F485053

General Info

Members Datasets Scaffolds Average Seq Length
897 394 871 152

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0072851|Ga0495668_0072851_252_788
Length 178
Sequence MSASAPKVRARSRRFSNDLQGEAETMDLILWRHAEASELEGAGDDLERALTPKGERQAQRMGEWLNQRLAHSTRILVSPALRCQQTAKALGRKFKTLPELAPDGNGESLLKAARWPDANEPVLVIGHQPTLGLVAAYLLSDTPQPWTIKKGAVWWIRSRNREDQAQVVLQAVQSPDCL

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2547132512 Azospira oryzae 6a3 Isolate Unclassified
5 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2643221660 Methylibium sp. Root1272 Isolate Unclassified
9 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
10 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
11 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
12 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
13 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
14 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
15 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
16 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
17 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
18 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
19 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
20 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
21 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
22 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
23 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
24 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
25 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
26 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
27 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
28 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
29 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
30 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
157 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
166 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
167 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
170 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
231 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
236 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
239 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
240 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
241 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
242 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
255 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
256 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
257 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
258 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
259 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
260 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
261 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
272 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
273 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
274 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
277 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
278 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
279 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
280 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
287 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
299 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
300 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
301 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
302 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
303 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
307 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
308 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
309 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
310 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
321 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
322 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
323 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
324 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
329 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
346 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
347 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
351 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
352 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
353 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
368 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
369 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
374 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
381 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
382 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
383 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
384 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
385 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
386 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
387 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
388 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
389 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
390 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.83
Nodule 0.56
Rhizoplane 2.45
Rhizosphere 71.01
Stem 0
Stem Tuber 0
Unclassified 11.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000552 3300002704 Bacteria 8473
2 JGI25156J39149_1000459 3300002705 Bacteria 24817
3 JGI25156J39149_1001026 3300002705 Bacteria 13042
4 JGI25156J39149_1002927 3300002705 Bacteria 5814
5 JGI25156J39149_1020328 3300002705 Bacteria 1171
6 JGI25162J39368_1010430 3300002737 Bacteria 1175
7 JGI25154J39366_1000871 3300002738 Bacteria 13042
8 JGI25154J39366_1000911 3300002738 Bacteria 12467
9 JGI25154J39366_1001802 3300002738 Bacteria 6715
10 JGI25157J39369_1000021 3300002741 Bacteria 163907
11 JGI25157J39369_1001256 3300002741 Bacteria 10403
12 JGI25164J39214_1005040 3300002772 Bacteria 1461
13 rootH1_10015810 3300003316 Bacteria 1931
14 rootH1_10015810 3300003323 Bacteria 19240
15 rootH1_10028438 3300003316 Bacteria 4544
16 rootH1_10028438 3300003323 Bacteria 1649
17 rootH1_10033518 3300003316 Bacteria 1211
18 rootH1_10042308 3300003316 Bacteria 1474
19 rootH2_10019687 3300003320 Bacteria 1609
20 rootH1_10021003 3300003323 Bacteria 1397
21 rootH1_10072734 3300003323 Bacteria 1364
22 rootH1_10085156 3300003323 Bacteria 1281
23 Ga0055538_1000013 3300003751 Bacteria 348596
24 Ga0055539_1000018 3300003752 Bacteria 348596
25 Ga0055539_1000422 3300003752 Bacteria 15528
26 Ga0055539_1006291 3300003752 Bacteria 1519
27 Ga0055539_1007357 3300003752 Bacteria 1394
28 Ga0055533_1000022 3300003756 Bacteria 348596
29 Ga0055533_1000033 3300003756 Bacteria 265716
30 Ga0055532_1000017 3300003758 Bacteria 306880
31 Ga0055525_1000024 3300003759 Bacteria 348596
32 Ga0055525_1001360 3300003759 Bacteria 4732
33 Ga0055535_1001037 3300003761 Bacteria 17524
34 Ga0055529_1000860 3300003763 Bacteria 17524
35 Ga0055540_1098486 3300003792 Bacteria 547
36 Ga0055531_10000303 3300003794 Bacteria 48725
37 Ga0055541_1000013 3300003841 Bacteria 348596
38 Ga0070658_10055065 3300005327 Bacteria 3231
39 Ga0070658_10159526 3300005327 Bacteria 1892
40 Ga0070658_10334405 3300005327 Bacteria 1295
41 Ga0070658_10546180 3300005327 Bacteria 1003
42 Ga0070658_10690884 3300005327 Bacteria 885
43 Ga0070676_10006846 3300005328 Bacteria 6103
44 Ga0070676_10031112 3300005328 Bacteria 3047
45 Ga0070683_100052816 3300005329 Bacteria 3766
46 Ga0070690_100258225 3300005330 Bacteria 1235
47 Ga0070690_100884353 3300005330 Bacteria 698
48 Ga0070670_100001932 3300005331 Bacteria 16972
49 Ga0070670_100016141 3300005331 Bacteria 6410
50 Ga0070670_100030522 3300005331 Bacteria 4641
51 Ga0070670_100043467 3300005331 Bacteria 3862
52 Ga0070670_100247824 3300005331 Bacteria 1551
53 Ga0070670_100413575 3300005331 Bacteria 1191
54 Ga0070670_100454897 3300005331 Bacteria 1135
55 Ga0070670_100565065 3300005331 Bacteria 1016
56 Ga0070677_10250943 3300005333 Bacteria 878
57 Ga0068869_100002015 3300005334 Bacteria 12211
58 Ga0068869_100009386 3300005334 Bacteria 6347
59 Ga0068869_100270562 3300005334 Bacteria 1363
60 Ga0068869_100280540 3300005334 Bacteria 1340
61 Ga0068869_100866308 3300005334 Bacteria 780
62 Ga0068869_100914381 3300005334 Bacteria 760
63 Ga0070666_10118688 3300005335 Bacteria 1833
64 Ga0070666_10578781 3300005335 Bacteria 818
65 Ga0070666_10716842 3300005335 Unclassified 734
66 Ga0070680_100951768 3300005336 Unclassified 741
67 Ga0068868_100009443 3300005338 Bacteria 7021
68 Ga0068868_100035076 3300005338 Bacteria 3876
69 Ga0068868_100637045 3300005338 Bacteria 948
70 Ga0068868_101715614 3300005338 Bacteria 592
71 Ga0070660_100008023 3300005339 Bacteria 7379
72 Ga0070660_100341540 3300005339 Bacteria 1232
73 Ga0070689_100078740 3300005340 Bacteria 2584
74 Ga0070687_100358331 3300005343 Bacteria 943
75 Ga0070661_100001088 3300005344 Bacteria 19203
76 Ga0070661_100248558 3300005344 Bacteria 1372
77 Ga0070661_100394804 3300005344 Bacteria 1093
78 Ga0070661_100552539 3300005344 Unclassified 926
79 Ga0070661_100885046 3300005344 Bacteria 736
80 Ga0070692_10004158 3300005345 Bacteria 5995
81 Ga0070668_100020530 3300005347 Bacteria 4987
82 Ga0070668_100329391 3300005347 Bacteria 1287
83 Ga0070668_100743087 3300005347 Bacteria 868
84 Ga0070669_100022076 3300005353 Bacteria 4553
85 Ga0070669_100113789 3300005353 Bacteria 2056
86 Ga0070675_100004356 3300005354 Bacteria 10791
87 Ga0070675_100013239 3300005354 Bacteria 6483
88 Ga0070675_100069593 3300005354 Bacteria 2916
89 Ga0070671_100348620 3300005355 Bacteria 1263
90 Ga0070674_100226733 3300005356 Bacteria 1456
91 Ga0070673_100020834 3300005364 Bacteria 4738
92 Ga0070673_100081701 3300005364 Bacteria 2621
93 Ga0070673_100093732 3300005364 Bacteria 2460
94 Ga0070673_100838826 3300005364 Bacteria 850
95 Ga0070673_101116476 3300005364 Bacteria 737
96 Ga0070688_100157273 3300005365 Bacteria 1559
97 Ga0070688_100163550 3300005365 Bacteria 1531
98 Ga0070688_100849343 3300005365 Bacteria 717
99 Ga0070659_100005381 3300005366 Bacteria 9188
100 Ga0070659_100189414 3300005366 Bacteria 1690
101 Ga0070659_100311689 3300005366 Bacteria 1314
102 Ga0070667_100003099 3300005367 Bacteria 14303
103 Ga0070667_100012027 3300005367 Bacteria 7164
104 Ga0070667_100025446 3300005367 Bacteria 4920
105 Ga0070667_100176479 3300005367 Bacteria 1888
106 Ga0070667_100783023 3300005367 Unclassified 885
107 Ga0070714_100002739 3300005435 Bacteria 12979
108 Ga0070700_100018494 3300005441 Bacteria 4006
109 Ga0070700_100306428 3300005441 Bacteria 1161
110 Ga0070694_100018628 3300005444 Bacteria 4408
111 Ga0070663_100085402 3300005455 Bacteria 2329
112 Ga0070663_100426950 3300005455 Bacteria 1088
113 Ga0070678_100113175 3300005456 Bacteria 2127
114 Ga0070678_100233511 3300005456 Bacteria 1534
115 Ga0070678_100593398 3300005456 Bacteria 988
116 Ga0070678_101830431 3300005456 Bacteria 573
117 Ga0070662_100010527 3300005457 Bacteria 6074
118 Ga0070662_100247329 3300005457 Bacteria 1432
119 Ga0070662_101459081 3300005457 Bacteria 590
120 Ga0070681_10034748 3300005458 Bacteria 5062
121 Ga0068867_100001409 3300005459 Bacteria 16608
122 Ga0068867_100013331 3300005459 Bacteria 5823
123 Ga0068867_100059713 3300005459 Bacteria 2827
124 Ga0068867_100109452 3300005459 Bacteria 2121
125 Ga0068867_100144721 3300005459 Bacteria 1861
126 Ga0068867_100236681 3300005459 Bacteria 1479
127 Ga0068867_100840446 3300005459 Bacteria 822
128 Ga0070685_10994582 3300005466 Bacteria 629
129 Ga0070706_100014174 3300005467 Bacteria 7365
130 Ga0070707_100032795 3300005468 Bacteria 4949
131 Ga0070679_100029666 3300005530 Bacteria 5396
132 Ga0070684_100006747 3300005535 Bacteria 8901
133 Ga0070684_101032662 3300005535 Unclassified 772
134 Ga0068853_100022449 3300005539 Bacteria 5270
135 Ga0068853_101224347 3300005539 Bacteria 725
136 Ga0070672_100001918 3300005543 Bacteria 13046
137 Ga0070672_100007461 3300005543 Bacteria 7422
138 Ga0070672_100037415 3300005543 Bacteria 3702
139 Ga0070672_100296542 3300005543 Bacteria 1370
140 Ga0070686_100000934 3300005544 Bacteria 16821
141 Ga0070665_100125079 3300005548 Bacteria 2573
142 Ga0070665_100176305 3300005548 Bacteria 2139
143 Ga0070665_100651882 3300005548 Bacteria 1066
144 Ga0070665_100797218 3300005548 Bacteria 958
145 Ga0070665_100849149 3300005548 Unclassified 926
146 Ga0068855_100000899 3300005563 Bacteria 36852
147 Ga0068855_100009898 3300005563 Bacteria 11499
148 Ga0068855_100026654 3300005563 Bacteria 6915
149 Ga0068855_100041346 3300005563 Bacteria 5464
150 Ga0068855_100129571 3300005563 Bacteria 2882
151 Ga0068855_100290538 3300005563 Bacteria 1812
152 Ga0068855_101784564 3300005563 Bacteria 625
153 Ga0068855_102205600 3300005563 Unclassified 553
154 Ga0068855_102490390 3300005563 Unclassified 515
155 Ga0070664_100012427 3300005564 Bacteria 6919
