 Bacteria 87960
693 Ga0395899_0029905 3300037312 Bacteria 4099
694 Ga0395899_0035871 3300037312 Bacteria 3721
695 Ga0395900_0000157 3300037418 Bacteria 112131
696 Ga0395900_0001198 3300037418 Bacteria 32072
697 Ga0395900_0018750 3300037418 Bacteria 7056
698 Ga0395900_0072094 3300037418 Bacteria 3551
699 Ga0395900_0282851 3300037418 Bacteria 1650
700 Ga0395898_0002190 3300037466 Bacteria 23869
701 Ga0395898_0154401 3300037466 Bacteria 2196
702 Ga0395905_0000195 3300037471 Bacteria 95130
703 Ga0395905_0000405 3300037471 Bacteria 60956
704 Ga0395905_0186841 3300037471 Bacteria 1945
705 Ga0395901_0000283 3300038443 Bacteria 62908
706 Ga0395901_0083896 3300038443 Bacteria 3331
707 Ga0395901_0335020 3300038443 Bacteria 1563
708 Ga0436365_0040113 3300039437 Bacteria 10715
709 Ga0436365_0486460 3300039437 Bacteria 2515
710 Ga0436361_1176719 3300039447 Bacteria 6431
711 Ga0439436_0013968 3300041404 Bacteria 2426
712 Ga0439439_0002323 3300041406 Bacteria 4021
713 Ga0451853_4091274 3300041512 Bacteria 5076
714 Ga0439449_0023565 3300042007 Bacteria 2301
715 Ga0439449_0043570 3300042007 Bacteria 1666
716 Ga0439457_000443 3300042014 Bacteria 11952
717 Ga0439462_0017135 3300042015 Bacteria 1876
718 Ga0451577_0012835 3300042876 Bacteria 7863
719 Ga0451577_0048296 3300042876 Bacteria 3802
720 Ga0451577_0090655 3300042876 Bacteria 2729
721 Ga0451577_0126817 3300042876 Bacteria 2287
722 Ga0451577_0286797 3300042876 Bacteria 1492
723 Ga0466969_0000580 3300044656 Bacteria 19895
724 Ga0466972_0000009 3300044658 Bacteria 256374
725 Ga0466972_0000112 3300044658 Bacteria 70349
726 Ga0466972_0022719 3300044658 Bacteria 3121
727 Ga0466972_0078419 3300044658 Bacteria 1573
728 Ga0453683_0000181 3300044673 Bacteria 87343
729 Ga0453683_0002130 3300044673 Bacteria 15772
730 Ga0453683_0104499 3300044673 Bacteria 1779
731 Ga0466966_0000144 3300044684 Bacteria 45151
732 Ga0466961_0009435 3300044693 Bacteria 6212
733 Ga0453684_0002765 3300044712 Bacteria 41523
734 Ga0453684_0027906 3300044712 Bacteria 8076
735 Ga0453684_0055338 3300044712 Bacteria 5159
736 Ga0453684_0080395 3300044712 Bacteria 4070
737 Ga0453684_0087982 3300044712 Bacteria 3848
738 Ga0453684_0121940 3300044712 Bacteria 3145
739 Ga0453684_0154856 3300044712 Bacteria 2719
740 Ga0466970_0000219 3300044765 Bacteria 28141
741 Ga0466957_0004511 3300044842 Bacteria 7771
742 Ga0466957_0007656 3300044842 Bacteria 6109
743 Ga0466959_0000097 3300045049 Bacteria 55620
744 Ga0466959_0006121 3300045049 Bacteria 8313
745 Ga0466959_0009178 3300045049 Bacteria 7024
746 Ga0451576_0000513 3300045051 Bacteria 85081
747 Ga0451576_0001538 3300045051 Bacteria 38821
748 Ga0451576_0013570 3300045051 Bacteria 9110
749 Ga0451576_0029508 3300045051 Bacteria 5868
750 Ga0451576_0129800 3300045051 Bacteria 2627
751 Ga0451576_0289011 3300045051 Bacteria 1714
752 Ga0451576_0329310 3300045051 Bacteria 1599
753 Ga0451576_0393376 3300045051 Bacteria 1453
754 Ga0495627_004188 3300046453 Bacteria 6113
755 Ga0495638_0065701 3300046460 Bacteria 2232
756 Ga0495606_0003054 3300046507 Bacteria 18247
757 Ga0495628_0045889 3300046516 Bacteria 3473
758 Ga0495630_0067282 3300046517 Bacteria 2693
759 Ga0495630_0111568 3300046517 Bacteria 2071
760 Ga0495631_0001845 3300046518 Bacteria 12502
761 Ga0495652_0042929 3300046529 Bacteria 3898
762 Ga0495586_0000034 3300046535 Bacteria 89391
763 Ga0495587_0062899 3300046536 Bacteria 2172
764 Ga0495633_0000159 3300046558 Bacteria 88400
765 Ga0495668_0000354 3300046616 Bacteria 60932
766 Ga0495668_0079637 3300046616 Bacteria 1798
767 Ga0495634_0094944 3300046642 Bacteria 1932
768 Ga0495611_0000575 3300046648 Bacteria 21197
769 Ga0495625_0078642 3300046660 Bacteria 2302
770 Ga0495613_0039614 3300046689 Unclassified 3494
771 Ga0495674_0000976 3300047319 Bacteria 27458
772 Ga0495672_0020427 3300047320 Bacteria 4342
773 Ga0495676_0009484 3300047321 Bacteria 8867
774 Ga0495676_0098157 3300047321 Bacteria 2174
775 Ga0495687_001403 3300047443 Bacteria 22225
776 Ga0495686_0000004 3300047472 Bacteria 869019
777 Ga0496100_0064183 3300048903 Bacteria 2429
778 Ga0496107_0026080 3300048910 Bacteria 4142
779 Ga0496108_0266551 3300048911 Bacteria 1491
780 Ga0496109_0033911 3300048912 Bacteria 4595
781 Ga0496110_0102393 3300048913 Bacteria 2568
782 Ga0496114_0045581 3300048917 Bacteria 3644
783 Ga0496116_0009315 3300048919 Bacteria 8388
784 Ga0496117_0000938 3300048920 Bacteria 44676
785 Ga0496117_0004744 3300048920 Bacteria 14761
786 Ga0496121_0000011 3300048924 Bacteria 792193
787 Ga0496122_0003582 3300048925 Bacteria 20269
788 Ga0496122_0007600 3300048925 Bacteria 11978
789 Ga0496122_0012699 3300048925 Bacteria 8343
790 Ga0496123_0005589 3300048926 Bacteria 12567
791 Ga0496123_0030795 3300048926 Bacteria 3920
792 Ga0496125_0138933 3300048928 Bacteria 1693
793 Ga0496126_0058412 3300048929 Bacteria 3477
794 Ga0501298_001859 3300049521 Bacteria 3130
795 Ga0501300_004413 3300049523 Bacteria 2086
796 Ga0501032_0005075 3300049569 Bacteria 9834
797 Ga0501032_0052328 3300049569 Bacteria 2751
798 Ga0501033_0144786 3300049570 Bacteria 1717
799 Ga0501034_0002417 3300049571 Bacteria 22602
800 Ga0501034_0009516 3300049571 Bacteria 10172
801 Ga0501034_0068233 3300049571 Bacteria 3567
802 Ga0501034_0328059 3300049571 Bacteria 1462
803 Ga0501036_0022474 3300049572 Bacteria 5305
804 Ga0501037_0069343 3300049573 Bacteria 2567
805 Ga0501038_0003726 3300049574 Bacteria 14200
806 Ga0501043_0003522 3300049579 Bacteria 12873
807 Ga0501043_0013663 3300049579 Bacteria 6355
808 Ga0501046_0124022 3300049580 Bacteria 1964
809 Ga0501046_0127689 3300049580 Bacteria 1930
810 Ga0501046_0159741 3300049580 Bacteria 1696
811 Ga0501047_0014683 3300049581 Bacteria 7453
812 Ga0501047_0041126 3300049581 Bacteria 4467
813 Ga0501047_0046945 3300049581 Bacteria 4173
814 Ga0501067_0073249 3300049583 Bacteria 1898
815 Ga0501069_0056045 3300049585 Bacteria 2195
816 Ga0501073_0001563 3300049589 Bacteria 16973
817 Ga0501074_0016152 3300049590 Bacteria 5425
818 Ga0501201_001583 3300049651 Bacteria 2116
819 Ga0501202_001201 3300049652 Bacteria 4081
820 Ga0501207_003077 3300049654 Bacteria 2194
821 Ga0501217_001912 3300049661 Bacteria 4001
822 Ga0501223_004327 3300049663 Bacteria 3050
823 Ga0501233_001105 3300049668 Bacteria 4570
824 Ga0501235_000216 3300049669 Bacteria 10374
825 Ga0501249_008146 3300049679 Bacteria 2174
826 Ga0501252_000189 3300049682 Bacteria 4021
827 Ga0501259_002702 3300049688 Bacteria 2853
828 Ga0501221_001496 3300049704 Bacteria 3871
829 Ga0501225_0010736 3300049705 Bacteria 2590
830 Ga0501080_0009971 3300049742 Bacteria 8682
831 Ga0501280_001371 3300049776 Bacteria 4569
832 Ga0501035_0006202 3300049822 Bacteria 11248
833 Ga0501035_0103845 3300049822 Bacteria 2493
834 Ga0501035_0191524 3300049822 Bacteria 1758
835 Ga0501044_0014709 3300049823 Bacteria 8437
836 Ga0501044_0087201 3300049823 Bacteria 3153
837 nmdc:mga0k408_46307_c1 3300050493 Bacteria 2511
838 nmdc:mga05p37_13392_c1 3300050507 Bacteria 9830
839 nmdc:mga05p37_159810_c1 3300050507 Bacteria 2752
840 nmdc:mga05p37_186185_c1 3300050507 Bacteria 2524
841 nmdc:mga09592_7424_c1 3300050508 Bacteria 8911
842 nmdc:mga06r32_170525_c1 3300050510 Unclassified 2160
843 nmdc:mga08y16_17603_c1 3300050511 Bacteria 7525
844 nmdc:mga08y16_256981_c1 3300050511 Bacteria 1804
845 nmdc:mga08y16_59548_c1 3300050511 Bacteria 3988
846 nmdc:mga08y16_64265_c1 3300050511 Bacteria 3832
847 nmdc:mga0a205_153495_c1 3300050515 Bacteria 2201
848 Ga0495619_0111335 3300053085 Bacteria 1871
849 Ga0500646_0001432 3300053090 Bacteria 6330
850 Ga0500646_0009704 3300053090 Bacteria 2464
851 Ga0500583_0000078 3300053092 Bacteria 58451
852 Ga0500651_0032856 3300053093 Bacteria 3272
853 Ga0500607_010270 3300053121 Bacteria 5590
854 Ga0500608_000548 3300053122 Bacteria 14063
855 Ga0500642_0027173 3300053130 Bacteria 2346
856 Ga0500652_010637 3300053131 Bacteria 3161
857 Ga0500559_0022676 3300053136 Bacteria 2663
858 Ga0500568_0003925 3300053139 Bacteria 8097
