F485085

General Info

Members Datasets Scaffolds Average Seq Length
898 449 1796 158

Family's Representative Sequence

Representative Sequence 3300046680|Ga0495646_0013429|Ga0495646_0013429_664_1125
Length 153
Sequence MTAIYDFTATSLAGADVPLKRFEGQVLLIVNTASACGFTPQYRGLEALQQEFGPRGFSVLGFPCNQFGKQEPGDAKAIEQFCVTFPMFAKIDVNGGEAHPLYRYLKCEKSGLLGSSIKWNFTKFLVDRSGRVVARHAPTTTPQSLKKEIEALL

Samples

Sample ID Description Type Environment
1 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
201 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
205 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
206 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
225 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
226 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
227 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
228 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
236 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
239 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
240 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
241 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
256 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
257 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
258 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
259 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
260 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
298 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
304 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
316 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
317 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
342 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
345 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
346 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
347 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
348 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
355 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
358 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
368 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
377 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
378 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
379 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
380 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
381 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
382 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
383 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
384 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
389 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
390 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
391 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
392 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
393 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
394 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
395 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
396 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
397 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
398 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
399 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
400 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
401 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
402 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
403 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
404 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
405 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
406 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
407 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
408 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
409 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
410 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
411 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
412 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
413 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
414 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
415 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
416 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
417 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
419 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
420 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
421 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
422 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
423 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
424 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
425 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
426 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
427 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
428 2922368715
429 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
430 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
431 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
432 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
433 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
434 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
435 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
436 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
437 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
438 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
439 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
440 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
441 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
442 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
443 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
444 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
445 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
446 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
447 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
448 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
449 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 0.11
Isolates 3.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.12
Nodule 3.01
Rhizoplane 9.02
Rhizosphere 76.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495646_0013429 3300046680 Bacteria 5207
2 JGI24750J21931_1019635 3300002070 Bacteria 938
3 JGI24745J21846_1020489 3300002073 Bacteria 775
4 JGI24034J26672_10038633 3300002239 Bacteria 796
5 JGI25153J46596_10003951 3300003215 Bacteria 8120
6 Ga0065707_10046658 3300005295 Bacteria 816
7 Ga0070658_10393396 3300005327 Bacteria 1190
8 Ga0070676_10612363 3300005328 Bacteria 787
9 Ga0070683_100024943 3300005329 Bacteria 5363
10 Ga0070683_100548941 3300005329 Bacteria 1105
11 Ga0070683_100874740 3300005329 Bacteria 862
12 Ga0070690_100093356 3300005330 Bacteria 1985
13 Ga0070670_100406226 3300005331 Bacteria 1203
14 Ga0068869_100278438 3300005334 Bacteria 1345
15 Ga0068869_100360192 3300005334 Bacteria 1187
16 Ga0068869_100671246 3300005334 Bacteria 881
17 Ga0070666_10154739 3300005335 Bacteria 1601
18 Ga0070666_10762167 3300005335 Bacteria 712
19 Ga0070680_100193678 3300005336 Bacteria 1713
20 Ga0070682_100957033 3300005337 Bacteria 708
21 Ga0068868_100075229 3300005338 Bacteria 2698
22 Ga0068868_100222267 3300005338 Bacteria 1581
23 Ga0068868_100458560 3300005338 Bacteria 1110
24 Ga0068868_100984209 3300005338 Bacteria 771
25 Ga0070660_100025178 3300005339 Bacteria 4421
26 Ga0070660_100043044 3300005339 Bacteria 3449
27 Ga0070691_10034993 3300005341 Bacteria 2365
28 Ga0070661_100338152 3300005344 Bacteria 1179
29 Ga0070661_100424266 3300005344 Bacteria 1055
30 Ga0070692_10427248 3300005345 Bacteria 843
31 Ga0070668_100021718 3300005347 Bacteria 4849
32 Ga0070668_100104843 3300005347 Bacteria 2244
33 Ga0070668_100152408 3300005347 Bacteria 1870
34 Ga0070668_100278834 3300005347 Bacteria 1395
35 Ga0070669_100740111 3300005353 Bacteria 832
36 Ga0070671_100043185 3300005355 Bacteria 3747
37 Ga0070671_100202460 3300005355 Bacteria 1684
38 Ga0070674_100093925 3300005356 Bacteria 2171
39 Ga0070673_100261911 3300005364 Bacteria 1511
40 Ga0070673_100320228 3300005364 Bacteria 1370
41 Ga0070673_100751363 3300005364 Bacteria 898
42 Ga0070688_100279065 3300005365 Bacteria 1200
43 Ga0070659_100137309 3300005366 Bacteria 1989
44 Ga0070659_100152726 3300005366 Bacteria 1884
45 Ga0070659_100815326 3300005366 Bacteria 812
46 Ga0070667_100190388 3300005367 Bacteria 1817
47 Ga0070667_100191157 3300005367 Bacteria 1813
48 Ga0070667_100502426 3300005367 Bacteria 1112
49 Ga0070703_10063438 3300005406 Bacteria 1215
50 Ga0070709_10000817 3300005434 Bacteria 17373
51 Ga0070709_10012504 3300005434 Bacteria 4752
52 Ga0070709_10021050 3300005434 Bacteria 3796
53 Ga0070713_100026351 3300005436 Bacteria 4563
54 Ga0070713_100126310 3300005436 Bacteria 2250
55 Ga0070710_10003096 3300005437 Bacteria 7895
56 Ga0070710_10019197 3300005437 Bacteria 3530
57 Ga0070710_10172467 3300005437 Bacteria 1348