156 Ga0070664_100051593 3300005564 Bacteria 3482
157 Ga0068857_100013188 3300005577 Bacteria 7203
158 Ga0068857_100022930 3300005577 Bacteria 5492
159 Ga0068857_100025706 3300005577 Bacteria 5184
160 Ga0068857_100098504 3300005577 Bacteria 2622
161 Ga0068857_100351971 3300005577 Bacteria 1364
162 Ga0068857_100430714 3300005577 Bacteria 1231
163 Ga0068857_100956919 3300005577 Unclassified 823
164 Ga0068854_100003968 3300005578 Bacteria 9275
165 Ga0068854_100028234 3300005578 Bacteria 3875
166 Ga0068854_100090238 3300005578 Bacteria 2279
167 Ga0068854_100102161 3300005578 Bacteria 2151
168 Ga0068854_100116060 3300005578 Bacteria 2026
169 Ga0068854_100615865 3300005578 Unclassified 928
170 Ga0068856_100000887 3300005614 Bacteria 32039
171 Ga0068856_100008336 3300005614 Bacteria 10097
172 Ga0068856_100069023 3300005614 Bacteria 3495
173 Ga0068856_100232885 3300005614 Bacteria 1857
174 Ga0070702_100000571 3300005615 Bacteria 13448
175 Ga0068852_100014656 3300005616 Bacteria 6045
176 Ga0068852_100078291 3300005616 Bacteria 2925
177 Ga0068852_100299390 3300005616 Bacteria 1556
178 Ga0068852_101492726 3300005616 Bacteria 698
179 Ga0068852_102178461 3300005616 Bacteria 576
180 Ga0068859_100091161 3300005617 Bacteria 3098
181 Ga0068859_100124734 3300005617 Bacteria 2643
182 Ga0068859_100296945 3300005617 Bacteria 1709
183 Ga0068864_100010671 3300005618 Bacteria 7592
184 Ga0068864_100170920 3300005618 Bacteria 1982
185 Ga0068864_100660326 3300005618 Bacteria 1019
186 Ga0068864_100676311 3300005618 Bacteria 1007
187 Ga0068861_100003204 3300005719 Bacteria 10828
188 Ga0068861_100117369 3300005719 Bacteria 2141
189 Ga0068851_10014082 3300005834 Bacteria 3792
190 Ga0068851_10097987 3300005834 Bacteria 1552
191 Ga0068851_10099999 3300005834 Bacteria 1538
192 Ga0068870_10003323 3300005840 Bacteria 6801
193 Ga0068870_10501577 3300005840 Bacteria 809
194 Ga0068870_10870479 3300005840 Bacteria 634
195 Ga0068863_100018071 3300005841 Bacteria 6752
196 Ga0068863_100091707 3300005841 Bacteria 2881
197 Ga0068863_100105308 3300005841 Bacteria 2683
198 Ga0068858_100365766 3300005842 Bacteria 1383
199 Ga0068860_100010532 3300005843 Bacteria 9135
200 Ga0068862_100057571 3300005844 Bacteria 3334
201 Ga0068862_100074688 3300005844 Bacteria 2931
202 Ga0068862_100933363 3300005844 Bacteria 855
203 Ga0075368_10045091 3300006042 Bacteria 1741
204 Ga0075368_10097158 3300006042 Bacteria 1208
205 Ga0075363_100002386 3300006048 Bacteria 7654
206 Ga0075363_100048094 3300006048 Bacteria 2267
207 Ga0075364_10028373 3300006051 Bacteria 3583
208 Ga0075362_10001909 3300006177 Bacteria 6845
209 Ga0075362_10003213 3300006177 Bacteria 5663
210 Ga0075362_10044596 3300006177 Bacteria 1967
211 Ga0075362_10104854 3300006177 Bacteria 1325
212 Ga0075362_10177192 3300006177 Bacteria 1032
213 Ga0075367_10099999 3300006178 Bacteria 1772
214 Ga0075367_10126960 3300006178 Bacteria 1574
215 Ga0075367_10281522 3300006178 Bacteria 1045
216 Ga0075369_10028500 3300006186 Bacteria 2341
217 Ga0075366_10005058 3300006195 Bacteria 7127
218 Ga0075366_10023138 3300006195 Bacteria 3619
219 Ga0075366_10057237 3300006195 Bacteria 2317
220 Ga0075366_10060280 3300006195 Bacteria 2254
221 Ga0075366_10081143 3300006195 Bacteria 1937
222 Ga0075366_10092862 3300006195 Bacteria 1808
223 Ga0075366_10120320 3300006195 Bacteria 1582
224 Ga0075366_10159629 3300006195 Bacteria 1366
225 Ga0075366_10174278 3300006195 Bacteria 1306
226 Ga0075366_10208037 3300006195 Bacteria 1191
227 Ga0075366_10454329 3300006195 Bacteria 790
228 Ga0075366_10658274 3300006195 Bacteria 650
229 Ga0097621_100000834 3300006237 Bacteria 21739
230 Ga0075370_10000059 3300006353 Bacteria 32632
231 Ga0075370_10000087 3300006353 Bacteria 28459
232 Ga0075370_10000813 3300006353 Bacteria 12535
233 Ga0075370_10002533 3300006353 Bacteria 8490
234 Ga0075370_10071038 3300006353 Bacteria 1991
235 Ga0075370_10165448 3300006353 Bacteria 1299
236 Ga0075370_10274767 3300006353 Bacteria 1000
237 Ga0075370_10313695 3300006353 Bacteria 933
238 Ga0068871_100392947 3300006358 Bacteria 1234
239 Ga0075428_100188651 3300006844 Bacteria 2230
240 Ga0075430_100025785 3300006846 Bacteria 5002
241 Ga0075434_101580907 3300006871 Bacteria 664
242 Ga0075429_100001289 3300006880 Bacteria 20430
243 Ga0068865_100023460 3300006881 Bacteria 4039
244 Ga0068865_100064205 3300006881 Bacteria 2583
245 Ga0068865_100276381 3300006881 Bacteria 1335
246 Ga0097620_100091157 3300006931 Bacteria 3098
247 Ga0097620_100124739 3300006931 Bacteria 2643
248 Ga0097620_100296946 3300006931 Bacteria 1709
249 Ga0079104_1004321 3300006946 Bacteria 6144
250 Ga0099794_10143398 3300007265 Bacteria 1210
251 Ga0105251_10026119 3300009011 Bacteria 2977
252 Ga0105240_10001001 3300009093 Bacteria 50438
253 Ga0105240_10004920 3300009093 Bacteria 20087
254 Ga0105240_10035820 3300009093 Bacteria 6391
255 Ga0105240_10064762 3300009093 Bacteria 4540
256 Ga0105240_10110979 3300009093 Bacteria 3318
257 Ga0105240_10151438 3300009093 Bacteria 2762
258 Ga0105240_10580327 3300009093 Bacteria 1237
259 Ga0105240_11387397 3300009093 Bacteria 739
260 Ga0105240_11511099 3300009093 Bacteria 704
261 Ga0111539_11726941 3300009094 Bacteria 726
262 Ga0105245_10000241 3300009098 Bacteria 52084
263 Ga0105245_10055064 3300009098 Bacteria 3572
264 Ga0105245_10702000 3300009098 Bacteria 1045
265 Ga0105245_10767526 3300009098 Bacteria 1001
266 Ga0105245_10791525 3300009098 Bacteria 986
267 Ga0105245_11483078 3300009098 Unclassified 729
268 Ga0105247_10209395 3300009101 Bacteria 1314
269 Ga0105247_10260653 3300009101 Bacteria 1189
270 Ga0105247_11251157 3300009101 Unclassified 593
271 Ga0114129_10496322 3300009147 Bacteria 1595
272 Ga0105243_10000390 3300009148 Bacteria 46725
273 Ga0105243_10020375 3300009148 Bacteria 5029
274 Ga0105243_11877900 3300009148 Bacteria 631
275 Ga0105241_10079604 3300009174 Bacteria 2563
276 Ga0105241_10082320 3300009174 Bacteria 2522
277 Ga0105241_10101868 3300009174 Bacteria 2284
278 Ga0105241_11137689 3300009174 Unclassified 737
279 Ga0105242_10185158 3300009176 Bacteria 1840
280 Ga0105248_10331566 3300009177 Bacteria 1714
281 Ga0105248_10827088 3300009177 Bacteria 1045
282 Ga0105248_10979732 3300009177 Bacteria 955
283 Ga0105248_11305591 3300009177 Bacteria 821
284 Ga0105248_13176897 3300009177 Unclassified 523
285 Ga0105237_10045864 3300009545 Bacteria 4398
286 Ga0105237_10187694 3300009545 Bacteria 2067
287 Ga0105237_10208760 3300009545 Bacteria 1953
288 Ga0105237_10251517 3300009545 Bacteria 1769
289 Ga0105237_10389651 3300009545 Bacteria 1398
290 Ga0105237_10501577 3300009545 Bacteria 1220
291 Ga0105238_10000738 3300009551 Bacteria 34144
292 Ga0105238_10002979 3300009551 Bacteria 16912
293 Ga0105238_10408954 3300009551 Bacteria 1351
294 Ga0105238_10690928 3300009551 Bacteria 1032
295 Ga0105238_10777075 3300009551 Bacteria 972
296 Ga0105249_10008116 3300009553 Bacteria 9153
297 Ga0105249_10173015 3300009553 Bacteria 2095
298 Ga0105249_11428734 3300009553 Bacteria 764
299 Ga0105239_10010208 3300010375 Bacteria 10520
300 Ga0105239_10019338 3300010375 Bacteria 7522
301 Ga0105239_10329892 3300010375 Bacteria 1721
302 Ga0105239_10337678 3300010375 Bacteria 1700
303 Ga0105239_12366395 3300010375 Bacteria 618
304 Ga0105239_12503689 3300010375 Bacteria 601
305 Ga0105246_10041666 3300011119 Bacteria 3105
306 Ga0105246_12451221 3300011119 Unclassified 513
307 Ga0157373_10030602 3300013100 Bacteria 3873
308 Ga0157373_10350290 3300013100 Bacteria 1053
309 Ga0157370_10005091 3300013104 Bacteria 14831
310 Ga0157369_10005877 3300013105 Bacteria 14257
311 Ga0157369_10112116 3300013105 Bacteria 2898
312 Ga0157374_10099755 3300013296 Bacteria 2782
313 Ga0157374_10181754 3300013296 Bacteria 2055
314 Ga0157374_11080750 3300013296 Unclassified 822
315 Ga0157378_10000691 3300013297 Bacteria 31706
316 Ga0157378_10146556 3300013297 Bacteria 2196
317 Ga0157378_10238755 3300013297 Bacteria 1735
318 Ga0157378_11353466 3300013297 Bacteria 754
319 Ga0163162_10109784 3300013306 Bacteria 2855
320 Ga0163162_10128309 3300013306 Bacteria 2644
321 Ga0163162_10247762 3300013306 Bacteria 1913
322 Ga0163162_10322669 3300013306 Bacteria 1677
323 Ga0163162_10343177 3300013306 Bacteria 1626
324 Ga0163162_12085872 3300013306 Bacteria 650
325 Ga0157372_10023891 3300013307 Bacteria 6632
326 Ga0157372_10345474 3300013307 Bacteria 1734
327 Ga0157375_10099480 3300013308 Bacteria 2987
328 Ga0157375_10103460 3300013308 Bacteria 2934
329 Ga0157375_10133410 3300013308 Bacteria 2605
330 Ga0157375_10133527 3300013308 Bacteria 2603
331 Ga0157375_10534409 3300013308 Bacteria 1335
332 Ga0157375_10606622 3300013308 Bacteria 1253
333 Ga0163163_10007845 3300014325 Bacteria 9441
334 Ga0163163_10349218 3300014325 Bacteria 1535
335 Ga0163163_10453346 3300014325 Bacteria 1343
336 Ga0157380_10030112 3300014326 Bacteria 4155
337 Ga0157380_10484356 3300014326 Bacteria 1197
338 Ga0182008_10010381 3300014497 Bacteria 4985
339 Ga0157379_10001790 3300014968 Bacteria 17741
340 Ga0157379_10006875 3300014968 Bacteria 9835
341 Ga0157379_10028002 3300014968 Bacteria 5016
342 Ga0157379_10301397 3300014968 Bacteria 1461
343 Ga0157379_10447386 3300014968 Bacteria 1192
344 Ga0157379_10572138 3300014968 Bacteria 1053
345 Ga0157379_11098943 3300014968 Bacteria 761
346 Ga0157379_11763756 3300014968 Unclassified 607
347 Ga0157379_12395590 3300014968 Bacteria 527
348 Ga0157376_10088635 3300014969 Bacteria 2673
349 Ga0157376_11381334 3300014969 Bacteria 735
350 Ga0182006_1019521 3300015261 Bacteria 2853
351 Ga0182006_1069162 3300015261 Bacteria 1314
352 Ga0182007_10101261 3300015262 Bacteria 954
353 Ga0182007_10234420 3300015262 Bacteria 653
354 Ga0163161_10803624 3300017792 Bacteria 790
355 Ga0163161_11531719 3300017792 Bacteria 586
356 Ga0213872_10000058 3300021361 Bacteria 100531
357 Ga0213872_10000102 3300021361 Bacteria 79440
358 Ga0213872_10000150 3300021361 Bacteria 63730
359 Ga0213872_10004383 3300021361 Bacteria 7513
360 Ga0213872_10153162 3300021361 Unclassified 1006
361 Ga0213872_10339958 3300021361 Bacteria 617
362 Ga0213875_10077329 3300021388 Bacteria 1553
363 Ga0209435_100015 3300025206 Bacteria 321177
364 Ga0209435_100288 3300025206 Bacteria 12225
365 Ga0209784_100005 3300025224 Bacteria 1040422
366 Ga0209566_100005 3300025225 Bacteria 1040422
367 Ga0209674_100009 3300025226 Bacteria 1040422
368 Ga0209674_100064 3300025226 Bacteria 265769
369 Ga0209147_100004 3300025229 Bacteria 1371850
370 Ga0209563_100012 3300025230 Bacteria 1040422
371 Ga0209563_100126 3300025230 Bacteria 113122
372 Ga0207427_100197 3300025231 Bacteria 57629
373 Ga0209437_100268 3300025233 Bacteria 79327
374 Ga0209258_100298 3300025242 Bacteria 81047
375 Ga0209258_100736 3300025242 Bacteria 21300
376 Ga0209258_100787 3300025242 Bacteria 19150
377 Ga0209646_1000040 3300025246 Bacteria 347867
378 Ga0209646_1000060 3300025246 Bacteria 256386
379 Ga0209646_1000105 3300025246 Bacteria 163453
380 Ga0209026_1000034 3300025250 Bacteria 306953
381 Ga0209026_1000049 3300025250 Bacteria 255273
382 Ga0209677_100006 3300025253 Bacteria 1040422
383 Ga0209677_100411 3300025253 Bacteria 25661
384 Ga0209677_101394 3300025253 Bacteria 10483
385 Ga0209677_109255 3300025253 Bacteria 1794
386 Ga0209148_1012868 3300025254 Bacteria 1518
387 Ga0209148_1022957 3300025254 Bacteria 997
388 Ga0209759_1000069 3300025256 Bacteria 182437
389 Ga0209759_1000234 3300025256 Bacteria 83099
390 Ga0209759_1000569 3300025256 Bacteria 37040
391 Ga0209759_1001582 3300025256 Bacteria 12362
392 Ga0209759_1002582 3300025256 Bacteria 7830
393 Ga0209759_1016603 3300025256 Bacteria 1850
394 Ga0209759_1020690 3300025256 Bacteria 1518
395 Ga0207666_1014266 3300025271 Bacteria 1122
396 Ga0209455_1002003 3300025272 Bacteria 8360
397 Ga0209455_1005524 3300025272 Bacteria 3887
398 Ga0209455_1029989 3300025272 Bacteria 931
399 Ga0209758_1000233 3300025297 Bacteria 116640
400 Ga0209051_1000140 3300025303 Bacteria 135919
401 Ga0209051_1001699 3300025303 Bacteria 17625
402 Ga0209051_1008265 3300025303 Bacteria 5536
403 Ga0209051_1029310 3300025303 Bacteria 2156
404 Ga0209257_1000012 3300025304 Bacteria 1111138
405 Ga0209257_1000045 3300025304 Bacteria 484429
406 Ga0209257_1063458 3300025304 Bacteria 996
407 Ga0207697_10185402 3300025315 Bacteria 913
408 Ga0207656_10018424 3300025321 Bacteria 2749
409 Ga0207656_10106539 3300025321 Bacteria 1291
410 Ga0207656_10137890 3300025321 Bacteria 1148
411 Ga0207656_10234031 3300025321 Bacteria 896
412 Ga0207656_10407251 3300025321 Unclassified 684
413 Ga0207710_10166332 3300025900 Bacteria 1076
414 Ga0207680_10301289 3300025903 Bacteria 1117
415 Ga0207645_10004810 3300025907 Bacteria 9928
416 Ga0207645_10034993 3300025907 Bacteria 3226
417 Ga0207643_10023140 3300025908 Bacteria 3425
418 Ga0207643_10089604 3300025908 Bacteria 1792
419 Ga0207643_10164665 3300025908 Bacteria 1335
420 Ga0207705_10035791 3300025909 Bacteria 3552