859 Ga0500568_0004057 3300053139 Bacteria 7928
860 Ga0500577_0001866 3300053142 Bacteria 5400
861 Ga0500616_0011098 3300053153 Bacteria 5350
862 Ga0500622_0000072 3300053156 Bacteria 112062
863 Ga0500622_0002480 3300053156 Bacteria 13283
864 Ga0500636_0005328 3300053177 Bacteria 7329
865 Ga0501084_0119351 3300054114 Bacteria 2216
866 Ga0501082_0037498 3300060353 Bacteria 4178

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028381 Ga0268264_10016685 Ga0268264_100166852 368
2 3300042876 Ga0451577_0090655 Ga0451577_0090655_1424_2590 378
3 3300042876 Ga0451577_0126817 Ga0451577_0126817_1004_2170 378
4 3300046535 Ga0495586_0000034 Ga0495586_0000034_75708_76868 378
5 3300046642 Ga0495634_0094944 Ga0495634_0094944_570_1730 378
6 3300046689 Ga0495613_0039614 Ga0495613_0039614_333_1493 378
7 3300047319 Ga0495674_0000976 Ga0495674_0000976_19679_20839 378
8 3300047321 Ga0495676_0009484 Ga0495676_0009484_6476_7636 378
9 3300025936 Ga0207670_10004542 Ga0207670_100045428 386
10 3300025972 Ga0207668_10010482 Ga0207668_100104824 386
11 3300005339 Ga0070660_100026775 Ga0070660_1000267753 387
12 3300025919 Ga0207657_10037840 Ga0207657_100378403 387
13 3300005459 Ga0068867_100092285 Ga0068867_1000922852 388
14 3300005471 Ga0070698_100003501 Ga0070698_1000035015 389
15 3300042007 Ga0439449_0043570 Ga0439449_0043570_294_1601 392
16 3300005577 Ga0068857_100036112 Ga0068857_1000361122 393
17 3300005618 Ga0068864_100041076 Ga0068864_1000410764 393
18 3300026116 Ga0207674_10028727 Ga0207674_100287276 393
19 3300044658 Ga0466972_0078419 Ga0466972_0078419_30_1226 394
20 3300045051 Ga0451576_0289011 Ga0451576_0289011_500_1684 394
21 3300006880 Ga0075429_100047835 Ga0075429_1000478351 396
22 3300009093 Ga0105240_10110486 Ga0105240_101104862 396
23 3300010375 Ga0105239_10000529 Ga0105239_100005293 396
24 3300053085 Ga0495619_0111335 Ga0495619_0111335_596_1816 396
25 3300053131 Ga0500652_010637 Ga0500652_010637_589_1818 396
26 3300005471 Ga0070698_100008096 Ga0070698_1000080967 397
27 3300025914 Ga0207671_10056877 Ga0207671_100568772 397
28 3300025949 Ga0207667_10015074 Ga0207667_100150742 397
29 3300053142 Ga0500577_0001866 Ga0500577_0001866_1321_2526 397
30 3300003322 rootL2_10056273 rootL2_100562733 398
31 3300005334 Ga0068869_100085972 Ga0068869_1000859723 398
32 3300005347 Ga0070668_100010496 Ga0070668_1000104968 398
33 3300005354 Ga0070675_100244487 Ga0070675_1002444871 398
34 3300005367 Ga0070667_100102353 Ga0070667_1001023532 398
35 3300005456 Ga0070678_100022468 Ga0070678_1000224683 398
36 3300005457 Ga0070662_100100205 Ga0070662_1001002054 398
37 3300005459 Ga0068867_100041721 Ga0068867_1000417213 398
38 3300005539 Ga0068853_100181125 Ga0068853_1001811252 398
39 3300005543 Ga0070672_100213858 Ga0070672_1002138582 398
40 3300005548 Ga0070665_100057751 Ga0070665_1000577512 398
41 3300005563 Ga0068855_100035606 Ga0068855_1000356066 398
42 3300005617 Ga0068859_100053979 Ga0068859_1000539792 398
43 3300006237 Ga0097621_100027606 Ga0097621_1000276067 398
44 3300006881 Ga0068865_100012625 Ga0068865_1000126256 398
45 3300006931 Ga0097620_100053979 Ga0097620_1000539792 398
46 3300009093 Ga0105240_10059908 Ga0105240_100599086 398
47 3300009147 Ga0114129_10126572 Ga0114129_101265723 398
48 3300009176 Ga0105242_10100421 Ga0105242_101004211 398
49 3300009551 Ga0105238_10022101 Ga0105238_100221014 398
50 3300009553 Ga0105249_10217876 Ga0105249_102178762 398
51 3300011119 Ga0105246_10091152 Ga0105246_100911521 398
52 3300013105 Ga0157369_10040305 Ga0157369_100403054 398
53 3300013307 Ga0157372_10001004 Ga0157372_1000100417 398
54 3300020078 Ga0206352_11067900 Ga0206352_110679002 398
55 3300025899 Ga0207642_10080968 Ga0207642_100809682 398
56 3300025903 Ga0207680_10080420 Ga0207680_100804202 398
57 3300025907 Ga0207645_10000979 Ga0207645_100009793 398
58 3300025913 Ga0207695_10018108 Ga0207695_100181086 398
59 3300025933 Ga0207706_10033205 Ga0207706_100332051 398
60 3300025940 Ga0207691_10012876 Ga0207691_100128765 398
61 3300025942 Ga0207689_10011619 Ga0207689_100116191 398
62 3300025960 Ga0207651_10075319 Ga0207651_100753193 398
63 3300026089 Ga0207648_10028250 Ga0207648_100282502 398
64 3300026121 Ga0207683_10004452 Ga0207683_100044524 398
65 3300028379 Ga0268266_10123418 Ga0268266_101234181 398
66 3300031251 Ga0265327_10040674 Ga0265327_100406742 398
67 3300049523 Ga0501300_004413 Ga0501300_004413_72_1295 398
68 3300050507 nmdc:mga05p37_186185_c1 nmdc:mga05p37_186185_c1_367_1713 398
69 iso_pu_bacteria 3003233435 3003235520 398
70 3300042876 Ga0451577_0012835 Ga0451577_0012835_5381_6649 401
71 3300044712 Ga0453684_0080395 Ga0453684_0080395_1225_2493 401
72 3300013105 Ga0157369_10012756 Ga0157369_100127562 402
73 3300014325 Ga0163163_10034510 Ga0163163_100345103 402
74 3300046616 Ga0495668_0000354 Ga0495668_0000354_13140_14471 402
75 3300013105 Ga0157369_10078615 Ga0157369_100786152 403
76 3300050515 nmdc:mga0a205_153495_c1 nmdc:mga0a205_153495_c1_838_2184 403
77 3300026089 Ga0207648_10104941 Ga0207648_101049412 405
78 3300028556 Ga0265337_1004886 Ga0265337_10048864 406
79 3300042876 Ga0451577_0286797 Ga0451577_0286797_105_1391 406
80 3300009093 Ga0105240_10003850 Ga0105240_100038509 407
81 3300009093 Ga0105240_10080849 Ga0105240_100808494 407
82 3300009545 Ga0105237_10017466 Ga0105237_100174662 407
83 3300010375 Ga0105239_10001186 Ga0105239_1000118615 407
84 3300014325 Ga0163163_10105980 Ga0163163_101059803 407
85 3300025303 Ga0209051_1024026 Ga0209051_10240261 407
86 3300025913 Ga0207695_10007302 Ga0207695_100073028 407
87 3300025913 Ga0207695_10213272 Ga0207695_102132722 407
88 3300046529 Ga0495652_0042929 Ga0495652_0042929_1560_2891 407
89 3300047320 Ga0495672_0020427 Ga0495672_0020427_1886_3214 407
90 3300005334 Ga0068869_100082498 Ga0068869_1000824981 408
91 3300005340 Ga0070689_100082955 Ga0070689_1000829551 408
92 3300005347 Ga0070668_100069889 Ga0070668_1000698894 408
93 3300005353 Ga0070669_100019917 Ga0070669_1000199174 408
94 3300005354 Ga0070675_100079654 Ga0070675_1000796541 408
95 3300005364 Ga0070673_100038431 Ga0070673_1000384313 408
96 3300005365 Ga0070688_100006850 Ga0070688_1000068503 408
97 3300005457 Ga0070662_100051531 Ga0070662_1000515313 408
98 3300005546 Ga0070696_100004704 Ga0070696_1000047045 408
99 3300005718 Ga0068866_10022853 Ga0068866_100228532 408
100 3300005719 Ga0068861_100000424 Ga0068861_10000042422 408
101 3300005719 Ga0068861_100111406 Ga0068861_1001114062 408
102 3300005844 Ga0068862_100137800 Ga0068862_1001378002 408
103 3300006881 Ga0068865_100026788 Ga0068865_1000267882 408
104 3300009094 Ga0111539_10012048 Ga0111539_100120489 408
105 3300009176 Ga0105242_10059536 Ga0105242_100595364 408
106 3300009553 Ga0105249_10029300 Ga0105249_100293002 408
107 3300009553 Ga0105249_10154209 Ga0105249_101542092 408
108 3300013308 Ga0157375_10013609 Ga0157375_100136092 408
109 3300014326 Ga0157380_10024047 Ga0157380_100240475 408
110 3300025904 Ga0207647_10042531 Ga0207647_100425313 408
111 3300025907 Ga0207645_10034290 Ga0207645_100342902 408
112 3300025923 Ga0207681_10034029 Ga0207681_100340292 408
113 3300025933 Ga0207706_10063906 Ga0207706_100639062 408
114 3300025938 Ga0207704_10048200 Ga0207704_100482002 408
115 3300025961 Ga0207712_10059931 Ga0207712_100599312 408
116 3300026089 Ga0207648_10015205 Ga0207648_100152054 408
117 3300026089 Ga0207648_10035635 Ga0207648_100356353 408
118 3300026116 Ga0207674_10025124 Ga0207674_100251242 408
119 3300026118 Ga0207675_100000496 Ga0207675_10000049631 408
120 3300026118 Ga0207675_100050055 Ga0207675_1000500554 408
121 3300028380 Ga0268265_10038092 Ga0268265_100380922 408
122 3300046460 Ga0495638_0065701 Ga0495638_0065701_708_1985 408
123 3300050511 nmdc:mga08y16_17603_c1 nmdc:mga08y16_17603_c1_1294_2601 408
124 3300006847 Ga0075431_100009982 Ga0075431_10000998210 409
125 3300036712 Ga0316584_0135970 Ga0316584_0135970_140_1483 409
126 3300037312 Ga0395899_0029905 Ga0395899_0029905_137_1468 409
127 3300037471 Ga0395905_0000405 Ga0395905_0000405_50484_51815 409
