F484943

General Info

Members Datasets Scaffolds Average Seq Length
894 446 782 161

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10108743|Ga0307414_101087433
Length 193
Sequence MPRANAVPLATIAAIAAPVRGAGENAVAARLLHMFTPNSLSGDKPEQYAQLAQQAQALVAGEHDRIANAANLSALVYHALPRLNWVGFYFFDGNELVVGPFQGLPACIRIPLDKGVCGAAARSGQTQRVPDVDAFDGHVACDSASRSELVVPLFRNDVLVGVFDLDSPDLDRFDVTDQRGIEELARIFVRSLG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
5 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
6 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
7 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
8 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
9 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
10 2643221559 Lysobacter sp. Root559 Isolate Unclassified
11 2643221569 Achromobacter sp. Root565 Isolate Unclassified
12 2643221573 Lysobacter sp. Root604 Isolate Unclassified
13 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
14 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
15 2643221586 Lysobacter sp. Root667 Isolate Unclassified
16 2643221593 Lysobacter sp. Root690 Isolate Unclassified
17 2643221594 Achromobacter sp. Root170 Isolate Unclassified
18 2643221612 Lysobacter sp. Root76 Isolate Unclassified
19 2643221621 Achromobacter sp. Root83 Isolate Unclassified
20 2643221720 Lysobacter sp. Root916 Isolate Unclassified
21 2643221727 Lysobacter sp. Root96 Isolate Unclassified
22 2643221728 Lysobacter sp. Root983 Isolate Unclassified
23 2643221731 Bacillus sp. Root147 Isolate Unclassified
24 2643221732 Bacillus sp. Root239 Isolate Unclassified
25 2671180694 Paenibacillus sp. A3 Isolate Unclassified
26 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
27 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
28 2738543010 Bacillus sp. YR335 Isolate Unclassified
29 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
30 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
31 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
32 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
33 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
34 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
35 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
36 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
37 2818991441 Niallia circulans 3243 Isolate Rhizosphere
38 2818991457 Xanthomonas translucens 569 Isolate Unclassified
39 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
40 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
41 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
42 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
43 2842882022 Bacillus sp. R-71893 Isolate Unclassified
44 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
45 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
46 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
47 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
48 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
49 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
50 2858950400 Achromobacter sp. K91 Isolate Unclassified
51 2860837431 Bacillus sp. WR11 Isolate Unclassified
52 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
53 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
54 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
55 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
56 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
57 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
58 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
59 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
60 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
61 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
62 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
63 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
64 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
65 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
66 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
67 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
68 2919513703 Luteimonas sp. 3794 Isolate Unclassified
69 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
70 2919675420 Luteimonas terrae 4099 Isolate Unclassified
71 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
72 2919720352 Priestia megaterium 4340 Isolate Unclassified
73 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
74 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
75 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
76 2929004312 Priestia megaterium 1104 Isolate Unclassified
77 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
78 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
79 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
80 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
81 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
82 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
83 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
84 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
85 2941479691
86 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
87 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
88 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
89 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
90 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
91 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
92 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
93 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
94 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
95 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
96 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
97 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
98 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
99 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
100 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
101 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
102 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
103 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
104 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
105 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