58 Ga0070701_10199997 3300005438 Bacteria 1181
59 Ga0070711_100115905 3300005439 Bacteria 1973
60 Ga0070711_100230838 3300005439 Bacteria 1443
61 Ga0070711_100515156 3300005439 Bacteria 988
62 Ga0070711_101583911 3300005439 Bacteria 572
63 Ga0070705_100093439 3300005440 Bacteria 1880
64 Ga0070705_100508758 3300005440 Bacteria 916
65 Ga0070705_101402738 3300005440 Bacteria 582
66 Ga0070700_100266596 3300005441 Bacteria 1235
67 Ga0070694_100240081 3300005444 Bacteria 1366
68 Ga0070708_100013596 3300005445 Bacteria 6671
69 Ga0070708_100571725 3300005445 Bacteria 1066
70 Ga0070663_100027477 3300005455 Bacteria 3865
71 Ga0070663_100058083 3300005455 Bacteria 2777
72 Ga0070663_100131423 3300005455 Bacteria 1901
73 Ga0070678_100011988 3300005456 Bacteria 5369
74 Ga0070678_100021269 3300005456 Bacteria 4274
75 Ga0070678_100160789 3300005456 Bacteria 1819
76 Ga0070678_100380925 3300005456 Bacteria 1220
77 Ga0070678_100403135 3300005456 Bacteria 1189
78 Ga0070662_100315079 3300005457 Bacteria 1274
79 Ga0070662_100513626 3300005457 Bacteria 1000
80 Ga0070681_10198897 3300005458 Bacteria 1923
81 Ga0070681_11531506 3300005458 Bacteria 592
82 Ga0068867_100060178 3300005459 Bacteria 2817
83 Ga0068867_101349600 3300005459 Bacteria 660
84 Ga0070685_10114948 3300005466 Bacteria 1664
85 Ga0070707_100342683 3300005468 Bacteria 1452
86 Ga0070698_100016987 3300005471 Bacteria 7671
87 Ga0070698_100351396 3300005471 Bacteria 1406
88 Ga0070699_100837925 3300005518 Bacteria 842
89 Ga0070679_100012993 3300005530 Bacteria 7976
90 Ga0070684_100041016 3300005535 Bacteria 3988
91 Ga0070684_100214528 3300005535 Bacteria 1755
92 Ga0070684_101508229 3300005535 Bacteria 634
93 Ga0070697_100221948 3300005536 Bacteria 1611
94 Ga0070697_100465975 3300005536 Bacteria 1102
95 Ga0070697_100621016 3300005536 Bacteria 951
96 Ga0068853_100007746 3300005539 Bacteria 8610
97 Ga0068853_100041678 3300005539 Bacteria 3924
98 Ga0068853_100456062 3300005539 Bacteria 1203
99 Ga0068853_101145147 3300005539 Bacteria 751
100 Ga0070672_100105866 3300005543 Bacteria 2287
101 Ga0070672_100295815 3300005543 Bacteria 1371
102 Ga0070672_100380745 3300005543 Bacteria 1207
103 Ga0070672_100552654 3300005543 Bacteria 1000
104 Ga0070672_100880020 3300005543 Bacteria 791
105 Ga0070686_100954312 3300005544 Bacteria 701
106 Ga0070695_100108405 3300005545 Bacteria 1881
107 Ga0070696_100383299 3300005546 Bacteria 1096
108 Ga0070665_100029407 3300005548 Bacteria 5530
109 Ga0070665_100073236 3300005548 Bacteria 3432
110 Ga0070665_100238367 3300005548 Bacteria 1820
111 Ga0070665_100479557 3300005548 Bacteria 1254
112 Ga0070665_100688288 3300005548 Bacteria 1035
113 Ga0070665_100732721 3300005548 Bacteria 1002
114 Ga0070665_101127974 3300005548 Bacteria 795
115 Ga0070704_100290739 3300005549 Bacteria 1358
116 Ga0068855_100008782 3300005563 Bacteria 12213
117 Ga0068855_100098069 3300005563 Bacteria 3376
118 Ga0070664_100609713 3300005564 Bacteria 1013
119 Ga0070664_101013163 3300005564 Bacteria 781
120 Ga0068857_100022346 3300005577 Bacteria 5565
121 Ga0068857_100244177 3300005577 Bacteria 1645
122 Ga0068856_100042754 3300005614 Bacteria 4458
123 Ga0068856_100135947 3300005614 Bacteria 2463
124 Ga0068856_100273371 3300005614 Bacteria 1706
125 Ga0068856_100938922 3300005614 Bacteria 884
126 Ga0068856_101449367 3300005614 Bacteria 701
127 Ga0070702_100206718 3300005615 Bacteria 1303
128 Ga0070702_100321301 3300005615 Bacteria 1079
129 Ga0070702_100609199 3300005615 Bacteria 820
130 Ga0068859_100090841 3300005617 Bacteria 3104
131 Ga0068859_100355950 3300005617 Bacteria 1559
132 Ga0068859_100524413 3300005617 Bacteria 1279
133 Ga0068859_102350041 3300005617 Bacteria 588
134 Ga0068864_100036135 3300005618 Bacteria 4209
135 Ga0068864_100998367 3300005618 Bacteria 830
136 Ga0068864_101213222 3300005618 Bacteria 753
137 Ga0068866_10467012 3300005718 Bacteria 829
138 Ga0068866_10521491 3300005718 Bacteria 790
139 Ga0068861_100166778 3300005719 Bacteria 1821
140 Ga0068861_100366571 3300005719 Bacteria 1268
141 Ga0068861_100492453 3300005719 Bacteria 1106
142 Ga0068861_100508393 3300005719 Bacteria 1090
143 Ga0068861_101623270 3300005719 Bacteria 638
144 Ga0068861_101633494 3300005719 Bacteria 636
145 Ga0068851_10010974 3300005834 Bacteria 4238
146 Ga0068851_10140778 3300005834 Bacteria 1312
147 Ga0068851_10147938 3300005834 Bacteria 1282
148 Ga0068870_10134745 3300005840 Bacteria 1438
149 Ga0068870_10217882 3300005840 Bacteria 1167
150 Ga0068870_10394870 3300005840 Bacteria 899
151 Ga0068863_100099688 3300005841 Bacteria 2760
152 Ga0068863_100167727 3300005841 Bacteria 2105
153 Ga0068858_100399172 3300005842 Bacteria 1321
154 Ga0068858_100401783 3300005842 Bacteria 1317
155 Ga0068858_100766464 3300005842 Bacteria 940
156 Ga0068858_100938729 3300005842 Bacteria 847
157 Ga0068860_100034021 3300005843 Bacteria 4888
158 Ga0068860_100249141 3300005843 Bacteria 1729
159 Ga0068860_100474324 3300005843 Bacteria 1246
160 Ga0068860_100551767 3300005843 Bacteria 1154
161 Ga0068860_101032275 3300005843 Bacteria 841
162 Ga0068860_101043816 3300005843 Bacteria 836
163 Ga0068862_100108344 3300005844 Bacteria 2436
164 Ga0068862_100239411 3300005844 Bacteria 1649
165 Ga0068862_100246850 3300005844 Bacteria 1625
166 Ga0068862_100320036 3300005844 Bacteria 1431
167 Ga0068862_100409193 3300005844 Bacteria 1270
168 Ga0068862_100782436 3300005844 Bacteria 930
169 Ga0081455_10008353 3300005937 Bacteria 10782
170 Ga0081455_10394896 3300005937 Bacteria 962
171 Ga0081540_1003129 3300005983 Bacteria 13231
172 Ga0081540_1004018 3300005983 Bacteria 11391
173 Ga0081540_1004757 3300005983 Bacteria 10254
174 Ga0081540_1100558 3300005983 Bacteria 1246
175 Ga0081540_1105575 3300005983 Bacteria 1203
176 Ga0081540_1142675 3300005983 Bacteria 959
177 Ga0081539_10060022 3300005985 Bacteria 2090
178 Ga0070717_10278583 3300006028 Bacteria 1483
179 Ga0070717_10617167 3300006028 Bacteria 984
180 Ga0075365_10128778 3300006038 Bacteria 1750
181 Ga0075365_10157671 3300006038 Bacteria 1580
182 Ga0075363_100064176 3300006048 Bacteria 1984
183 Ga0075364_10091041 3300006051 Bacteria 2023
184 Ga0075364_10091590 3300006051 Bacteria 2017
185 Ga0070715_10108372 3300006163 Bacteria 1307
186 Ga0070715_10241300 3300006163 Bacteria 940
187 Ga0070715_10336296 3300006163 Bacteria 820
188 Ga0070716_100007087 3300006173 Bacteria 5505
189 Ga0070716_100906221 3300006173 Bacteria 691
190 Ga0070712_100013773 3300006175 Bacteria 5172
191 Ga0070712_100029780 3300006175 Bacteria 3662
192 Ga0070712_100055052 3300006175 Bacteria 2784
193 Ga0070712_100218149 3300006175 Bacteria 1508
194 Ga0070712_100757788 3300006175 Bacteria 831
195 Ga0075362_10054698 3300006177 Bacteria 1794
196 Ga0075367_10088221 3300006178 Bacteria 1885
197 Ga0075367_10114274 3300006178 Bacteria 1659
198 Ga0075367_10138774 3300006178 Bacteria 1505
199 Ga0075369_10093363 3300006186 Bacteria 1344
200 Ga0075369_10243323 3300006186 Bacteria 835
201 Ga0075366_10259455 3300006195 Bacteria 1061
202 Ga0097621_100126302 3300006237 Bacteria 2173
203 Ga0097621_100231102 3300006237 Bacteria 1615
204 Ga0097621_100728169 3300006237 Bacteria 915
205 Ga0097621_101027710 3300006237 Bacteria 772
206 Ga0075370_10110608 3300006353 Bacteria 1596
207 Ga0075370_10181625 3300006353 Bacteria 1238
208 Ga0068871_100079952 3300006358 Bacteria 2706
209 Ga0068871_100297968 3300006358 Bacteria 1415
210 Ga0068871_101193228 3300006358 Bacteria 714
211 Ga0075428_100589500 3300006844 Bacteria 1187
212 Ga0075434_100048137 3300006871 Bacteria 4231
213 Ga0075434_100224646 3300006871 Bacteria 1897
214 Ga0068865_100184520 3300006881 Bacteria 1609
215 Ga0068865_100310792 3300006881 Bacteria 1264
216 Ga0097620_100090844 3300006931 Bacteria 3104
217 Ga0097620_100355958 3300006931 Bacteria 1559
218 Ga0097620_100524410 3300006931 Bacteria 1279
219 Ga0097620_102350075 3300006931 Bacteria 588
220 Ga0075435_101070424 3300007076 Bacteria 705
221 Ga0099794_10071767 3300007265 Bacteria 1696
222 Ga0099794_10365028 3300007265 Bacteria 752
223 Ga0099795_10013387 3300007788 Bacteria 2517
224 Ga0099795_10030306 3300007788 Bacteria 1856
225 Ga0099795_10642456 3300007788 Bacteria 507
226 Ga0105250_10080541 3300009092 Bacteria 1320
227 Ga0105240_10004088 3300009093 Bacteria 22447
228 Ga0105240_10187100 3300009093 Bacteria 2438
229 Ga0105240_10190989 3300009093 Bacteria 2408
230 Ga0105240_10280133 3300009093 Bacteria 1916
231 Ga0111539_10129515 3300009094 Bacteria 2955
232 Ga0111539_10189586 3300009094 Bacteria 2399
233 Ga0105245_10490352 3300009098 Bacteria 1243
234 Ga0105245_12266888 3300009098 Bacteria 597
235 Ga0105247_10112923 3300009101 Bacteria 1751
236 Ga0114129_10350452 3300009147 Bacteria 1956
237 Ga0114129_11395407 3300009147 Bacteria 864
238 Ga0114129_11610186 3300009147 Bacteria 795
239 Ga0105243_10151274 3300009148 Bacteria 1991
240 Ga0105243_10179192 3300009148 Bacteria 1841
241 Ga0105243_11168216 3300009148 Bacteria 781
242 Ga0105241_10980499 3300009174 Bacteria 789