421 Ga0207705_10162995 3300025909 Bacteria 1676
422 Ga0207705_10233564 3300025909 Bacteria 1399
423 Ga0207684_10012635 3300025910 Bacteria 7333
424 Ga0207654_10378130 3300025911 Bacteria 980
425 Ga0207654_10834454 3300025911 Bacteria 667
426 Ga0207707_10036063 3300025912 Bacteria 4325
427 Ga0207695_10000573 3300025913 Bacteria 75332
428 Ga0207695_10004109 3300025913 Bacteria 20007
429 Ga0207695_10006006 3300025913 Bacteria 15874
430 Ga0207695_10030732 3300025913 Bacteria 5910
431 Ga0207695_10080469 3300025913 Bacteria 3299
432 Ga0207695_10099795 3300025913 Bacteria 2900
433 Ga0207695_10255540 3300025913 Bacteria 1651
434 Ga0207671_10046969 3300025914 Bacteria 3195
435 Ga0207671_10225306 3300025914 Bacteria 1470
436 Ga0207671_10248091 3300025914 Bacteria 1399
437 Ga0207671_10302330 3300025914 Bacteria 1264
438 Ga0207671_10775753 3300025914 Bacteria 761
439 Ga0207660_10906699 3300025917 Unclassified 719
440 Ga0207660_10990277 3300025917 Bacteria 686
441 Ga0207657_10024892 3300025919 Bacteria 5532
442 Ga0207657_10286982 3300025919 Bacteria 1306
443 Ga0207657_10727761 3300025919 Unclassified 769
444 Ga0207657_10765968 3300025919 Bacteria 747
445 Ga0207649_10002217 3300025920 Bacteria 10974
446 Ga0207649_10563024 3300025920 Unclassified 873
447 Ga0207652_10047116 3300025921 Bacteria 3681
448 Ga0207652_10310463 3300025921 Bacteria 1423
449 Ga0207646_10198051 3300025922 Bacteria 1814
450 Ga0207681_10005071 3300025923 Bacteria 8095
451 Ga0207681_10208885 3300025923 Bacteria 1503
452 Ga0207694_10000505 3300025924 Bacteria 35291
453 Ga0207694_10010773 3300025924 Bacteria 6903
454 Ga0207694_10361493 3300025924 Bacteria 1203
455 Ga0207694_10384437 3300025924 Bacteria 1165
456 Ga0207694_10783681 3300025924 Bacteria 805
457 Ga0207694_10819862 3300025924 Bacteria 786
458 Ga0207650_10022889 3300025925 Bacteria 4427
459 Ga0207650_10023873 3300025925 Bacteria 4341
460 Ga0207650_10050850 3300025925 Bacteria 3066
461 Ga0207650_10053437 3300025925 Bacteria 2994
462 Ga0207650_10075425 3300025925 Bacteria 2545
463 Ga0207650_10370508 3300025925 Bacteria 1181
464 Ga0207650_10373791 3300025925 Bacteria 1176
465 Ga0207659_10009257 3300025926 Bacteria 6152
466 Ga0207659_10110207 3300025926 Bacteria 2091
467 Ga0207659_10587076 3300025926 Bacteria 949
468 Ga0207687_10000799 3300025927 Bacteria 21252
469 Ga0207687_10060589 3300025927 Bacteria 2670
470 Ga0207687_10241914 3300025927 Bacteria 1431
471 Ga0207687_11504785 3300025927 Bacteria 578
472 Ga0207664_10050874 3300025929 Bacteria 3269
473 Ga0207644_10017024 3300025931 Bacteria 4901
474 Ga0207644_10092568 3300025931 Bacteria 2256
475 Ga0207644_10332254 3300025931 Bacteria 1231
476 Ga0207644_10362591 3300025931 Bacteria 1179
477 Ga0207644_11190387 3300025931 Bacteria 640
478 Ga0207690_10013867 3300025932 Bacteria 4855
479 Ga0207690_10189386 3300025932 Bacteria 1555
480 Ga0207706_10074485 3300025933 Bacteria 2985
481 Ga0207706_10132942 3300025933 Bacteria 2188
482 Ga0207686_10004205 3300025934 Bacteria 7723
483 Ga0207686_10276959 3300025934 Bacteria 1237
484 Ga0207709_10060578 3300025935 Bacteria 2361
485 Ga0207709_11177358 3300025935 Bacteria 631
486 Ga0207670_10051735 3300025936 Bacteria 2760
487 Ga0207669_10068061 3300025937 Bacteria 2222
488 Ga0207669_10182940 3300025937 Bacteria 1504
489 Ga0207669_10535201 3300025937 Bacteria 943
490 Ga0207704_10058715 3300025938 Bacteria 2370
491 Ga0207691_10004143 3300025940 Bacteria 14086
492 Ga0207691_10006762 3300025940 Bacteria 11060
493 Ga0207691_10024653 3300025940 Bacteria 5657
494 Ga0207691_10061422 3300025940 Bacteria 3413
495 Ga0207711_10011889 3300025941 Bacteria 7235
496 Ga0207711_10549147 3300025941 Bacteria 1078
497 Ga0207711_10620816 3300025941 Bacteria 1009
498 Ga0207689_10000452 3300025942 Bacteria 38652
499 Ga0207689_10147813 3300025942 Bacteria 1936
500 Ga0207689_10584203 3300025942 Bacteria 939
501 Ga0207689_10757036 3300025942 Bacteria 820
502 Ga0207661_10028466 3300025944 Bacteria 4279
503 Ga0207661_10866758 3300025944 Bacteria 832
504 Ga0207679_10117544 3300025945 Bacteria 2110
505 Ga0207679_10139525 3300025945 Bacteria 1957
506 Ga0207679_10850953 3300025945 Bacteria 833
507 Ga0207667_10000053 3300025949 Bacteria 226712
508 Ga0207667_10026989 3300025949 Bacteria 6264
509 Ga0207667_10028711 3300025949 Bacteria 6039
510 Ga0207667_10052477 3300025949 Bacteria 4294
511 Ga0207667_10248612 3300025949 Bacteria 1819
512 Ga0207667_12123069 3300025949 Unclassified 520
513 Ga0207651_10069538 3300025960 Bacteria 2486
514 Ga0207651_10088444 3300025960 Bacteria 2258
515 Ga0207651_10105872 3300025960 Bacteria 2099
516 Ga0207651_10413338 3300025960 Bacteria 1150
517 Ga0207651_11251062 3300025960 Bacteria 667
518 Ga0207712_10123168 3300025961 Bacteria 1965
519 Ga0207668_10012253 3300025972 Bacteria 5243
520 Ga0207668_10247602 3300025972 Bacteria 1446
521 Ga0207668_10407248 3300025972 Bacteria 1151
522 Ga0207668_11296762 3300025972 Bacteria 655
523 Ga0207640_10031492 3300025981 Bacteria 3277
524 Ga0207640_10049985 3300025981 Bacteria 2710
525 Ga0207640_10112897 3300025981 Bacteria 1930
526 Ga0207640_10212227 3300025981 Bacteria 1476
527 Ga0207640_10380006 3300025981 Bacteria 1144
528 Ga0207658_10047106 3300025986 Bacteria 3153
529 Ga0207658_10050043 3300025986 Bacteria 3073
530 Ga0207658_10061349 3300025986 Bacteria 2809
531 Ga0207658_10125710 3300025986 Bacteria 2052
532 Ga0207658_10968704 3300025986 Bacteria 776
533 Ga0207677_10031338 3300026023 Bacteria 3405
534 Ga0207677_10051376 3300026023 Bacteria 2795
535 Ga0207677_10774884 3300026023 Bacteria 857
536 Ga0207677_11011251 3300026023 Bacteria 754
537 Ga0207677_11999619 3300026023 Bacteria 539
538 Ga0207703_10003194 3300026035 Bacteria 13797
539 Ga0207703_10399632 3300026035 Bacteria 1275
540 Ga0207639_10075141 3300026041 Bacteria 2656
541 Ga0207639_10144245 3300026041 Bacteria 1987
542 Ga0207639_11096435 3300026041 Bacteria 747
543 Ga0207639_11415759 3300026041 Bacteria 652
544 Ga0207678_10106297 3300026067 Bacteria 2394
545 Ga0207678_10373059 3300026067 Bacteria 1233
546 Ga0207708_10000701 3300026075 Bacteria 25411
547 Ga0207702_10022449 3300026078 Bacteria 5231
548 Ga0207702_10083504 3300026078 Bacteria 2779
549 Ga0207702_10204748 3300026078 Bacteria 1831
550 Ga0207641_10009598 3300026088 Bacteria 7974
551 Ga0207641_10026935 3300026088 Bacteria 4747
552 Ga0207641_10272468 3300026088 Bacteria 1589
553 Ga0207648_10000159 3300026089 Bacteria 69221
554 Ga0207648_10003372 3300026089 Bacteria 16778
555 Ga0207648_10038891 3300026089 Bacteria 4185
556 Ga0207648_10071567 3300026089 Bacteria 3022
557 Ga0207648_10160108 3300026089 Bacteria 1988
558 Ga0207648_10506563 3300026089 Bacteria 1105
559 Ga0207648_10542851 3300026089 Bacteria 1067
560 Ga0207648_10738928 3300026089 Bacteria 914
561 Ga0207676_10003896 3300026095 Bacteria 10542
562 Ga0207676_10037088 3300026095 Bacteria 3712
563 Ga0207676_10620870 3300026095 Bacteria 1040
564 Ga0207674_10000954 3300026116 Bacteria 37774
565 Ga0207674_10006659 3300026116 Bacteria 13573
566 Ga0207674_10022384 3300026116 Bacteria 6786
567 Ga0207674_10121427 3300026116 Bacteria 2580
568 Ga0207674_10435399 3300026116 Bacteria 1267
569 Ga0207674_10437071 3300026116 Bacteria 1265
570 Ga0207674_10636845 3300026116 Bacteria 1029
571 Ga0207674_10975356 3300026116 Bacteria 816
572 Ga0207674_11234974 3300026116 Bacteria 717
573 Ga0207675_100000068 3300026118 Bacteria 78105
574 Ga0207675_100037965 3300026118 Bacteria 4494
575 Ga0207675_100213377 3300026118 Bacteria 1857
576 Ga0207675_100454833 3300026118 Bacteria 1269
577 Ga0207683_10013791 3300026121 Bacteria 6891
578 Ga0207683_10093306 3300026121 Bacteria 2682
579 Ga0207683_10598439 3300026121 Bacteria 1020
580 Ga0207698_10007618 3300026142 Bacteria 6789
581 Ga0207698_10025226 3300026142 Bacteria 4184
582 Ga0207698_10698688 3300026142 Bacteria 1009
583 Ga0207698_10767765 3300026142 Bacteria 964
584 Ga0207698_11320615 3300026142 Bacteria 736
585 Ga0209281_1007305 3300027111 Bacteria 2782
586 Ga0209813_10008368 3300027866 Bacteria 2611
587 Ga0209813_10140803 3300027866 Bacteria 856
588 Ga0268266_10037951 3300028379 Bacteria 4102
589 Ga0268266_10707477 3300028379 Unclassified 971
590 Ga0268265_10016151 3300028380 Bacteria 5125
591 Ga0268265_10031173 3300028380 Bacteria 3849
592 Ga0268265_10050837 3300028380 Bacteria 3125
593 Ga0268265_10223199 3300028380 Bacteria 1650
594 Ga0268265_12588079 3300028380 Bacteria 513
595 Ga0268264_10020364 3300028381 Bacteria 5421
596 Ga0268264_10149599 3300028381 Bacteria 2092
597 Ga0268264_10241375 3300028381 Bacteria 1674
598 Ga0268264_10804770 3300028381 Bacteria 939
599 Ga0265336_10000123 3300028666 Bacteria 57956
600 Ga0307517_10002354 3300028786 Bacteria 30505
601 Ga0307517_10077719 3300028786 Bacteria 2880
602 Ga0307517_10318467 3300028786 Bacteria 862
603 Ga0307515_10015864 3300028794 Bacteria 13844
604 Ga0307515_10106461 3300028794 Bacteria 3327
605 Ga0307515_10254589 3300028794 Bacteria 1502
606 Ga0307515_10583058 3300028794 Bacteria 728
607 Ga0265324_10000849 3300029957 Bacteria 19632
608 Ga0307511_10253296 3300030521 Bacteria 843
609 Ga0307512_10182106 3300030522 Bacteria 1178
610 Ga0307512_10233028 3300030522 Bacteria 943
611 Ga0307512_10252093 3300030522 Bacteria 878
612 Ga0265332_10000278 3300031238 Bacteria 40354
613 Ga0265331_10009024 3300031250 Bacteria 5634
614 Ga0265331_10058535 3300031250 Bacteria 1824
615 Ga0265327_10000328 3300031251 Bacteria 90489
616 Ga0307513_10021976 3300031456 Bacteria 7515
617 Ga0307513_10195711 3300031456 Bacteria 1868
618 Ga0307513_10380145 3300031456 Bacteria 1152
619 Ga0307509_10000234 3300031507 Bacteria 89398
620 Ga0307509_10039607 3300031507 Bacteria 5132
621 Ga0307509_10090207 3300031507 Bacteria 3141
622 Ga0307509_10112558 3300031507 Bacteria 2721
623 Ga0307509_10120503 3300031507 Bacteria 2602
624 Ga0307509_10902039 3300031507 Unclassified 549
625 Ga0307408_100211432 3300031548 Bacteria 1576
626 Ga0307408_100603774 3300031548 Bacteria 975
627 Ga0307508_10001066 3300031616 Bacteria 31732
628 Ga0307508_10088896 3300031616 Bacteria 2673
629 Ga0307514_10052858 3300031649 Bacteria 3137
630 Ga0307514_10062249 3300031649 Bacteria 2839
631 Ga0307514_10253912 3300031649 Bacteria 1037
632 Ga0307514_10414020 3300031649 Bacteria 681
633 Ga0307516_10037289 3300031730 Bacteria 4861
634 Ga0307516_10090008 3300031730 Bacteria 2898
635 Ga0307516_10124340 3300031730 Bacteria 2366
636 Ga0307516_10143470 3300031730 Bacteria 2155
637 Ga0307516_10613533 3300031730 Bacteria 742
638 Ga0307516_10629741 3300031730 Bacteria 727
639 Ga0307516_10769828 3300031730 Bacteria 623
640 Ga0307405_10174205 3300031731 Bacteria 1538
641 Ga0307413_10017248 3300031824 Bacteria 3756
642 Ga0307413_11501109 3300031824 Bacteria 596
643 Ga0307518_10357644 3300031838 Bacteria 845
644 Ga0307410_10283779 3300031852 Bacteria 1300
645 Ga0307412_10401022 3300031911 Bacteria 1116
646 Ga0307412_11085580 3300031911 Unclassified 711
647 Ga0307409_100372205 3300031995 Bacteria 1355
648 Ga0307416_102294687 3300032002 Bacteria 640
649 Ga0307414_10689805 3300032004 Bacteria 924
650 Ga0307411_10044945 3300032005 Bacteria 2838
651 Ga0307411_10321696 3300032005 Bacteria 1249
652 Ga0307415_100740945 3300032126 Bacteria 891
653 Ga0307415_101200948 3300032126 Bacteria 715
654 Ga0316583_10227339 3300032133 Bacteria 647
655 Ga0307510_10012165 3300033180 Bacteria 10203
656 Ga0307510_10032961 3300033180 Bacteria 5829
657 Ga0373952_0001139 3300035092 Bacteria 4848
658 Ga0373946_0066198 3300035171 Bacteria 1549
659 Ga0373931_0025723 3300035691 Bacteria 2989
660 Ga0373937_0179223 3300036401 Bacteria 1989
661 Ga0373937_0340219 3300036401 Bacteria 1421
662 Ga0373937_0669136 3300036401 Bacteria 984
663 Ga0395899_0195598 3300037312 Bacteria 1413
664 Ga0395899_0204210 3300037312 Bacteria 1376
665 Ga0395898_0038029 3300037466 Bacteria 4772
666 Ga0436364_0570264 3300037853 Bacteria 3035
667 Ga0395901_0029531 3300038443 Bacteria 5646
668 Ga0436365_0680524 3300039437 Bacteria 1610
669 Ga0436361_0018388 3300039447 Bacteria 44345
670 Ga0436361_0068556 3300039447 Bacteria 100895
671 Ga0436361_0162163 3300039447 Bacteria 1247
672 Ga0436361_0614815 3300039447 Bacteria 45728
673 Ga0436361_0651406 3300039447 Bacteria 3013
674 Ga0436361_0658018 3300039447 Bacteria 686
675 Ga0436361_0704442 3300039447 Bacteria 599
676 Ga0436361_1050932 3300039447 Bacteria 935
677 Ga0436361_1078434 3300039447 Bacteria 1024
678 Ga0451791_0302276 3300041451 Bacteria 1038
679 Ga0451795_1577239 3300041456 Bacteria 631
680 Ga0451837_1131948 3300041494 Bacteria 583
681 Ga0451853_1225302 3300041512 Bacteria 1310
682 Ga0451853_1592565 3300041512 Bacteria 996
683 Ga0451853_2413001 3300041512 Bacteria 822
684 Ga0439437_064593 3300042000 Unclassified 500
685 Ga0439448_0053162 3300042005 Bacteria 1329
686 Ga0439448_0323230 3300042005 Bacteria 549