128 3300038443 Ga0395901_0335020 Ga0395901_0335020_140_1471 409
129 3300044693 Ga0466961_0009435 Ga0466961_0009435_1276_2607 409
130 3300044712 Ga0453684_0055338 Ga0453684_0055338_1349_2689 409
131 3300045049 Ga0466959_0009178 Ga0466959_0009178_47_1378 409
132 3300002772 JGI25164J39214_1000820 JGI25164J39214_10008202 410
133 3300003214 JGI25165J46597_1000655 JGI25165J46597_10006555 410
134 3300003320 rootH2_10103944 rootH2_101039443 410
135 3300003323 rootH1_10004576 rootH1_1000457635 410
136 3300003323 rootH1_10026336 rootH1_100263363 410
137 3300005290 Ga0065712_10004771 Ga0065712_100047713 410
138 3300005327 Ga0070658_10056185 Ga0070658_100561852 410
139 3300005328 Ga0070676_10000375 Ga0070676_100003756 410
140 3300005331 Ga0070670_100077448 Ga0070670_1000774482 410
141 3300005335 Ga0070666_10025874 Ga0070666_100258743 410
142 3300005347 Ga0070668_100003881 Ga0070668_1000038816 410
143 3300005354 Ga0070675_100064163 Ga0070675_1000641633 410
144 3300005364 Ga0070673_100015236 Ga0070673_1000152362 410
145 3300005367 Ga0070667_100000482 Ga0070667_10000048215 410
146 3300005457 Ga0070662_100010886 Ga0070662_1000108865 410
147 3300005459 Ga0068867_100030855 Ga0068867_1000308552 410
148 3300005539 Ga0068853_100019481 Ga0068853_1000194812 410
149 3300005543 Ga0070672_100000361 Ga0070672_1000003618 410
150 3300005548 Ga0070665_100204264 Ga0070665_1002042642 410
151 3300005618 Ga0068864_100000785 Ga0068864_10000078518 410
152 3300005719 Ga0068861_100048849 Ga0068861_1000488493 410
153 3300005834 Ga0068851_10004750 Ga0068851_100047502 410
154 3300005841 Ga0068863_100004269 Ga0068863_1000042692 410
155 3300005842 Ga0068858_100003593 Ga0068858_1000035936 410
156 3300006881 Ga0068865_100034237 Ga0068865_1000342373 410
157 3300009093 Ga0105240_10142492 Ga0105240_101424922 410
158 3300009176 Ga0105242_10105879 Ga0105242_101058791 410
159 3300009553 Ga0105249_10004604 Ga0105249_1000460411 410
160 3300013296 Ga0157374_10005551 Ga0157374_100055513 410
161 3300013297 Ga0157378_10037755 Ga0157378_100377552 410
162 3300013306 Ga0163162_10004022 Ga0163162_100040221 410
163 3300013308 Ga0157375_10003367 Ga0157375_1000336715 410
164 3300014325 Ga0163163_10002339 Ga0163163_100023393 410
165 3300014326 Ga0157380_10074105 Ga0157380_100741053 410
166 3300014968 Ga0157379_10004638 Ga0157379_100046388 410
167 3300014969 Ga0157376_10017500 Ga0157376_100175002 410
168 3300025231 Ga0207427_101087 Ga0207427_1010877 410
169 3300025233 Ga0209437_100048 Ga0209437_100048156 410
170 3300025261 Ga0209233_1000029 Ga0209233_1000029221 410
171 3300025903 Ga0207680_10062876 Ga0207680_100628762 410
172 3300025907 Ga0207645_10002593 Ga0207645_100025932 410
173 3300025909 Ga0207705_10015164 Ga0207705_100151645 410
174 3300025925 Ga0207650_10170484 Ga0207650_101704842 410
175 3300025933 Ga0207706_10011242 Ga0207706_100112425 410
176 3300025938 Ga0207704_10006675 Ga0207704_100066753 410
177 3300025940 Ga0207691_10001273 Ga0207691_1000127319 410
178 3300025960 Ga0207651_10005874 Ga0207651_100058744 410
179 3300025961 Ga0207712_10116532 Ga0207712_101165321 410
180 3300025972 Ga0207668_10000617 Ga0207668_1000061719 410
181 3300026035 Ga0207703_10005312 Ga0207703_100053126 410
182 3300026041 Ga0207639_10022389 Ga0207639_100223893 410
183 3300026088 Ga0207641_10005384 Ga0207641_100053846 410
184 3300026089 Ga0207648_10013902 Ga0207648_100139026 410
185 3300026095 Ga0207676_10015212 Ga0207676_100152125 410
186 3300026118 Ga0207675_100036217 Ga0207675_1000362172 410
187 3300028379 Ga0268266_10006486 Ga0268266_100064861 410
188 3300031344 Ga0265316_10052175 Ga0265316_100521752 410
189 3300031711 Ga0265314_10000692 Ga0265314_100006923 410
190 3300046453 Ga0495627_004188 Ga0495627_004188_591_1889 410
191 3300046558 Ga0495633_0000159 Ga0495633_0000159_83446_84744 410
192 3300048912 Ga0496109_0033911 Ga0496109_0033911_3238_4563 410
193 3300050508 nmdc:mga09592_7424_c1 nmdc:mga09592_7424_c1_2142_3473 410
194 3300053093 Ga0500651_0032856 Ga0500651_0032856_1465_2763 410
195 3300005327 Ga0070658_10002733 Ga0070658_1000273310 411
196 3300005518 Ga0070699_100049932 Ga0070699_1000499322 411
197 3300009101 Ga0105247_10012786 Ga0105247_100127862 411
198 3300010375 Ga0105239_10143333 Ga0105239_101433332 411
199 3300013307 Ga0157372_10260480 Ga0157372_102604802 411
200 3300025909 Ga0207705_10004298 Ga0207705_100042983 411
201 3300026075 Ga0207708_10117390 Ga0207708_101173902 411
202 3300026078 Ga0207702_10007706 Ga0207702_100077065 411
203 3300049579 Ga0501043_0013663 Ga0501043_0013663_663_1991 411
204 3300050510 nmdc:mga06r32_170525_c1 nmdc:mga06r32_170525_c1_516_1847 411
205 3300003322 rootL2_10212594 rootL2_102125942 412
206 3300005290 Ga0065712_10003244 Ga0065712_100032443 412
207 3300005293 Ga0065715_10006829 Ga0065715_100068292 412
208 3300005343 Ga0070687_100023265 Ga0070687_1000232653 412
209 3300005364 Ga0070673_100083696 Ga0070673_1000836962 412
210 3300005365 Ga0070688_100022637 Ga0070688_1000226373 412
211 3300005466 Ga0070685_10025212 Ga0070685_100252123 412
212 3300005543 Ga0070672_100058066 Ga0070672_1000580663 412
213 3300005840 Ga0068870_10034123 Ga0068870_100341232 412
214 3300005841 Ga0068863_100015248 Ga0068863_1000152486 412
215 3300005844 Ga0068862_100098698 Ga0068862_1000986982 412
216 3300013100 Ga0157373_10065628 Ga0157373_100656281 412
217 3300013102 Ga0157371_10018612 Ga0157371_100186123 412
218 3300013308 Ga0157375_10254302 Ga0157375_102543021 412
219 3300025295 Ga0209564_1009916 Ga0209564_10099163 412
220 3300025295 Ga0209564_1020641 Ga0209564_10206412 412
221 3300025297 Ga0209758_1018343 Ga0209758_10183433 412
222 3300025302 Ga0207426_1000002 Ga0207426_1000002808 412
223 3300025304 Ga0209257_1002828 Ga0209257_10028283 412
224 3300025908 Ga0207643_10020394 Ga0207643_100203942 412
225 3300025918 Ga0207662_10049139 Ga0207662_100491392 412
226 3300025926 Ga0207659_10033668 Ga0207659_100336682 412
227 3300025940 Ga0207691_10026811 Ga0207691_100268114 412
228 3300025960 Ga0207651_10091926 Ga0207651_100919261 412
229 3300026088 Ga0207641_10000088 Ga0207641_1000008852 412
230 3300048929 Ga0496126_0058412 Ga0496126_0058412_2198_3463 412
231 3300049569 Ga0501032_0052328 Ga0501032_0052328_655_1983 412
232 3300049571 Ga0501034_0009516 Ga0501034_0009516_7034_8362 412
233 3300049572 Ga0501036_0022474 Ga0501036_0022474_1175_2503 412
234 3300049574 Ga0501038_0003726 Ga0501038_0003726_10785_12113 412
235 3300049580 Ga0501046_0124022 Ga0501046_0124022_623_1951 412
236 3300049581 Ga0501047_0041126 Ga0501047_0041126_1291_2619 412
237 3300049822 Ga0501035_0006202 Ga0501035_0006202_3203_4531 412
238 3300049823 Ga0501044_0014709 Ga0501044_0014709_5114_6442 412
239 3300006844 Ga0075428_100004166 Ga0075428_10000416612 413
240 3300009094 Ga0111539_10076468 Ga0111539_100764684 413
241 3300009147 Ga0114129_10180236 Ga0114129_101802362 413
242 3300009545 Ga0105237_10035606 Ga0105237_100356062 413
243 3300010375 Ga0105239_10047274 Ga0105239_100472742 413
244 3300026075 Ga0207708_10027777 Ga0207708_100277772 413
245 3300032004 Ga0307414_10071634 Ga0307414_100716342 413
246 3300037418 Ga0395900_0018750 Ga0395900_0018750_3283_4584 413
247 3300037418 Ga0395900_0282851 Ga0395900_0282851_337_1629 413
248 3300037466 Ga0395898_0154401 Ga0395898_0154401_152_1453 413
249 3300050507 nmdc:mga05p37_159810_c1 nmdc:mga05p37_159810_c1_988_2337 413
250 3300050511 nmdc:mga08y16_59548_c1 nmdc:mga08y16_59548_c1_2561_3910 413
251 3300053092 Ga0500583_0000078 Ga0500583_0000078_1819_3111 413
252 3300053136 Ga0500559_0022676 Ga0500559_0022676_1236_2567 413
253 3300003322 rootL2_10101507 rootL2_101015073 414
254 3300009553 Ga0105249_10001259 Ga0105249_1000125919 414
255 3300025903 Ga0207680_10118071 Ga0207680_101180711 414
256 3300025961 Ga0207712_10000482 Ga0207712_100004822 414
257 3300048910 Ga0496107_0026080 Ga0496107_0026080_2578_3894 414
258 3300053139 Ga0500568_0004057 Ga0500568_0004057_465_1856 414
259 3300005339 Ga0070660_100106424 Ga0070660_1001064242 415