243 Ga0105242_10364695 3300009176 Bacteria 1338
244 Ga0105248_10468128 3300009177 Bacteria 1421
245 Ga0105248_11331226 3300009177 Bacteria 812
246 Ga0105237_10966062 3300009545 Bacteria 859
247 Ga0105238_10038422 3300009551 Bacteria 4862
248 Ga0105249_10030460 3300009553 Bacteria 4877
249 Ga0105249_10032133 3300009553 Bacteria 4748
250 Ga0105249_10250058 3300009553 Bacteria 1757
251 Ga0105249_11550756 3300009553 Bacteria 735
252 Ga0099796_10006193 3300010159 Bacteria 3047
253 Ga0099796_10014784 3300010159 Bacteria 2265
254 Ga0099796_10038162 3300010159 Bacteria 1610
255 Ga0099796_10123512 3300010159 Bacteria 997
256 Ga0105239_10062429 3300010375 Bacteria 4089
257 Ga0105239_10089688 3300010375 Bacteria 3391
258 Ga0105239_10282615 3300010375 Bacteria 1868
259 Ga0105246_10221367 3300011119 Bacteria 1484
260 Ga0105246_10438931 3300011119 Bacteria 1094
261 Ga0157373_10206760 3300013100 Bacteria 1384
262 Ga0157370_10122806 3300013104 Bacteria 2425
263 Ga0157369_10004274 3300013105 Bacteria 16883
264 Ga0157374_10228113 3300013296 Bacteria 1829
265 Ga0157378_10405697 3300013297 Bacteria 1344
266 Ga0157378_10575962 3300013297 Bacteria 1134
267 Ga0157378_10788904 3300013297 Bacteria 975
268 Ga0157378_10926101 3300013297 Bacteria 903
269 Ga0157378_11539372 3300013297 Bacteria 710
270 Ga0163162_10012112 3300013306 Bacteria 8416
271 Ga0163162_10100329 3300013306 Bacteria 2986
272 Ga0163162_10285720 3300013306 Bacteria 1782
273 Ga0157375_10048277 3300013308 Bacteria 4163
274 Ga0157375_10125656 3300013308 Bacteria 2679
275 Ga0157375_10330697 3300013308 Bacteria 1689
276 Ga0157375_10449504 3300013308 Bacteria 1454
277 Ga0157375_10706569 3300013308 Bacteria 1161
278 Ga0157375_11051065 3300013308 Bacteria 952
279 Ga0163163_10048880 3300014325 Bacteria 4161
280 Ga0163163_10093691 3300014325 Bacteria 3020
281 Ga0163163_10293338 3300014325 Bacteria 1679
282 Ga0163163_11249462 3300014325 Bacteria 805
283 Ga0163163_11828606 3300014325 Bacteria 668
284 Ga0157380_10229726 3300014326 Bacteria 1666
285 Ga0157380_10247869 3300014326 Bacteria 1610
286 Ga0157380_10868938 3300014326 Bacteria 925
287 Ga0157380_11969630 3300014326 Bacteria 646
288 Ga0157377_10350939 3300014745 Bacteria 990
289 Ga0157379_10007175 3300014968 Bacteria 9642
290 Ga0157379_10036753 3300014968 Bacteria 4367
291 Ga0157379_10504960 3300014968 Bacteria 1121
292 Ga0157379_10923990 3300014968 Bacteria 829
293 Ga0157376_10006597 3300014969 Bacteria 8211
294 Ga0157376_10270967 3300014969 Bacteria 1595
295 Ga0157376_10635686 3300014969 Bacteria 1066
296 Ga0157376_10990630 3300014969 Bacteria 863
297 Ga0182007_10120845 3300015262 Bacteria 876
298 Ga0163161_10196006 3300017792 Bacteria 1555
299 Ga0163161_10288846 3300017792 Bacteria 1288
300 Ga0163161_10445773 3300017792 Bacteria 1045
301 Ga0163161_11496653 3300017792 Bacteria 592
302 Ga0213875_10008646 3300021388 Bacteria 5200
303 Ga0209758_1007842 3300025297 Bacteria 7115
304 Ga0207697_10039132 3300025315 Bacteria 1945
305 Ga0207697_10048136 3300025315 Bacteria 1758
306 Ga0207692_10009574 3300025898 Bacteria 4053
307 Ga0207692_10044136 3300025898 Bacteria 2222
308 Ga0207692_10383180 3300025898 Bacteria 873
309 Ga0207642_10110687 3300025899 Bacteria 1398
310 Ga0207642_10396375 3300025899 Bacteria 825
311 Ga0207642_10642810 3300025899 Bacteria 664
312 Ga0207710_10041818 3300025900 Bacteria 2033
313 Ga0207710_10213910 3300025900 Bacteria 955
314 Ga0207710_10216696 3300025900 Bacteria 949
315 Ga0207710_10319490 3300025900 Bacteria 787
316 Ga0207710_10393794 3300025900 Bacteria 710
317 Ga0207688_10119566 3300025901 Bacteria 1536
318 Ga0207688_10245720 3300025901 Bacteria 1083
319 Ga0207680_10074988 3300025903 Bacteria 2108
320 Ga0207680_10478570 3300025903 Bacteria 885
321 Ga0207647_10154974 3300025904 Bacteria 1338
322 Ga0207647_10328768 3300025904 Bacteria 867
323 Ga0207699_10005610 3300025906 Bacteria 6020
324 Ga0207699_10068562 3300025906 Bacteria 2160
325 Ga0207699_10149853 3300025906 Bacteria 1542
326 Ga0207699_10872589 3300025906 Bacteria 663
327 Ga0207645_10061305 3300025907 Bacteria 2402
328 Ga0207645_10272156 3300025907 Bacteria 1123
329 Ga0207643_10106529 3300025908 Bacteria 1648
330 Ga0207643_10362148 3300025908 Bacteria 912
331 Ga0207643_10519647 3300025908 Bacteria 762
332 Ga0207705_10062361 3300025909 Bacteria 2693
333 Ga0207654_10109703 3300025911 Bacteria 1715
334 Ga0207654_10627437 3300025911 Bacteria 768
335 Ga0207707_10038869 3300025912 Bacteria 4159
336 Ga0207695_10026167 3300025913 Bacteria 6513
337 Ga0207695_10363649 3300025913 Bacteria 1333
338 Ga0207671_10159187 3300025914 Bacteria 1748
339 Ga0207693_10017508 3300025915 Bacteria 5713
340 Ga0207693_10022416 3300025915 Bacteria 5019
341 Ga0207693_10031207 3300025915 Bacteria 4210
342 Ga0207693_10307180 3300025915 Bacteria 1242
343 Ga0207663_10000481 3300025916 Bacteria 17353
344 Ga0207663_10045948 3300025916 Bacteria 2688
345 Ga0207663_10128503 3300025916 Bacteria 1747
346 Ga0207663_10407903 3300025916 Bacteria 1040
347 Ga0207660_10040990 3300025917 Bacteria 3243
348 Ga0207662_10060332 3300025918 Bacteria 2275
349 Ga0207657_10005699 3300025919 Bacteria 12997
350 Ga0207657_10080434 3300025919 Bacteria 2739
351 Ga0207649_10350708 3300025920 Bacteria 1092
352 Ga0207652_10688091 3300025921 Bacteria 913
353 Ga0207652_10733306 3300025921 Bacteria 880
354 Ga0207646_10423184 3300025922 Bacteria 1202
355 Ga0207681_10485202 3300025923 Bacteria 1010
356 Ga0207681_10505290 3300025923 Bacteria 990
357 Ga0207694_10005588 3300025924 Bacteria 9639
358 Ga0207694_10760584 3300025924 Bacteria 818
359 Ga0207650_10617587 3300025925 Bacteria 912
360 Ga0207659_10127146 3300025926 Bacteria 1962
361 Ga0207659_10208986 3300025926 Bacteria 1563
362 Ga0207659_10475237 3300025926 Bacteria 1055
363 Ga0207687_10033929 3300025927 Bacteria 3464
364 Ga0207687_10349662 3300025927 Bacteria 1204
365 Ga0207687_10811163 3300025927 Bacteria 798
366 Ga0207700_10130608 3300025928 Bacteria 2050
367 Ga0207700_10186281 3300025928 Bacteria 1741
368 Ga0207700_10618597 3300025928 Bacteria 964
369 Ga0207664_10013072 3300025929 Bacteria 5950
370 Ga0207644_10119460 3300025931 Bacteria 2005
371 Ga0207644_10894962 3300025931 Bacteria 744
372 Ga0207644_11063693 3300025931 Bacteria 680
373 Ga0207706_10044659 3300025933 Bacteria 3927
374 Ga0207706_10157989 3300025933 Bacteria 1993
375 Ga0207706_10646261 3300025933 Bacteria 906
376 Ga0207706_10901935 3300025933 Bacteria 746
377 Ga0207686_10054501 3300025934 Bacteria 2505
378 Ga0207686_10316261 3300025934 Bacteria 1165
379 Ga0207686_10505448 3300025934 Bacteria 938
380 Ga0207686_11066399 3300025934 Bacteria 658
381 Ga0207709_10085816 3300025935 Bacteria 2042
382 Ga0207670_10157921 3300025936 Bacteria 1690
383 Ga0207669_10050724 3300025937 Bacteria 2482
384 Ga0207669_10240273 3300025937 Bacteria 1342
385 Ga0207704_10355667 3300025938 Bacteria 1142
386 Ga0207665_10009371 3300025939 Bacteria 6425
387 Ga0207665_10100266 3300025939 Bacteria 2021
388 Ga0207691_10310999 3300025940 Bacteria 1352
389 Ga0207691_10611175 3300025940 Bacteria 922
390 Ga0207691_10707210 3300025940 Bacteria 849
391 Ga0207691_10954395 3300025940 Bacteria 716
392 Ga0207691_11465646 3300025940 Bacteria 559
393 Ga0207711_10221138 3300025941 Bacteria 1732
394 Ga0207711_10473743 3300025941 Bacteria 1166
395 Ga0207711_10808231 3300025941 Bacteria 873
396 Ga0207689_10016426 3300025942 Bacteria 6266
397 Ga0207689_10046080 3300025942 Bacteria 3605
398 Ga0207689_10068815 3300025942 Bacteria 2909
399 Ga0207661_10286297 3300025944 Bacteria 1474
400 Ga0207661_10596878 3300025944 Bacteria 1013
401 Ga0207679_10188718 3300025945 Bacteria 1712
402 Ga0207679_10605314 3300025945 Bacteria 988
403 Ga0207667_10161632 3300025949 Bacteria 2303
404 Ga0207667_10953690 3300025949 Bacteria 847
405 Ga0207651_10124148 3300025960 Bacteria 1964
406 Ga0207651_10245077 3300025960 Bacteria 1463
407 Ga0207651_10255618 3300025960 Bacteria 1436
408 Ga0207712_10790372 3300025961 Bacteria 834
409 Ga0207668_10044587 3300025972 Bacteria 3018
410 Ga0207668_10057553 3300025972 Bacteria 2712
411 Ga0207668_10111419 3300025972 Bacteria 2054
412 Ga0207668_10258963 3300025972 Bacteria 1416
413 Ga0207668_10906881 3300025972 Bacteria 784
414 Ga0207640_10545672 3300025981 Bacteria 973
415 Ga0207658_10719309 3300025986 Bacteria 903
416 Ga0207677_10157482 3300026023 Bacteria 1760
417 Ga0207677_10447289 3300026023 Bacteria 1106
418 Ga0207677_10871205 3300026023 Bacteria 810
419 Ga0207703_10176117 3300026035 Bacteria 1885
420 Ga0207703_10384165 3300026035 Bacteria 1299
421 Ga0207703_10849148 3300026035 Bacteria 873
422 Ga0207703_11111754 3300026035 Bacteria 759
423 Ga0207703_11239277 3300026035 Bacteria 717
424 Ga0207703_12103474 3300026035 Bacteria 541
425 Ga0207639_10044620 3300026041 Bacteria 3335
426 Ga0207639_11467250 3300026041 Bacteria 640
427 Ga0207678_10011034 3300026067 Bacteria 7936
428 Ga0207678_10118095 3300026067 Bacteria 2263