687 Ga0439450_054731 3300042008 Bacteria 954
688 Ga0450889_021654 3300042144 Bacteria 717
689 Ga0439464_0008576 3300042439 Bacteria 2679
690 Ga0451577_0180363 3300042876 Bacteria 1904
691 Ga0466965_0030229 3300044683 Bacteria 2638
692 Ga0466963_0645760 3300044694 Bacteria 747
693 Ga0466964_0004400 3300044706 Bacteria 5198
694 Ga0453684_0562581 3300044712 Bacteria 1254
695 Ga0466968_0068366 3300044735 Bacteria 1542
696 Ga0466970_0011861 3300044765 Bacteria 4445
697 Ga0466957_0028524 3300044842 Bacteria 3324
698 Ga0466957_0351328 3300044842 Bacteria 1000
699 Ga0466957_0571936 3300044842 Bacteria 789
700 Ga0466959_0022300 3300045049 Bacteria 4680
701 Ga0451576_0001324 3300045051 Bacteria 42824
702 Ga0451576_0978897 3300045051 Bacteria 887
703 Ga0466958_0153786 3300045836 Bacteria 1451
704 Ga0466967_0234772 3300045976 Bacteria 1747
705 Ga0466967_0379341 3300045976 Bacteria 1372
706 Ga0466967_0635782 3300045976 Bacteria 1055
707 Ga0466967_0962078 3300045976 Bacteria 850
708 Ga0466967_1447903 3300045976 Unclassified 684
709 Ga0495592_0000291 3300046454 Bacteria 42990
710 Ga0495638_0118661 3300046460 Bacteria 1565
711 Ga0495638_0276953 3300046460 Bacteria 913
712 Ga0495651_0387051 3300046462 Bacteria 916
713 Ga0495650_0053966 3300046471 Bacteria 1642
714 Ga0495650_0085334 3300046471 Bacteria 1210
715 Ga0495582_0254919 3300046473 Bacteria 1006
716 Ga0495605_0082544 3300046474 Bacteria 1501
717 Ga0495664_0201984 3300046477 Bacteria 1204
718 Ga0495607_0200564 3300046501 Bacteria 988
719 Ga0495583_0000046 3300046506 Bacteria 218059
720 Ga0495583_0312776 3300046506 Bacteria 623
721 Ga0495610_0053848 3300046512 Bacteria 1947
722 Ga0495628_0051863 3300046516 Bacteria 3242
723 Ga0495631_0377690 3300046518 Bacteria 603
724 Ga0495632_0006200 3300046519 Bacteria 7737
725 Ga0495648_0303349 3300046524 Bacteria 747
726 Ga0495666_0021091 3300046526 Bacteria 3226
727 Ga0495598_0006095 3300046537 Bacteria 2708
728 Ga0495621_0193356 3300046539 Bacteria 816
729 Ga0495597_0003922 3300046542 Bacteria 8402
730 Ga0495597_0024542 3300046542 Bacteria 2782
731 Ga0495597_0134198 3300046542 Bacteria 1025
732 Ga0495645_0071213 3300046543 Bacteria 2507
733 Ga0495622_0025296 3300046557 Bacteria 2773
734 Ga0495668_0072851 3300046616 Bacteria 1887
735 Ga0495611_0221658 3300046648 Bacteria 880
736 Ga0495625_0005740 3300046660 Bacteria 11219
737 Ga0495625_0036997 3300046660 Bacteria 3583
738 Ga0495625_0150118 3300046660 Bacteria 1567
739 Ga0495625_0321463 3300046660 Bacteria 985
740 Ga0495647_0334470 3300046681 Bacteria 687
741 Ga0495658_0004796 3300046683 Bacteria 6631
742 Ga0495658_0454283 3300046683 Bacteria 818
743 Ga0495658_0693015 3300046683 Bacteria 653
744 Ga0495613_0603713 3300046689 Bacteria 730
745 Ga0495624_0056474 3300046690 Bacteria 2470
746 Ga0495671_0111819 3300046692 Bacteria 1334
747 Ga0495671_0154985 3300046692 Bacteria 1115
748 Ga0495671_0363925 3300046692 Bacteria 693
749 Ga0495671_0598998 3300046692 Bacteria 524
750 Ga0495649_0000638 3300046694 Bacteria 28526
751 Ga0495649_0037138 3300046694 Bacteria 2674
752 Ga0495660_0024873 3300046810 Bacteria 3406
753 Ga0495687_000367 3300047443 Bacteria 56387
754 Ga0495687_011817 3300047443 Bacteria 4662
755 Ga0495673_0156408 3300047469 Bacteria 878
756 Ga0495686_0029542 3300047472 Bacteria 3565
757 Ga0495686_0145468 3300047472 Bacteria 1395
758 Ga0495593_0031997 3300047673 Bacteria 2870
759 Ga0495614_0287908 3300048089 Bacteria 757
760 Ga0495615_0024194 3300048090 Bacteria 1398
761 Ga0495626_0074869 3300048091 Bacteria 1514
762 Ga0496100_0095075 3300048903 Bacteria 2042
763 Ga0496101_0242656 3300048904 Bacteria 1402
764 Ga0496101_1162577 3300048904 Bacteria 605
765 Ga0496104_0046378 3300048907 Bacteria 4093
766 Ga0496105_0557045 3300048908 Bacteria 894
767 Ga0496106_0056501 3300048909 Bacteria 2967
768 Ga0496106_0361007 3300048909 Unclassified 1167
769 Ga0496108_0054157 3300048911 Bacteria 3367
770 Ga0496108_0458421 3300048911 Bacteria 1114
771 Ga0496108_0475861 3300048911 Bacteria 1091
772 Ga0496108_0716479 3300048911 Bacteria 867
773 Ga0496109_0023407 3300048912 Bacteria 5484
774 Ga0496111_0149444 3300048914 Bacteria 1732
775 Ga0496112_0000429 3300048915 Bacteria 27778
776 Ga0496112_0207877 3300048915 Bacteria 1915
777 Ga0496112_1081738 3300048915 Bacteria 720
778 Ga0496113_0400549 3300048916 Bacteria 1102
779 Ga0496114_0006440 3300048917 Bacteria 9243
780 Ga0496114_0322714 3300048917 Bacteria 1365
781 Ga0496115_0416682 3300048918 Bacteria 1088
782 Ga0496116_0018094 3300048919 Bacteria 5444
783 Ga0496118_0185082 3300048921 Bacteria 1253
784 Ga0496121_0020869 3300048924 Bacteria 6453
785 Ga0496121_0054604 3300048924 Bacteria 3336
786 Ga0496121_0316427 3300048924 Bacteria 1053
787 Ga0496122_0008179 3300048925 Bacteria 11370
788 Ga0496123_0008042 3300048926 Bacteria 9765
789 Ga0496124_0469914 3300048927 Bacteria 852
790 Ga0496125_0005346 3300048928 Bacteria 14333
791 Ga0496126_0026066 3300048929 Bacteria 5612
792 Ga0495682_0276103 3300049460 Bacteria 593
793 Ga0501290_079332 3300049513 Bacteria 557
794 Ga0501300_027973 3300049523 Bacteria 829
795 Ga0501032_0010930 3300049569 Bacteria 6527
796 Ga0501032_0140832 3300049569 Bacteria 1588
797 Ga0501034_0024667 3300049571 Bacteria 6115
798 Ga0501034_0257622 3300049571 Bacteria 1688
799 Ga0501038_0058614 3300049574 Bacteria 3301
800 Ga0501039_0013485 3300049575 Bacteria 6250
801 Ga0501043_0000149 3300049579 Bacteria 65122
802 Ga0501046_0000092 3300049580 Bacteria 97456
803 Ga0501047_0000028 3300049581 Bacteria 220279
804 Ga0501048_0006680 3300049582 Bacteria 8763
805 Ga0501072_0586099 3300049588 Bacteria 880
806 Ga0501079_0657938 3300049741 Bacteria 825
807 Ga0501081_0688929 3300049743 Bacteria 767
808 Ga0501266_000057 3300049763 Bacteria 17898
809 Ga0501035_0046260 3300049822 Bacteria 3914
810 Ga0501035_1209385 3300049822 Bacteria 586
811 Ga0501044_0272835 3300049823 Bacteria 1627
812 Ga0501045_0000170 3300049824 Bacteria 35617
813 nmdc:mga03683_10952_c1 3300050489 Bacteria 3265
814 nmdc:mga03683_120460_c1 3300050489 Bacteria 1166
815 nmdc:mga03683_19823_c1 3300050489 Bacteria 2572
816 nmdc:mga03n38_230957_c1 3300050490 Bacteria 970
817 nmdc:mga03n38_48533_c1 3300050490 Bacteria 1884
818 nmdc:mga00v17_10380_c1 3300050491 Bacteria 5082
819 nmdc:mga0k408_11251_c1 3300050493 Bacteria 4865
820 nmdc:mga0k408_198791_c1 3300050493 Bacteria 1196
821 nmdc:mga0k408_22329_c1 3300050493 Bacteria 3563
822 nmdc:mga0k408_2308_c1 3300050493 Bacteria 10151
823 nmdc:mga0k408_27898_c1 3300050493 Bacteria 3209
824 nmdc:mga0k408_355_c1 3300050493 Bacteria 25188
825 nmdc:mga0k408_40234_c1 3300050493 Bacteria 2689
826 nmdc:mga0k408_61790_c1 3300050493 Bacteria 2178
827 nmdc:mga0k408_68274_c1 3300050493 Bacteria 2073
828 nmdc:mga0k408_69103_c1 3300050493 Bacteria 2061
829 nmdc:mga0k408_8262_c1 3300050493 Bacteria 5584
830 nmdc:mga06z11_127044_c1 3300050494 Bacteria 1428
831 nmdc:mga06z11_165950_c1 3300050494 Bacteria 1265
832 nmdc:mga06z11_5785_c1 3300050494 Bacteria 4985
833 nmdc:mga04h51_11203_c1 3300050495 Bacteria 2483
834 nmdc:mga04h51_160506_c1 3300050495 Bacteria 865
835 nmdc:mga07m45_10918_c1 3300050496 Bacteria 4758
836 nmdc:mga07m45_1116_c1 3300050496 Bacteria 12021
837 nmdc:mga07m45_175262_c1 3300050496 Bacteria 1247
838 nmdc:mga07m45_216266_c1 3300050496 Bacteria 1115
839 nmdc:mga07m45_2223_c1 3300050496 Bacteria 9067
840 nmdc:mga07m45_27823_c1 3300050496 Bacteria 3118
841 nmdc:mga07m45_398480_c1 3300050496 Bacteria 799
842 nmdc:mga07m45_6961_c1 3300050496 Bacteria 5751
843 nmdc:mga07m45_7118_c1 3300050496 Bacteria 5697
844 nmdc:mga07m45_7357_c1 3300050496 Bacteria 5622
845 nmdc:mga09592_4802_c1 3300050508 Bacteria 10952
846 nmdc:mga0qj67_89016_c1 3300050509 Bacteria 2479
847 nmdc:mga0n895_1200895_c1 3300050512 Bacteria 732
848 nmdc:mga0n895_1778329_c1 3300050512 Bacteria 577
849 nmdc:mga0sz30_176495_c1 3300050516 Bacteria 947
850 Ga0495601_0498003 3300053077 Bacteria 786
851 Ga0500635_0000005 3300053080 Bacteria 187821
852 Ga0500644_0100473 3300053088 Bacteria 1098
853 Ga0500651_0028942 3300053093 Bacteria 3482
854 Ga0500651_0058855 3300053093 Bacteria 2403
855 Ga0500651_0422206 3300053093 Bacteria 746
856 Ga0500618_001127 3300053125 Bacteria 12996
857 Ga0500618_003179 3300053125 Bacteria 5763
858 Ga0500658_0002097 3300053134 Bacteria 7754
859 Ga0500559_0000119 3300053136 Bacteria 62358
860 Ga0500564_107433 3300053138 Bacteria 1228
861 Ga0500564_113828 3300053138 Bacteria 1185
862 Ga0500564_138173 3300053138 Bacteria 1049
863 Ga0500568_0005734 3300053139 Bacteria 6362
864 Ga0500622_0005643 3300053156 Bacteria 7455
865 Ga0500636_0045101 3300053177 Bacteria 2600
866 Ga0500636_0132989 3300053177 Bacteria 1384
867 Ga0500587_004225 3300053739 Bacteria 1980
868 Ga0501084_1049680 3300054114 Bacteria 684
869 Ga0500661_014650 3300055283 Bacteria 1411
870 Ga0501082_0504992 3300060353 Bacteria 1057
871 Ga0466962_0057998 3300061719 Bacteria 1848

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100290538 Ga0068855_1002905382 123
2 3300025949 Ga0207667_10248612 Ga0207667_102486123 123
3 3300005327 Ga0070658_10334405 Ga0070658_103344052 125
4 3300005456 Ga0070678_100593398 Ga0070678_1005933981 125
5 3300025919 Ga0207657_10765968 Ga0207657_107659681 126
6 3300026121 Ga0207683_10598439 Ga0207683_105984392 126
7 3300005563 Ga0068855_101784564 Ga0068855_1017845641 129
8 3300046539 Ga0495621_0193356 Ga0495621_0193356_149_607 132
9 3300048090 Ga0495615_0024194 Ga0495615_0024194_762_1220 132
10 3300050512 nmdc:mga0n895_1778329_c1 nmdc:mga0n895_1778329_c1_161_562 132
11 3300005327 Ga0070658_10159526 Ga0070658_101595262 134
12 3300025909 Ga0207705_10233564 Ga0207705_102335641 134
13 3300003323 rootH1_10085156 rootH1_100851562 135
14 3300011119 Ga0105246_12451221 Ga0105246_124512211 135
15 3300003316 rootH1_10042308 rootH1_100423081 136
16 3300003323 rootH1_10072734 rootH1_100727341 136
17 3300003752 Ga0055539_1000422 Ga0055539_100042213 136
18 3300003756 Ga0055533_1000033 Ga0055533_10000331 136
19 3300003759 Ga0055525_1001360 Ga0055525_10013604 136
20 3300005334 Ga0068869_100002015 Ga0068869_10000201511 136
21 3300005340 Ga0070689_100078740 Ga0070689_1000787402 136
22 3300005343 Ga0070687_100358331 Ga0070687_1003583311 136
23 3300005365 Ga0070688_100157273 Ga0070688_1001572731 136
24 3300005441 Ga0070700_100018494 Ga0070700_1000184943 136
25 3300005444 Ga0070694_100018628 Ga0070694_1000186282 136
26 3300005456 Ga0070678_100113175 Ga0070678_1001131751 136
27 3300005459 Ga0068867_100001409 Ga0068867_1000014092 136
28 3300005544 Ga0070686_100000934 Ga0070686_1000009342 136
29 3300005615 Ga0070702_100000571 Ga0070702_1000005712 136
30 3300005617 Ga0068859_100091161 Ga0068859_1000911612 136
31 3300005719 Ga0068861_100003204 Ga0068861_1000032049 136
32 3300005840 Ga0068870_10003323 Ga0068870_100033233 136
33 3300005843 Ga0068860_100010532 Ga0068860_1000105328 136
34 3300005844 Ga0068862_100074688 Ga0068862_1000746882 136
35 3300006237 Ga0097621_100000834 Ga0097621_10000083414 136
36 3300006881 Ga0068865_100064205 Ga0068865_1000642053 136
37 3300006931 Ga0097620_100091157 Ga0097620_1000911572 136
38 3300009098 Ga0105245_10000241 Ga0105245_1000024116 136
39 3300009148 Ga0105243_10000390 Ga0105243_1000039010 136
40 3300009551 Ga0105238_10408954 Ga0105238_104089542 136
41 3300009553 Ga0105249_10008116 Ga0105249_100081165 136
42 3300013297 Ga0157378_10000691 Ga0157378_1000069119 136
43 3300013306 Ga0163162_10109784 Ga0163162_101097842 136
44 3300014968 Ga0157379_10006875 Ga0157379_100068758 136
45 3300014969 Ga0157376_10088635 Ga0157376_100886352 136
46 3300025226 Ga0209674_100064 Ga0209674_100064248 136
47 3300025230 Ga0209563_100126 Ga0209563_100126107 136
48 3300025253 Ga0209677_100411 Ga0209677_1004111 136
49 3300025908 Ga0207643_10023140 Ga0207643_100231402 136
50 3300025924 Ga0207694_10361493 Ga0207694_103614931 136
51 3300025927 Ga0207687_10000799 Ga0207687_100007997 136
52 3300025934 Ga0207686_10004205 Ga0207686_100042056 136
53 3300025935 Ga0207709_10060578 Ga0207709_100605782 136
54 3300025936 Ga0207670_10051735 Ga0207670_100517352 136
55 3300025942 Ga0207689_10000452 Ga0207689_1000045240 136
56 3300026075 Ga0207708_10000701 Ga0207708_1000070113 136
57 3300026089 Ga0207648_10000159 Ga0207648_1000015938 136
58 3300026118 Ga0207675_100000068 Ga0207675_10000006845 136
59 3300026121 Ga0207683_10013791 Ga0207683_100137915 136
60 3300028380 Ga0268265_10050837 Ga0268265_100508372 136
61 3300028381 Ga0268264_10020364 Ga0268264_100203642 136
62 3300044694 Ga0466963_0645760 Ga0466963_0645760_48_524 136
63 3300044842 Ga0466957_0351328 Ga0466957_0351328_90_566 136
64 3300002772 JGI25164J39214_1005040 JGI25164J39214_10050401 137
65 3300009093 Ga0105240_10151438 Ga0105240_101514382 137
66 3300025231 Ga0207427_100197 Ga0207427_1001972 137
67 3300025913 Ga0207695_10080469 Ga0207695_100804692 137