260 3300005355 Ga0070671_100006460 Ga0070671_1000064606 415
261 3300005471 Ga0070698_100004308 Ga0070698_10000430815 415
262 3300005539 Ga0068853_100100047 Ga0068853_1001000473 415
263 3300005563 Ga0068855_100006289 Ga0068855_1000062894 415
264 3300005577 Ga0068857_100082949 Ga0068857_1000829492 415
265 3300013308 Ga0157375_10006134 Ga0157375_100061347 415
266 3300025909 Ga0207705_10152710 Ga0207705_101527102 415
267 3300025919 Ga0207657_10124693 Ga0207657_101246932 415
268 3300025924 Ga0207694_10028164 Ga0207694_100281643 415
269 3300025931 Ga0207644_10017737 Ga0207644_100177375 415
270 3300026116 Ga0207674_10136072 Ga0207674_101360722 415
271 3300044712 Ga0453684_0027906 Ga0453684_0027906_1035_2342 415
272 3300045051 Ga0451576_0129800 Ga0451576_0129800_30_1352 415
273 3300047443 Ga0495687_001403 Ga0495687_001403_16665_17996 415
274 3300049570 Ga0501033_0144786 Ga0501033_0144786_293_1702 415
275 3300049573 Ga0501037_0069343 Ga0501037_0069343_742_2073 415
276 3300049822 Ga0501035_0191524 Ga0501035_0191524_146_1555 415
277 3300050511 nmdc:mga08y16_256981_c1 nmdc:mga08y16_256981_c1_182_1522 415
278 3300005842 Ga0068858_100030266 Ga0068858_1000302666 416
279 3300006163 Ga0070715_10056215 Ga0070715_100562151 416
280 3300009176 Ga0105242_10010916 Ga0105242_100109166 416
281 3300013306 Ga0163162_10110737 Ga0163162_101107372 416
282 3300025934 Ga0207686_10001493 Ga0207686_1000149314 416
283 3300031616 Ga0307508_10004344 Ga0307508_100043444 416
284 3300044656 Ga0466969_0000580 Ga0466969_0000580_10496_11827 416
285 3300044684 Ga0466966_0000144 Ga0466966_0000144_3296_4627 416
286 3300044712 Ga0453684_0121940 Ga0453684_0121940_22_1344 416
287 3300045049 Ga0466959_0000097 Ga0466959_0000097_13577_14908 416
288 3300045051 Ga0451576_0001538 Ga0451576_0001538_17230_18552 416
289 3300045051 Ga0451576_0013570 Ga0451576_0013570_7006_8331 416
290 3300003322 rootL2_10180035 rootL2_101800352 417
291 3300005340 Ga0070689_100010923 Ga0070689_1000109232 417
292 3300005364 Ga0070673_100199907 Ga0070673_1001999071 417
293 3300005466 Ga0070685_10014893 Ga0070685_100148932 417
294 3300005617 Ga0068859_100167398 Ga0068859_1001673981 417
295 3300005841 Ga0068863_100053225 Ga0068863_1000532252 417
296 3300006931 Ga0097620_100167391 Ga0097620_1001673911 417
297 3300009553 Ga0105249_10043048 Ga0105249_100430484 417
298 3300013306 Ga0163162_10020649 Ga0163162_100206495 417
299 3300013308 Ga0157375_10161340 Ga0157375_101613402 417
300 3300025960 Ga0207651_10134748 Ga0207651_101347482 417
301 3300026035 Ga0207703_10143527 Ga0207703_101435272 417
302 3300026142 Ga0207698_10043756 Ga0207698_100437562 417
303 3300030521 Ga0307511_10004978 Ga0307511_100049786 417
304 3300031251 Ga0265327_10006000 Ga0265327_100060008 417
305 3300031730 Ga0307516_10000656 Ga0307516_1000065617 417
306 3300032004 Ga0307414_10047697 Ga0307414_100476972 417
307 3300046518 Ga0495631_0001845 Ga0495631_0001845_578_1909 417
308 3300048913 Ga0496110_0102393 Ga0496110_0102393_131_1465 417
309 iso_pu_bacteria 2883068021 2883072105 417
310 iso_pu_bacteria 2896085136 2896089266 417
311 3300005288 Ga0065714_10109159 Ga0065714_101091591 418
312 3300005563 Ga0068855_100000393 Ga0068855_10000039332 418
313 3300005614 Ga0068856_100027819 Ga0068856_1000278195 418
314 3300009094 Ga0111539_10091864 Ga0111539_100918642 418
315 3300013306 Ga0163162_10011151 Ga0163162_100111517 418
316 3300013308 Ga0157375_10008017 Ga0157375_100080179 418
317 3300017792 Ga0163161_10015902 Ga0163161_100159023 418
318 3300025949 Ga0207667_10000117 Ga0207667_10000117108 418
319 3300025961 Ga0207712_10068830 Ga0207712_100688302 418
320 3300044673 Ga0453683_0000181 Ga0453683_0000181_46718_48064 418
321 3300045051 Ga0451576_0000513 Ga0451576_0000513_46684_48030 418
322 3300045051 Ga0451576_0393376 Ga0451576_0393376_63_1394 418
323 iso_pu_bacteria 2896109856 2896111292 418
324 3300026088 Ga0207641_10288087 Ga0207641_102880871 419
325 3300028556 Ga0265337_1021708 Ga0265337_10217082 419
326 3300049571 Ga0501034_0068233 Ga0501034_0068233_1119_2402 419
327 3300050493 nmdc:mga0k408_46307_c1 nmdc:mga0k408_46307_c1_13_1323 419
328 3300053090 Ga0500646_0001432 Ga0500646_0001432_2436_3746 419
329 iso_pu_bacteria 2896344016 2896344947 419
330 3300010375 Ga0105239_10041585 Ga0105239_100415853 420
331 3300013306 Ga0163162_10000773 Ga0163162_100007733 420
332 3300005290 Ga0065712_10004111 Ga0065712_100041114 421
333 3300005329 Ga0070683_100015621 Ga0070683_1000156215 421
334 3300005329 Ga0070683_100161545 Ga0070683_1001615452 421
335 3300005331 Ga0070670_100014394 Ga0070670_1000143942 421
336 3300005331 Ga0070670_100042609 Ga0070670_1000426092 421
337 3300005338 Ga0068868_100050675 Ga0068868_1000506754 421
338 3300005339 Ga0070660_100033516 Ga0070660_1000335165 421
339 3300005366 Ga0070659_100130681 Ga0070659_1001306811 421
340 3300005457 Ga0070662_100073666 Ga0070662_1000736662 421
341 3300005539 Ga0068853_100085121 Ga0068853_1000851212 421
342 3300005549 Ga0070704_100027391 Ga0070704_1000273914 421
343 3300005563 Ga0068855_100102479 Ga0068855_1001024795 421
344 3300005564 Ga0070664_100025631 Ga0070664_1000256315 421
345 3300005577 Ga0068857_100032480 Ga0068857_1000324804 421
346 3300005578 Ga0068854_100046447 Ga0068854_1000464474 421
347 3300005614 Ga0068856_100018743 Ga0068856_1000187432 421
348 3300005616 Ga0068852_100004228 Ga0068852_1000042284 421
349 3300005618 Ga0068864_100022225 Ga0068864_1000222254 421
350 3300005842 Ga0068858_100088396 Ga0068858_1000883961 421
351 3300005985 Ga0081539_10000622 Ga0081539_1000062275 421
352 3300006237 Ga0097621_100009274 Ga0097621_1000092747 421
353 3300009553 Ga0105249_10093405 Ga0105249_100934053 421
354 3300013100 Ga0157373_10003187 Ga0157373_1000318714 421
355 3300013102 Ga0157371_10027291 Ga0157371_100272912 421
356 3300013105 Ga0157369_10056903 Ga0157369_100569035 421
357 3300013296 Ga0157374_10009761 Ga0157374_100097615 421
358 3300013297 Ga0157378_10020701 Ga0157378_100207014 421
359 3300013297 Ga0157378_10050978 Ga0157378_100509783 421
360 3300013306 Ga0163162_10230942 Ga0163162_102309421 421
361 3300013307 Ga0157372_10230196 Ga0157372_102301962 421
362 3300025912 Ga0207707_10124166 Ga0207707_101241661 421
363 3300025925 Ga0207650_10061745 Ga0207650_100617453 421
364 3300025926 Ga0207659_10021177 Ga0207659_100211772 421
365 3300025932 Ga0207690_10126486 Ga0207690_101264861 421
366 3300025933 Ga0207706_10033206 Ga0207706_100332062 421
367 3300025945 Ga0207679_10079105 Ga0207679_100791052 421
368 3300025960 Ga0207651_10015179 Ga0207651_100151792 421
369 3300025961 Ga0207712_10047892 Ga0207712_100478923 421
370 3300025981 Ga0207640_10035597 Ga0207640_100355973 421
371 3300026023 Ga0207677_10163501 Ga0207677_101635011 421
372 3300026035 Ga0207703_10243883 Ga0207703_102438832 421
373 3300026078 Ga0207702_10082943 Ga0207702_100829432 421
374 3300026095 Ga0207676_10016815 Ga0207676_100168153 421
375 3300026116 Ga0207674_10010597 Ga0207674_1001059710 421
376 3300031507 Ga0307509_10011639 Ga0307509_100116396 421
377 3300032004 Ga0307414_10003747 Ga0307414_100037475 421
378 3300037471 Ga0395905_0186841 Ga0395905_0186841_84_1391 421
379 3300039437 Ga0436365_0040113 Ga0436365_0040113_2215_3531 421
380 3300039437 Ga0436365_0486460 Ga0436365_0486460_1087_2394 421
381 3300044673 Ga0453683_0002130 Ga0453683_0002130_12010_13347 421
382 3300049571 Ga0501034_0328059 Ga0501034_0328059_34_1344 421
383 3300049823 Ga0501044_0087201 Ga0501044_0087201_1226_2536 421
384 3300002773 JGI25152J39213_1001701 JGI25152J39213_10017013 422
385 3300002774 JGI25150J39212_1000030 JGI25150J39212_10000303 422
386 3300003187 JGI25151J46595_10000129 JGI25151J46595_1000012991 422
387 3300003215 JGI25153J46596_10000096 JGI25153J46596_1000009691 422
388 3300005563 Ga0068855_100000463 Ga0068855_10000046311 422
389 3300005614 Ga0068856_100033380 Ga0068856_1000333801 422
390 3300005843 Ga0068860_100006909 Ga0068860_1000069097 422