429 Ga0207678_10141918 3300026067 Bacteria 2050
430 Ga0207678_11438261 3300026067 Bacteria 609
431 Ga0207708_10034360 3300026075 Bacteria 3857
432 Ga0207708_10294267 3300026075 Bacteria 1319
433 Ga0207708_10764917 3300026075 Bacteria 830
434 Ga0207702_10029332 3300026078 Bacteria 4577
435 Ga0207702_10041616 3300026078 Bacteria 3853
436 Ga0207702_10273688 3300026078 Bacteria 1594
437 Ga0207702_10595520 3300026078 Bacteria 1084
438 Ga0207702_11249258 3300026078 Bacteria 737
439 Ga0207641_11125878 3300026088 Bacteria 784
440 Ga0207648_10042364 3300026089 Bacteria 3996
441 Ga0207676_10289587 3300026095 Bacteria 1490
442 Ga0207676_10366407 3300026095 Bacteria 1337
443 Ga0207676_10980969 3300026095 Bacteria 832
444 Ga0207674_10007221 3300026116 Bacteria 12962
445 Ga0207674_10159032 3300026116 Bacteria 2214
446 Ga0207674_10252745 3300026116 Bacteria 1709
447 Ga0207675_100218073 3300026118 Bacteria 1837
448 Ga0207675_101145503 3300026118 Bacteria 798
449 Ga0207683_10008843 3300026121 Bacteria 8591
450 Ga0207683_10362585 3300026121 Bacteria 1331
451 Ga0207683_10392926 3300026121 Bacteria 1275
452 Ga0207683_10827780 3300026121 Bacteria 859
453 Ga0207698_10316334 3300026142 Bacteria 1460
454 Ga0207698_10620526 3300026142 Bacteria 1068
455 Ga0209179_1035400 3300027512 Bacteria 1037
456 Ga0209588_1001423 3300027671 Bacteria 6253
457 Ga0209813_10233068 3300027866 Bacteria 693
458 Ga0207428_10107201 3300027907 Bacteria 2153
459 Ga0207428_10352334 3300027907 Bacteria 1083
460 Ga0268266_10004005 3300028379 Bacteria 14252
461 Ga0268266_10293572 3300028379 Bacteria 1514
462 Ga0268266_10438311 3300028379 Bacteria 1240
463 Ga0268266_10642500 3300028379 Bacteria 1021
464 Ga0268265_10067880 3300028380 Bacteria 2762
465 Ga0268265_10160980 3300028380 Bacteria 1906
466 Ga0268265_10260535 3300028380 Bacteria 1541
467 Ga0268265_10316393 3300028380 Bacteria 1411
468 Ga0268265_10409688 3300028380 Bacteria 1255
469 Ga0268264_10236071 3300028381 Bacteria 1691
470 Ga0268264_10642701 3300028381 Bacteria 1049
471 Ga0268264_11051345 3300028381 Bacteria 822
472 Ga0268264_11182114 3300028381 Bacteria 774
473 Ga0265319_1037075 3300028563 Bacteria 1664
474 Ga0265334_10019489 3300028573 Bacteria 2790
475 Ga0265336_10001725 3300028666 Bacteria 9598
476 Ga0307517_10000248 3300028786 Bacteria 92084
477 Ga0307517_10332189 3300028786 Bacteria 835
478 Ga0307515_10140854 3300028794 Bacteria 2588
479 Ga0307515_10512895 3300028794 Bacteria 809
480 Ga0265338_10008662 3300028800 Bacteria 12306
481 Ga0265324_10079547 3300029957 Bacteria 1115
482 Ga0265330_10061590 3300031235 Bacteria 1632
483 Ga0265330_10131280 3300031235 Bacteria 1066
484 Ga0265330_10185669 3300031235 Bacteria 880
485 Ga0265330_10278236 3300031235 Bacteria 705
486 Ga0265332_10038128 3300031238 Bacteria 2083
487 Ga0265332_10064108 3300031238 Bacteria 1569
488 Ga0265325_10086747 3300031241 Bacteria 1548
489 Ga0265340_10136329 3300031247 Bacteria 1124
490 Ga0265339_10004338 3300031249 Bacteria 9683
491 Ga0265339_10115554 3300031249 Bacteria 1384
492 Ga0265339_10478512 3300031249 Bacteria 576
493 Ga0307513_10270208 3300031456 Bacteria 1484
494 Ga0307509_10411751 3300031507 Bacteria 1055
495 Ga0307509_10779188 3300031507 Bacteria 621
496 Ga0265314_10057845 3300031711 Bacteria 2660
497 Ga0265342_10041932 3300031712 Bacteria 2768
498 Ga0307516_10164494 3300031730 Bacteria 1965
499 Ga0307516_10395510 3300031730 Bacteria 1042
500 Ga0307405_10977315 3300031731 Bacteria 721
501 Ga0307406_11347614 3300031901 Bacteria 624
502 Ga0307407_10331170 3300031903 Bacteria 1072
503 Ga0307412_10146219 3300031911 Bacteria 1738
504 Ga0307409_100338349 3300031995 Bacteria 1415
505 Ga0307409_101027102 3300031995 Bacteria 843
506 Ga0307409_101274119 3300031995 Bacteria 760
507 Ga0307416_100963673 3300032002 Bacteria 955
508 Ga0307414_10461120 3300032004 Bacteria 1117
509 Ga0307411_10510868 3300032005 Bacteria 1018
510 Ga0307415_100154081 3300032126 Bacteria 1772
511 Ga0307415_100626929 3300032126 Bacteria 961
512 Ga0307510_10018694 3300033180 Bacteria 8144
513 Ga0307510_10069821 3300033180 Bacteria 3514
514 Ga0316215_1002965 3300033544 Bacteria 1612
515 Ga0373930_0140650 3300034816 Bacteria 600
516 Ga0373959_0016096 3300034820 Bacteria 1382
517 Ga0373928_0053661 3300035084 Bacteria 958
518 Ga0373934_0000914 3300035086 Bacteria 10668
519 Ga0373952_0035856 3300035092 Bacteria 1124
520 Ga0373923_0008141 3300035111 Bacteria 3723
521 Ga0373936_0445800 3300035113 Bacteria 598
522 Ga0373953_0000596 3300035117 Bacteria 9976
523 Ga0373953_0078198 3300035117 Bacteria 1372
524 Ga0373954_0001095 3300035118 Bacteria 10822
525 Ga0373956_0005630 3300035119 Bacteria 5010
526 Ga0373957_0001877 3300035120 Bacteria 5830
527 Ga0373943_0042392 3300035170 Bacteria 2206
528 Ga0373946_0670533 3300035171 Bacteria 541
529 Ga0373955_0001814 3300035172 Bacteria 9172
530 Ga0373961_0060243 3300035241 Bacteria 1150
531 Ga0373962_0111007 3300035242 Bacteria 865
532 Ga0373924_0000963 3300035410 Bacteria 9118
533 Ga0373924_0270453 3300035410 Bacteria 753
534 Ga0373924_0416518 3300035410 Bacteria 601
535 Ga0373931_0740985 3300035691 Bacteria 651
536 Ga0373935_0393999 3300035692 Bacteria 994
537 Ga0373927_0010102 3300035695 Bacteria 6317
538 Ga0373927_0029648 3300035695 Bacteria 3568
539 Ga0373927_0043019 3300035695 Bacteria 2926
540 Ga0373927_0070175 3300035695 Bacteria 2268
541 Ga0373933_0003252 3300035724 Bacteria 9076
542 Ga0373933_0946210 3300035724 Bacteria 567
543 Ga0373947_0008005 3300035725 Bacteria 6097
544 Ga0373947_0258533 3300035725 Bacteria 1153
545 Ga0373937_0005268 3300036401 Bacteria 11042
546 Ga0373937_0216129 3300036401 Bacteria 1804
547 Ga0373937_0421529 3300036401 Bacteria 1267
548 Ga0373925_0029655 3300037068 Bacteria 4014
549 Ga0373925_0610571 3300037068 Bacteria 898
550 Ga0395900_0006895 3300037418 Bacteria 11788
551 Ga0395900_0765787 3300037418 Bacteria 895
552 Ga0395900_0782128 3300037418 Bacteria 883
553 Ga0395898_0143548 3300037466 Bacteria 2285
554 Ga0395898_0313324 3300037466 Bacteria 1497
555 Ga0395898_1006332 3300037466 Bacteria 769
556 Ga0436364_0577167 3300037853 Bacteria 2020
557 Ga0436364_0860093 3300037853 Bacteria 5544
558 Ga0395901_0136961 3300038443 Bacteria 2573
559 Ga0395901_0250742 3300038443 Bacteria 1844
560 Ga0395901_1694026 3300038443 Bacteria 584
561 Ga0436365_0900431 3300039437 Bacteria 1075
562 Ga0436365_1910270 3300039437 Bacteria 551
563 Ga0439465_0109031 3300041413 Bacteria 962
564 Ga0451787_501728 3300041441 Bacteria 674
565 Ga0451800_1136385 3300041459 Bacteria 1015
566 Ga0451802_1150291 3300041460 Bacteria 957
567 Ga0451845_0736930 3300041501 Bacteria 628
568 Ga0439459_0139718 3300042438 Bacteria 625
569 Ga0466966_0016435 3300044684 Bacteria 4889
570 Ga0466966_0378676 3300044684 Bacteria 850
571 Ga0466963_0089506 3300044694 Bacteria 2094
572 Ga0466964_0067024 3300044706 Bacteria 1508
573 Ga0466957_0044279 3300044842 Bacteria 2697
574 Ga0451576_0683241 3300045051 Bacteria 1079
575 Ga0466967_0063879 3300045976 Bacteria 3273
576 Ga0495617_069809 3300046452 Bacteria 1156
577 Ga0495592_0005044 3300046454 Bacteria 9715
578 Ga0495603_0043056 3300046455 Bacteria 2697
579 Ga0495603_0043234 3300046455 Bacteria 2691
580 Ga0495590_0197515 3300046457 Bacteria 738
581 Ga0495591_081842 3300046458 Bacteria 822
582 Ga0495629_0001194 3300046459 Bacteria 20460
583 Ga0495629_0159553 3300046459 Bacteria 1567
584 Ga0495629_0282206 3300046459 Bacteria 1139
585 Ga0495629_0509240 3300046459 Bacteria 811
586 Ga0495638_0120048 3300046460 Bacteria 1554
587 Ga0495638_0460106 3300046460 Bacteria 648
588 Ga0495651_0006142 3300046462 Bacteria 9174
589 Ga0495651_0049814 3300046462 Bacteria 3233
590 Ga0495653_0001332 3300046463 Bacteria 19165
591 Ga0495650_0141849 3300046471 Bacteria 869
592 Ga0495580_0037554 3300046472 Bacteria 3475
593 Ga0495605_0054057 3300046474 Bacteria 1946
594 Ga0495605_0148663 3300046474 Bacteria 1047
595 Ga0495605_0310064 3300046474 Bacteria 666
596 Ga0495639_0135731 3300046475 Bacteria 1180
597 Ga0495639_0187567 3300046475 Bacteria 1009
598 Ga0495664_0402988 3300046477 Bacteria 821
599 Ga0495584_0182408 3300046491 Bacteria 1067
600 Ga0495585_0138227 3300046492 Bacteria 1277
601 Ga0495585_0310037 3300046492 Bacteria 774
602 Ga0495594_0136668 3300046499 Bacteria 1389
603 Ga0495594_0655583 3300046499 Bacteria 594
604 Ga0495596_0192214 3300046500 Bacteria 793
605 Ga0495607_0225191 3300046501 Bacteria 915
606 Ga0495607_0280866 3300046501 Bacteria 790
607 Ga0495583_0105991 3300046506 Bacteria 1195
608 Ga0495583_0246557 3300046506 Bacteria 717
609 Ga0495606_0179948 3300046507 Bacteria 1220
610 Ga0495606_0467591 3300046507 Bacteria 643
611 Ga0495608_0007821 3300046511 Bacteria 7520
612 Ga0495616_0424687 3300046513 Bacteria 542
613 Ga0495618_0020965 3300046514 Bacteria 4025
614 Ga0495620_0085438 3300046515 Bacteria 1272
615 Ga0495620_0167978 3300046515 Bacteria 851
616 Ga0495628_0100373 3300046516 Bacteria 2234