106 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
107 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
108 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
109 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
110 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
111 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
112 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
113 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
114 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
115 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
116 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
117 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
118 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
119 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
120 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
121 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
122 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
123 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
124 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
125 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
126 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
127 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
128 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
129 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
130 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
131 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
132 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
133 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
134 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
135 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
136 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
137 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
138 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
139 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
140 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
141 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
142 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
143 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
144 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
145 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
146 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
147 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
148 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
149 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
150 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
151 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
152 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
153 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
154 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
155 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
156 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
157 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
158 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
159 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
160 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
161 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
162 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
163 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
164 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
165 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
166 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
167 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
168 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
169 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
170 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
171 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
172 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
173 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
174 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
175 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
176 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
177 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
178 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
182 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
183 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
184 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
185 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
186 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
187 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
188 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
189 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
190 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
193 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
198 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
199 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
205 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
207 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
256 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
257 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
258 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
259 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
260 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
261 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
262 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
263 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
264 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
265 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
266 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
267 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
268 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
269 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
270 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
271 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
272 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
273 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
274 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
275 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
276 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
277 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
278 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
279 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
280 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
283 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
284 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
285 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
286 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
287 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
288 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
289 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
290 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
291 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
292 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
293 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
294 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
295 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
296 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
297 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
298 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
299 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
300 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
301 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
302 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
303 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
304 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
305 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
306 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
307 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
308 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
309 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
310 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
311 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
312 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
313 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
314 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
315 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
316 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
317 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
318 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
319 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
320 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
321 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
322 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
323 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
324 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
325 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
326 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
327 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
328 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
331 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
332 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
333 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
334 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
335 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
336 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
337 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
338 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
345 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
346 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
347 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
350 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
351 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
352 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
353 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
365 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
368 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
369 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
370 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
371 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
376 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
379 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
380 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
402 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
403 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
404 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
405 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
406 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
407 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
408 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
409 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
410 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
411 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
412 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
413 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
414 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
415 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
416 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
417 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
420 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
421 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
422 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
423 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
424 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
425 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
426 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
427 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
428 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
429 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
430 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
431 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
432 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
433 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
434 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