391 3300009093 Ga0105240_10002072 Ga0105240_1000207218 422
392 3300013307 Ga0157372_10072185 Ga0157372_100721854 422
393 3300013307 Ga0157372_10283480 Ga0157372_102834801 422
394 3300014969 Ga0157376_10003188 Ga0157376_100031885 422
395 3300014969 Ga0157376_10006082 Ga0157376_100060828 422
396 3300014969 Ga0157376_10062423 Ga0157376_100624232 422
397 3300025245 Ga0207425_1000004 Ga0207425_1000004306 422
398 3300025258 Ga0209129_1000005 Ga0209129_1000005634 422
399 3300025294 Ga0209025_1000009 Ga0209025_1000009306 422
400 3300025297 Ga0209758_1000010 Ga0209758_1000010307 422
401 3300025912 Ga0207707_10002312 Ga0207707_100023122 422
402 3300025913 Ga0207695_10000071 Ga0207695_10000071130 422
403 3300025913 Ga0207695_10069983 Ga0207695_100699832 422
404 3300025921 Ga0207652_10132924 Ga0207652_101329242 422
405 3300025944 Ga0207661_10009033 Ga0207661_100090333 422
406 3300025949 Ga0207667_10000209 Ga0207667_1000020936 422
407 3300028381 Ga0268264_10010792 Ga0268264_100107922 422
408 3300046517 Ga0495630_0111568 Ga0495630_0111568_268_1593 422
409 3300049580 Ga0501046_0159741 Ga0501046_0159741_246_1571 422
410 3300049585 Ga0501069_0056045 Ga0501069_0056045_684_2009 422
411 3300054114 Ga0501084_0119351 Ga0501084_0119351_404_1729 422
412 3300060353 Ga0501082_0037498 Ga0501082_0037498_2123_3448 422
413 iso_pu_bacteria 2738541278 2738725251 422
414 iso_pu_bacteria 2738541283 2738757943 422
415 iso_pu_bacteria 2738541302 2738853285 422
416 iso_pu_bacteria 2842722452 2842723814 422
417 iso_pu_bacteria 2842909656 2842910319 422
418 iso_pu_bacteria 2857627736 2857628453 422
419 iso_pu_bacteria 2929239360 2929243919 422
420 iso_pu_bacteria 2929921140 2929925937 422
421 iso_pu_bacteria 2945997725 2946000652 422
422 iso_pu_bacteria 2954016120 2954017551 422
423 iso_pu_bacteria 8003151029 8003153105 422
424 3300005354 Ga0070675_100020974 Ga0070675_1000209742 423
425 3300009545 Ga0105237_10035471 Ga0105237_100354713 423
426 3300010375 Ga0105239_10011094 Ga0105239_1001109410 423
427 3300013102 Ga0157371_10038237 Ga0157371_100382372 423
428 3300013104 Ga0157370_10070048 Ga0157370_100700482 423
429 3300013296 Ga0157374_10158014 Ga0157374_101580142 423
430 3300025914 Ga0207671_10038512 Ga0207671_100385124 423
431 3300025926 Ga0207659_10040100 Ga0207659_100401004 423
432 3300050511 nmdc:mga08y16_64265_c1 nmdc:mga08y16_64265_c1_903_2231 423
433 iso_pu_bacteria 2522125168 2522548684 423
434 iso_pu_bacteria 2522125168 2522550596 423
435 iso_pu_bacteria 2721755487 2722729580 423
436 iso_pu_bacteria 2818991460 2819679808 423
437 iso_pu_bacteria 2884791551 2884794368 423
438 iso_pu_bacteria 2904780799 2904780882 423
439 iso_pu_bacteria 2904780799 2904781202 423
440 iso_pu_bacteria 2919177583 2919178805 423
441 iso_pu_bacteria 2919177583 2919180654 423
442 iso_pu_bacteria 2929177148 2929180079 423
443 iso_pu_bacteria 2945977869 2945982506 423
444 iso_pu_bacteria 2946013367 2946018109 423
445 iso_pu_bacteria 3003233435 3003235521 423
446 3300001990 JGI24737J22298_10012446 JGI24737J22298_100124462 424
447 3300002738 JGI25154J39366_1000179 JGI25154J39366_100017919 424
448 3300003320 rootH2_10002127 rootH2_1000212734 424
449 3300003323 rootH1_10190967 rootH1_101909675 424
450 3300003354 JGI25160J50197_1003411 JGI25160J50197_10034118 424
451 3300003762 Ga0055542_1006065 Ga0055542_10060653 424
452 3300003781 Ga0055536_1001818 Ga0055536_100181811 424
453 3300004803 Ga0058862_12292963 Ga0058862_122929632 424
454 3300005262 Ga0065165_1000259 Ga0065165_100025929 424
455 3300005262 Ga0065165_1037409 Ga0065165_10374091 424
456 3300005288 Ga0065714_10086418 Ga0065714_100864181 424
457 3300005290 Ga0065712_10070396 Ga0065712_100703964 424
458 3300005327 Ga0070658_10051061 Ga0070658_100510612 424
459 3300005329 Ga0070683_100227021 Ga0070683_1002270212 424
460 3300005331 Ga0070670_100110524 Ga0070670_1001105243 424
461 3300005334 Ga0068869_100008042 Ga0068869_1000080425 424
462 3300005335 Ga0070666_10000030 Ga0070666_1000003018 424
463 3300005335 Ga0070666_10031202 Ga0070666_100312022 424
464 3300005337 Ga0070682_100084379 Ga0070682_1000843791 424
465 3300005338 Ga0068868_100035467 Ga0068868_1000354672 424
466 3300005338 Ga0068868_100060702 Ga0068868_1000607023 424
467 3300005353 Ga0070669_100102087 Ga0070669_1001020872 424
468 3300005354 Ga0070675_100043197 Ga0070675_1000431973 424
469 3300005355 Ga0070671_100024337 Ga0070671_1000243372 424
470 3300005355 Ga0070671_100069058 Ga0070671_1000690582 424
471 3300005356 Ga0070674_100032111 Ga0070674_1000321111 424
472 3300005365 Ga0070688_100039392 Ga0070688_1000393923 424
473 3300005366 Ga0070659_100003883 Ga0070659_10000388312 424
474 3300005367 Ga0070667_100001675 Ga0070667_1000016758 424
475 3300005367 Ga0070667_100015893 Ga0070667_1000158932 424
476 3300005367 Ga0070667_100019741 Ga0070667_1000197415 424
477 3300005456 Ga0070678_100027160 Ga0070678_1000271604 424
478 3300005457 Ga0070662_100000311 Ga0070662_1000003117 424
479 3300005457 Ga0070662_100131647 Ga0070662_1001316471 424
480 3300005458 Ga0070681_10057046 Ga0070681_100570464 424
481 3300005530 Ga0070679_100001547 Ga0070679_1000015477 424
482 3300005530 Ga0070679_100003672 Ga0070679_1000036727 424
483 3300005539 Ga0068853_100000250 Ga0068853_10000025036 424
484 3300005539 Ga0068853_100096681 Ga0068853_1000966813 424
485 3300005539 Ga0068853_100113912 Ga0068853_1001139121 424
486 3300005548 Ga0070665_100000001 Ga0070665_100000001571 424
487 3300005563 Ga0068855_100001155 Ga0068855_1000011552 424
488 3300005563 Ga0068855_100002947 Ga0068855_10000294711 424
489 3300005563 Ga0068855_100074258 Ga0068855_1000742583 424
490 3300005563 Ga0068855_100265849 Ga0068855_1002658492 424
491 3300005563 Ga0068855_100336613 Ga0068855_1003366132 424
492 3300005578 Ga0068854_100149273 Ga0068854_1001492731 424
493 3300005614 Ga0068856_100000976 Ga0068856_10000097614 424
494 3300005614 Ga0068856_100010242 Ga0068856_1000102422 424
495 3300005614 Ga0068856_100109193 Ga0068856_1001091932 424
496 3300005614 Ga0068856_100136587 Ga0068856_1001365874 424
497 3300005614 Ga0068856_100256661 Ga0068856_1002566611 424
498 3300005616 Ga0068852_100000242 Ga0068852_10000024226 424
499 3300005616 Ga0068852_100000336 Ga0068852_1000003366 424
500 3300005616 Ga0068852_100000842 Ga0068852_1000008427 424
501 3300005617 Ga0068859_100000003 Ga0068859_100000003355 424
502 3300005617 Ga0068859_100013814 Ga0068859_1000138143 424
503 3300005617 Ga0068859_100043651 Ga0068859_1000436512 424
504 3300005618 Ga0068864_100006709 Ga0068864_1000067094 424
505 3300005719 Ga0068861_100027169 Ga0068861_1000271695 424
506 3300005834 Ga0068851_10002845 Ga0068851_100028455 424
507 3300005840 Ga0068870_10030849 Ga0068870_100308492 424
508 3300005841 Ga0068863_100006964 Ga0068863_1000069649 424
509 3300005841 Ga0068863_100027774 Ga0068863_1000277745 424
510 3300005841 Ga0068863_100033321 Ga0068863_1000333213 424
511 3300005843 Ga0068860_100000097 Ga0068860_100000097122 424
512 3300005843 Ga0068860_100002301 Ga0068860_10000230115 424
513 3300005843 Ga0068860_100002474 Ga0068860_10000247414 424
514 3300005843 Ga0068860_100010870 Ga0068860_10001087013 424
515 3300005843 Ga0068860_100168485 Ga0068860_1001684852 424
516 3300005844 Ga0068862_100017277 Ga0068862_1000172777 424
517 3300006237 Ga0097621_100000626 Ga0097621_10000062619 424
518 3300006237 Ga0097621_100000681 Ga0097621_10000068122 424
519 3300006237 Ga0097621_100005463 Ga0097621_1000054636 424
520 3300006358 Ga0068871_100000790 Ga0068871_1000007906 424
521 3300006358 Ga0068871_100001337 Ga0068871_1000013376 424
522 3300006358 Ga0068871_100004687 Ga0068871_1000046873 424
523 3300006881 Ga0068865_100000110 Ga0068865_10000011021 424
524 3300006931 Ga0097620_100000003 Ga0097620_100000003355 424
525 3300006931 Ga0097620_100013814 Ga0097620_1000138143 424
526 3300006931 Ga0097620_100043651 Ga0097620_1000436512 424
527 3300009093 Ga0105240_10000754 Ga0105240_1000075415 424
528 3300009093 Ga0105240_10000862 Ga0105240_1000086214 424