617 Ga0495631_0072562 3300046518 Bacteria 1487
618 Ga0495632_0113736 3300046519 Bacteria 1269
619 Ga0495632_0409942 3300046519 Bacteria 591
620 Ga0495644_0179212 3300046523 Bacteria 814
621 Ga0495648_0097331 3300046524 Bacteria 1632
622 Ga0495663_0070919 3300046525 Bacteria 1109
623 Ga0495642_0159179 3300046528 Bacteria 979
624 Ga0495652_0005875 3300046529 Bacteria 11481
625 Ga0495652_0141301 3300046529 Bacteria 1893
626 Ga0495652_0479693 3300046529 Bacteria 866
627 Ga0495640_0009106 3300046533 Bacteria 7749
628 Ga0495587_0004179 3300046536 Bacteria 9559
629 Ga0495609_0126800 3300046538 Bacteria 1095
630 Ga0495609_0150500 3300046538 Bacteria 990
631 Ga0495621_0016134 3300046539 Bacteria 2393
632 Ga0495621_0373550 3300046539 Bacteria 601
633 Ga0495597_0192329 3300046542 Bacteria 820
634 Ga0495645_0031272 3300046543 Bacteria 3878
635 Ga0495645_0421778 3300046543 Bacteria 847
636 Ga0495622_0041263 3300046557 Bacteria 2146
637 Ga0495622_0129983 3300046557 Bacteria 1147
638 Ga0495633_0216376 3300046558 Bacteria 877
639 Ga0495667_0004347 3300046559 Bacteria 9564
640 Ga0495667_0363995 3300046559 Bacteria 913
641 Ga0495667_0554829 3300046559 Bacteria 718
642 Ga0495656_0004775 3300046615 Bacteria 4661
643 Ga0495656_0367441 3300046615 Bacteria 748
644 Ga0495668_0152101 3300046616 Bacteria 1267
645 Ga0495668_0293283 3300046616 Bacteria 891
646 Ga0495668_0373889 3300046616 Bacteria 782
647 Ga0495634_0096593 3300046642 Bacteria 1913
648 Ga0495611_0085896 3300046648 Bacteria 1451
649 Ga0495611_0312815 3300046648 Bacteria 723
650 Ga0495625_0402031 3300046660 Bacteria 855
651 Ga0495635_0005285 3300046663 Bacteria 8981
652 Ga0495659_0139259 3300046664 Bacteria 967
653 Ga0495661_0307884 3300046665 Bacteria 791
654 Ga0495588_0028763 3300046674 Bacteria 2784
655 Ga0495588_0119943 3300046674 Bacteria 1386
656 Ga0495657_0005253 3300046675 Bacteria 10251
657 Ga0495657_0422676 3300046675 Bacteria 782
658 Ga0495599_0001083 3300046678 Bacteria 15336
659 Ga0495623_0007253 3300046679 Bacteria 7196
660 Ga0495647_0074254 3300046681 Bacteria 1367
661 Ga0495647_0320033 3300046681 Bacteria 702
662 Ga0495658_0157130 3300046683 Bacteria 1400
663 Ga0495669_0001534 3300046684 Bacteria 9504
664 Ga0495669_0276114 3300046684 Bacteria 808
665 Ga0495613_0004000 3300046689 Bacteria 11027
666 Ga0495624_0073748 3300046690 Bacteria 2121
667 Ga0495670_0284344 3300046691 Bacteria 885
668 Ga0495670_0310804 3300046691 Bacteria 845
669 Ga0495649_0147526 3300046694 Bacteria 1236
670 Ga0495600_0000487 3300046809 Bacteria 20485
671 Ga0495600_0315937 3300046809 Bacteria 983
672 Ga0495581_0092265 3300047315 Bacteria 1758
673 Ga0495604_0001233 3300047317 Bacteria 20969
674 Ga0495604_0254530 3300047317 Bacteria 1196
675 Ga0495636_0181030 3300047318 Bacteria 956
676 Ga0495636_0558833 3300047318 Bacteria 557
677 Ga0495674_0015308 3300047319 Bacteria 7174
678 Ga0495674_0060099 3300047319 Bacteria 3317
679 Ga0495672_0014599 3300047320 Bacteria 5370
680 Ga0495672_0051610 3300047320 Bacteria 2421
681 Ga0495672_0230326 3300047320 Bacteria 910
682 Ga0495672_0241079 3300047320 Bacteria 883
683 Ga0495676_0087913 3300047321 Bacteria 2333
684 Ga0495680_0008167 3300047322 Bacteria 9542
685 Ga0495683_0223624 3300047323 Bacteria 838
686 Ga0495675_0002633 3300047444 Bacteria 10759
687 Ga0495675_0321614 3300047444 Bacteria 915
688 Ga0495677_0116935 3300047445 Bacteria 1016
689 Ga0495685_077874 3300047447 Bacteria 1106
690 Ga0495685_184404 3300047447 Bacteria 672
691 Ga0495673_0065072 3300047469 Bacteria 1549
692 Ga0495673_0117844 3300047469 Bacteria 1054
693 Ga0495673_0136786 3300047469 Bacteria 958
694 Ga0495681_0084054 3300047470 Bacteria 1416
695 Ga0495684_0001401 3300047471 Bacteria 19308
696 Ga0495686_0348203 3300047472 Bacteria 806
697 Ga0495593_0001680 3300047673 Bacteria 13122
698 Ga0495593_0142099 3300047673 Bacteria 1216
699 Ga0495602_0030779 3300048088 Bacteria 5085
700 Ga0495602_0204947 3300048088 Bacteria 1502
701 Ga0495615_0041118 3300048090 Bacteria 1154
702 Ga0495615_0083477 3300048090 Bacteria 880
703 Ga0495626_0068872 3300048091 Bacteria 1595
704 Ga0496100_0033931 3300048903 Bacteria 3197
705 Ga0496100_0161550 3300048903 Bacteria 1606
706 Ga0496101_0024382 3300048904 Bacteria 4186
707 Ga0496101_0031114 3300048904 Bacteria 3749
708 Ga0496101_0227990 3300048904 Bacteria 1447
709 Ga0496101_0594093 3300048904 Bacteria 875
710 Ga0496101_0620153 3300048904 Bacteria 855
711 Ga0496102_0001612 3300048905 Bacteria 19881
712 Ga0496102_0064701 3300048905 Bacteria 3350
713 Ga0496102_0069394 3300048905 Bacteria 3235
714 Ga0496102_0187677 3300048905 Bacteria 1948
715 Ga0496102_0516159 3300048905 Bacteria 1117
716 Ga0496102_0624929 3300048905 Bacteria 1000
717 Ga0496102_1231933 3300048905 Bacteria 668
718 Ga0496103_0013657 3300048906 Bacteria 4818
719 Ga0496103_0205843 3300048906 Bacteria 1265
720 Ga0496103_0311808 3300048906 Bacteria 1012
721 Ga0496103_0557464 3300048906 Bacteria 731
722 Ga0496104_0012979 3300048907 Bacteria 7500
723 Ga0496104_0195365 3300048907 Bacteria 1935
724 Ga0496105_0273503 3300048908 Bacteria 1363
725 Ga0496105_0635032 3300048908 Bacteria 825
726 Ga0496105_0713793 3300048908 Bacteria 769
727 Ga0496106_0057224 3300048909 Bacteria 2948
728 Ga0496106_0099949 3300048909 Bacteria 2249
729 Ga0496106_0228476 3300048909 Bacteria 1485
730 Ga0496106_0251110 3300048909 Bacteria 1414
731 Ga0496107_0061346 3300048910 Bacteria 2722
732 Ga0496107_0072472 3300048910 Bacteria 2504
733 Ga0496107_0095551 3300048910 Bacteria 2174
734 Ga0496107_0170306 3300048910 Bacteria 1616
735 Ga0496107_0665511 3300048910 Bacteria 767
736 Ga0496108_0000424 3300048911 Bacteria 34409
737 Ga0496108_0041859 3300048911 Bacteria 3825
738 Ga0496108_0118214 3300048911 Bacteria 2272
739 Ga0496108_0172612 3300048911 Bacteria 1871
740 Ga0496108_0225954 3300048911 Bacteria 1627
741 Ga0496108_0414968 3300048911 Bacteria 1176
742 Ga0496108_0714847 3300048911 Bacteria 868
743 Ga0496109_0000199 3300048912 Bacteria 59773
744 Ga0496109_0028901 3300048912 Bacteria 4963
745 Ga0496109_0110865 3300048912 Bacteria 2551
746 Ga0496109_0128684 3300048912 Bacteria 2362
747 Ga0496109_0276228 3300048912 Bacteria 1583
748 Ga0496110_0031819 3300048913 Bacteria 4554
749 Ga0496110_0189545 3300048913 Bacteria 1867
750 Ga0496110_0190015 3300048913 Bacteria 1865
751 Ga0496110_0233967 3300048913 Bacteria 1671
752 Ga0496110_0381417 3300048913 Bacteria 1285
753 Ga0496110_0700219 3300048913 Bacteria 914
754 Ga0496111_0029844 3300048914 Bacteria 3874
755 Ga0496111_0064966 3300048914 Bacteria 2648
756 Ga0496111_0378917 3300048914 Bacteria 1046
757 Ga0496111_0471883 3300048914 Bacteria 925
758 Ga0496112_0003500 3300048915 Bacteria 13013
759 Ga0496112_0017223 3300048915 Bacteria 6784
760 Ga0496112_0247730 3300048915 Bacteria 1733
761 Ga0496112_0249036 3300048915 Bacteria 1728
762 Ga0496112_0791295 3300048915 Bacteria 873
763 Ga0496112_0987453 3300048915 Bacteria 762
764 Ga0496113_0049407 3300048916 Bacteria 3132
765 Ga0496113_0160108 3300048916 Bacteria 1779
766 Ga0496113_0189038 3300048916 Bacteria 1634
767 Ga0496114_0001820 3300048917 Bacteria 16179
768 Ga0496114_0018797 3300048917 Bacteria 5592
769 Ga0496114_0026457 3300048917 Bacteria 4750
770 Ga0496114_0177482 3300048917 Bacteria 1859
771 Ga0496114_0284322 3300048917 Bacteria 1459
772 Ga0496114_0390187 3300048917 Bacteria 1233
773 Ga0496114_0566103 3300048917 Bacteria 1003
774 Ga0496114_1269217 3300048917 Bacteria 623
775 Ga0496115_0002305 3300048918 Bacteria 13669
776 Ga0496115_0036050 3300048918 Bacteria 3915
777 Ga0496115_0111547 3300048918 Bacteria 2247
778 Ga0496115_0253139 3300048918 Bacteria 1449
779 Ga0496115_0415070 3300048918 Bacteria 1091
780 Ga0496115_0507715 3300048918 Bacteria 968
781 Ga0496115_0647236 3300048918 Bacteria 836
782 Ga0496116_0057570 3300048919 Bacteria 2540
783 Ga0496117_0240672 3300048920 Bacteria 994
784 Ga0496118_0066690 3300048921 Bacteria 2626
785 Ga0496118_0155574 3300048921 Bacteria 1423
786 Ga0496118_0310390 3300048921 Bacteria 861
787 Ga0496119_0073875 3300048922 Bacteria 1987
788 Ga0496120_0111007 3300048923 Bacteria 1433
789 Ga0496120_0234947 3300048923 Bacteria 869
790 Ga0496121_0000500 3300048924 Bacteria 74914
791 Ga0496121_0054359 3300048924 Bacteria 3346
792 Ga0496121_0243593 3300048924 Bacteria 1251
793 Ga0496121_0295764 3300048924 Bacteria 1101
794 Ga0496121_0299263 3300048924 Bacteria 1092
795 Ga0496121_0483886 3300048924 Bacteria 790
796 Ga0496124_0129635 3300048927 Bacteria 2005
797 Ga0496125_0125184 3300048928 Bacteria 1823
798 Ga0496125_0575795 3300048928 Bacteria 619
799 Ga0496126_0076249 3300048929 Bacteria 2974
800 Ga0496126_0083887 3300048929 Bacteria 2811
801 Ga0496126_0206334 3300048929 Bacteria 1656
802 Ga0496126_0229473 3300048929 Bacteria 1556
803 Ga0496126_0492974 3300048929 Bacteria 980
804 Ga0496126_0569706 3300048929 Bacteria 896
805 Ga0496126_0741113 3300048929 Bacteria 759
806 Ga0495678_064210 3300049459 Bacteria 1368
807 Ga0501042_0384234 3300049578 Bacteria 1017