435 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
436 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
437 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
438 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
439 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
440 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
441 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
442 8022653035 Bacillus sp. Rc4 Isolate Unclassified
443 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
444 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
445 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
446 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.36
Metatranscriptomes 0.11
Isolates 12.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 15.66
Nodule 0.11
Rhizoplane 4.59
Rhizosphere 57.49
Stem 0
Stem Tuber 0
Unclassified 22.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3802179 2162886007 Bacteria 1037
2 SwRhRL2b_contig_46047 2162886007 Bacteria 1444
3 JGI25152J39213_1000025 3300002773 Bacteria 103262
4 JGI25150J39212_1000066 3300002774 Bacteria 63677
5 JGI25151J46595_10000117 3300003187 Bacteria 106850
6 JGI25151J46595_10000139 3300003187 Bacteria 96000
7 JGI25151J46595_10016266 3300003187 Bacteria 3258
8 JGI25151J46595_10019101 3300003187 Bacteria 2921
9 JGI25151J46595_10038704 3300003187 Bacteria 1771
10 JGI25153J46596_10000101 3300003215 Bacteria 96639
11 rootH2_10038994 3300003320 Bacteria 6203
12 Ga0055538_1000164 3300003751 Bacteria 43510
13 Ga0055535_1002595 3300003761 Bacteria 6072
14 Ga0055535_1009874 3300003761 Bacteria 1609
15 Ga0055526_1000183 3300003771 Bacteria 54759
16 Ga0055526_1001045 3300003771 Bacteria 20206
17 Ga0055526_1004844 3300003771 Bacteria 7941
18 Ga0055537_1000028 3300003773 Bacteria 102200
19 Ga0055537_1000314 3300003773 Bacteria 33100
20 Ga0055524_1000461 3300003775 Bacteria 33100
21 Ga0055524_1018198 3300003775 Bacteria 2447
22 Ga0055536_1001419 3300003781 Bacteria 14468
23 Ga0055536_1001978 3300003781 Bacteria 11747
24 Ga0055536_1002334 3300003781 Bacteria 10736
25 Ga0055536_1019619 3300003781 Bacteria 2119
26 Ga0055536_1022683 3300003781 Bacteria 1865
27 Ga0055536_1030270 3300003781 Bacteria 1438
28 Ga0055534_1000180 3300003784 Bacteria 46550
29 Ga0055534_1000302 3300003784 Bacteria 33100
30 Ga0055528_1000172 3300003790 Bacteria 54759
31 Ga0055528_1000262 3300003790 Bacteria 44658
32 Ga0055530_10000784 3300003791 Bacteria 26455
33 Ga0055530_10001075 3300003791 Bacteria 21506
34 Ga0055530_10002332 3300003791 Bacteria 12397
35 Ga0055530_10049130 3300003791 Bacteria 988
36 Ga0055530_10080760 3300003791 Bacteria 683
37 Ga0055531_10010004 3300003794 Bacteria 4777
38 Ga0055531_10010801 3300003794 Bacteria 4493
39 Ga0055531_10014958 3300003794 Bacteria 3457
40 Ga0055531_10026654 3300003794 Bacteria 2053
41 Ga0055531_10026698 3300003794 Bacteria 2050
42 Ga0055531_10034540 3300003794 Bacteria 1602
43 Ga0055541_1000253 3300003841 Bacteria 19354
44 Ga0055541_1020817 3300003841 Bacteria 770
45 Ga0058692_1000026 3300003856 Bacteria 203096
46 Ga0058692_1000040 3300003856 Bacteria 132805
47 Ga0065165_1016213 3300005262 Bacteria 2800
48 Ga0065714_10275140 3300005288 Bacteria 732
49 Ga0065704_10033986 3300005289 Bacteria 1037
50 Ga0065704_10071027 3300005289 Bacteria 13649
51 Ga0065704_10098809 3300005289 Bacteria 2338
52 Ga0065704_10457457 3300005289 Bacteria 694
53 Ga0065715_10161706 3300005293 Bacteria 1622
54 Ga0070658_10013884 3300005327 Bacteria 6466
55 Ga0070670_100011457 3300005331 Bacteria 7585
56 Ga0070670_100050456 3300005331 Bacteria 3575
57 Ga0070670_100294827 3300005331 Bacteria 1418
58 Ga0070670_100317434 3300005331 Bacteria 1365
59 Ga0070670_101153080 3300005331 Bacteria 707
60 Ga0070666_10274967 3300005335 Bacteria 1196
61 Ga0070680_100027857 3300005336 Bacteria 4527
62 Ga0070680_100168041 3300005336 Bacteria 1845
63 Ga0070680_100504777 3300005336 Bacteria 1035
64 Ga0070660_100437854 3300005339 Bacteria 1083
65 Ga0070691_10001219 3300005341 Bacteria 10820
66 Ga0070668_100008075 3300005347 Bacteria 7816
67 Ga0070668_100056289 3300005347 Bacteria 3037
68 Ga0070668_100318540 3300005347 Bacteria 1309
69 Ga0070669_100011958 3300005353 Bacteria 6160
70 Ga0070669_100033911 3300005353 Bacteria 3694
71 Ga0070669_100292934 3300005353 Bacteria 1307
72 Ga0070669_101526823 3300005353 Bacteria 581
73 Ga0070675_100106930 3300005354 Bacteria 2362
74 Ga0070675_100250156 3300005354 Bacteria 1551
75 Ga0070675_100442360 3300005354 Bacteria 1165
76 Ga0070675_100841081 3300005354 Bacteria 840
77 Ga0070671_100109163 3300005355 Bacteria 2323
78 Ga0070671_100554437 3300005355 Bacteria 991
79 Ga0070674_100014888 3300005356 Bacteria 4843
80 Ga0070659_101358036 3300005366 Bacteria 631
81 Ga0070667_100887726 3300005367 Bacteria 830
82 Ga0070705_100202730 3300005440 Bacteria 1361
83 Ga0070678_100061918 3300005456 Bacteria 2760
84 Ga0070662_100766456 3300005457 Bacteria 819
85 Ga0070681_10000625 3300005458 Bacteria 29017
86 Ga0070681_10191696 3300005458 Bacteria 1964
87 Ga0068867_100127289 3300005459 Bacteria 1975
88 Ga0070679_100016885 3300005530 Bacteria 7055
89 Ga0070679_100106292 3300005530 Bacteria 2792
90 Ga0070679_100326324 3300005530 Bacteria 1484
91 Ga0070672_100001204 3300005543 Bacteria 15828
92 Ga0070672_100515988 3300005543 Bacteria 1035
93 Ga0070672_101458262 3300005543 Bacteria 613
94 Ga0070693_100018623 3300005547 Bacteria 3631
95 Ga0070665_100005654 3300005548 Bacteria 12855
96 Ga0070665_100007318 3300005548 Bacteria 11230
97 Ga0070665_100104205 3300005548 Bacteria 2839
98 Ga0070665_100596980 3300005548 Bacteria 1117
99 Ga0070665_102291851 3300005548 Bacteria 543
100 Ga0068855_100026332 3300005563 Bacteria 6957
101 Ga0068855_100555681 3300005563 Bacteria 1242
102 Ga0070664_100502989 3300005564 Bacteria 1117
103 Ga0068857_100054874 3300005577 Bacteria 3536
104 Ga0068857_100442624 3300005577 Bacteria 1214
105 Ga0068856_100079882 3300005614 Bacteria 3244
106 Ga0068852_100700428 3300005616 Bacteria 1023
107 Ga0068864_100241186 3300005618 Bacteria 1675
108 Ga0068861_101559593 3300005719 Bacteria 650
109 Ga0075365_10177577 3300006038 Bacteria 1488
110 Ga0075365_10633675 3300006038 Bacteria 756
111 Ga0075368_10047232 3300006042 Bacteria 1704