68 3300006195 Ga0075366_10023138 Ga0075366_100231383 138
69 3300025919 Ga0207657_10727761 Ga0207657_107277612 138
70 3300042005 Ga0439448_0053162 Ga0439448_0053162_662_1138 138
71 3300050493 nmdc:mga0k408_22329_c1 nmdc:mga0k408_22329_c1_2826_3302 138
72 3300053080 Ga0500635_0000005 Ga0500635_0000005_24693_25169 141
73 3300048907 Ga0496104_0046378 Ga0496104_0046378_1485_1967 142
74 3300048908 Ga0496105_0557045 Ga0496105_0557045_26_508 142
75 3300048909 Ga0496106_0056501 Ga0496106_0056501_1642_2097 143
76 3300048929 Ga0496126_0026066 Ga0496126_0026066_1114_1569 143
77 3300049523 Ga0501300_027973 Ga0501300_027973_95_550 143
78 3300006846 Ga0075430_100025785 Ga0075430_1000257852 145
79 3300006880 Ga0075429_100001289 Ga0075429_1000012892 145
80 3300009147 Ga0114129_10496322 Ga0114129_104963222 145
81 3300042876 Ga0451577_0180363 Ga0451577_0180363_1432_1881 145
82 3300044712 Ga0453684_0562581 Ga0453684_0562581_524_973 145
83 3300045051 Ga0451576_0001324 Ga0451576_0001324_21962_22411 145
84 3300050508 nmdc:mga09592_4802_c1 nmdc:mga09592_4802_c1_8311_8760 145
85 3300050509 nmdc:mga0qj67_89016_c1 nmdc:mga0qj67_89016_c1_1184_1633 145
86 iso_pu_bacteria 2643221654 2644303978 145
87 iso_pu_bacteria 2643221660 2644338794 145
88 3300049513 Ga0501290_079332 Ga0501290_079332_104_547 146
89 3300049569 Ga0501032_0140832 Ga0501032_0140832_382_867 147
90 3300049579 Ga0501043_0000149 Ga0501043_0000149_56981_57466 147
91 3300049580 Ga0501046_0000092 Ga0501046_0000092_7793_8278 147
92 3300049581 Ga0501047_0000028 Ga0501047_0000028_162988_163473 147
93 3300049582 Ga0501048_0006680 Ga0501048_0006680_7046_7531 147
94 3300049823 Ga0501044_0272835 Ga0501044_0272835_731_1216 147
95 3300049824 Ga0501045_0000170 Ga0501045_0000170_14212_14697 147
96 3300042144 Ga0450889_021654 Ga0450889_021654_144_602 148
97 iso_pu_bacteria 2511231003 2511250706 148
98 iso_pu_bacteria 2511231026 2511383165 148
99 iso_pu_bacteria 2521172590 2521557186 148
100 iso_pu_bacteria 2548876994 2550696542 148
101 iso_pu_bacteria 2551306416 2553007707 148
102 iso_pu_bacteria 2765235838 2765568317 148
103 iso_pu_bacteria 2808606386 2808983393 148
104 iso_pu_bacteria 2808606415 2809128621 148
105 iso_pu_bacteria 2808606419 2809148242 148
106 iso_pu_bacteria 2818991445 2819591914 148
107 iso_pu_bacteria 2818991449 2819618660 148
108 iso_pu_bacteria 2839094727 2839094821 148
109 iso_pu_bacteria 2852618963 2852620336 148
110 iso_pu_bacteria 2884836552 2884840674 148
111 iso_pu_bacteria 2884852848 2884855931 148
112 iso_pu_bacteria 2896154374 2896157144 148
113 iso_pu_bacteria 2904439833 2904440108 148
114 iso_pu_bacteria 2904530477 2904530956 148
115 iso_pu_bacteria 2904584206 2904587411 148
116 iso_pu_bacteria 2904589729 2904592554 148
117 iso_pu_bacteria 2904601388 2904604654 148
118 iso_pu_bacteria 2919046199 2919050465 148
119 iso_pu_bacteria 2919079590 2919082485 148
120 iso_pu_bacteria 2923510766 2923515812 148
121 iso_pu_bacteria 2928130867 2928133396 148
122 3300002705 JGI25156J39149_1000459 JGI25156J39149_10004591 149
123 3300002705 JGI25156J39149_1020328 JGI25156J39149_10203281 149
124 3300002738 JGI25154J39366_1001802 JGI25154J39366_10018021 149
125 3300002741 JGI25157J39369_1000021 JGI25157J39369_1000021153 149
126 3300003316 rootH1_10015810 rootH1_100158102 149
127 3300003316 rootH1_10028438 rootH1_100284384 149
128 3300003316 rootH1_10033518 rootH1_100335182 149
129 3300003320 rootH2_10019687 rootH2_100196872 149
130 3300003323 rootH1_10021003 rootH1_100210031 149
131 3300003752 Ga0055539_1006291 Ga0055539_10062912 149
132 3300003752 Ga0055539_1007357 Ga0055539_10073572 149
133 3300003761 Ga0055535_1001037 Ga0055535_10010371 149
134 3300003763 Ga0055529_1000860 Ga0055529_10008601 149
135 3300003794 Ga0055531_10000303 Ga0055531_1000030325 149
136 3300005327 Ga0070658_10055065 Ga0070658_100550652 149
137 3300005327 Ga0070658_10546180 Ga0070658_105461801 149
138 3300005327 Ga0070658_10690884 Ga0070658_106908841 149
139 3300005328 Ga0070676_10006846 Ga0070676_100068464 149
140 3300005328 Ga0070676_10031112 Ga0070676_100311122 149
141 3300005329 Ga0070683_100052816 Ga0070683_1000528163 149
142 3300005330 Ga0070690_100258225 Ga0070690_1002582252 149
143 3300005331 Ga0070670_100001932 Ga0070670_10000193213 149
144 3300005331 Ga0070670_100016141 Ga0070670_1000161412 149
145 3300005331 Ga0070670_100030522 Ga0070670_1000305223 149
146 3300005331 Ga0070670_100247824 Ga0070670_1002478242 149
147 3300005331 Ga0070670_100413575 Ga0070670_1004135752 149
148 3300005331 Ga0070670_100454897 Ga0070670_1004548972 149
149 3300005331 Ga0070670_100565065 Ga0070670_1005650651 149
150 3300005333 Ga0070677_10250943 Ga0070677_102509432 149
151 3300005334 Ga0068869_100009386 Ga0068869_1000093866 149
152 3300005334 Ga0068869_100270562 Ga0068869_1002705622 149
153 3300005334 Ga0068869_100280540 Ga0068869_1002805402 149
154 3300005334 Ga0068869_100866308 Ga0068869_1008663082 149
155 3300005334 Ga0068869_100914381 Ga0068869_1009143812 149
156 3300005335 Ga0070666_10118688 Ga0070666_101186882 149
157 3300005335 Ga0070666_10578781 Ga0070666_105787812 149
158 3300005335 Ga0070666_10716842 Ga0070666_107168421 149
159 3300005336 Ga0070680_100951768 Ga0070680_1009517681 149
160 3300005338 Ga0068868_100009443 Ga0068868_1000094432 149
161 3300005338 Ga0068868_100035076 Ga0068868_1000350762 149
162 3300005338 Ga0068868_100637045 Ga0068868_1006370452 149
163 3300005338 Ga0068868_101715614 Ga0068868_1017156141 149
164 3300005339 Ga0070660_100008023 Ga0070660_1000080234 149
165 3300005339 Ga0070660_100341540 Ga0070660_1003415401 149
166 3300005344 Ga0070661_100001088 Ga0070661_1000010883 149
167 3300005344 Ga0070661_100248558 Ga0070661_1002485582 149
168 3300005344 Ga0070661_100394804 Ga0070661_1003948042 149
169 3300005344 Ga0070661_100552539 Ga0070661_1005525392 149
170 3300005347 Ga0070668_100020530 Ga0070668_1000205303 149
171 3300005347 Ga0070668_100743087 Ga0070668_1007430872 149
172 3300005353 Ga0070669_100022076 Ga0070669_1000220762 149
173 3300005354 Ga0070675_100004356 Ga0070675_10000435610 149
174 3300005354 Ga0070675_100013239 Ga0070675_1000132394 149
175 3300005354 Ga0070675_100069593 Ga0070675_1000695932 149
176 3300005355 Ga0070671_100348620 Ga0070671_1003486202 149
177 3300005356 Ga0070674_100226733 Ga0070674_1002267332 149
178 3300005364 Ga0070673_100020834 Ga0070673_1000208342 149
179 3300005364 Ga0070673_100081701 Ga0070673_1000817012 149
180 3300005364 Ga0070673_100093732 Ga0070673_1000937323 149
181 3300005364 Ga0070673_100838826 Ga0070673_1008388262 149
182 3300005364 Ga0070673_101116476 Ga0070673_1011164762 149
183 3300005365 Ga0070688_100163550 Ga0070688_1001635502 149
184 3300005365 Ga0070688_100849343 Ga0070688_1008493432 149
185 3300005366 Ga0070659_100005381 Ga0070659_1000053817 149
186 3300005366 Ga0070659_100189414 Ga0070659_1001894142 149
187 3300005366 Ga0070659_100311689 Ga0070659_1003116892 149
188 3300005367 Ga0070667_100003099 Ga0070667_1000030999 149
189 3300005367 Ga0070667_100012027 Ga0070667_1000120275 149
190 3300005367 Ga0070667_100025446 Ga0070667_1000254463 149
191 3300005367 Ga0070667_100176479 Ga0070667_1001764792 149
192 3300005367 Ga0070667_100783023 Ga0070667_1007830232 149
193 3300005435 Ga0070714_100002739 Ga0070714_1000027398 149
194 3300005455 Ga0070663_100085402 Ga0070663_1000854022 149
195 3300005455 Ga0070663_100426950 Ga0070663_1004269502 149
196 3300005456 Ga0070678_100233511 Ga0070678_1002335112 149
197 3300005456 Ga0070678_101830431 Ga0070678_1018304311 149
198 3300005457 Ga0070662_100010527 Ga0070662_1000105272 149
199 3300005457 Ga0070662_100247329 Ga0070662_1002473292 149
200 3300005457 Ga0070662_101459081 Ga0070662_1014590811 149
201 3300005458 Ga0070681_10034748 Ga0070681_100347482 149
202 3300005459 Ga0068867_100013331 Ga0068867_1000133316 149
203 3300005459 Ga0068867_100059713 Ga0068867_1000597132 149
204 3300005459 Ga0068867_100109452 Ga0068867_1001094522 149
205 3300005459 Ga0068867_100144721 Ga0068867_1001447212 149
206 3300005459 Ga0068867_100236681 Ga0068867_1002366812 149
207 3300005459 Ga0068867_100840446 Ga0068867_1008404461 149
208 3300005466 Ga0070685_10994582 Ga0070685_109945821 149
209 3300005467 Ga0070706_100014174 Ga0070706_1000141744 149
210 3300005468 Ga0070707_100032795 Ga0070707_1000327953 149
211 3300005530 Ga0070679_100029666 Ga0070679_1000296663 149
212 3300005535 Ga0070684_100006747 Ga0070684_1000067476 149
213 3300005535 Ga0070684_101032662 Ga0070684_1010326621 149
214 3300005539 Ga0068853_100022449 Ga0068853_1000224492 149
215 3300005539 Ga0068853_101224347 Ga0068853_1012243471 149
216 3300005543 Ga0070672_100001918 Ga0070672_1000019182 149
217 3300005543 Ga0070672_100007461 Ga0070672_1000074613 149
218 3300005543 Ga0070672_100296542 Ga0070672_1002965422 149
219 3300005548 Ga0070665_100125079 Ga0070665_1001250794 149
220 3300005548 Ga0070665_100176305 Ga0070665_1001763052 149
221 3300005548 Ga0070665_100651882 Ga0070665_1006518822 149
222 3300005548 Ga0070665_100797218 Ga0070665_1007972182 149
223 3300005548 Ga0070665_100849149 Ga0070665_1008491492 149
224 3300005563 Ga0068855_100009898 Ga0068855_1000098989 149
225 3300005563 Ga0068855_100041346 Ga0068855_1000413463 149
226 3300005563 Ga0068855_102205600 Ga0068855_1022056001 149
227 3300005563 Ga0068855_102490390 Ga0068855_1024903901 149
228 3300005564 Ga0070664_100012427 Ga0070664_1000124273 149
229 3300005564 Ga0070664_100051593 Ga0070664_1000515932 149
230 3300005577 Ga0068857_100013188 Ga0068857_1000131886 149
231 3300005577 Ga0068857_100022930 Ga0068857_1000229306 149
232 3300005577 Ga0068857_100025706 Ga0068857_1000257064 149
233 3300005577 Ga0068857_100098504 Ga0068857_1000985042 149
234 3300005577 Ga0068857_100351971 Ga0068857_1003519712 149
235 3300005577 Ga0068857_100430714 Ga0068857_1004307142 149
236 3300005577 Ga0068857_100956919 Ga0068857_1009569192 149
237 3300005578 Ga0068854_100028234 Ga0068854_1000282344 149
238 3300005578 Ga0068854_100090238 Ga0068854_1000902382 149
239 3300005578 Ga0068854_100102161 Ga0068854_1001021612 149
240 3300005578 Ga0068854_100116060 Ga0068854_1001160602 149
241 3300005578 Ga0068854_100615865 Ga0068854_1006158652 149
242 3300005614 Ga0068856_100000887 Ga0068856_1000008871 149
243 3300005614 Ga0068856_100008336 Ga0068856_1000083366 149
244 3300005614 Ga0068856_100069023 Ga0068856_1000690231 149
245 3300005614 Ga0068856_100232885 Ga0068856_1002328852 149
246 3300005616 Ga0068852_100014656 Ga0068852_1000146562 149
247 3300005616 Ga0068852_100299390 Ga0068852_1002993902 149
248 3300005616 Ga0068852_101492726 Ga0068852_1014927261 149
249 3300005616 Ga0068852_102178461 Ga0068852_1021784611 149
250 3300005617 Ga0068859_100124734 Ga0068859_1001247342 149
251 3300005617 Ga0068859_100296945 Ga0068859_1002969452 149
252 3300005618 Ga0068864_100010671 Ga0068864_1000106713 149
253 3300005618 Ga0068864_100170920 Ga0068864_1001709202 149
254 3300005618 Ga0068864_100660326 Ga0068864_1006603262 149
255 3300005618 Ga0068864_100676311 Ga0068864_1006763112 149
256 3300005719 Ga0068861_100117369 Ga0068861_1001173692 149
257 3300005834 Ga0068851_10014082 Ga0068851_100140822 149
258 3300005834 Ga0068851_10099999 Ga0068851_100999992 149
259 3300005840 Ga0068870_10501577 Ga0068870_105015772 149
260 3300005840 Ga0068870_10870479 Ga0068870_108704792 149
261 3300005841 Ga0068863_100018071 Ga0068863_1000180713 149
262 3300005841 Ga0068863_100091707 Ga0068863_1000917072 149
263 3300005841 Ga0068863_100105308 Ga0068863_1001053082 149
264 3300005842 Ga0068858_100365766 Ga0068858_1003657662 149
265 3300005844 Ga0068862_100057571 Ga0068862_1000575712 149
266 3300005844 Ga0068862_100933363 Ga0068862_1009333632 149
267 3300006042 Ga0075368_10045091 Ga0075368_100450912 149
268 3300006042 Ga0075368_10097158 Ga0075368_100971582 149
269 3300006048 Ga0075363_100002386 Ga0075363_1000023865 149
270 3300006048 Ga0075363_100048094 Ga0075363_1000480942 149
271 3300006051 Ga0075364_10028373 Ga0075364_100283733 149
272 3300006177 Ga0075362_10001909 Ga0075362_100019093 149
273 3300006177 Ga0075362_10003213 Ga0075362_100032132 149
274 3300006177 Ga0075362_10044596 Ga0075362_100445962 149
275 3300006177 Ga0075362_10104854 Ga0075362_101048542 149
276 3300006177 Ga0075362_10177192 Ga0075362_101771922 149
277 3300006178 Ga0075367_10099999 Ga0075367_100999992 149
278 3300006178 Ga0075367_10126960 Ga0075367_101269602 149
279 3300006186 Ga0075369_10028500 Ga0075369_100285002 149
280 3300006195 Ga0075366_10005058 Ga0075366_100050583 149
281 3300006195 Ga0075366_10057237 Ga0075366_100572372 149
282 3300006195 Ga0075366_10060280 Ga0075366_100602802 149
283 3300006195 Ga0075366_10081143 Ga0075366_100811432 149
284 3300006195 Ga0075366_10092862 Ga0075366_100928622 149
285 3300006195 Ga0075366_10120320 Ga0075366_101203201 149
286 3300006195 Ga0075366_10174278 Ga0075366_101742782 149