808 Ga0501046_0116850 3300049580 Bacteria 2033
809 Ga0501067_0339023 3300049583 Bacteria 838
810 nmdc:mga03683_179757_c1 3300050489 Bacteria 965
811 nmdc:mga03n38_45608_c1 3300050490 Bacteria 1931
812 nmdc:mga00v17_34680_c1 3300050491 Bacteria 2353
813 nmdc:mga00v17_66042_c1 3300050491 Bacteria 2233
814 nmdc:mga0yw44_510451_c1 3300050492 Bacteria 816
815 nmdc:mga0yw44_91022_c1 3300050492 Bacteria 1928
816 nmdc:mga0k408_147879_c1 3300050493 Bacteria 1399
817 nmdc:mga06z11_376388_c1 3300050494 Bacteria 853
818 nmdc:mga06z11_445811_c1 3300050494 Bacteria 782
819 nmdc:mga04h51_261948_c1 3300050495 Bacteria 696
820 nmdc:mga07m45_44861_c1 3300050496 Bacteria 2481
821 nmdc:mga06r32_1018147_c1 3300050510 Bacteria 780
822 nmdc:mga08y16_219167_c1 3300050511 Bacteria 1970
823 nmdc:mga08y16_641880_c1 3300050511 Bacteria 1067
824 nmdc:mga0n895_742449_c1 3300050512 Bacteria 975
825 nmdc:mga0n895_86740_c1 3300050512 Bacteria 3127
826 nmdc:mga0rr50_867436_c1 3300050513 Bacteria 770
827 nmdc:mga08x19_451374_c1 3300050514 Bacteria 905
828 nmdc:mga0sz30_336563_c1 3300050516 Bacteria 674
829 Ga0495601_0020502 3300053077 Bacteria 4038
830 Ga0495601_0082022 3300053077 Bacteria 2070
831 Ga0495601_0671328 3300053077 Bacteria 662
832 Ga0495612_0155108 3300053078 Bacteria 998
833 Ga0500610_0177522 3300053079 Bacteria 1046
834 Ga0495655_0090894 3300053083 Bacteria 889
835 Ga0495655_0200153 3300053083 Bacteria 653
836 Ga0495595_0000399 3300053084 Bacteria 16497
837 Ga0495619_0000861 3300053085 Bacteria 19892
838 Ga0495619_0139735 3300053085 Bacteria 1667
839 Ga0495619_0306633 3300053085 Bacteria 1100
840 Ga0495619_0331050 3300053085 Bacteria 1054
841 Ga0500644_0173185 3300053088 Bacteria 879
842 Ga0500646_0047159 3300053090 Bacteria 1232
843 Ga0500583_0161904 3300053092 Bacteria 1114
844 Ga0500583_0164416 3300053092 Bacteria 1105
845 Ga0500641_0110265 3300053096 Bacteria 1184
846 Ga0500556_0210497 3300053104 Bacteria 768
847 Ga0500582_073259 3300053114 Bacteria 1167
848 Ga0500595_002102 3300053119 Bacteria 10177
849 Ga0500642_0403420 3300053130 Bacteria 596
850 Ga0500655_024701 3300053133 Bacteria 1138
851 Ga0500658_0040225 3300053134 Bacteria 1871
852 Ga0500658_0153433 3300053134 Bacteria 1039
853 Ga0500658_0423751 3300053134 Bacteria 608
854 Ga0500568_0005851 3300053139 Bacteria 6268
855 Ga0500577_0149554 3300053142 Bacteria 990
856 Ga0500577_0240137 3300053142 Bacteria 786
857 Ga0500589_250955 3300053147 Bacteria 649
858 Ga0500604_0100537 3300053151 Bacteria 953
859 Ga0500622_0116894 3300053156 Bacteria 1297
860 Ga0500627_0408825 3300053158 Bacteria 577
861 Ga0500634_0231460 3300053161 Bacteria 784
862 Ga0500636_0200039 3300053177 Bacteria 1058
863 Ga0500637_0203807 3300053178 Bacteria 1125
864 Ga0500645_081221 3300053730 Bacteria 925
865 Ga0500645_089071 3300053730 Bacteria 876
866 Ga0587088_123174 3300059508 Bacteria 602
867 2508693698 2508501042 Bacteria 8719808
868 2509146879 2508501128 Bacteria 8613869
869 2723848283 2721755755 Bacteria 8322773
870 2874607504 2874604998 Bacteria 7834745
871 2876809686 2876808645 Bacteria 8824342
872 2879108950 2879099564 Bacteria 10442239
873 2879111010 2879110137 Bacteria 8907982
874 2889037198 2889033259 Bacteria 9099371
875 2903777779 2903768456 Bacteria 9749579
876 2922361338 2922361189 Bacteria 7436256
877 2922371034
878 2932813678 2932809354 Bacteria 9135765
879 2932822354 2932818245 Bacteria 9955613
880 2935620842 2935616580 Bacteria 9032984
881 2935690365 2935684952 Bacteria 9590419
882 2935697312 2935694250 Bacteria 9291695
883 2935717939 2935713505 Bacteria 9608509
884 2935726911 2935722832 Bacteria 9608746
885 2935735681 2935732158 Bacteria 9706831
886 2935745048 2935741537 Bacteria 9707219
887 2935755375 2935750917 Bacteria 9590372
888 2935762118 2935760218 Bacteria 9817913
889 2935811537 2935810662 Bacteria 9401221
890 2935858650 2935855204 Bacteria 9035059
891 2935866928 2935864058 Bacteria 9784707
892 2935877059 2935873716 Bacteria 9632195
893 2935992125 2935984226 Bacteria 8302647
894 2936038119 2936037263 Bacteria 9446081
895 2940561344 2940556831 Bacteria 9590747
896 8006969583 8006964411 Bacteria 8966052
897 8006988777 8006984368 Bacteria 9651211
898 8056675815 8056673599 Bacteria 7871253
899 Ga0495646_0013429
900 JGI24750J21931_1019635
901 JGI24745J21846_1020489
902 JGI24034J26672_10038633
903 JGI25153J46596_10003951
904 Ga0065707_10046658
905 Ga0070658_10393396
906 Ga0070676_10612363
907 Ga0070683_100024943
908 Ga0070683_100548941
909 Ga0070683_100874740
910 Ga0070690_100093356
911 Ga0070670_100406226
912 Ga0068869_100278438
913 Ga0068869_100360192
914 Ga0068869_100671246
915 Ga0070666_10154739
916 Ga0070666_10762167
917 Ga0070680_100193678
918 Ga0070682_100957033
919 Ga0068868_100075229
920 Ga0068868_100222267
921 Ga0068868_100458560
922 Ga0068868_100984209
923 Ga0070660_100025178
924 Ga0070660_100043044
925 Ga0070691_10034993
926 Ga0070661_100338152
927 Ga0070661_100424266
928 Ga0070692_10427248
929 Ga0070668_100021718
930 Ga0070668_100104843
931 Ga0070668_100152408
932 Ga0070668_100278834
933 Ga0070669_100740111
934 Ga0070671_100043185
935 Ga0070671_100202460
936 Ga0070674_100093925
937 Ga0070673_100261911
938 Ga0070673_100320228
939 Ga0070673_100751363
940 Ga0070688_100279065
941 Ga0070659_100137309
942 Ga0070659_100152726
943 Ga0070659_100815326
944 Ga0070667_100190388
945 Ga0070667_100191157
946 Ga0070667_100502426
947 Ga0070703_10063438
948 Ga0070709_10000817
949 Ga0070709_10012504
950 Ga0070709_10021050
951 Ga0070713_100026351
952 Ga0070713_100126310
953 Ga0070710_10003096
954 Ga0070710_10019197
955 Ga0070710_10172467
956 Ga0070701_10199997
957 Ga0070711_100115905
958 Ga0070711_100230838
959 Ga0070711_100515156
960 Ga0070711_101583911
961 Ga0070705_100093439
962 Ga0070705_100508758
963 Ga0070705_101402738
964 Ga0070700_100266596
965 Ga0070694_100240081
966 Ga0070708_100013596
967 Ga0070708_100571725
968 Ga0070663_100027477
969 Ga0070663_100058083
970 Ga0070663_100131423
971 Ga0070678_100011988
972 Ga0070678_100021269
973 Ga0070678_100160789
974 Ga0070678_100380925
975 Ga0070678_100403135
976 Ga0070662_100315079
977 Ga0070662_100513626
978 Ga0070681_10198897
979 Ga0070681_11531506
980 Ga0068867_100060178
981 Ga0068867_101349600
982 Ga0070685_10114948
983 Ga0070707_100342683
984 Ga0070698_100016987
985 Ga0070698_100351396
986 Ga0070699_100837925
987 Ga0070679_100012993
988 Ga0070684_100041016
989 Ga0070684_100214528
990 Ga0070684_101508229
991 Ga0070697_100221948
992 Ga0070697_100465975
993 Ga0070697_100621016
994 Ga0068853_100007746
995 Ga0068853_100041678
996 Ga0068853_100456062
997 Ga0068853_101145147
998 Ga0070672_100105866
999 Ga0070672_100295815
1000 Ga0070672_100380745
1001 Ga0070672_100552654
1002 Ga0070672_100880020
1003 Ga0070686_100954312
1004 Ga0070695_100108405
1005 Ga0070696_100383299
1006 Ga0070665_100029407
1007 Ga0070665_100073236
1008 Ga0070665_100238367
1009 Ga0070665_100479557
1010 Ga0070665_100688288
1011 Ga0070665_100732721
1012 Ga0070665_101127974
1013 Ga0070704_100290739
1014 Ga0068855_100008782
1015 Ga0068855_100098069
1016 Ga0070664_100609713
1017 Ga0070664_101013163
1018 Ga0068857_100022346
1019 Ga0068857_100244177
1020 Ga0068856_100042754
1021 Ga0068856_100135947
1022 Ga0068856_100273371
1023 Ga0068856_100938922
1024 Ga0068856_101449367
1025 Ga0070702_100206718
1026 Ga0070702_100321301
1027 Ga0070702_100609199
1028 Ga0068859_100090841
1029 Ga0068859_100355950
1030 Ga0068859_100524413
1031 Ga0068859_102350041
1032 Ga0068864_100036135
1033 Ga0068864_100998367
1034 Ga0068864_101213222
1035 Ga0068866_10467012
1036 Ga0068866_10521491
1037 Ga0068861_100166778
1038 Ga0068861_100366571
1039 Ga0068861_100492453
1040 Ga0068861_100508393
1041 Ga0068861_101623270
1042 Ga0068861_101633494
1043 Ga0068851_10010974
1044 Ga0068851_10140778
1045 Ga0068851_10147938
1046 Ga0068870_10134745
1047 Ga0068870_10217882
1048 Ga0068870_10394870
1049 Ga0068863_100099688
1050 Ga0068863_100167727
1051 Ga0068858_100399172
1052 Ga0068858_100401783
1053 Ga0068858_100766464
1054 Ga0068858_100938729
1055 Ga0068860_100034021
1056 Ga0068860_100249141
1057 Ga0068860_100474324
1058 Ga0068860_100551767
1059 Ga0068860_101032275
1060 Ga0068860_101043816
1061 Ga0068862_100108344
1062 Ga0068862_100239411
1063 Ga0068862_100246850
1064 Ga0068862_100320036
1065 Ga0068862_100409193
1066 Ga0068862_100782436
1067 Ga0081455_10008353
1068 Ga0081455_10394896
1069 Ga0081540_1003129
1070 Ga0081540_1004018
1071 Ga0081540_1004757
1072 Ga0081540_1100558
1073 Ga0081540_1105575
1074 Ga0081540_1142675
1075 Ga0081539_10060022
1076 Ga0070717_10278583
1077 Ga0070717_10617167
1078 Ga0075365_10128778
1079 Ga0075365_10157671
1080 Ga0075363_100064176
1081 Ga0075364_10091041
1082 Ga0075364_10091590
1083 Ga0070715_10108372
1084 Ga0070715_10241300
1085 Ga0070715_10336296
1086 Ga0070716_100007087
1087 Ga0070716_100906221
1088 Ga0070712_100013773
1089 Ga0070712_100029780
1090 Ga0070712_100055052