112 Ga0075363_100130488 3300006048 Bacteria 1409
113 Ga0075364_10000005 3300006051 Bacteria 93405
114 Ga0075364_10033668 3300006051 Bacteria 3301
115 Ga0075364_10039167 3300006051 Bacteria 3072
116 Ga0075364_10118436 3300006051 Bacteria 1771
117 Ga0075364_10204290 3300006051 Bacteria 1339
118 Ga0075364_10312604 3300006051 Bacteria 1070
119 Ga0070712_100259432 3300006175 Bacteria 1392
120 Ga0075362_10071327 3300006177 Bacteria 1587
121 Ga0075369_10129978 3300006186 Bacteria 1144
122 Ga0105251_10001131 3300009011 Bacteria 23181
123 Ga0105251_10004086 3300009011 Bacteria 10221
124 Ga0105244_10018430 3300009036 Bacteria 3917
125 Ga0105244_10070874 3300009036 Bacteria 1738
126 Ga0105244_10319381 3300009036 Bacteria 717
127 Ga0105240_10015095 3300009093 Bacteria 10514
128 Ga0105240_10029298 3300009093 Bacteria 7175
129 Ga0105245_10155857 3300009098 Bacteria 2163
130 Ga0105247_10650881 3300009101 Bacteria 787
131 Ga0105243_10009739 3300009148 Bacteria 7319
132 Ga0105243_10032820 3300009148 Bacteria 4013
133 Ga0105241_10062611 3300009174 Bacteria 2868
134 Ga0105242_10329799 3300009176 Bacteria 1403
135 Ga0105242_10970637 3300009176 Bacteria 855
136 Ga0105248_10002072 3300009177 Bacteria 22185
137 Ga0105248_11043579 3300009177 Bacteria 923
138 Ga0105248_12362639 3300009177 Bacteria 605
139 Ga0105238_10194061 3300009551 Bacteria 2006
140 Ga0105032_101190 3300009979 Bacteria 2403
141 Ga0105029_110633 3300009984 Bacteria 698
142 Ga0105239_10016256 3300010375 Bacteria 8229
143 Ga0105239_12211901 3300010375 Bacteria 640
144 Ga0157318_1004328 3300012482 Bacteria 861
145 Ga0157319_1015394 3300012497 Bacteria 683
146 Ga0157314_1001703 3300012500 Bacteria 1547
147 Ga0157338_1070602 3300012515 Bacteria 544
148 Ga0157373_10068840 3300013100 Bacteria 2502
149 Ga0157371_10000658 3300013102 Bacteria 40993
150 Ga0157371_10043343 3300013102 Bacteria 3205
151 Ga0157371_10316042 3300013102 Bacteria 1133
152 Ga0157371_10574622 3300013102 Bacteria 837
153 Ga0157370_10016314 3300013104 Bacteria 7525
154 Ga0157370_10239140 3300013104 Bacteria 1680
155 Ga0157370_10271084 3300013104 Bacteria 1568
156 Ga0157369_10020199 3300013105 Bacteria 7448
157 Ga0157369_10070214 3300013105 Bacteria 3763
158 Ga0157374_10144870 3300013296 Bacteria 2307
159 Ga0157378_10091347 3300013297 Bacteria 2768
160 Ga0157378_10633571 3300013297 Bacteria 1083
161 Ga0157372_10111602 3300013307 Bacteria 3133
162 Ga0157375_10029463 3300013308 Bacteria 5162
163 Ga0157375_10213409 3300013308 Bacteria 2088
164 Ga0157375_10502640 3300013308 Bacteria 1376
165 Ga0157380_10097097 3300014326 Bacteria 2444
166 Ga0157380_10935501 3300014326 Bacteria 896
167 Ga0182008_10000730 3300014497 Bacteria 23330
168 Ga0182008_10013902 3300014497 Bacteria 4224
169 Ga0182008_10024004 3300014497 Bacteria 3107
170 Ga0182006_1015620 3300015261 Bacteria 3252
171 Ga0182006_1065014 3300015261 Bacteria 1366
172 Ga0182007_10000025 3300015262 Bacteria 172058
173 Ga0182005_1000063 3300015265 Bacteria 97663
174 Ga0182005_1004147 3300015265 Bacteria 4737
175 Ga0183360_10003 3300015689 Bacteria 713221
176 Ga0163161_10004635 3300017792 Bacteria 9565
177 Ga0163161_10012078 3300017792 Bacteria 5990
178 Ga0163161_10040670 3300017792 Bacteria 3339
179 Ga0163161_10161692 3300017792 Bacteria 1707
180 Ga0163161_10343145 3300017792 Bacteria 1185
181 Ga0163161_10562756 3300017792 Bacteria 936
182 Ga0213875_10329094 3300021388 Bacteria 724
183 Ga0209784_100084 3300025224 Bacteria 125995
184 Ga0209566_100092 3300025225 Bacteria 137641
185 Ga0209566_100122 3300025225 Bacteria 101406
186 Ga0209566_111607 3300025225 Bacteria 858
187 Ga0209147_112588 3300025229 Unclassified 904
188 Ga0209258_101493 3300025242 Bacteria 8003
189 Ga0207425_1000040 3300025245 Bacteria 218121
190 Ga0207425_1024176 3300025245 Bacteria 1264
191 Ga0207425_1049150 3300025245 Bacteria 776
192 Ga0209129_1000011 3300025258 Bacteria 568657
193 Ga0209565_1000002 3300025263 Bacteria 1423083
194 Ga0209565_1000037 3300025263 Bacteria 289371
195 Ga0209565_1024592 3300025263 Bacteria 1224
196 Ga0209673_1000002 3300025273 Bacteria 1423083
197 Ga0209673_1000032 3300025273 Bacteria 339956
198 Ga0209673_1009916 3300025273 Bacteria 4070
199 Ga0209673_1056213 3300025273 Bacteria 1009
200 Ga0209130_1007940 3300025284 Bacteria 3200
201 Ga0209675_1000002 3300025291 Bacteria 1423083
202 Ga0209675_1000020 3300025291 Bacteria 335854
203 Ga0209675_1010710 3300025291 Bacteria 3106
204 Ga0209675_1019174 3300025291 Bacteria 1890
205 Ga0209676_1000063 3300025292 Bacteria 322025
206 Ga0209676_1000149 3300025292 Bacteria 167854
207 Ga0209676_1000199 3300025292 Bacteria 134270
208 Ga0209676_1000610 3300025292 Bacteria 52296
209 Ga0209676_1004196 3300025292 Bacteria 8178
210 Ga0209676_1011454 3300025292 Bacteria 3573
211 Ga0209676_1017123 3300025292 Bacteria 2579
212 Ga0209025_1000002 3300025294 Bacteria 1393142
213 Ga0209025_1000030 3300025294 Bacteria 441196
214 Ga0209025_1006488 3300025294 Bacteria 9053
215 Ga0209025_1007306 3300025294 Bacteria 8285
216 Ga0209025_1009758 3300025294 Bacteria 6628
217 Ga0209025_1012032 3300025294 Bacteria 5607
218 Ga0209025_1033326 3300025294 Bacteria 2382
219 Ga0209025_1039683 3300025294 Bacteria 2049
220 Ga0209025_1043666 3300025294 Bacteria 1884
221 Ga0209025_1097167 3300025294 Bacteria 944
222 Ga0209564_1000004 3300025295 Bacteria 1424639
223 Ga0209564_1000951 3300025295 Bacteria 37038
224 Ga0209564_1004958 3300025295 Bacteria 7855
225 Ga0209758_1000003 3300025297 Bacteria 1398533
226 Ga0209758_1012563 3300025297 Bacteria 4723
227 Ga0209050_1000189 3300025298 Bacteria 138610
228 Ga0209050_1000199 3300025298 Bacteria 134682
229 Ga0209050_1000794 3300025298 Bacteria 44654
230 Ga0209050_1001310 3300025298 Bacteria 27931
231 Ga0209050_1007848 3300025298 Bacteria 5862
232 Ga0209050_1047328 3300025298 Bacteria 1121
233 Ga0209256_1000004 3300025299 Bacteria 1424643
234 Ga0209256_1001838 3300025299 Bacteria 19738
235 Ga0209256_1002507 3300025299 Bacteria 14781
236 Ga0209256_1003521 3300025299 Bacteria 10900
237 Ga0209256_1006653 3300025299 Bacteria 6015
238 Ga0209256_1048142 3300025299 Bacteria 1045
239 Ga0209051_1013273 3300025303 Bacteria 3931