287 3300006195 Ga0075366_10208037 Ga0075366_102080372 149
288 3300006195 Ga0075366_10454329 Ga0075366_104543292 149
289 3300006195 Ga0075366_10658274 Ga0075366_106582741 149
290 3300006353 Ga0075370_10000059 Ga0075370_100000597 149
291 3300006353 Ga0075370_10000087 Ga0075370_100000872 149
292 3300006353 Ga0075370_10000813 Ga0075370_100008133 149
293 3300006353 Ga0075370_10002533 Ga0075370_100025332 149
294 3300006353 Ga0075370_10071038 Ga0075370_100710382 149
295 3300006353 Ga0075370_10165448 Ga0075370_101654482 149
296 3300006353 Ga0075370_10274767 Ga0075370_102747672 149
297 3300006353 Ga0075370_10313695 Ga0075370_103136952 149
298 3300006358 Ga0068871_100392947 Ga0068871_1003929472 149
299 3300006844 Ga0075428_100188651 Ga0075428_1001886513 149
300 3300006871 Ga0075434_101580907 Ga0075434_1015809071 149
301 3300006881 Ga0068865_100276381 Ga0068865_1002763812 149
302 3300006931 Ga0097620_100124739 Ga0097620_1001247392 149
303 3300006931 Ga0097620_100296946 Ga0097620_1002969462 149
304 3300009093 Ga0105240_10001001 Ga0105240_1000100135 149
305 3300009093 Ga0105240_10110979 Ga0105240_101109792 149
306 3300009093 Ga0105240_10580327 Ga0105240_105803271 149
307 3300009093 Ga0105240_11387397 Ga0105240_113873971 149
308 3300009093 Ga0105240_11511099 Ga0105240_115110991 149
309 3300009094 Ga0111539_11726941 Ga0111539_117269412 149
310 3300009098 Ga0105245_10055064 Ga0105245_100550642 149
311 3300009098 Ga0105245_10702000 Ga0105245_107020002 149
312 3300009098 Ga0105245_10767526 Ga0105245_107675262 149
313 3300009098 Ga0105245_10791525 Ga0105245_107915252 149
314 3300009098 Ga0105245_11483078 Ga0105245_114830782 149
315 3300009101 Ga0105247_10209395 Ga0105247_102093952 149
316 3300009101 Ga0105247_10260653 Ga0105247_102606532 149
317 3300009148 Ga0105243_10020375 Ga0105243_100203753 149
318 3300009148 Ga0105243_11877900 Ga0105243_118779002 149
319 3300009174 Ga0105241_10079604 Ga0105241_100796042 149
320 3300009174 Ga0105241_10082320 Ga0105241_100823203 149
321 3300009174 Ga0105241_10101868 Ga0105241_101018682 149
322 3300009174 Ga0105241_11137689 Ga0105241_111376891 149
323 3300009176 Ga0105242_10185158 Ga0105242_101851583 149
324 3300009177 Ga0105248_10331566 Ga0105248_103315662 149
325 3300009177 Ga0105248_10827088 Ga0105248_108270882 149
326 3300009177 Ga0105248_10979732 Ga0105248_109797322 149
327 3300009177 Ga0105248_11305591 Ga0105248_113055912 149
328 3300009177 Ga0105248_13176897 Ga0105248_131768971 149
329 3300009545 Ga0105237_10045864 Ga0105237_100458642 149
330 3300009545 Ga0105237_10208760 Ga0105237_102087602 149
331 3300009545 Ga0105237_10251517 Ga0105237_102515173 149
332 3300009551 Ga0105238_10002979 Ga0105238_100029798 149
333 3300009551 Ga0105238_10690928 Ga0105238_106909282 149
334 3300009551 Ga0105238_10777075 Ga0105238_107770751 149
335 3300009553 Ga0105249_11428734 Ga0105249_114287342 149
336 3300010375 Ga0105239_10010208 Ga0105239_100102089 149
337 3300010375 Ga0105239_10337678 Ga0105239_103376782 149
338 3300010375 Ga0105239_12366395 Ga0105239_123663951 149
339 3300010375 Ga0105239_12503689 Ga0105239_125036892 149
340 3300011119 Ga0105246_10041666 Ga0105246_100416663 149
341 3300013100 Ga0157373_10030602 Ga0157373_100306023 149
342 3300013104 Ga0157370_10005091 Ga0157370_100050917 149
343 3300013105 Ga0157369_10005877 Ga0157369_100058777 149
344 3300013105 Ga0157369_10112116 Ga0157369_101121162 149
345 3300013296 Ga0157374_10099755 Ga0157374_100997552 149
346 3300013296 Ga0157374_10181754 Ga0157374_101817542 149
347 3300013296 Ga0157374_11080750 Ga0157374_110807501 149
348 3300013297 Ga0157378_10238755 Ga0157378_102387552 149
349 3300013297 Ga0157378_11353466 Ga0157378_113534662 149
350 3300013306 Ga0163162_10322669 Ga0163162_103226693 149
351 3300013306 Ga0163162_10343177 Ga0163162_103431772 149
352 3300013306 Ga0163162_12085872 Ga0163162_120858721 149
353 3300013307 Ga0157372_10023891 Ga0157372_100238913 149
354 3300013307 Ga0157372_10345474 Ga0157372_103454742 149
355 3300013308 Ga0157375_10099480 Ga0157375_100994803 149
356 3300013308 Ga0157375_10103460 Ga0157375_101034603 149
357 3300013308 Ga0157375_10133410 Ga0157375_101334102 149
358 3300013308 Ga0157375_10133527 Ga0157375_101335272 149
359 3300013308 Ga0157375_10534409 Ga0157375_105344092 149
360 3300014325 Ga0163163_10007845 Ga0163163_100078455 149
361 3300014325 Ga0163163_10349218 Ga0163163_103492182 149
362 3300014325 Ga0163163_10453346 Ga0163163_104533462 149
363 3300014326 Ga0157380_10484356 Ga0157380_104843562 149
364 3300014968 Ga0157379_10001790 Ga0157379_100017904 149
365 3300014968 Ga0157379_10028002 Ga0157379_100280024 149
366 3300014968 Ga0157379_10301397 Ga0157379_103013972 149
367 3300014968 Ga0157379_10447386 Ga0157379_104473861 149
368 3300014968 Ga0157379_11098943 Ga0157379_110989431 149
369 3300014968 Ga0157379_12395590 Ga0157379_123955901 149
370 3300015262 Ga0182007_10101261 Ga0182007_101012611 149
371 3300015262 Ga0182007_10234420 Ga0182007_102344202 149
372 3300017792 Ga0163161_10803624 Ga0163161_108036241 149
373 3300017792 Ga0163161_11531719 Ga0163161_115317191 149
374 3300021361 Ga0213872_10000058 Ga0213872_1000005870 149
375 3300021361 Ga0213872_10000102 Ga0213872_1000010253 149
376 3300021361 Ga0213872_10000150 Ga0213872_1000015010 149
377 3300021361 Ga0213872_10153162 Ga0213872_101531622 149
378 3300021361 Ga0213872_10339958 Ga0213872_103399581 149
379 3300025242 Ga0209258_100736 Ga0209258_1007363 149
380 3300025242 Ga0209258_100787 Ga0209258_1007872 149
381 3300025246 Ga0209646_1000060 Ga0209646_10000603 149
382 3300025250 Ga0209026_1000049 Ga0209026_10000491 149
383 3300025253 Ga0209677_101394 Ga0209677_1013941 149
384 3300025253 Ga0209677_109255 Ga0209677_1092551 149
385 3300025254 Ga0209148_1022957 Ga0209148_10229571 149
386 3300025256 Ga0209759_1000069 Ga0209759_10000691 149
387 3300025256 Ga0209759_1001582 Ga0209759_100158210 149
388 3300025256 Ga0209759_1002582 Ga0209759_10025822 149
389 3300025256 Ga0209759_1016603 Ga0209759_10166032 149
390 3300025256 Ga0209759_1020690 Ga0209759_10206902 149
391 3300025272 Ga0209455_1002003 Ga0209455_10020031 149
392 3300025272 Ga0209455_1029989 Ga0209455_10299891 149
393 3300025297 Ga0209758_1000233 Ga0209758_100023323 149
394 3300025303 Ga0209051_1000140 Ga0209051_10001402 149
395 3300025303 Ga0209051_1001699 Ga0209051_100169916 149
396 3300025304 Ga0209257_1000012 Ga0209257_1000012838 149
397 3300025304 Ga0209257_1000045 Ga0209257_1000045244 149
398 3300025304 Ga0209257_1063458 Ga0209257_10634581 149
399 3300025315 Ga0207697_10185402 Ga0207697_101854022 149
400 3300025321 Ga0207656_10018424 Ga0207656_100184242 149
401 3300025321 Ga0207656_10106539 Ga0207656_101065392 149
402 3300025321 Ga0207656_10407251 Ga0207656_104072512 149
403 3300025900 Ga0207710_10166332 Ga0207710_101663322 149
404 3300025903 Ga0207680_10301289 Ga0207680_103012892 149
405 3300025907 Ga0207645_10004810 Ga0207645_100048104 149
406 3300025907 Ga0207645_10034993 Ga0207645_100349932 149
407 3300025908 Ga0207643_10089604 Ga0207643_100896042 149
408 3300025908 Ga0207643_10164665 Ga0207643_101646652 149
409 3300025909 Ga0207705_10035791 Ga0207705_100357914 149
410 3300025909 Ga0207705_10162995 Ga0207705_101629952 149
411 3300025910 Ga0207684_10012635 Ga0207684_100126353 149
412 3300025911 Ga0207654_10378130 Ga0207654_103781302 149
413 3300025911 Ga0207654_10834454 Ga0207654_108344541 149
414 3300025912 Ga0207707_10036063 Ga0207707_100360632 149
415 3300025913 Ga0207695_10030732 Ga0207695_100307322 149
416 3300025913 Ga0207695_10099795 Ga0207695_100997951 149
417 3300025913 Ga0207695_10255540 Ga0207695_102555402 149
418 3300025914 Ga0207671_10046969 Ga0207671_100469692 149
419 3300025914 Ga0207671_10225306 Ga0207671_102253061 149
420 3300025914 Ga0207671_10775753 Ga0207671_107757532 149
421 3300025917 Ga0207660_10906699 Ga0207660_109066992 149
422 3300025917 Ga0207660_10990277 Ga0207660_109902771 149
423 3300025919 Ga0207657_10024892 Ga0207657_100248923 149
424 3300025919 Ga0207657_10286982 Ga0207657_102869821 149
425 3300025920 Ga0207649_10002217 Ga0207649_100022172 149
426 3300025920 Ga0207649_10563024 Ga0207649_105630242 149
427 3300025921 Ga0207652_10047116 Ga0207652_100471162 149
428 3300025921 Ga0207652_10310463 Ga0207652_103104631 149
429 3300025922 Ga0207646_10198051 Ga0207646_101980512 149
430 3300025923 Ga0207681_10005071 Ga0207681_100050712 149
431 3300025924 Ga0207694_10010773 Ga0207694_100107733 149
432 3300025924 Ga0207694_10384437 Ga0207694_103844372 149
433 3300025925 Ga0207650_10022889 Ga0207650_100228893 149
434 3300025925 Ga0207650_10023873 Ga0207650_100238732 149
435 3300025925 Ga0207650_10050850 Ga0207650_100508502 149
436 3300025925 Ga0207650_10053437 Ga0207650_100534373 149
437 3300025925 Ga0207650_10370508 Ga0207650_103705082 149
438 3300025925 Ga0207650_10373791 Ga0207650_103737912 149
439 3300025926 Ga0207659_10009257 Ga0207659_100092575 149
440 3300025926 Ga0207659_10110207 Ga0207659_101102072 149
441 3300025926 Ga0207659_10587076 Ga0207659_105870762 149
442 3300025927 Ga0207687_10060589 Ga0207687_100605893 149
443 3300025927 Ga0207687_10241914 Ga0207687_102419142 149
444 3300025927 Ga0207687_11504785 Ga0207687_115047851 149
445 3300025929 Ga0207664_10050874 Ga0207664_100508742 149
446 3300025931 Ga0207644_10017024 Ga0207644_100170242 149
447 3300025931 Ga0207644_10092568 Ga0207644_100925682 149
448 3300025931 Ga0207644_10332254 Ga0207644_103322542 149
449 3300025931 Ga0207644_10362591 Ga0207644_103625912 149
450 3300025931 Ga0207644_11190387 Ga0207644_111903871 149
451 3300025932 Ga0207690_10013867 Ga0207690_100138673 149
452 3300025932 Ga0207690_10189386 Ga0207690_101893862 149
453 3300025933 Ga0207706_10074485 Ga0207706_100744852 149
454 3300025933 Ga0207706_10132942 Ga0207706_101329422 149
455 3300025934 Ga0207686_10276959 Ga0207686_102769593 149
456 3300025935 Ga0207709_11177358 Ga0207709_111773582 149
457 3300025937 Ga0207669_10068061 Ga0207669_100680612 149
458 3300025937 Ga0207669_10535201 Ga0207669_105352012 149
459 3300025940 Ga0207691_10004143 Ga0207691_100041433 149
460 3300025940 Ga0207691_10006762 Ga0207691_1000676210 149
461 3300025940 Ga0207691_10061422 Ga0207691_100614222 149
462 3300025941 Ga0207711_10011889 Ga0207711_100118894 149
463 3300025941 Ga0207711_10549147 Ga0207711_105491472 149
464 3300025941 Ga0207711_10620816 Ga0207711_106208162 149
465 3300025942 Ga0207689_10147813 Ga0207689_101478132 149
466 3300025942 Ga0207689_10584203 Ga0207689_105842032 149
467 3300025942 Ga0207689_10757036 Ga0207689_107570362 149
468 3300025944 Ga0207661_10028466 Ga0207661_100284662 149
469 3300025944 Ga0207661_10866758 Ga0207661_108667582 149
470 3300025945 Ga0207679_10117544 Ga0207679_101175441 149
471 3300025945 Ga0207679_10139525 Ga0207679_101395252 149
472 3300025945 Ga0207679_10850953 Ga0207679_108509532 149
473 3300025949 Ga0207667_10028711 Ga0207667_100287112 149
474 3300025949 Ga0207667_12123069 Ga0207667_121230691 149
475 3300025960 Ga0207651_10069538 Ga0207651_100695381 149
476 3300025960 Ga0207651_10088444 Ga0207651_100884442 149
477 3300025960 Ga0207651_10105872 Ga0207651_101058723 149
478 3300025960 Ga0207651_10413338 Ga0207651_104133381 149
479 3300025960 Ga0207651_11251062 Ga0207651_112510621 149
480 3300025972 Ga0207668_10012253 Ga0207668_100122533 149
481 3300025972 Ga0207668_10247602 Ga0207668_102476022 149
482 3300025972 Ga0207668_10407248 Ga0207668_104072482 149
483 3300025972 Ga0207668_11296762 Ga0207668_112967621 149
484 3300025981 Ga0207640_10031492 Ga0207640_100314925 149
485 3300025981 Ga0207640_10112897 Ga0207640_101128972 149
486 3300025981 Ga0207640_10212227 Ga0207640_102122272 149
487 3300025981 Ga0207640_10380006 Ga0207640_103800062 149
488 3300025986 Ga0207658_10047106 Ga0207658_100471062 149
489 3300025986 Ga0207658_10050043 Ga0207658_100500432 149
490 3300025986 Ga0207658_10061349 Ga0207658_100613493 149
491 3300025986 Ga0207658_10125710 Ga0207658_101257102 149
492 3300025986 Ga0207658_10968704 Ga0207658_109687041 149
493 3300026023 Ga0207677_10031338 Ga0207677_100313382 149
494 3300026023 Ga0207677_10051376 Ga0207677_100513762 149
495 3300026023 Ga0207677_10774884 Ga0207677_107748841 149
496 3300026023 Ga0207677_11011251 Ga0207677_110112512 149
497 3300026035 Ga0207703_10003194 Ga0207703_100031942 149
498 3300026035 Ga0207703_10399632 Ga0207703_103996322 149
499 3300026041 Ga0207639_10075141 Ga0207639_100751412 149
500 3300026041 Ga0207639_10144245 Ga0207639_101442452 149
501 3300026041 Ga0207639_11096435 Ga0207639_110964352 149
502 3300026041 Ga0207639_11415759 Ga0207639_114157592 149
503 3300026067 Ga0207678_10106297 Ga0207678_101062972 149
504 3300026067 Ga0207678_10373059 Ga0207678_103730592 149
505 3300026078 Ga0207702_10022449 Ga0207702_100224491 149
506 3300026078 Ga0207702_10083504 Ga0207702_100835042 149