529 3300009093 Ga0105240_10002236 Ga0105240_1000223623 424
530 3300009093 Ga0105240_10045116 Ga0105240_100451167 424
531 3300009093 Ga0105240_10092636 Ga0105240_100926365 424
532 3300009093 Ga0105240_10099383 Ga0105240_100993833 424
533 3300009093 Ga0105240_10354069 Ga0105240_103540692 424
534 3300009101 Ga0105247_10001011 Ga0105247_1000101113 424
535 3300009147 Ga0114129_10000267 Ga0114129_1000026730 424
536 3300009174 Ga0105241_10000612 Ga0105241_100006125 424
537 3300009174 Ga0105241_10003226 Ga0105241_100032269 424
538 3300009174 Ga0105241_10004704 Ga0105241_100047042 424
539 3300009174 Ga0105241_10009184 Ga0105241_100091842 424
540 3300009174 Ga0105241_10026016 Ga0105241_100260162 424
541 3300009176 Ga0105242_10014682 Ga0105242_100146824 424
542 3300009177 Ga0105248_10012794 Ga0105248_100127945 424
543 3300009545 Ga0105237_10001136 Ga0105237_100011369 424
544 3300009545 Ga0105237_10001588 Ga0105237_1000158837 424
545 3300009545 Ga0105237_10002905 Ga0105237_1000290514 424
546 3300009545 Ga0105237_10006929 Ga0105237_100069296 424
547 3300009545 Ga0105237_10008019 Ga0105237_100080196 424
548 3300009545 Ga0105237_10028155 Ga0105237_100281554 424
549 3300009551 Ga0105238_10001868 Ga0105238_100018682 424
550 3300009551 Ga0105238_10016135 Ga0105238_100161353 424
551 3300009551 Ga0105238_10175495 Ga0105238_101754952 424
552 3300009551 Ga0105238_10318915 Ga0105238_103189151 424
553 3300009553 Ga0105249_10003433 Ga0105249_100034339 424
554 3300009553 Ga0105249_10019531 Ga0105249_100195315 424
555 3300010375 Ga0105239_10000009 Ga0105239_10000009241 424
556 3300010375 Ga0105239_10003433 Ga0105239_1000343314 424
557 3300010375 Ga0105239_10009700 Ga0105239_1000970011 424
558 3300010375 Ga0105239_10015004 Ga0105239_100150044 424
559 3300010375 Ga0105239_10064979 Ga0105239_100649794 424
560 3300010375 Ga0105239_10217707 Ga0105239_102177072 424
561 3300011119 Ga0105246_10011910 Ga0105246_100119103 424
562 3300011119 Ga0105246_10195640 Ga0105246_101956402 424
563 3300013100 Ga0157373_10023103 Ga0157373_100231032 424
564 3300013102 Ga0157371_10000139 Ga0157371_1000013957 424
565 3300013102 Ga0157371_10000178 Ga0157371_1000017885 424
566 3300013102 Ga0157371_10029728 Ga0157371_100297282 424
567 3300013102 Ga0157371_10038710 Ga0157371_100387104 424
568 3300013102 Ga0157371_10153392 Ga0157371_101533922 424
569 3300013104 Ga0157370_10000463 Ga0157370_100004639 424
570 3300013104 Ga0157370_10002924 Ga0157370_100029249 424
571 3300013105 Ga0157369_10000002 Ga0157369_10000002409 424
572 3300013105 Ga0157369_10040076 Ga0157369_100400762 424
573 3300013105 Ga0157369_10067826 Ga0157369_100678264 424
574 3300013296 Ga0157374_10000715 Ga0157374_100007157 424
575 3300013296 Ga0157374_10000740 Ga0157374_1000074013 424
576 3300013296 Ga0157374_10175980 Ga0157374_101759802 424
577 3300013297 Ga0157378_10015389 Ga0157378_100153893 424
578 3300013297 Ga0157378_10026283 Ga0157378_100262833 424
579 3300013297 Ga0157378_10038211 Ga0157378_100382111 424
580 3300013297 Ga0157378_10051934 Ga0157378_100519342 424
581 3300013306 Ga0163162_10000555 Ga0163162_1000055514 424
582 3300013306 Ga0163162_10002336 Ga0163162_100023368 424
583 3300013306 Ga0163162_10004535 Ga0163162_100045353 424
584 3300013306 Ga0163162_10010522 Ga0163162_100105226 424
585 3300013306 Ga0163162_10020542 Ga0163162_100205425 424
586 3300013306 Ga0163162_10028214 Ga0163162_100282143 424
587 3300013306 Ga0163162_10241516 Ga0163162_102415161 424
588 3300013307 Ga0157372_10039240 Ga0157372_100392401 424
589 3300013307 Ga0157372_10064471 Ga0157372_100644712 424
590 3300013307 Ga0157372_10071929 Ga0157372_100719293 424
591 3300013307 Ga0157372_10127834 Ga0157372_101278342 424
592 3300013307 Ga0157372_10218925 Ga0157372_102189252 424
593 3300013307 Ga0157372_10243763 Ga0157372_102437632 424
594 3300013308 Ga0157375_10000735 Ga0157375_1000073514 424
595 3300013308 Ga0157375_10089287 Ga0157375_100892873 424
596 3300014325 Ga0163163_10011675 Ga0163163_100116757 424
597 3300014325 Ga0163163_10117213 Ga0163163_101172132 424
598 3300014497 Ga0182008_10026498 Ga0182008_100264984 424
599 3300014745 Ga0157377_10004540 Ga0157377_100045402 424
600 3300014968 Ga0157379_10030074 Ga0157379_100300745 424
601 3300014968 Ga0157379_10047298 Ga0157379_100472982 424
602 3300014969 Ga0157376_10003813 Ga0157376_100038135 424
603 3300014969 Ga0157376_10007905 Ga0157376_100079056 424
604 3300015261 Ga0182006_1000110 Ga0182006_100011036 424
605 3300015261 Ga0182006_1000868 Ga0182006_100086814 424
606 3300015262 Ga0182007_10000001 Ga0182007_10000001373 424
607 3300015262 Ga0182007_10004091 Ga0182007_100040913 424
608 3300015262 Ga0182007_10008190 Ga0182007_100081902 424
609 3300017792 Ga0163161_10000617 Ga0163161_1000061718 424
610 3300017792 Ga0163161_10001132 Ga0163161_1000113215 424
611 3300017792 Ga0163161_10003565 Ga0163161_100035658 424
612 3300017792 Ga0163161_10020081 Ga0163161_100200815 424
613 3300021361 Ga0213872_10005681 Ga0213872_100056814 424
614 3300025242 Ga0209258_100295 Ga0209258_10029567 424
615 3300025246 Ga0209646_1000037 Ga0209646_1000037210 424
616 3300025250 Ga0209026_1001866 Ga0209026_10018666 424
617 3300025254 Ga0209148_1000242 Ga0209148_100024224 424
618 3300025292 Ga0209676_1000686 Ga0209676_100068611 424
619 3300025298 Ga0209050_1025214 Ga0209050_10252142 424
620 3300025302 Ga0207426_1001093 Ga0207426_10010933 424
621 3300025900 Ga0207710_10024054 Ga0207710_100240541 424
622 3300025903 Ga0207680_10000014 Ga0207680_1000001488 424
623 3300025904 Ga0207647_10000563 Ga0207647_1000056312 424
624 3300025904 Ga0207647_10046454 Ga0207647_100464542 424
625 3300025907 Ga0207645_10000298 Ga0207645_1000029820 424
626 3300025907 Ga0207645_10009555 Ga0207645_100095552 424
627 3300025909 Ga0207705_10019756 Ga0207705_100197562 424
628 3300025909 Ga0207705_10062536 Ga0207705_100625362 424
629 3300025911 Ga0207654_10004369 Ga0207654_100043697 424
630 3300025912 Ga0207707_10073724 Ga0207707_100737243 424
631 3300025913 Ga0207695_10000084 Ga0207695_1000008475 424
632 3300025913 Ga0207695_10000515 Ga0207695_1000051538 424
633 3300025913 Ga0207695_10001197 Ga0207695_100011972 424
634 3300025913 Ga0207695_10043598 Ga0207695_100435982 424
635 3300025913 Ga0207695_10055384 Ga0207695_100553843 424
636 3300025914 Ga0207671_10002536 Ga0207671_1000253618 424
637 3300025914 Ga0207671_10002992 Ga0207671_1000299212 424
638 3300025914 Ga0207671_10003129 Ga0207671_1000312911 424
639 3300025914 Ga0207671_10007505 Ga0207671_100075055 424
640 3300025914 Ga0207671_10008601 Ga0207671_100086015 424
641 3300025919 Ga0207657_10108147 Ga0207657_101081471 424
642 3300025921 Ga0207652_10000301 Ga0207652_1000030153 424
643 3300025921 Ga0207652_10001364 Ga0207652_100013646 424
644 3300025921 Ga0207652_10028149 Ga0207652_100281495 424
645 3300025923 Ga0207681_10169649 Ga0207681_101696491 424
646 3300025924 Ga0207694_10195329 Ga0207694_101953292 424
647 3300025925 Ga0207650_10106669 Ga0207650_101066692 424
648 3300025926 Ga0207659_10154982 Ga0207659_101549821 424
649 3300025932 Ga0207690_10015276 Ga0207690_100152764 424
650 3300025933 Ga0207706_10000246 Ga0207706_1000024618 424
651 3300025933 Ga0207706_10161498 Ga0207706_101614982 424
652 3300025934 Ga0207686_10066224 Ga0207686_100662242 424
653 3300025936 Ga0207670_10062112 Ga0207670_100621124 424
654 3300025938 Ga0207704_10000011 Ga0207704_10000011127 424
655 3300025940 Ga0207691_10021514 Ga0207691_100215142 424
656 3300025940 Ga0207691_10140235 Ga0207691_101402353 424
657 3300025941 Ga0207711_10085185 Ga0207711_100851853 424
658 3300025942 Ga0207689_10002295 Ga0207689_100022952 424
659 3300025949 Ga0207667_10000197 Ga0207667_100001973 424
660 3300025949 Ga0207667_10003048 Ga0207667_1000304810 424
661 3300025949 Ga0207667_10009393 Ga0207667_100093937 424
662 3300025949 Ga0207667_10009844 Ga0207667_100098445 424
663 3300025949 Ga0207667_10148600 Ga0207667_101486002 424
664 3300025960 Ga0207651_10025737 Ga0207651_100257373 424
665 3300025961 Ga0207712_10002038 Ga0207712_1000203816 424