240 Ga0209257_1000078 3300025304 Bacteria 317483
241 Ga0209257_1000086 3300025304 Bacteria 287437
242 Ga0209257_1001558 3300025304 Bacteria 26541
243 Ga0209257_1001969 3300025304 Bacteria 22127
244 Ga0209257_1002257 3300025304 Bacteria 19699
245 Ga0209257_1003701 3300025304 Bacteria 12719
246 Ga0209257_1012493 3300025304 Bacteria 3914
247 Ga0209257_1023282 3300025304 Bacteria 2181
248 Ga0209257_1025141 3300025304 Bacteria 2041
249 Ga0209257_1071658 3300025304 Bacteria 911
250 Ga0207655_1068386 3300025728 Bacteria 1332
251 Ga0207713_1000253 3300025735 Bacteria 66728
252 Ga0207713_1023662 3300025735 Bacteria 2885
253 Ga0207680_10652729 3300025903 Bacteria 753
254 Ga0207705_10078723 3300025909 Bacteria 2399
255 Ga0207654_10020676 3300025911 Bacteria 3494
256 Ga0207707_10001167 3300025912 Bacteria 24740
257 Ga0207707_10295362 3300025912 Bacteria 1402
258 Ga0207695_10051073 3300025913 Bacteria 4344
259 Ga0207695_10151847 3300025913 Bacteria 2255
260 Ga0207693_10136936 3300025915 Bacteria 1925
261 Ga0207660_10007789 3300025917 Bacteria 6933
262 Ga0207660_10358631 3300025917 Bacteria 1169
263 Ga0207657_10025581 3300025919 Bacteria 5440
264 Ga0207649_11136356 3300025920 Bacteria 617
265 Ga0207652_10003496 3300025921 Bacteria 12949
266 Ga0207652_10111470 3300025921 Bacteria 2426
267 Ga0207652_10198608 3300025921 Bacteria 1805
268 Ga0207681_10025032 3300025923 Bacteria 3835
269 Ga0207681_10217484 3300025923 Bacteria 1476
270 Ga0207681_10471331 3300025923 Bacteria 1024
271 Ga0207694_10324880 3300025924 Bacteria 1270
272 Ga0207650_10008541 3300025925 Bacteria 6994
273 Ga0207650_10033189 3300025925 Bacteria 3737
274 Ga0207650_10129489 3300025925 Bacteria 1973
275 Ga0207659_10077556 3300025926 Bacteria 2446
276 Ga0207659_10244659 3300025926 Bacteria 1453
277 Ga0207644_10006436 3300025931 Bacteria 7653
278 Ga0207644_10111606 3300025931 Bacteria 2068
279 Ga0207644_10560895 3300025931 Bacteria 946
280 Ga0207690_10874258 3300025932 Bacteria 745
281 Ga0207709_10001569 3300025935 Bacteria 15656
282 Ga0207709_10075898 3300025935 Bacteria 2150
283 Ga0207669_10049010 3300025937 Bacteria 2514
284 Ga0207691_10018899 3300025940 Bacteria 6527
285 Ga0207711_10002243 3300025941 Bacteria 17327
286 Ga0207711_10468665 3300025941 Bacteria 1173
287 Ga0207711_10566441 3300025941 Bacteria 1060
288 Ga0207667_10040754 3300025949 Bacteria 4943
289 Ga0207667_10464492 3300025949 Bacteria 1285
290 Ga0207651_10409869 3300025960 Bacteria 1155
291 Ga0207668_10004601 3300025972 Bacteria 8112
292 Ga0207668_10024065 3300025972 Bacteria 3925
293 Ga0207640_11214820 3300025981 Bacteria 671
294 Ga0207658_10332020 3300025986 Bacteria 1319
295 Ga0207708_10921796 3300026075 Bacteria 757
296 Ga0207702_10175258 3300026078 Bacteria 1970
297 Ga0207648_10444570 3300026089 Bacteria 1180
298 Ga0207674_10010009 3300026116 Bacteria 10791
299 Ga0207675_100671875 3300026118 Bacteria 1043
300 Ga0207683_10095515 3300026121 Bacteria 2650
301 Ga0207683_10802538 3300026121 Bacteria 873
302 Ga0209371_1000028 3300027312 Bacteria 429688
303 Ga0209371_1000048 3300027312 Bacteria 281705
304 Ga0209371_1010826 3300027312 Bacteria 2765
305 Ga0209981_1042102 3300027378 Bacteria 684
306 Ga0209984_1009274 3300027424 Bacteria 1249
307 Ga0209995_1010920 3300027471 Bacteria 1475
308 Ga0209999_1004632 3300027543 Bacteria 2469
309 Ga0209970_1006158 3300027614 Bacteria 1969
310 Ga0209970_1007034 3300027614 Bacteria 1844
311 Ga0209983_1001083 3300027665 Bacteria 6013
312 Ga0209983_1027086 3300027665 Bacteria 1213
313 Ga0209971_1000758 3300027682 Bacteria 8335
314 Ga0209971_1012091 3300027682 Bacteria 2043
315 Ga0209974_10010835 3300027876 Bacteria 3071
316 Ga0209974_10019745 3300027876 Bacteria 2234
317 Ga0209974_10025126 3300027876 Bacteria 1972
318 Ga0268266_10001436 3300028379 Bacteria 28384
319 Ga0268266_10024900 3300028379 Bacteria 5092
320 Ga0268266_10054746 3300028379 Bacteria 3429
321 Ga0268266_11412684 3300028379 Bacteria 671
322 Ga0268265_10103400 3300028380 Bacteria 2307
323 Ga0307515_10286484 3300028794 Bacteria 1348
324 Ga0268256_1000030 3300030500 Bacteria 429688
325 Ga0268256_1000049 3300030500 Bacteria 307229
326 Ga0268256_1010567 3300030500 Bacteria 2982
327 Ga0316177_1019699 3300030731 Bacteria 3600
328 Ga0316177_1090695 3300030731 Bacteria 1889
329 Ga0316176_1178239 3300030732 Bacteria 2187
330 Ga0314311_1198609 3300030733 Bacteria 2084
331 Ga0314311_1212235 3300030733 Bacteria 2734
332 Ga0316178_1100148 3300030735 Bacteria 909
333 Ga0316180_1135407 3300030736 Bacteria 976
334 Ga0316183_1032517 3300030742 Bacteria 3263
335 Ga0316183_1156169 3300030742 Bacteria 1292
336 Ga0316182_1090418 3300030745 Bacteria 1168
337 Ga0316182_1113265 3300030745 Bacteria 1959
338 Ga0316182_1139274 3300030745 Bacteria 1715
339 Ga0307513_10002045 3300031456 Bacteria 28381
340 Ga0307513_10310084 3300031456 Bacteria 1341
341 Ga0307509_10753553 3300031507 Bacteria 639
342 Ga0307408_100049397 3300031548 Bacteria 3021
343 Ga0307408_100058931 3300031548 Bacteria 2793
344 Ga0307408_100059523 3300031548 Bacteria 2780
345 Ga0307408_100740267 3300031548 Bacteria 887
346 Ga0307408_100758912 3300031548 Bacteria 877
347 Ga0307408_101243580 3300031548 Bacteria 696
348 Ga0316576_10321852 3300031727 Bacteria 1153
349 Ga0307405_10223600 3300031731 Bacteria 1383
350 Ga0307405_10234444 3300031731 Bacteria 1355
351 Ga0307405_11036510 3300031731 Bacteria 702
352 Ga0307413_10006572 3300031824 Bacteria 5325
353 Ga0307413_10007402 3300031824 Bacteria 5097
354 Ga0307413_10079998 3300031824 Bacteria 2091
355 Ga0307413_10100253 3300031824 Bacteria 1912
356 Ga0307413_10147237 3300031824 Bacteria 1636
357 Ga0307413_10214365 3300031824 Bacteria 1401
358 Ga0307413_10241967 3300031824 Bacteria 1333
359 Ga0307413_10457698 3300031824 Bacteria 1014
360 Ga0307413_10495350 3300031824 Bacteria 980
361 Ga0307413_10554644 3300031824 Bacteria 933
362 Ga0307410_10084596 3300031852 Bacteria 2237
363 Ga0307410_10417360 3300031852 Bacteria 1088
364 Ga0307410_10554581 3300031852 Bacteria 953
365 Ga0307406_10008217 3300031901 Bacteria 5817
366 Ga0307406_10149539 3300031901 Bacteria 1664
367 Ga0307406_10257809 3300031901 Bacteria 1317
368 Ga0307406_10466902 3300031901 Bacteria 1016