507 3300026088 Ga0207641_10009598 Ga0207641_100095982 149
508 3300026088 Ga0207641_10026935 Ga0207641_100269353 149
509 3300026088 Ga0207641_10272468 Ga0207641_102724682 149
510 3300026089 Ga0207648_10003372 Ga0207648_100033728 149
511 3300026089 Ga0207648_10038891 Ga0207648_100388912 149
512 3300026089 Ga0207648_10071567 Ga0207648_100715672 149
513 3300026089 Ga0207648_10160108 Ga0207648_101601082 149
514 3300026089 Ga0207648_10506563 Ga0207648_105065632 149
515 3300026089 Ga0207648_10542851 Ga0207648_105428512 149
516 3300026095 Ga0207676_10003896 Ga0207676_100038964 149
517 3300026095 Ga0207676_10037088 Ga0207676_100370882 149
518 3300026095 Ga0207676_10620870 Ga0207676_106208702 149
519 3300026116 Ga0207674_10000954 Ga0207674_1000095430 149
520 3300026116 Ga0207674_10006659 Ga0207674_1000665914 149
521 3300026116 Ga0207674_10022384 Ga0207674_100223842 149
522 3300026116 Ga0207674_10121427 Ga0207674_101214271 149
523 3300026116 Ga0207674_10435399 Ga0207674_104353992 149
524 3300026116 Ga0207674_10437071 Ga0207674_104370712 149
525 3300026116 Ga0207674_10636845 Ga0207674_106368452 149
526 3300026116 Ga0207674_11234974 Ga0207674_112349741 149
527 3300026118 Ga0207675_100037965 Ga0207675_1000379654 149
528 3300026118 Ga0207675_100454833 Ga0207675_1004548332 149
529 3300026121 Ga0207683_10093306 Ga0207683_100933062 149
530 3300026142 Ga0207698_10007618 Ga0207698_100076183 149
531 3300026142 Ga0207698_10698688 Ga0207698_106986882 149
532 3300026142 Ga0207698_10767765 Ga0207698_107677651 149
533 3300027866 Ga0209813_10008368 Ga0209813_100083682 149
534 3300027866 Ga0209813_10140803 Ga0209813_101408032 149
535 3300028379 Ga0268266_10037951 Ga0268266_100379512 149
536 3300028379 Ga0268266_10707477 Ga0268266_107074772 149
537 3300028380 Ga0268265_10016151 Ga0268265_100161513 149
538 3300028380 Ga0268265_10031173 Ga0268265_100311733 149
539 3300028380 Ga0268265_12588079 Ga0268265_125880791 149
540 3300028381 Ga0268264_10149599 Ga0268264_101495992 149
541 3300028381 Ga0268264_10241375 Ga0268264_102413752 149
542 3300028381 Ga0268264_10804770 Ga0268264_108047701 149
543 3300028666 Ga0265336_10000123 Ga0265336_1000012351 149
544 3300028786 Ga0307517_10002354 Ga0307517_1000235413 149
545 3300028786 Ga0307517_10077719 Ga0307517_100777193 149
546 3300028786 Ga0307517_10318467 Ga0307517_103184672 149
547 3300028794 Ga0307515_10015864 Ga0307515_100158645 149
548 3300028794 Ga0307515_10106461 Ga0307515_101064612 149
549 3300028794 Ga0307515_10254589 Ga0307515_102545892 149
550 3300028794 Ga0307515_10583058 Ga0307515_105830581 149
551 3300029957 Ga0265324_10000849 Ga0265324_100008491 149
552 3300030521 Ga0307511_10253296 Ga0307511_102532961 149
553 3300030522 Ga0307512_10182106 Ga0307512_101821062 149
554 3300030522 Ga0307512_10233028 Ga0307512_102330282 149
555 3300030522 Ga0307512_10252093 Ga0307512_102520931 149
556 3300031250 Ga0265331_10058535 Ga0265331_100585352 149
557 3300031251 Ga0265327_10000328 Ga0265327_1000032851 149
558 3300031456 Ga0307513_10021976 Ga0307513_100219763 149
559 3300031456 Ga0307513_10195711 Ga0307513_101957112 149
560 3300031456 Ga0307513_10380145 Ga0307513_103801452 149
561 3300031507 Ga0307509_10000234 Ga0307509_1000023437 149
562 3300031507 Ga0307509_10039607 Ga0307509_100396074 149
563 3300031507 Ga0307509_10090207 Ga0307509_100902073 149
564 3300031507 Ga0307509_10112558 Ga0307509_101125583 149
565 3300031507 Ga0307509_10120503 Ga0307509_101205032 149
566 3300031507 Ga0307509_10902039 Ga0307509_109020391 149
567 3300031548 Ga0307408_100211432 Ga0307408_1002114322 149
568 3300031616 Ga0307508_10001066 Ga0307508_100010662 149
569 3300031616 Ga0307508_10088896 Ga0307508_100888962 149
570 3300031649 Ga0307514_10052858 Ga0307514_100528582 149
571 3300031649 Ga0307514_10062249 Ga0307514_100622493 149
572 3300031649 Ga0307514_10253912 Ga0307514_102539122 149
573 3300031649 Ga0307514_10414020 Ga0307514_104140202 149
574 3300031730 Ga0307516_10037289 Ga0307516_100372894 149
575 3300031730 Ga0307516_10090008 Ga0307516_100900082 149
576 3300031730 Ga0307516_10124340 Ga0307516_101243402 149
577 3300031730 Ga0307516_10143470 Ga0307516_101434702 149
578 3300031730 Ga0307516_10613533 Ga0307516_106135332 149
579 3300031730 Ga0307516_10629741 Ga0307516_106297411 149
580 3300031730 Ga0307516_10769828 Ga0307516_107698281 149
581 3300031824 Ga0307413_10017248 Ga0307413_100172482 149
582 3300031824 Ga0307413_11501109 Ga0307413_115011091 149
583 3300031838 Ga0307518_10357644 Ga0307518_103576442 149
584 3300031852 Ga0307410_10283779 Ga0307410_102837792 149
585 3300031911 Ga0307412_10401022 Ga0307412_104010222 149
586 3300031995 Ga0307409_100372205 Ga0307409_1003722052 149
587 3300032002 Ga0307416_102294687 Ga0307416_1022946871 149
588 3300032004 Ga0307414_10689805 Ga0307414_106898052 149
589 3300032005 Ga0307411_10044945 Ga0307411_100449452 149
590 3300032005 Ga0307411_10321696 Ga0307411_103216962 149
591 3300032126 Ga0307415_100740945 Ga0307415_1007409452 149
592 3300032126 Ga0307415_101200948 Ga0307415_1012009482 149
593 3300033180 Ga0307510_10012165 Ga0307510_100121658 149
594 3300033180 Ga0307510_10032961 Ga0307510_100329612 149
595 3300035171 Ga0373946_0066198 Ga0373946_0066198_265_729 149
596 3300035691 Ga0373931_0025723 Ga0373931_0025723_1929_2405 149
597 3300036401 Ga0373937_0179223 Ga0373937_0179223_190_648 149
598 3300036401 Ga0373937_0669136 Ga0373937_0669136_143_604 149
599 3300037312 Ga0395899_0195598 Ga0395899_0195598_528_1004 149
600 3300037312 Ga0395899_0204210 Ga0395899_0204210_108_584 149
601 3300037466 Ga0395898_0038029 Ga0395898_0038029_370_846 149
602 3300038443 Ga0395901_0029531 Ga0395901_0029531_4934_5410 149
603 3300039447 Ga0436361_0018388 Ga0436361_0018388_8761_9231 149
604 3300039447 Ga0436361_0068556 Ga0436361_0068556_48920_49390 149
605 3300039447 Ga0436361_0614815 Ga0436361_0614815_22291_22752 149
606 3300039447 Ga0436361_0651406 Ga0436361_0651406_2077_2553 149
607 3300039447 Ga0436361_0658018 Ga0436361_0658018_112_573 149
608 3300039447 Ga0436361_0704442 Ga0436361_0704442_80_556 149
609 3300039447 Ga0436361_1078434 Ga0436361_1078434_33_509 149
610 3300041451 Ga0451791_0302276 Ga0451791_0302276_142_603 149
611 3300041456 Ga0451795_1577239 Ga0451795_1577239_122_583 149
612 3300041494 Ga0451837_1131948 Ga0451837_1131948_25_486 149
613 3300041512 Ga0451853_1225302 Ga0451853_1225302_453_914 149
614 3300041512 Ga0451853_1592565 Ga0451853_1592565_502_963 149
615 3300042005 Ga0439448_0323230 Ga0439448_0323230_24_485 149
616 3300044683 Ga0466965_0030229 Ga0466965_0030229_1670_2146 149
617 3300044706 Ga0466964_0004400 Ga0466964_0004400_12_488 149
618 3300044735 Ga0466968_0068366 Ga0466968_0068366_501_977 149
619 3300044765 Ga0466970_0011861 Ga0466970_0011861_494_970 149
620 3300044842 Ga0466957_0028524 Ga0466957_0028524_144_620 149
621 3300044842 Ga0466957_0571936 Ga0466957_0571936_159_620 149
622 3300045049 Ga0466959_0022300 Ga0466959_0022300_18_494 149
623 3300045051 Ga0451576_0978897 Ga0451576_0978897_378_836 149
624 3300045836 Ga0466958_0153786 Ga0466958_0153786_264_740 149
625 3300045976 Ga0466967_0234772 Ga0466967_0234772_379_855 149
626 3300045976 Ga0466967_0379341 Ga0466967_0379341_43_519 149
627 3300045976 Ga0466967_0635782 Ga0466967_0635782_335_796 149
628 3300045976 Ga0466967_0962078 Ga0466967_0962078_270_722 149
629 3300045976 Ga0466967_1447903 Ga0466967_1447903_56_508 149
630 3300046454 Ga0495592_0000291 Ga0495592_0000291_29991_30452 149
631 3300046460 Ga0495638_0118661 Ga0495638_0118661_241_702 149
632 3300046460 Ga0495638_0276953 Ga0495638_0276953_422_883 149
633 3300046462 Ga0495651_0387051 Ga0495651_0387051_367_843 149
634 3300046471 Ga0495650_0053966 Ga0495650_0053966_816_1292 149
635 3300046471 Ga0495650_0085334 Ga0495650_0085334_38_499 149
636 3300046473 Ga0495582_0254919 Ga0495582_0254919_217_678 149
637 3300046474 Ga0495605_0082544 Ga0495605_0082544_360_821 149
638 3300046477 Ga0495664_0201984 Ga0495664_0201984_55_507 149
639 3300046501 Ga0495607_0200564 Ga0495607_0200564_45_506 149
640 3300046506 Ga0495583_0000046 Ga0495583_0000046_217302_217778 149
641 3300046506 Ga0495583_0312776 Ga0495583_0312776_50_511 149
642 3300046512 Ga0495610_0053848 Ga0495610_0053848_101_562 149
643 3300046516 Ga0495628_0051863 Ga0495628_0051863_1869_2321 149
644 3300046519 Ga0495632_0006200 Ga0495632_0006200_7066_7527 149
645 3300046524 Ga0495648_0303349 Ga0495648_0303349_186_647 149
646 3300046526 Ga0495666_0021091 Ga0495666_0021091_1507_1968 149
647 3300046542 Ga0495597_0003922 Ga0495597_0003922_6061_6522 149
648 3300046542 Ga0495597_0024542 Ga0495597_0024542_931_1392 149
649 3300046542 Ga0495597_0134198 Ga0495597_0134198_412_873 149
650 3300046543 Ga0495645_0071213 Ga0495645_0071213_312_764 149
651 3300046557 Ga0495622_0025296 Ga0495622_0025296_2090_2551 149
652 3300046616 Ga0495668_0072851 Ga0495668_0072851_252_788 149
653 3300046648 Ga0495611_0221658 Ga0495611_0221658_353_814 149
654 3300046660 Ga0495625_0036997 Ga0495625_0036997_2079_2540 149
655 3300046660 Ga0495625_0150118 Ga0495625_0150118_389_850 149
656 3300046660 Ga0495625_0321463 Ga0495625_0321463_445_906 149
657 3300046681 Ga0495647_0334470 Ga0495647_0334470_213_674 149
658 3300046683 Ga0495658_0004796 Ga0495658_0004796_2633_3094 149
659 3300046683 Ga0495658_0454283 Ga0495658_0454283_120_581 149
660 3300046683 Ga0495658_0693015 Ga0495658_0693015_154_618 149
661 3300046689 Ga0495613_0603713 Ga0495613_0603713_215_676 149
662 3300046690 Ga0495624_0056474 Ga0495624_0056474_334_795 149
663 3300046692 Ga0495671_0111819 Ga0495671_0111819_481_942 149
664 3300046692 Ga0495671_0154985 Ga0495671_0154985_51_512 149
665 3300046692 Ga0495671_0363925 Ga0495671_0363925_140_601 149
666 3300046692 Ga0495671_0598998 Ga0495671_0598998_17_478 149
667 3300046694 Ga0495649_0000638 Ga0495649_0000638_164_640 149
668 3300046694 Ga0495649_0037138 Ga0495649_0037138_1952_2413 149
669 3300046810 Ga0495660_0024873 Ga0495660_0024873_899_1360 149
670 3300047443 Ga0495687_000367 Ga0495687_000367_48199_48660 149
671 3300047443 Ga0495687_011817 Ga0495687_011817_2184_2645 149
672 3300047469 Ga0495673_0156408 Ga0495673_0156408_363_824 149
673 3300047472 Ga0495686_0029542 Ga0495686_0029542_2544_3005 149
674 3300047472 Ga0495686_0145468 Ga0495686_0145468_588_1064 149
675 3300047673 Ga0495593_0031997 Ga0495593_0031997_2305_2766 149
676 3300048089 Ga0495614_0287908 Ga0495614_0287908_259_720 149
677 3300048091 Ga0495626_0074869 Ga0495626_0074869_741_1202 149
678 3300048904 Ga0496101_1162577 Ga0496101_1162577_74_535 149
679 3300048911 Ga0496108_0054157 Ga0496108_0054157_633_1085 149
680 3300048911 Ga0496108_0475861 Ga0496108_0475861_331_783 149
681 3300048912 Ga0496109_0023407 Ga0496109_0023407_408_860 149
682 3300048914 Ga0496111_0149444 Ga0496111_0149444_73_525 149
683 3300048915 Ga0496112_0000429 Ga0496112_0000429_9319_9771 149
684 3300048915 Ga0496112_0207877 Ga0496112_0207877_85_537 149
685 3300048915 Ga0496112_1081738 Ga0496112_1081738_188_649 149
686 3300048916 Ga0496113_0400549 Ga0496113_0400549_146_607 149
687 3300048917 Ga0496114_0322714 Ga0496114_0322714_93_554 149
688 3300048918 Ga0496115_0416682 Ga0496115_0416682_166_642 149
689 3300048927 Ga0496124_0469914 Ga0496124_0469914_61_528 149
690 3300049460 Ga0495682_0276103 Ga0495682_0276103_43_504 149
691 3300049571 Ga0501034_0257622 Ga0501034_0257622_1081_1542 149
692 3300049588 Ga0501072_0586099 Ga0501072_0586099_75_533 149
693 3300049763 Ga0501266_000057 Ga0501266_000057_10271_10732 149
694 3300050489 nmdc:mga03683_10952_c1 nmdc:mga03683_10952_c1_2152_2613 149
695 3300050489 nmdc:mga03683_120460_c1 nmdc:mga03683_120460_c1_133_594 149
696 3300050489 nmdc:mga03683_19823_c1 nmdc:mga03683_19823_c1_1510_1971 149
697 3300050490 nmdc:mga03n38_230957_c1 nmdc:mga03n38_230957_c1_219_680 149
698 3300050490 nmdc:mga03n38_48533_c1 nmdc:mga03n38_48533_c1_542_1003 149
699 3300050491 nmdc:mga00v17_10380_c1 nmdc:mga00v17_10380_c1_3644_4105 149
700 3300050493 nmdc:mga0k408_11251_c1 nmdc:mga0k408_11251_c1_1980_2441 149
701 3300050493 nmdc:mga0k408_198791_c1 nmdc:mga0k408_198791_c1_566_1027 149
702 3300050493 nmdc:mga0k408_2308_c1 nmdc:mga0k408_2308_c1_3520_3981 149
703 3300050493 nmdc:mga0k408_27898_c1 nmdc:mga0k408_27898_c1_1851_2312 149
704 3300050493 nmdc:mga0k408_355_c1 nmdc:mga0k408_355_c1_10608_11069 149
705 3300050493 nmdc:mga0k408_40234_c1 nmdc:mga0k408_40234_c1_1201_1662 149
706 3300050493 nmdc:mga0k408_61790_c1 nmdc:mga0k408_61790_c1_1667_2131 149
707 3300050493 nmdc:mga0k408_68274_c1 nmdc:mga0k408_68274_c1_550_1011 149
708 3300050493 nmdc:mga0k408_69103_c1 nmdc:mga0k408_69103_c1_718_1179 149
709 3300050493 nmdc:mga0k408_8262_c1 nmdc:mga0k408_8262_c1_141_602 149
710 3300050494 nmdc:mga06z11_127044_c1 nmdc:mga06z11_127044_c1_579_1040 149
711 3300050494 nmdc:mga06z11_165950_c1 nmdc:mga06z11_165950_c1_588_1052 149
712 3300050494 nmdc:mga06z11_5785_c1 nmdc:mga06z11_5785_c1_4127_4588 149