666 3300025961 Ga0207712_10010801 Ga0207712_100108016 424
667 3300025986 Ga0207658_10006444 Ga0207658_100064442 424
668 3300026023 Ga0207677_10010708 Ga0207677_100107084 424
669 3300026023 Ga0207677_10018744 Ga0207677_100187443 424
670 3300026023 Ga0207677_10025054 Ga0207677_100250542 424
671 3300026023 Ga0207677_10155500 Ga0207677_101555001 424
672 3300026035 Ga0207703_10001353 Ga0207703_100013535 424
673 3300026041 Ga0207639_10013965 Ga0207639_100139651 424
674 3300026041 Ga0207639_10087962 Ga0207639_100879622 424
675 3300026078 Ga0207702_10000402 Ga0207702_1000040240 424
676 3300026078 Ga0207702_10058598 Ga0207702_100585983 424
677 3300026078 Ga0207702_10209872 Ga0207702_102098722 424
678 3300026088 Ga0207641_10000015 Ga0207641_10000015179 424
679 3300026088 Ga0207641_10003713 Ga0207641_100037134 424
680 3300026088 Ga0207641_10060038 Ga0207641_100600382 424
681 3300026089 Ga0207648_10004907 Ga0207648_100049076 424
682 3300026095 Ga0207676_10259282 Ga0207676_102592821 424
683 3300026116 Ga0207674_10130099 Ga0207674_101300992 424
684 3300026118 Ga0207675_100029111 Ga0207675_1000291115 424
685 3300026121 Ga0207683_10031923 Ga0207683_100319233 424
686 3300026121 Ga0207683_10032833 Ga0207683_100328332 424
687 3300026142 Ga0207698_10000781 Ga0207698_100007818 424
688 3300026142 Ga0207698_10003383 Ga0207698_100033836 424
689 3300026142 Ga0207698_10023497 Ga0207698_100234974 424
690 3300026142 Ga0207698_10067557 Ga0207698_100675573 424
691 3300028379 Ga0268266_10000038 Ga0268266_1000003869 424
692 3300028379 Ga0268266_10002407 Ga0268266_1000240712 424
693 3300028380 Ga0268265_10024985 Ga0268265_100249854 424
694 3300028381 Ga0268264_10000167 Ga0268264_1000016783 424
695 3300028381 Ga0268264_10001730 Ga0268264_100017307 424
696 3300028381 Ga0268264_10003170 Ga0268264_100031708 424
697 3300028381 Ga0268264_10146204 Ga0268264_101462042 424
698 3300028786 Ga0307517_10002284 Ga0307517_100022849 424
699 3300028786 Ga0307517_10039015 Ga0307517_100390155 424
700 3300028794 Ga0307515_10000001 Ga0307515_100000011519 424
701 3300028794 Ga0307515_10000118 Ga0307515_1000011817 424
702 3300028800 Ga0265338_10029424 Ga0265338_100294243 424
703 3300031251 Ga0265327_10000048 Ga0265327_10000048113 424
704 3300031251 Ga0265327_10000087 Ga0265327_1000008749 424
705 3300031251 Ga0265327_10027369 Ga0265327_100273693 424
706 3300031456 Ga0307513_10043230 Ga0307513_100432304 424
707 3300031507 Ga0307509_10034066 Ga0307509_100340666 424
708 3300031731 Ga0307405_10000019 Ga0307405_1000001919 424
709 3300031903 Ga0307407_10000019 Ga0307407_1000001974 424
710 3300032002 Ga0307416_100000043 Ga0307416_10000004316 424
711 3300032004 Ga0307414_10020378 Ga0307414_100203782 424
712 3300032004 Ga0307414_10021936 Ga0307414_100219364 424
713 3300033180 Ga0307510_10000366 Ga0307510_100003662 424
714 3300033180 Ga0307510_10000584 Ga0307510_1000058427 424
715 3300035115 Ga0373941_0026539 Ga0373941_0026539_313_1644 424
716 3300037312 Ga0395899_0000199 Ga0395899_0000199_18663_19994 424
717 3300037312 Ga0395899_0035871 Ga0395899_0035871_2201_3532 424
718 3300037418 Ga0395900_0000157 Ga0395900_0000157_90377_91708 424
719 3300037418 Ga0395900_0001198 Ga0395900_0001198_21570_22973 424
720 3300037418 Ga0395900_0072094 Ga0395900_0072094_1450_2781 424
721 3300037466 Ga0395898_0002190 Ga0395898_0002190_21698_23101 424
722 3300037471 Ga0395905_0000195 Ga0395905_0000195_20406_21737 424
723 3300038443 Ga0395901_0000283 Ga0395901_0000283_41157_42488 424
724 3300038443 Ga0395901_0083896 Ga0395901_0083896_610_2013 424
725 3300039447 Ga0436361_1176719 Ga0436361_1176719_3234_4565 424
726 3300041404 Ga0439436_0013968 Ga0439436_0013968_118_1449 424
727 3300041406 Ga0439439_0002323 Ga0439439_0002323_38_1369 424
728 3300041512 Ga0451853_4091274 Ga0451853_4091274_1294_2625 424
729 3300042007 Ga0439449_0023565 Ga0439449_0023565_680_2011 424
730 3300042014 Ga0439457_000443 Ga0439457_000443_7798_9129 424
731 3300042015 Ga0439462_0017135 Ga0439462_0017135_217_1548 424
732 3300044658 Ga0466972_0000009 Ga0466972_0000009_38295_39626 424
733 3300044658 Ga0466972_0000112 Ga0466972_0000112_65908_67239 424
734 3300044658 Ga0466972_0022719 Ga0466972_0022719_77_1408 424
735 3300044765 Ga0466970_0000219 Ga0466970_0000219_2945_4276 424
736 3300044842 Ga0466957_0004511 Ga0466957_0004511_849_2180 424
737 3300044842 Ga0466957_0007656 Ga0466957_0007656_1670_3001 424
738 3300046507 Ga0495606_0003054 Ga0495606_0003054_13895_15226 424
739 3300046616 Ga0495668_0079637 Ga0495668_0079637_201_1532 424
740 3300046648 Ga0495611_0000575 Ga0495611_0000575_5647_6978 424
741 3300047472 Ga0495686_0000004 Ga0495686_0000004_273434_274765 424
742 3300048903 Ga0496100_0064183 Ga0496100_0064183_503_1837 424
743 3300048911 Ga0496108_0266551 Ga0496108_0266551_52_1383 424
744 3300048917 Ga0496114_0045581 Ga0496114_0045581_941_2275 424
745 3300048925 Ga0496122_0007600 Ga0496122_0007600_5199_6530 424
746 3300048926 Ga0496123_0005589 Ga0496123_0005589_8812_10143 424
747 3300048928 Ga0496125_0138933 Ga0496125_0138933_18_1349 424
748 3300049521 Ga0501298_001859 Ga0501298_001859_991_2322 424
749 3300049581 Ga0501047_0046945 Ga0501047_0046945_459_1790 424
750 3300049651 Ga0501201_001583 Ga0501201_001583_492_1823 424
751 3300049652 Ga0501202_001201 Ga0501202_001201_2516_3847 424
752 3300049654 Ga0501207_003077 Ga0501207_003077_705_2036 424
753 3300049661 Ga0501217_001912 Ga0501217_001912_1468_2799 424
754 3300049663 Ga0501223_004327 Ga0501223_004327_235_1566 424
755 3300049668 Ga0501233_001105 Ga0501233_001105_2575_3906 424
756 3300049669 Ga0501235_000216 Ga0501235_000216_1977_3308 424
757 3300049679 Ga0501249_008146 Ga0501249_008146_315_1646 424
758 3300049682 Ga0501252_000189 Ga0501252_000189_2056_3387 424
759 3300049688 Ga0501259_002702 Ga0501259_002702_512_1843 424
760 3300049704 Ga0501221_001496 Ga0501221_001496_1485_2816 424
761 3300049705 Ga0501225_0010736 Ga0501225_0010736_130_1461 424
762 3300049776 Ga0501280_001371 Ga0501280_001371_3109_4425 424
763 3300050507 nmdc:mga05p37_13392_c1 nmdc:mga05p37_13392_c1_8146_9477 424
764 3300053090 Ga0500646_0009704 Ga0500646_0009704_1042_2382 424
765 3300053122 Ga0500608_000548 Ga0500608_000548_3956_5287 424
766 3300053130 Ga0500642_0027173 Ga0500642_0027173_206_1537 424
767 3300053139 Ga0500568_0003925 Ga0500568_0003925_6725_8056 424
768 3300053153 Ga0500616_0011098 Ga0500616_0011098_3536_4867 424
769 3300053156 Ga0500622_0002480 Ga0500622_0002480_4285_5625 424
770 iso_pu_bacteria 2884634485 2884636377 424
771 iso_pu_bacteria 2896317667 2896319237 424
772 3300001989 JGI24739J22299_10006165 JGI24739J22299_100061655 425
773 3300003316 rootH1_10066410 rootH1_100664102 425
774 3300003354 JGI25160J50197_1011032 JGI25160J50197_10110322 425
775 3300003781 Ga0055536_1007187 Ga0055536_10071874 425
776 3300003790 Ga0055528_1003675 Ga0055528_10036757 425
777 3300003794 Ga0055531_10000122 Ga0055531_1000012229 425
778 3300005262 Ga0065165_1000032 Ga0065165_100003290 425
779 3300005262 Ga0065165_1000038 Ga0065165_100003813 425
780 3300005328 Ga0070676_10043662 Ga0070676_100436622 425
781 3300005329 Ga0070683_100063721 Ga0070683_1000637214 425
782 3300005330 Ga0070690_100006298 Ga0070690_1000062982 425
783 3300005334 Ga0068869_100003479 Ga0068869_1000034792 425
784 3300005334 Ga0068869_100036630 Ga0068869_1000366302 425
785 3300005335 Ga0070666_10122148 Ga0070666_101221481 425
786 3300005338 Ga0068868_100033422 Ga0068868_1000334223 425
787 3300005338 Ga0068868_100043561 Ga0068868_1000435611 425
788 3300005344 Ga0070661_100001902 Ga0070661_10000190210 425
789 3300005344 Ga0070661_100013862 Ga0070661_1000138622 425
790 3300005456 Ga0070678_100043920 Ga0070678_1000439202 425
791 3300005535 Ga0070684_100004405 Ga0070684_1000044057 425
792 3300005539 Ga0068853_100008940 Ga0068853_1000089406 425
793 3300005577 Ga0068857_100007688 Ga0068857_1000076884 425
794 3300005577 Ga0068857_100044712 Ga0068857_1000447122 425