369 Ga0307406_10629293 3300031901 Bacteria 888
370 Ga0307412_10000087 3300031911 Bacteria 84138
371 Ga0307412_10002247 3300031911 Bacteria 10705
372 Ga0307412_10064564 3300031911 Bacteria 2474
373 Ga0307412_10187844 3300031911 Bacteria 1560
374 Ga0307412_10339356 3300031911 Bacteria 1202
375 Ga0307412_10520922 3300031911 Bacteria 993
376 Ga0307412_10889744 3300031911 Bacteria 779
377 Ga0307412_11545596 3300031911 Bacteria 604
378 Ga0307409_100510405 3300031995 Bacteria 1172
379 Ga0307409_102321007 3300031995 Bacteria 566
380 Ga0307416_100006969 3300032002 Bacteria 7126
381 Ga0307416_100023561 3300032002 Bacteria 4470
382 Ga0307416_100343905 3300032002 Bacteria 1506
383 Ga0307416_100438009 3300032002 Bacteria 1356
384 Ga0307416_100496923 3300032002 Bacteria 1283
385 Ga0307416_101605709 3300032002 Bacteria 755
386 Ga0307416_102083253 3300032002 Bacteria 669
387 Ga0307414_10000159 3300032004 Bacteria 45131
388 Ga0307414_10004389 3300032004 Bacteria 7659
389 Ga0307414_10017345 3300032004 Bacteria 4402
390 Ga0307414_10019952 3300032004 Bacteria 4166
391 Ga0307414_10023608 3300032004 Bacteria 3904
392 Ga0307414_10054278 3300032004 Bacteria 2799
393 Ga0307414_10094518 3300032004 Bacteria 2231
394 Ga0307414_10108743 3300032004 Bacteria 2104
395 Ga0307414_10135051 3300032004 Bacteria 1922
396 Ga0307414_10498444 3300032004 Bacteria 1077
397 Ga0307414_10521656 3300032004 Bacteria 1054
398 Ga0307414_11196948 3300032004 Bacteria 703
399 Ga0307411_10051787 3300032005 Bacteria 2680
400 Ga0307411_10119139 3300032005 Bacteria 1906
401 Ga0307411_10180443 3300032005 Bacteria 1602
402 Ga0307411_10310407 3300032005 Bacteria 1269
403 Ga0307411_10526672 3300032005 Bacteria 1004
404 Ga0307411_10639650 3300032005 Bacteria 919
405 Ga0307411_10759786 3300032005 Bacteria 850
406 Ga0307411_11092444 3300032005 Bacteria 718
407 Ga0316574_0244884 3300035398 Bacteria 1146
408 Ga0316574_0461989 3300035398 Bacteria 794
409 Ga0373937_0181755 3300036401 Bacteria 1975
410 Ga0373937_1595327 3300036401 Bacteria 600
411 Ga0316584_0515278 3300036712 Bacteria 839
412 Ga0395899_0352222 3300037312 Bacteria 984
413 Ga0395898_0743001 3300037466 Bacteria 923
414 Ga0395905_0002859 3300037471 Bacteria 18881
415 Ga0395905_0016448 3300037471 Bacteria 7031
416 Ga0395905_0477278 3300037471 Bacteria 1146
417 Ga0436364_0744029 3300037853 Bacteria 3696
418 Ga0395901_0020794 3300038443 Bacteria 6718
419 Ga0237819_00279 3300038705 Bacteria 18711
420 Ga0237819_02264 3300038705 Bacteria 4030
421 Ga0237816_01687 3300039145 Bacteria 1766
422 Ga0439436_0004641 3300041404 Bacteria 4213
423 Ga0439436_0032076 3300041404 Bacteria 1524
424 Ga0439447_000033 3300041407 Bacteria 49181
425 Ga0439461_0085376 3300041410 Bacteria 750
426 Ga0439465_0003016 3300041413 Bacteria 5502
427 Ga0439465_0044755 3300041413 Bacteria 1438
428 Ga0439465_0049197 3300041413 Bacteria 1376
429 Ga0451787_691700 3300041441 Bacteria 979
430 Ga0451791_0061126 3300041451 Bacteria 1443
431 Ga0451793_0248173 3300041452 Bacteria 1158
432 Ga0451797_0206176 3300041453 Bacteria 803
433 Ga0451797_0209795 3300041453 Bacteria 2573
434 Ga0451797_0510974 3300041453 Bacteria 1113
435 Ga0451797_1381519 3300041453 Bacteria 674
436 Ga0451795_1281766 3300041456 Bacteria 2072
437 Ga0451800_0961261 3300041459 Bacteria 1327
438 Ga0451800_1014250 3300041459 Bacteria 2965
439 Ga0451802_1249029 3300041460 Bacteria 1378
440 Ga0451802_1339368 3300041460 Bacteria 777
441 Ga0451802_1567617 3300041460 Bacteria 1438
442 Ga0451806_130861 3300041462 Bacteria 3982
443 Ga0451807_0759871 3300041486 Bacteria 1643
444 Ga0451807_0894472 3300041486 Bacteria 914
445 Ga0451807_1140346 3300041486 Bacteria 1134
446 Ga0451807_2568450 3300041486 Bacteria 634
447 Ga0451833_1204446 3300041491 Bacteria 547
448 Ga0451833_1243150 3300041491 Bacteria 628
449 Ga0451835_1055552 3300041492 Bacteria 586
450 Ga0451837_0766626 3300041494 Bacteria 1008
451 Ga0451837_1042500 3300041494 Bacteria 2185
452 Ga0451837_1185966 3300041494 Bacteria 737
453 Ga0451839_0654108 3300041496 Bacteria 1064
454 Ga0451841_0842399 3300041498 Bacteria 743
455 Ga0451845_0504423 3300041501 Bacteria 584
456 Ga0451843_0501131 3300041509 Bacteria 2276
457 Ga0451843_0984714 3300041509 Bacteria 682
458 Ga0451853_1276073 3300041512 Bacteria 554
459 Ga0451853_2512039 3300041512 Bacteria 647
460 Ga0451853_2928858 3300041512 Bacteria 743
461 Ga0451853_3785856 3300041512 Bacteria 1516
462 Ga0439433_0016096 3300041999 Bacteria 1654
463 Ga0439433_0055837 3300041999 Bacteria 936
464 Ga0439433_0100366 3300041999 Bacteria 718
465 Ga0439433_0100772 3300041999 Bacteria 716
466 Ga0439445_0005312 3300042004 Bacteria 2934
467 Ga0439445_0042303 3300042004 Bacteria 1213
468 Ga0439432_006084 3300042006 Bacteria 4324
469 Ga0439432_011439 3300042006 Bacteria 3059
470 Ga0439432_019376 3300042006 Bacteria 2267
471 Ga0439432_019821 3300042006 Bacteria 2238
472 Ga0439432_029249 3300042006 Bacteria 1792
473 Ga0439449_0000650 3300042007 Bacteria 13086
474 Ga0439449_0002587 3300042007 Bacteria 7058
475 Ga0439449_0003784 3300042007 Bacteria 5856
476 Ga0439449_0006088 3300042007 Bacteria 4612
477 Ga0439449_0009505 3300042007 Bacteria 3684
478 Ga0439449_0014318 3300042007 Bacteria 2981
479 Ga0439449_0068772 3300042007 Bacteria 1305
480 Ga0439452_016951 3300042010 Bacteria 1970
481 Ga0439462_0008072 3300042015 Bacteria 2648
482 Ga0439462_0017511 3300042015 Bacteria 1856
483 Ga0439462_0071841 3300042015 Bacteria 940
484 Ga0450911_000371 3300042115 Bacteria 14936
485 Ga0450899_006367 3300042135 Bacteria 1278
486 Ga0439446_0048727 3300042156 Bacteria 1262
487 Ga0439446_0142766 3300042156 Bacteria 783
488 Ga0439434_0025040 3300042435 Bacteria 1801
489 Ga0439434_0266653 3300042435 Bacteria 588
490 Ga0450893_0096079 3300042532 Bacteria 600
491 Ga0451577_0015288 3300042876 Bacteria 7142
492 Ga0439440_0010673 3300042993 Bacteria 1925
493 Ga0453684_0000316 3300044712 Bacteria 204457
494 Ga0453684_0089807 3300044712 Bacteria 3798
495 Ga0451576_0000128 3300045051 Bacteria 192071
496 Ga0466967_0218258 3300045976 Bacteria 1811
497 Ga0495627_000853 3300046453 Bacteria 21817
498 Ga0495627_066089 3300046453 Bacteria 1062
499 Ga0495627_072249 3300046453 Bacteria 1006
500 Ga0495590_0024956 3300046457 Bacteria 2104