713 3300050495 nmdc:mga04h51_11203_c1 nmdc:mga04h51_11203_c1_750_1211 149
714 3300050495 nmdc:mga04h51_160506_c1 nmdc:mga04h51_160506_c1_255_716 149
715 3300050496 nmdc:mga07m45_10918_c1 nmdc:mga07m45_10918_c1_3495_3956 149
716 3300050496 nmdc:mga07m45_1116_c1 nmdc:mga07m45_1116_c1_315_791 149
717 3300050496 nmdc:mga07m45_175262_c1 nmdc:mga07m45_175262_c1_703_1164 149
718 3300050496 nmdc:mga07m45_216266_c1 nmdc:mga07m45_216266_c1_253_717 149
719 3300050496 nmdc:mga07m45_2223_c1 nmdc:mga07m45_2223_c1_6455_6916 149
720 3300050496 nmdc:mga07m45_27823_c1 nmdc:mga07m45_27823_c1_2209_2670 149
721 3300050496 nmdc:mga07m45_398480_c1 nmdc:mga07m45_398480_c1_246_707 149
722 3300050496 nmdc:mga07m45_6961_c1 nmdc:mga07m45_6961_c1_3294_3755 149
723 3300050496 nmdc:mga07m45_7118_c1 nmdc:mga07m45_7118_c1_4776_5237 149
724 3300050496 nmdc:mga07m45_7357_c1 nmdc:mga07m45_7357_c1_115_576 149
725 3300050512 nmdc:mga0n895_1200895_c1 nmdc:mga0n895_1200895_c1_162_614 149
726 3300050516 nmdc:mga0sz30_176495_c1 nmdc:mga0sz30_176495_c1_43_504 149
727 3300053077 Ga0495601_0498003 Ga0495601_0498003_277_729 149
728 3300053088 Ga0500644_0100473 Ga0500644_0100473_308_769 149
729 3300053093 Ga0500651_0028942 Ga0500651_0028942_1581_2042 149
730 3300053093 Ga0500651_0058855 Ga0500651_0058855_979_1440 149
731 3300053093 Ga0500651_0422206 Ga0500651_0422206_20_481 149
732 3300053134 Ga0500658_0002097 Ga0500658_0002097_5862_6323 149
733 3300053136 Ga0500559_0000119 Ga0500559_0000119_58041_58502 149
734 3300053138 Ga0500564_107433 Ga0500564_107433_731_1207 149
735 3300053138 Ga0500564_113828 Ga0500564_113828_55_516 149
736 3300053138 Ga0500564_138173 Ga0500564_138173_314_790 149
737 3300053139 Ga0500568_0005734 Ga0500568_0005734_2401_2937 149
738 3300053156 Ga0500622_0005643 Ga0500622_0005643_4957_5418 149
739 3300053177 Ga0500636_0045101 Ga0500636_0045101_726_1202 149
740 3300053177 Ga0500636_0132989 Ga0500636_0132989_103_564 149
741 3300053739 Ga0500587_004225 Ga0500587_004225_1447_1908 149
742 3300055283 Ga0500661_014650 Ga0500661_014650_23_499 149
743 3300060353 Ga0501082_0504992 Ga0501082_0504992_578_1036 149
744 3300061719 Ga0466962_0057998 Ga0466962_0057998_519_995 149
745 3300003792 Ga0055540_1098486 Ga0055540_10984861 150
746 3300005330 Ga0070690_100884353 Ga0070690_1008843532 150
747 3300005345 Ga0070692_10004158 Ga0070692_100041582 150
748 3300005347 Ga0070668_100329391 Ga0070668_1003293912 150
749 3300005353 Ga0070669_100113789 Ga0070669_1001137892 150
750 3300005441 Ga0070700_100306428 Ga0070700_1003064282 150
751 3300005543 Ga0070672_100037415 Ga0070672_1000374153 150
752 3300006178 Ga0075367_10281522 Ga0075367_102815222 150
753 3300006195 Ga0075366_10159629 Ga0075366_101596292 150
754 3300006881 Ga0068865_100023460 Ga0068865_1000234602 150
755 3300007265 Ga0099794_10143398 Ga0099794_101433981 150
756 3300009101 Ga0105247_11251157 Ga0105247_112511571 150
757 3300009553 Ga0105249_10173015 Ga0105249_101730152 150
758 3300013297 Ga0157378_10146556 Ga0157378_101465563 150
759 3300013306 Ga0163162_10247762 Ga0163162_102477622 150
760 3300013308 Ga0157375_10606622 Ga0157375_106066222 150
761 3300014326 Ga0157380_10030112 Ga0157380_100301122 150
762 3300014968 Ga0157379_10572138 Ga0157379_105721382 150
763 3300014968 Ga0157379_11763756 Ga0157379_117637561 150
764 3300014969 Ga0157376_11381334 Ga0157376_113813341 150
765 3300021388 Ga0213875_10077329 Ga0213875_100773292 150
766 3300025271 Ga0207666_1014266 Ga0207666_10142662 150
767 3300025303 Ga0209051_1008265 Ga0209051_10082655 150
768 3300025303 Ga0209051_1029310 Ga0209051_10293103 150
769 3300025923 Ga0207681_10208885 Ga0207681_102088852 150
770 3300025924 Ga0207694_10819862 Ga0207694_108198621 150
771 3300025937 Ga0207669_10182940 Ga0207669_101829402 150
772 3300025938 Ga0207704_10058715 Ga0207704_100587152 150
773 3300025940 Ga0207691_10024653 Ga0207691_100246533 150
774 3300025961 Ga0207712_10123168 Ga0207712_101231682 150
775 3300026023 Ga0207677_11999619 Ga0207677_119996191 150
776 3300026089 Ga0207648_10738928 Ga0207648_107389282 150
777 3300026118 Ga0207675_100213377 Ga0207675_1002133772 150
778 3300026142 Ga0207698_11320615 Ga0207698_113206151 150
779 3300028380 Ga0268265_10223199 Ga0268265_102231992 150
780 3300031250 Ga0265331_10009024 Ga0265331_100090244 150
781 3300031548 Ga0307408_100603774 Ga0307408_1006037741 150
782 3300031911 Ga0307412_11085580 Ga0307412_110855802 150
783 3300032133 Ga0316583_10227339 Ga0316583_102273392 150
784 3300035092 Ga0373952_0001139 Ga0373952_0001139_1915_2367 150
785 3300036401 Ga0373937_0340219 Ga0373937_0340219_290_742 150
786 3300037853 Ga0436364_0570264 Ga0436364_0570264_1178_1642 150
787 3300039437 Ga0436365_0680524 Ga0436365_0680524_568_1026 150
788 3300042000 Ga0439437_064593 Ga0439437_064593_17_475 150
789 3300042008 Ga0439450_054731 Ga0439450_054731_150_608 150
790 3300042439 Ga0439464_0008576 Ga0439464_0008576_2194_2652 150
791 3300046518 Ga0495631_0377690 Ga0495631_0377690_40_498 150
792 3300046537 Ga0495598_0006095 Ga0495598_0006095_1047_1505 150
793 3300048909 Ga0496106_0361007 Ga0496106_0361007_249_722 150
794 3300048911 Ga0496108_0458421 Ga0496108_0458421_138_602 150
795 3300048911 Ga0496108_0716479 Ga0496108_0716479_115_597 150
796 3300048917 Ga0496114_0006440 Ga0496114_0006440_527_1000 150
797 3300049569 Ga0501032_0010930 Ga0501032_0010930_5861_6313 150
798 3300049571 Ga0501034_0024667 Ga0501034_0024667_4054_4506 150
799 3300049574 Ga0501038_0058614 Ga0501038_0058614_2293_2745 150
800 3300049575 Ga0501039_0013485 Ga0501039_0013485_1133_1585 150
801 3300049741 Ga0501079_0657938 Ga0501079_0657938_113_595 150
802 3300049743 Ga0501081_0688929 Ga0501081_0688929_235_717 150
803 3300049822 Ga0501035_0046260 Ga0501035_0046260_1355_1807 150
804 3300054114 Ga0501084_1049680 Ga0501084_1049680_175_657 150
805 3300041512 Ga0451853_2413001 Ga0451853_2413001_199_666 151
806 3300002704 JGI25155J39150_1000552 JGI25155J39150_10005522 152
807 3300002705 JGI25156J39149_1001026 JGI25156J39149_10010263 152
808 3300002705 JGI25156J39149_1002927 JGI25156J39149_10029272 152
809 3300002737 JGI25162J39368_1010430 JGI25162J39368_10104302 152
810 3300002738 JGI25154J39366_1000871 JGI25154J39366_10008718 152
811 3300002738 JGI25154J39366_1000911 JGI25154J39366_10009118 152
812 3300002741 JGI25157J39369_1001256 JGI25157J39369_10012566 152
813 3300003751 Ga0055538_1000013 Ga0055538_1000013237 152
814 3300003752 Ga0055539_1000018 Ga0055539_1000018237 152
815 3300003756 Ga0055533_1000022 Ga0055533_1000022237 152
816 3300003758 Ga0055532_1000017 Ga0055532_10000178 152
817 3300003759 Ga0055525_1000024 Ga0055525_1000024237 152
818 3300003841 Ga0055541_1000013 Ga0055541_1000013237 152
819 3300005331 Ga0070670_100043467 Ga0070670_1000434672 152
820 3300005344 Ga0070661_100885046 Ga0070661_1008850461 152
821 3300005563 Ga0068855_100000899 Ga0068855_10000089912 152
822 3300005563 Ga0068855_100026654 Ga0068855_1000266542 152
823 3300005563 Ga0068855_100129571 Ga0068855_1001295712 152
824 3300005578 Ga0068854_100003968 Ga0068854_1000039685 152
825 3300005616 Ga0068852_100078291 Ga0068852_1000782912 152
826 3300005834 Ga0068851_10097987 Ga0068851_100979872 152
827 3300006946 Ga0079104_1004321 Ga0079104_10043213 152
828 3300009011 Ga0105251_10026119 Ga0105251_100261192 152
829 3300009093 Ga0105240_10004920 Ga0105240_1000492014 152
830 3300009093 Ga0105240_10035820 Ga0105240_100358204 152
831 3300009093 Ga0105240_10064762 Ga0105240_100647622 152
832 3300009545 Ga0105237_10187694 Ga0105237_101876942 152
833 3300009545 Ga0105237_10389651 Ga0105237_103896512 152
834 3300009545 Ga0105237_10501577 Ga0105237_105015772 152
835 3300009551 Ga0105238_10000738 Ga0105238_1000073810 152
836 3300010375 Ga0105239_10019338 Ga0105239_100193385 152
837 3300010375 Ga0105239_10329892 Ga0105239_103298922 152
838 3300013100 Ga0157373_10350290 Ga0157373_103502902 152
839 3300013306 Ga0163162_10128309 Ga0163162_101283092 152
840 3300014497 Ga0182008_10010381 Ga0182008_100103814 152
841 3300015261 Ga0182006_1019521 Ga0182006_10195212 152
842 3300015261 Ga0182006_1069162 Ga0182006_10691622 152
843 3300021361 Ga0213872_10004383 Ga0213872_100043831 152
844 3300025206 Ga0209435_100015 Ga0209435_10001521 152
845 3300025206 Ga0209435_100288 Ga0209435_1002888 152
846 3300025224 Ga0209784_100005 Ga0209784_100005490 152
847 3300025225 Ga0209566_100005 Ga0209566_100005490 152
848 3300025226 Ga0209674_100009 Ga0209674_100009490 152
849 3300025229 Ga0209147_100004 Ga0209147_1000041205 152
850 3300025230 Ga0209563_100012 Ga0209563_100012490 152
851 3300025233 Ga0209437_100268 Ga0209437_10026871 152
852 3300025242 Ga0209258_100298 Ga0209258_10029866 152
853 3300025246 Ga0209646_1000040 Ga0209646_100004051 152
854 3300025246 Ga0209646_1000105 Ga0209646_100010528 152
855 3300025250 Ga0209026_1000034 Ga0209026_1000034268 152
856 3300025253 Ga0209677_100006 Ga0209677_100006490 152
857 3300025254 Ga0209148_1012868 Ga0209148_10128682 152
858 3300025256 Ga0209759_1000234 Ga0209759_10002349 152
859 3300025256 Ga0209759_1000569 Ga0209759_100056929 152
860 3300025272 Ga0209455_1005524 Ga0209455_10055243 152
861 3300025321 Ga0207656_10137890 Ga0207656_101378902 152
862 3300025321 Ga0207656_10234031 Ga0207656_102340312 152
863 3300025913 Ga0207695_10000573 Ga0207695_1000057326 152
864 3300025913 Ga0207695_10004109 Ga0207695_100041093 152
865 3300025913 Ga0207695_10006006 Ga0207695_100060064 152
866 3300025914 Ga0207671_10248091 Ga0207671_102480912 152
867 3300025914 Ga0207671_10302330 Ga0207671_103023301 152
868 3300025924 Ga0207694_10000505 Ga0207694_1000050518 152
869 3300025924 Ga0207694_10783681 Ga0207694_107836812 152
870 3300025925 Ga0207650_10075425 Ga0207650_100754252 152
871 3300025949 Ga0207667_10000053 Ga0207667_1000005338 152
872 3300025949 Ga0207667_10026989 Ga0207667_100269892 152
873 3300025949 Ga0207667_10052477 Ga0207667_100524772 152
874 3300025981 Ga0207640_10049985 Ga0207640_100499852 152
875 3300026078 Ga0207702_10204748 Ga0207702_102047482 152
876 3300026116 Ga0207674_10975356 Ga0207674_109753561 152
877 3300026142 Ga0207698_10025226 Ga0207698_100252263 152
878 3300027111 Ga0209281_1007305 Ga0209281_10073052 152
879 3300031238 Ga0265332_10000278 Ga0265332_1000027820 152
880 3300031731 Ga0307405_10174205 Ga0307405_101742052 152
881 3300039447 Ga0436361_0162163 Ga0436361_0162163_264_722 152
882 3300039447 Ga0436361_1050932 Ga0436361_1050932_235_693 152
883 3300046660 Ga0495625_0005740 Ga0495625_0005740_6397_6855 152
884 3300048903 Ga0496100_0095075 Ga0496100_0095075_882_1340 152
885 3300048904 Ga0496101_0242656 Ga0496101_0242656_536_994 152
886 3300048919 Ga0496116_0018094 Ga0496116_0018094_2772_3230 152
887 3300048921 Ga0496118_0185082 Ga0496118_0185082_384_842 152
888 3300048924 Ga0496121_0020869 Ga0496121_0020869_1588_2046 152
889 3300048924 Ga0496121_0054604 Ga0496121_0054604_1521_1979 152
890 3300048924 Ga0496121_0316427 Ga0496121_0316427_496_954 152
891 3300048925 Ga0496122_0008179 Ga0496122_0008179_4839_5297 152
892 3300048926 Ga0496123_0008042 Ga0496123_0008042_4966_5424 152
893 3300048928 Ga0496125_0005346 Ga0496125_0005346_12737_13195 152
894 3300049822 Ga0501035_1209385 Ga0501035_1209385_83_574 152
895 3300053125 Ga0500618_001127 Ga0500618_001127_9659_10129 152
896 3300053125 Ga0500618_003179 Ga0500618_003179_4928_5425 152
897 iso_pu_bacteria 2547132512 2548848656 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

28

103

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8325 1 151
3f2i-assembly3.cif.gz_E crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. 0.8267 1 151
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8225 1 151
3f2i-assembly1.cif.gz_A crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. 0.8213 1 152
3f2i-assembly3.cif.gz_E crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. 0.8168 1 151
ID Description Score Start End Superfamily
af_P42522_761_951_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8556 124 146 2.30.29.30
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8323 1 151 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8224 1 151 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7915 2 147 3.40.50.1240
af_Q3UQ05_61_243_3.15.10.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 0.7874 124 147 3.15.10.10
ID Description Score Start End GO Terms
AF-A0A259DDT1-F1-model_v4 Histidine phosphatase family protein 0.9988 1 104
AF-A0A0Q8H1B7-F1-model_v4 Phosphohistidine phosphatase 0.9896 1 149
AF-A0A3N7EGH1-F1-model_v4 Histidine phosphatase family protein 0.9859 1 152
AF-A0A5C1EC62-F1-model_v4 Putative phosphohistidine phosphatase 0.9852 1 152
AF-A0A521KDL3-F1-model_v4 Histidine phosphatase family protein 0.9848 1 149

Feature Viewer

pLDDT pTM Quality
96.81 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map