1091 Ga0070712_100218149
1092 Ga0070712_100757788
1093 Ga0075362_10054698
1094 Ga0075367_10088221
1095 Ga0075367_10114274
1096 Ga0075367_10138774
1097 Ga0075369_10093363
1098 Ga0075369_10243323
1099 Ga0075366_10259455
1100 Ga0097621_100126302
1101 Ga0097621_100231102
1102 Ga0097621_100728169
1103 Ga0097621_101027710
1104 Ga0075370_10110608
1105 Ga0075370_10181625
1106 Ga0068871_100079952
1107 Ga0068871_100297968
1108 Ga0068871_101193228
1109 Ga0075428_100589500
1110 Ga0075434_100048137
1111 Ga0075434_100224646
1112 Ga0068865_100184520
1113 Ga0068865_100310792
1114 Ga0097620_100090844
1115 Ga0097620_100355958
1116 Ga0097620_100524410
1117 Ga0097620_102350075
1118 Ga0075435_101070424
1119 Ga0099794_10071767
1120 Ga0099794_10365028
1121 Ga0099795_10013387
1122 Ga0099795_10030306
1123 Ga0099795_10642456
1124 Ga0105250_10080541
1125 Ga0105240_10004088
1126 Ga0105240_10187100
1127 Ga0105240_10190989
1128 Ga0105240_10280133
1129 Ga0111539_10129515
1130 Ga0111539_10189586
1131 Ga0105245_10490352
1132 Ga0105245_12266888
1133 Ga0105247_10112923
1134 Ga0114129_10350452
1135 Ga0114129_11395407
1136 Ga0114129_11610186
1137 Ga0105243_10151274
1138 Ga0105243_10179192
1139 Ga0105243_11168216
1140 Ga0105241_10980499
1141 Ga0105242_10364695
1142 Ga0105248_10468128
1143 Ga0105248_11331226
1144 Ga0105237_10966062
1145 Ga0105238_10038422
1146 Ga0105249_10030460
1147 Ga0105249_10032133
1148 Ga0105249_10250058
1149 Ga0105249_11550756
1150 Ga0099796_10006193
1151 Ga0099796_10014784
1152 Ga0099796_10038162
1153 Ga0099796_10123512
1154 Ga0105239_10062429
1155 Ga0105239_10089688
1156 Ga0105239_10282615
1157 Ga0105246_10221367
1158 Ga0105246_10438931
1159 Ga0157373_10206760
1160 Ga0157370_10122806
1161 Ga0157369_10004274
1162 Ga0157374_10228113
1163 Ga0157378_10405697
1164 Ga0157378_10575962
1165 Ga0157378_10788904
1166 Ga0157378_10926101
1167 Ga0157378_11539372
1168 Ga0163162_10012112
1169 Ga0163162_10100329
1170 Ga0163162_10285720
1171 Ga0157375_10048277
1172 Ga0157375_10125656
1173 Ga0157375_10330697
1174 Ga0157375_10449504
1175 Ga0157375_10706569
1176 Ga0157375_11051065
1177 Ga0163163_10048880
1178 Ga0163163_10093691
1179 Ga0163163_10293338
1180 Ga0163163_11249462
1181 Ga0163163_11828606
1182 Ga0157380_10229726
1183 Ga0157380_10247869
1184 Ga0157380_10868938
1185 Ga0157380_11969630
1186 Ga0157377_10350939
1187 Ga0157379_10007175
1188 Ga0157379_10036753
1189 Ga0157379_10504960
1190 Ga0157379_10923990
1191 Ga0157376_10006597
1192 Ga0157376_10270967
1193 Ga0157376_10635686
1194 Ga0157376_10990630
1195 Ga0182007_10120845
1196 Ga0163161_10196006
1197 Ga0163161_10288846
1198 Ga0163161_10445773
1199 Ga0163161_11496653
1200 Ga0213875_10008646
1201 Ga0209758_1007842
1202 Ga0207697_10039132
1203 Ga0207697_10048136
1204 Ga0207692_10009574
1205 Ga0207692_10044136
1206 Ga0207692_10383180
1207 Ga0207642_10110687
1208 Ga0207642_10396375
1209 Ga0207642_10642810
1210 Ga0207710_10041818
1211 Ga0207710_10213910
1212 Ga0207710_10216696
1213 Ga0207710_10319490
1214 Ga0207710_10393794
1215 Ga0207688_10119566
1216 Ga0207688_10245720
1217 Ga0207680_10074988
1218 Ga0207680_10478570
1219 Ga0207647_10154974
1220 Ga0207647_10328768
1221 Ga0207699_10005610
1222 Ga0207699_10068562
1223 Ga0207699_10149853
1224 Ga0207699_10872589
1225 Ga0207645_10061305
1226 Ga0207645_10272156
1227 Ga0207643_10106529
1228 Ga0207643_10362148
1229 Ga0207643_10519647
1230 Ga0207705_10062361
1231 Ga0207654_10109703
1232 Ga0207654_10627437
1233 Ga0207707_10038869
1234 Ga0207695_10026167
1235 Ga0207695_10363649
1236 Ga0207671_10159187
1237 Ga0207693_10017508
1238 Ga0207693_10022416
1239 Ga0207693_10031207
1240 Ga0207693_10307180
1241 Ga0207663_10000481
1242 Ga0207663_10045948
1243 Ga0207663_10128503
1244 Ga0207663_10407903
1245 Ga0207660_10040990
1246 Ga0207662_10060332
1247 Ga0207657_10005699
1248 Ga0207657_10080434
1249 Ga0207649_10350708
1250 Ga0207652_10688091
1251 Ga0207652_10733306
1252 Ga0207646_10423184
1253 Ga0207681_10485202
1254 Ga0207681_10505290
1255 Ga0207694_10005588
1256 Ga0207694_10760584
1257 Ga0207650_10617587
1258 Ga0207659_10127146
1259 Ga0207659_10208986
1260 Ga0207659_10475237
1261 Ga0207687_10033929
1262 Ga0207687_10349662
1263 Ga0207687_10811163
1264 Ga0207700_10130608
1265 Ga0207700_10186281
1266 Ga0207700_10618597
1267 Ga0207664_10013072
1268 Ga0207644_10119460
1269 Ga0207644_10894962
1270 Ga0207644_11063693
1271 Ga0207706_10044659
1272 Ga0207706_10157989
1273 Ga0207706_10646261
1274 Ga0207706_10901935
1275 Ga0207686_10054501
1276 Ga0207686_10316261
1277 Ga0207686_10505448
1278 Ga0207686_11066399
1279 Ga0207709_10085816
1280 Ga0207670_10157921
1281 Ga0207669_10050724
1282 Ga0207669_10240273
1283 Ga0207704_10355667
1284 Ga0207665_10009371
1285 Ga0207665_10100266
1286 Ga0207691_10310999
1287 Ga0207691_10611175
1288 Ga0207691_10707210
1289 Ga0207691_10954395
1290 Ga0207691_11465646
1291 Ga0207711_10221138
1292 Ga0207711_10473743
1293 Ga0207711_10808231
1294 Ga0207689_10016426
1295 Ga0207689_10046080
1296 Ga0207689_10068815
1297 Ga0207661_10286297
1298 Ga0207661_10596878
1299 Ga0207679_10188718
1300 Ga0207679_10605314
1301 Ga0207667_10161632
1302 Ga0207667_10953690
1303 Ga0207651_10124148
1304 Ga0207651_10245077
1305 Ga0207651_10255618
1306 Ga0207712_10790372
1307 Ga0207668_10044587
1308 Ga0207668_10057553
1309 Ga0207668_10111419
1310 Ga0207668_10258963
1311 Ga0207668_10906881
1312 Ga0207640_10545672
1313 Ga0207658_10719309
1314 Ga0207677_10157482
1315 Ga0207677_10447289
1316 Ga0207677_10871205
1317 Ga0207703_10176117
1318 Ga0207703_10384165
1319 Ga0207703_10849148
1320 Ga0207703_11111754
1321 Ga0207703_11239277
1322 Ga0207703_12103474
1323 Ga0207639_10044620
1324 Ga0207639_11467250
1325 Ga0207678_10011034
1326 Ga0207678_10118095
1327 Ga0207678_10141918
1328 Ga0207678_11438261
1329 Ga0207708_10034360
1330 Ga0207708_10294267
1331 Ga0207708_10764917
1332 Ga0207702_10029332
1333 Ga0207702_10041616
1334 Ga0207702_10273688
1335 Ga0207702_10595520
1336 Ga0207702_11249258
1337 Ga0207641_11125878
1338 Ga0207648_10042364
1339 Ga0207676_10289587
1340 Ga0207676_10366407
1341 Ga0207676_10980969
1342 Ga0207674_10007221
1343 Ga0207674_10159032
1344 Ga0207674_10252745
1345 Ga0207675_100218073
1346 Ga0207675_101145503
1347 Ga0207683_10008843
1348 Ga0207683_10362585
1349 Ga0207683_10392926
1350 Ga0207683_10827780
1351 Ga0207698_10316334
1352 Ga0207698_10620526
1353 Ga0209179_1035400
1354 Ga0209588_1001423
1355 Ga0209813_10233068
1356 Ga0207428_10107201
1357 Ga0207428_10352334
1358 Ga0268266_10004005
1359 Ga0268266_10293572
1360 Ga0268266_10438311
1361 Ga0268266_10642500
1362 Ga0268265_10067880
1363 Ga0268265_10160980
1364 Ga0268265_10260535
1365 Ga0268265_10316393
1366 Ga0268265_10409688
1367 Ga0268264_10236071
1368 Ga0268264_10642701
1369 Ga0268264_11051345
1370 Ga0268264_11182114
1371 Ga0265319_1037075
1372 Ga0265334_10019489
1373 Ga0265336_10001725
1374 Ga0307517_10000248
1375 Ga0307517_10332189
1376 Ga0307515_10140854
1377 Ga0307515_10512895
1378 Ga0265338_10008662
1379 Ga0265324_10079547
1380 Ga0265330_10061590
1381 Ga0265330_10131280
1382 Ga0265330_10185669
1383 Ga0265330_10278236
1384 Ga0265332_10038128
1385 Ga0265332_10064108
1386 Ga0265325_10086747
1387 Ga0265340_10136329
1388 Ga0265339_10004338
1389 Ga0265339_10115554
1390 Ga0265339_10478512
1391 Ga0307513_10270208
1392 Ga0307509_10411751
1393 Ga0307509_10779188
1394 Ga0265314_10057845
1395 Ga0265342_10041932
1396 Ga0307516_10164494
1397 Ga0307516_10395510
1398 Ga0307405_10977315
1399 Ga0307406_11347614
1400 Ga0307407_10331170
1401 Ga0307412_10146219
1402 Ga0307409_100338349
1403 Ga0307409_101027102
1404 Ga0307409_101274119
1405 Ga0307416_100963673
1406 Ga0307414_10461120
1407 Ga0307411_10510868
1408 Ga0307415_100154081
1409 Ga0307415_100626929
1410 Ga0307510_10018694
1411 Ga0307510_10069821
1412 Ga0316215_1002965
1413 Ga0373930_0140650
1414 Ga0373959_0016096
1415 Ga0373928_0053661
1416 Ga0373934_0000914
1417 Ga0373952_0035856
1418 Ga0373923_0008141
1419 Ga0373936_0445800
1420 Ga0373953_0000596
1421 Ga0373953_0078198
1422 Ga0373954_0001095
1423 Ga0373956_0005630
1424 Ga0373957_0001877
1425 Ga0373943_0042392
1426 Ga0373946_0670533
1427 Ga0373955_0001814
1428 Ga0373961_0060243
1429 Ga0373962_0111007
1430 Ga0373924_0000963
1431 Ga0373924_0270453
1432 Ga0373924_0416518
1433 Ga0373931_0740985
1434 Ga0373935_0393999
1435 Ga0373927_0010102
1436 Ga0373927_0029648
1437 Ga0373927_0043019
1438 Ga0373927_0070175
1439 Ga0373933_0003252
1440 Ga0373933_0946210
1441 Ga0373947_0008005
1442 Ga0373947_0258533
1443 Ga0373937_0005268
1444 Ga0373937_0216129
1445 Ga0373937_0421529
1446 Ga0373925_0029655
1447 Ga0373925_0610571
1448 Ga0395900_0006895
1449 Ga0395900_0765787
1450 Ga0395900_0782128
1451 Ga0395898_0143548
1452 Ga0395898_0313324
1453 Ga0395898_1006332
1454 Ga0436364_0577167
1455 Ga0436364_0860093
1456 Ga0395901_0136961
1457 Ga0395901_0250742
1458 Ga0395901_1694026
1459 Ga0436365_0900431
1460 Ga0436365_1910270
1461 Ga0439465_0109031
1462 Ga0451787_501728