795 3300005719 Ga0068861_100207861 Ga0068861_1002078612 425
796 3300005841 Ga0068863_100224267 Ga0068863_1002242671 425
797 3300005843 Ga0068860_100312667 Ga0068860_1003126671 425
798 3300006237 Ga0097621_100257459 Ga0097621_1002574592 425
799 3300006881 Ga0068865_100045912 Ga0068865_1000459122 425
800 3300009101 Ga0105247_10000703 Ga0105247_100007039 425
801 3300009176 Ga0105242_10028204 Ga0105242_100282041 425
802 3300009553 Ga0105249_10001349 Ga0105249_1000134921 425
803 3300009553 Ga0105249_10030283 Ga0105249_100302832 425
804 3300009553 Ga0105249_10030611 Ga0105249_100306115 425
805 3300010375 Ga0105239_10190018 Ga0105239_101900182 425
806 3300013296 Ga0157374_10001929 Ga0157374_1000192915 425
807 3300013296 Ga0157374_10008313 Ga0157374_100083139 425
808 3300013306 Ga0163162_10003753 Ga0163162_100037539 425
809 3300014325 Ga0163163_10000218 Ga0163163_1000021824 425
810 3300014325 Ga0163163_10084163 Ga0163163_100841632 425
811 3300014968 Ga0157379_10041030 Ga0157379_100410304 425
812 3300014968 Ga0157379_10098063 Ga0157379_100980632 425
813 3300014969 Ga0157376_10064348 Ga0157376_100643482 425
814 3300017792 Ga0163161_10024980 Ga0163161_100249802 425
815 3300017792 Ga0163161_10055284 Ga0163161_100552842 425
816 3300025273 Ga0209673_1000130 Ga0209673_1000130118 425
817 3300025284 Ga0209130_1002095 Ga0209130_10020959 425
818 3300025292 Ga0209676_1001398 Ga0209676_100139812 425
819 3300025302 Ga0207426_1000134 Ga0207426_1000134125 425
820 3300025304 Ga0209257_1000008 Ga0209257_1000008449 425
821 3300025900 Ga0207710_10002539 Ga0207710_100025394 425
822 3300025904 Ga0207647_10055996 Ga0207647_100559962 425
823 3300025907 Ga0207645_10069066 Ga0207645_100690662 425
824 3300025920 Ga0207649_10039990 Ga0207649_100399902 425
825 3300025933 Ga0207706_10073160 Ga0207706_100731602 425
826 3300025934 Ga0207686_10136787 Ga0207686_101367871 425
827 3300025942 Ga0207689_10005981 Ga0207689_100059818 425
828 3300025942 Ga0207689_10025097 Ga0207689_100250974 425
829 3300025942 Ga0207689_10033598 Ga0207689_100335983 425
830 3300025942 Ga0207689_10037526 Ga0207689_100375262 425
831 3300025945 Ga0207679_10012320 Ga0207679_100123206 425
832 3300025945 Ga0207679_10022977 Ga0207679_100229774 425
833 3300025961 Ga0207712_10019928 Ga0207712_100199283 425
834 3300026023 Ga0207677_10155314 Ga0207677_101553142 425
835 3300026116 Ga0207674_10001258 Ga0207674_100012584 425
836 3300026116 Ga0207674_10082272 Ga0207674_100822723 425
837 3300026116 Ga0207674_10264265 Ga0207674_102642652 425
838 3300026118 Ga0207675_100097964 Ga0207675_1000979642 425
839 3300026121 Ga0207683_10066895 Ga0207683_100668953 425
840 3300035172 Ga0373955_0017629 Ga0373955_0017629_250_1587 425
841 3300036401 Ga0373937_0075722 Ga0373937_0075722_464_1801 425
842 3300044673 Ga0453683_0104499 Ga0453683_0104499_438_1754 425
843 3300044712 Ga0453684_0087982 Ga0453684_0087982_1871_3187 425
844 3300045049 Ga0466959_0006121 Ga0466959_0006121_6842_8164 425
845 3300045051 Ga0451576_0329310 Ga0451576_0329310_123_1463 425
846 3300046516 Ga0495628_0045889 Ga0495628_0045889_1059_2396 425
847 3300046517 Ga0495630_0067282 Ga0495630_0067282_773_2110 425
848 3300046536 Ga0495587_0062899 Ga0495587_0062899_223_1560 425
849 3300047321 Ga0495676_0098157 Ga0495676_0098157_395_1729 425
850 3300049569 Ga0501032_0005075 Ga0501032_0005075_3553_4887 425
851 3300049571 Ga0501034_0002417 Ga0501034_0002417_13741_15075 425
852 3300049579 Ga0501043_0003522 Ga0501043_0003522_1410_2744 425
853 3300049580 Ga0501046_0127689 Ga0501046_0127689_11_1345 425
854 3300049581 Ga0501047_0014683 Ga0501047_0014683_4354_5658 425
855 3300049583 Ga0501067_0073249 Ga0501067_0073249_479_1813 425
856 3300049589 Ga0501073_0001563 Ga0501073_0001563_13641_14975 425
857 3300049590 Ga0501074_0016152 Ga0501074_0016152_144_1478 425
858 3300049742 Ga0501080_0009971 Ga0501080_0009971_6322_7656 425
859 3300049822 Ga0501035_0103845 Ga0501035_0103845_327_1631 425
860 3300053121 Ga0500607_010270 Ga0500607_010270_1554_2858 425
861 3300053156 Ga0500622_0000072 Ga0500622_0000072_56735_58036 425
862 3300053177 Ga0500636_0005328 Ga0500636_0005328_2980_4284 425
863 iso_pu_bacteria 2842903701 2842907241 425
864 3300005262 Ga0065165_1010235 Ga0065165_10102354 426
865 3300009094 Ga0111539_10006292 Ga0111539_100062925 426
866 3300026035 Ga0207703_10146961 Ga0207703_101469612 426
867 3300042876 Ga0451577_0048296 Ga0451577_0048296_746_2086 426
868 3300044712 Ga0453684_0154856 Ga0453684_0154856_1260_2588 426
869 3300048924 Ga0496121_0000011 Ga0496121_0000011_13956_15269 426
870 2162886007 SwRhRL2b_contig_2061135 SwRhRL2b_0637.00004210 427
871 3300003794 Ga0055531_10000061 Ga0055531_100000612 427
872 3300005289 Ga0065704_10000361 Ga0065704_100003615 427
873 3300005289 Ga0065704_10072305 Ga0065704_100723054 427
874 3300005354 Ga0070675_100112565 Ga0070675_1001125652 427
875 3300005543 Ga0070672_100163286 Ga0070672_1001632862 427
876 3300005547 Ga0070693_100114148 Ga0070693_1001141482 427
877 3300009148 Ga0105243_10000002 Ga0105243_10000002673 427
878 3300025304 Ga0209257_1000006 Ga0209257_1000006253 427
879 3300025935 Ga0207709_10000003 Ga0207709_10000003680 427
880 3300025940 Ga0207691_10004645 Ga0207691_100046454 427
881 3300025960 Ga0207651_10023804 Ga0207651_100238042 427
882 3300030731 Ga0316177_1089841 Ga0316177_10898411 427
883 3300030732 Ga0316176_1068370 Ga0316176_10683703 427
884 3300030742 Ga0316183_1006105 Ga0316183_100610515 427
885 3300030744 Ga0316181_1099963 Ga0316181_10999633 427
886 3300031731 Ga0307405_10032487 Ga0307405_100324874 427
887 3300031903 Ga0307407_10010507 Ga0307407_100105075 427
888 3300032002 Ga0307416_100000341 Ga0307416_10000034124 427
889 3300032126 Ga0307415_100048082 Ga0307415_1000480823 427
890 3300044712 Ga0453684_0002765 Ga0453684_0002765_36724_38040 427
891 3300045051 Ga0451576_0029508 Ga0451576_0029508_3400_4716 427
892 3300046660 Ga0495625_0078642 Ga0495625_0078642_469_1932 427
893 3300048919 Ga0496116_0009315 Ga0496116_0009315_299_1582 427
894 3300048920 Ga0496117_0000938 Ga0496117_0000938_918_2201 427
895 3300048920 Ga0496117_0004744 Ga0496117_0004744_12842_14125 427
896 3300048925 Ga0496122_0003582 Ga0496122_0003582_12991_14274 427
897 3300048925 Ga0496122_0012699 Ga0496122_0012699_6734_8017 427
898 3300048926 Ga0496123_0030795 Ga0496123_0030795_2053_3336 427
899 iso_pu_bacteria 8055588893 8055591946 427

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

102

228

0.9

PF19051

GFO_IDH_MocA_C2

Oxidoreductase family, C-terminal alpha/beta domain

242

499

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3evn-assembly1.cif.gz_A crystal structure of putative oxidoreductase from streptococcus agalactiae 2603v/r 0.8451 32 393
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8402 32 392
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8399 32 392
6o15-assembly1.cif.gz_B crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with nad(h) 0.8384 32 397
3q2k-assembly2.cif.gz_P crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.8375 32 399
ID Description Score Start End Superfamily
3moiA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.932 32 154 3.40.50.720
af_Q66GR2_10_139_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9292 33 154 3.40.50.720
af_P42599_1_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9249 32 153 3.40.50.720
2ixbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9207 30 153 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9149 32 154 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X8BRV8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9807 35 427 GO:0000166
AF-A0A3C0AG81-F1-model_v4 Dehydrogenase 0.9745 90 427 GO:0000166
AF-A0A3C0AG81-F1-model_v4 Dehydrogenase 0.9687 90 427 GO:0000166
AF-A0A356AZ50-F1-model_v4 Oxidoreductase 0.9538 229 427
AF-A0A7C1YPV6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9399 30 173 GO:0000166

Feature Viewer

pLDDT pTM Quality
93.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map