1463 Ga0451800_1136385
1464 Ga0451802_1150291
1465 Ga0451845_0736930
1466 Ga0439459_0139718
1467 Ga0466966_0016435
1468 Ga0466966_0378676
1469 Ga0466963_0089506
1470 Ga0466964_0067024
1471 Ga0466957_0044279
1472 Ga0451576_0683241
1473 Ga0466967_0063879
1474 Ga0495617_069809
1475 Ga0495592_0005044
1476 Ga0495603_0043056
1477 Ga0495603_0043234
1478 Ga0495590_0197515
1479 Ga0495591_081842
1480 Ga0495629_0001194
1481 Ga0495629_0159553
1482 Ga0495629_0282206
1483 Ga0495629_0509240
1484 Ga0495638_0120048
1485 Ga0495638_0460106
1486 Ga0495651_0006142
1487 Ga0495651_0049814
1488 Ga0495653_0001332
1489 Ga0495650_0141849
1490 Ga0495580_0037554
1491 Ga0495605_0054057
1492 Ga0495605_0148663
1493 Ga0495605_0310064
1494 Ga0495639_0135731
1495 Ga0495639_0187567
1496 Ga0495664_0402988
1497 Ga0495584_0182408
1498 Ga0495585_0138227
1499 Ga0495585_0310037
1500 Ga0495594_0136668
1501 Ga0495594_0655583
1502 Ga0495596_0192214
1503 Ga0495607_0225191
1504 Ga0495607_0280866
1505 Ga0495583_0105991
1506 Ga0495583_0246557
1507 Ga0495606_0179948
1508 Ga0495606_0467591
1509 Ga0495608_0007821
1510 Ga0495616_0424687
1511 Ga0495618_0020965
1512 Ga0495620_0085438
1513 Ga0495620_0167978
1514 Ga0495628_0100373
1515 Ga0495631_0072562
1516 Ga0495632_0113736
1517 Ga0495632_0409942
1518 Ga0495644_0179212
1519 Ga0495648_0097331
1520 Ga0495663_0070919
1521 Ga0495642_0159179
1522 Ga0495652_0005875
1523 Ga0495652_0141301
1524 Ga0495652_0479693
1525 Ga0495640_0009106
1526 Ga0495587_0004179
1527 Ga0495609_0126800
1528 Ga0495609_0150500
1529 Ga0495621_0016134
1530 Ga0495621_0373550
1531 Ga0495597_0192329
1532 Ga0495645_0031272
1533 Ga0495645_0421778
1534 Ga0495622_0041263
1535 Ga0495622_0129983
1536 Ga0495633_0216376
1537 Ga0495667_0004347
1538 Ga0495667_0363995
1539 Ga0495667_0554829
1540 Ga0495656_0004775
1541 Ga0495656_0367441
1542 Ga0495668_0152101
1543 Ga0495668_0293283
1544 Ga0495668_0373889
1545 Ga0495634_0096593
1546 Ga0495611_0085896
1547 Ga0495611_0312815
1548 Ga0495625_0402031
1549 Ga0495635_0005285
1550 Ga0495659_0139259
1551 Ga0495661_0307884
1552 Ga0495588_0028763
1553 Ga0495588_0119943
1554 Ga0495657_0005253
1555 Ga0495657_0422676
1556 Ga0495599_0001083
1557 Ga0495623_0007253
1558 Ga0495647_0074254
1559 Ga0495647_0320033
1560 Ga0495658_0157130
1561 Ga0495669_0001534
1562 Ga0495669_0276114
1563 Ga0495613_0004000
1564 Ga0495624_0073748
1565 Ga0495670_0284344
1566 Ga0495670_0310804
1567 Ga0495649_0147526
1568 Ga0495600_0000487
1569 Ga0495600_0315937
1570 Ga0495581_0092265
1571 Ga0495604_0001233
1572 Ga0495604_0254530
1573 Ga0495636_0181030
1574 Ga0495636_0558833
1575 Ga0495674_0015308
1576 Ga0495674_0060099
1577 Ga0495672_0014599
1578 Ga0495672_0051610
1579 Ga0495672_0230326
1580 Ga0495672_0241079
1581 Ga0495676_0087913
1582 Ga0495680_0008167
1583 Ga0495683_0223624
1584 Ga0495675_0002633
1585 Ga0495675_0321614
1586 Ga0495677_0116935
1587 Ga0495685_077874
1588 Ga0495685_184404
1589 Ga0495673_0065072
1590 Ga0495673_0117844
1591 Ga0495673_0136786
1592 Ga0495681_0084054
1593 Ga0495684_0001401
1594 Ga0495686_0348203
1595 Ga0495593_0001680
1596 Ga0495593_0142099
1597 Ga0495602_0030779
1598 Ga0495602_0204947
1599 Ga0495615_0041118
1600 Ga0495615_0083477
1601 Ga0495626_0068872
1602 Ga0496100_0033931
1603 Ga0496100_0161550
1604 Ga0496101_0024382
1605 Ga0496101_0031114
1606 Ga0496101_0227990
1607 Ga0496101_0594093
1608 Ga0496101_0620153
1609 Ga0496102_0001612
1610 Ga0496102_0064701
1611 Ga0496102_0069394
1612 Ga0496102_0187677
1613 Ga0496102_0516159
1614 Ga0496102_0624929
1615 Ga0496102_1231933
1616 Ga0496103_0013657
1617 Ga0496103_0205843
1618 Ga0496103_0311808
1619 Ga0496103_0557464
1620 Ga0496104_0012979
1621 Ga0496104_0195365
1622 Ga0496105_0273503
1623 Ga0496105_0635032
1624 Ga0496105_0713793
1625 Ga0496106_0057224
1626 Ga0496106_0099949
1627 Ga0496106_0228476
1628 Ga0496106_0251110
1629 Ga0496107_0061346
1630 Ga0496107_0072472
1631 Ga0496107_0095551
1632 Ga0496107_0170306
1633 Ga0496107_0665511
1634 Ga0496108_0000424
1635 Ga0496108_0041859
1636 Ga0496108_0118214
1637 Ga0496108_0172612
1638 Ga0496108_0225954
1639 Ga0496108_0414968
1640 Ga0496108_0714847
1641 Ga0496109_0000199
1642 Ga0496109_0028901
1643 Ga0496109_0110865
1644 Ga0496109_0128684
1645 Ga0496109_0276228
1646 Ga0496110_0031819
1647 Ga0496110_0189545
1648 Ga0496110_0190015
1649 Ga0496110_0233967
1650 Ga0496110_0381417
1651 Ga0496110_0700219
1652 Ga0496111_0029844
1653 Ga0496111_0064966
1654 Ga0496111_0378917
1655 Ga0496111_0471883
1656 Ga0496112_0003500
1657 Ga0496112_0017223
1658 Ga0496112_0247730
1659 Ga0496112_0249036
1660 Ga0496112_0791295
1661 Ga0496112_0987453
1662 Ga0496113_0049407
1663 Ga0496113_0160108
1664 Ga0496113_0189038
1665 Ga0496114_0001820
1666 Ga0496114_0018797
1667 Ga0496114_0026457
1668 Ga0496114_0177482
1669 Ga0496114_0284322
1670 Ga0496114_0390187
1671 Ga0496114_0566103
1672 Ga0496114_1269217
1673 Ga0496115_0002305
1674 Ga0496115_0036050
1675 Ga0496115_0111547
1676 Ga0496115_0253139
1677 Ga0496115_0415070
1678 Ga0496115_0507715
1679 Ga0496115_0647236
1680 Ga0496116_0057570
1681 Ga0496117_0240672
1682 Ga0496118_0066690
1683 Ga0496118_0155574
1684 Ga0496118_0310390
1685 Ga0496119_0073875
1686 Ga0496120_0111007
1687 Ga0496120_0234947
1688 Ga0496121_0000500
1689 Ga0496121_0054359
1690 Ga0496121_0243593
1691 Ga0496121_0295764
1692 Ga0496121_0299263
1693 Ga0496121_0483886
1694 Ga0496124_0129635
1695 Ga0496125_0125184
1696 Ga0496125_0575795
1697 Ga0496126_0076249
1698 Ga0496126_0083887
1699 Ga0496126_0206334
1700 Ga0496126_0229473
1701 Ga0496126_0492974
1702 Ga0496126_0569706
1703 Ga0496126_0741113
1704 Ga0495678_064210
1705 Ga0501042_0384234
1706 Ga0501046_0116850
1707 Ga0501067_0339023
1708 nmdc:mga03683_179757_c1
1709 nmdc:mga03n38_45608_c1
1710 nmdc:mga00v17_34680_c1
1711 nmdc:mga00v17_66042_c1
1712 nmdc:mga0yw44_510451_c1
1713 nmdc:mga0yw44_91022_c1
1714 nmdc:mga0k408_147879_c1
1715 nmdc:mga06z11_376388_c1
1716 nmdc:mga06z11_445811_c1
1717 nmdc:mga04h51_261948_c1
1718 nmdc:mga07m45_44861_c1
1719 nmdc:mga06r32_1018147_c1
1720 nmdc:mga08y16_219167_c1
1721 nmdc:mga08y16_641880_c1
1722 nmdc:mga0n895_742449_c1
1723 nmdc:mga0n895_86740_c1
1724 nmdc:mga0rr50_867436_c1
1725 nmdc:mga08x19_451374_c1
1726 nmdc:mga0sz30_336563_c1
1727 Ga0495601_0020502
1728 Ga0495601_0082022
1729 Ga0495601_0671328
1730 Ga0495612_0155108
1731 Ga0500610_0177522
1732 Ga0495655_0090894
1733 Ga0495655_0200153
1734 Ga0495595_0000399
1735 Ga0495619_0000861
1736 Ga0495619_0139735
1737 Ga0495619_0306633
1738 Ga0495619_0331050
1739 Ga0500644_0173185
1740 Ga0500646_0047159
1741 Ga0500583_0161904
1742 Ga0500583_0164416
1743 Ga0500641_0110265
1744 Ga0500556_0210497
1745 Ga0500582_073259
1746 Ga0500595_002102
1747 Ga0500642_0403420
1748 Ga0500655_024701
1749 Ga0500658_0040225
1750 Ga0500658_0153433
1751 Ga0500658_0423751
1752 Ga0500568_0005851
1753 Ga0500577_0149554
1754 Ga0500577_0240137
1755 Ga0500589_250955
1756 Ga0500604_0100537
1757 Ga0500622_0116894
1758 Ga0500627_0408825
1759 Ga0500634_0231460
1760 Ga0500636_0200039
1761 Ga0500637_0203807
1762 Ga0500645_081221
1763 Ga0500645_089071
1764 Ga0587088_123174
1765 2508693698
1766 2509146879
1767 2723848283
1768 2874607504
1769 2876809686
1770 2879108950
1771 2879111010
1772 2889037198
1773 2903777779
1774 2922361338
1775 2922371034
1776 2932813678
1777 2932822354
1778 2935620842
1779 2935690365
1780 2935697312
1781 2935717939
1782 2935726911
1783 2935735681
1784 2935745048
1785 2935755375
1786 2935762118
1787 2935811537
1788 2935858650
1789 2935866928
1790 2935877059
1791 2935992125
1792 2936038119
1793 2940561344
1794 8006969583
1795 8006988777
1796 8056675815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

4

106

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.8912 4 157
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.8896 1 157
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.8867 1 157
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.879 1 157
2vup-assembly1.cif.gz_A crystal structure of a type ii tryparedoxin-dependant peroxidase from trypanosoma brucei 0.8784 1 157
ID Description Score Start End Superfamily
af_A8WFK6_20_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.895 1 157 3.40.30.10
af_Q7FS88_1_175_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8918 1 158 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8893 3 157 3.40.30.10
af_Q7FS88_1_175_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8865 1 158 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.886 1 158 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1V9XLZ4-F1-model_v4 Glutathione peroxidase 0.9002 1 157 GO:0004602
GO:0006979
AF-A0A183UEA8-F1-model_v4 Glutathione peroxidase 0.8999 2 157 GO:0003729
GO:0004601
GO:0005730
GO:0006979
AF-A0A077WXL2-F1-model_v4 Glutathione peroxidase 0.8995 3 158 GO:0034599
GO:0140824
AF-A0A835G3A4-F1-model_v4 Glutathione peroxidase 0.8994 3 158 GO:0004601
GO:0034599
AF-A0A1L3RXL4-F1-model_v4 deleted 0.8994 1 158

Map