501 Ga0495591_013488 3300046458 Bacteria 2987
502 Ga0495638_0001228 3300046460 Bacteria 24256
503 Ga0495638_0030301 3300046460 Bacteria 3484
504 Ga0495638_0147851 3300046460 Bacteria 1365
505 Ga0495607_0218148 3300046501 Bacteria 934
506 Ga0495606_0021112 3300046507 Bacteria 4776
507 Ga0495610_0001130 3300046512 Bacteria 24312
508 Ga0495610_0021459 3300046512 Bacteria 3551
509 Ga0495616_0016650 3300046513 Bacteria 4064
510 Ga0495631_0000369 3300046518 Bacteria 30975
511 Ga0495632_0089096 3300046519 Bacteria 1465
512 Ga0495643_0003775 3300046522 Bacteria 10950
513 Ga0495663_0000899 3300046525 Bacteria 10023
514 Ga0495663_0013048 3300046525 Bacteria 2321
515 Ga0495663_0025795 3300046525 Bacteria 1716
516 Ga0495663_0058290 3300046525 Bacteria 1210
517 Ga0495654_0107423 3300046530 Bacteria 1276
518 Ga0495598_0024218 3300046537 Bacteria 1643
519 Ga0495621_0002787 3300046539 Bacteria 4751
520 Ga0495621_0008296 3300046539 Bacteria 3109
521 Ga0495621_0025179 3300046539 Bacteria 1997
522 Ga0495622_0135747 3300046557 Bacteria 1119
523 Ga0495633_0001102 3300046558 Bacteria 21787
524 Ga0495633_0003816 3300046558 Bacteria 9863
525 Ga0495633_0011696 3300046558 Bacteria 4713
526 Ga0495633_0041280 3300046558 Bacteria 2194
527 Ga0495633_0043736 3300046558 Bacteria 2124
528 Ga0495633_0264369 3300046558 Bacteria 784
529 Ga0495656_0001943 3300046615 Bacteria 6814
530 Ga0495656_0002508 3300046615 Bacteria 6105
531 Ga0495656_0004358 3300046615 Bacteria 4839
532 Ga0495656_0067967 3300046615 Bacteria 1574
533 Ga0495656_0232697 3300046615 Bacteria 925
534 Ga0495668_0000960 3300046616 Bacteria 32037
535 Ga0495625_0096632 3300046660 Bacteria 2035
536 Ga0495659_0008952 3300046664 Bacteria 3189
537 Ga0495670_0275136 3300046691 Bacteria 900
538 Ga0495671_0083413 3300046692 Bacteria 1566
539 Ga0495660_0004923 3300046810 Bacteria 8048
540 Ga0495660_0113172 3300046810 Bacteria 1382
541 Ga0495660_0155429 3300046810 Bacteria 1126
542 Ga0495636_0013289 3300047318 Bacteria 3266
543 Ga0495636_0028691 3300047318 Bacteria 2270
544 Ga0495636_0030645 3300047318 Bacteria 2200
545 Ga0495636_0060586 3300047318 Bacteria 1599
546 Ga0495636_0062891 3300047318 Bacteria 1571
547 Ga0495672_0000079 3300047320 Bacteria 161885
548 Ga0495672_0026243 3300047320 Bacteria 3719
549 Ga0495672_0076591 3300047320 Bacteria 1878
550 Ga0495685_081273 3300047447 Bacteria 1079
551 Ga0495681_0033084 3300047470 Bacteria 2594
552 Ga0495681_0101672 3300047470 Bacteria 1256
553 Ga0495686_0012567 3300047472 Bacteria 5919
554 Ga0495615_0279499 3300048090 Bacteria 536
555 Ga0496101_0119291 3300048904 Bacteria 1993
556 Ga0496101_0254279 3300048904 Bacteria 1369
557 Ga0496101_1336992 3300048904 Bacteria 560
558 Ga0496102_0328648 3300048905 Bacteria 1440
559 Ga0496103_0127295 3300048906 Bacteria 1625
560 Ga0496105_0401066 3300048908 Bacteria 1089
561 Ga0496106_0123063 3300048909 Bacteria 2029
562 Ga0496107_0139447 3300048910 Bacteria 1792
563 Ga0496108_0404326 3300048911 Bacteria 1192
564 Ga0496108_0909007 3300048911 Bacteria 755
565 Ga0496109_0192086 3300048912 Bacteria 1919
566 Ga0496109_0204493 3300048912 Bacteria 1856
567 Ga0496110_0063713 3300048913 Bacteria 3258
568 Ga0496111_0298825 3300048914 Bacteria 1193
569 Ga0496111_0406901 3300048914 Bacteria 1005
570 Ga0496111_0444681 3300048914 Bacteria 956
571 Ga0496112_0449356 3300048915 Bacteria 1226
572 Ga0496113_0004036 3300048916 Bacteria 8936
573 Ga0496113_0026815 3300048916 Bacteria 4124
574 Ga0496113_0046556 3300048916 Bacteria 3220
575 Ga0496113_0491132 3300048916 Bacteria 986
576 Ga0496114_0001425 3300048917 Bacteria 18148
577 Ga0496116_0000742 3300048919 Bacteria 41599
578 Ga0496116_0004402 3300048919 Bacteria 13471
579 Ga0496116_0006168 3300048919 Bacteria 10962
580 Ga0496116_0015795 3300048919 Bacteria 5947
581 Ga0496116_0020093 3300048919 Bacteria 5084
582 Ga0496116_0023042 3300048919 Bacteria 4647
583 Ga0496116_0030969 3300048919 Bacteria 3837
584 Ga0496116_0042398 3300048919 Bacteria 3111
585 Ga0496116_0282868 3300048919 Bacteria 802
586 Ga0496117_0000483 3300048920 Bacteria 66226
587 Ga0496117_0001569 3300048920 Bacteria 32439
588 Ga0496117_0001801 3300048920 Bacteria 29132
589 Ga0496117_0005801 3300048920 Bacteria 12806
590 Ga0496117_0009988 3300048920 Bacteria 8726
591 Ga0496117_0015910 3300048920 Bacteria 6373
592 Ga0496117_0050192 3300048920 Bacteria 2960
593 Ga0496117_0053529 3300048920 Bacteria 2835
594 Ga0496117_0071182 3300048920 Bacteria 2331
595 Ga0496118_0000732 3300048921 Bacteria 53036
596 Ga0496118_0002860 3300048921 Bacteria 22520
597 Ga0496118_0005588 3300048921 Bacteria 14220
598 Ga0496118_0009765 3300048921 Bacteria 9625
599 Ga0496118_0010427 3300048921 Bacteria 9205
600 Ga0496118_0014077 3300048921 Bacteria 7507
601 Ga0496118_0031298 3300048921 Bacteria 4413
602 Ga0496118_0031992 3300048921 Bacteria 4345
603 Ga0496118_0058232 3300048921 Bacteria 2889
604 Ga0496118_0092602 3300048921 Bacteria 2073
605 Ga0496118_0546112 3300048921 Bacteria 566
606 Ga0496119_0001225 3300048922 Bacteria 31961
607 Ga0496119_0001601 3300048922 Bacteria 26908
608 Ga0496119_0003714 3300048922 Bacteria 15636
609 Ga0496119_0016440 3300048922 Bacteria 5631
610 Ga0496119_0026613 3300048922 Bacteria 4005
611 Ga0496120_0000262 3300048923 Bacteria 88205
612 Ga0496120_0000564 3300048923 Bacteria 56487
613 Ga0496120_0003036 3300048923 Bacteria 15844
614 Ga0496120_0003756 3300048923 Bacteria 13441
615 Ga0496120_0012681 3300048923 Bacteria 5719
616 Ga0496120_0167909 3300048923 Bacteria 1088
617 Ga0496121_0000165 3300048924 Bacteria 145052
618 Ga0496121_0001145 3300048924 Bacteria 46506
619 Ga0496121_0005386 3300048924 Bacteria 16439
620 Ga0496121_0006141 3300048924 Bacteria 15082
621 Ga0496121_0016056 3300048924 Bacteria 7760
622 Ga0496121_0035993 3300048924 Bacteria 4421
623 Ga0496121_0074701 3300048924 Bacteria 2710
624 Ga0496121_0080844 3300048924 Bacteria 2574
625 Ga0496121_0095467 3300048924 Bacteria 2311
626 Ga0496121_0127008 3300048924 Bacteria 1915
627 Ga0496121_0528919 3300048924 Bacteria 742
628 Ga0496122_0000537 3300048925 Bacteria 78505
629 Ga0496122_0000736 3300048925 Bacteria 63894
630 Ga0496122_0001070 3300048925 Bacteria 47552
631 Ga0496122_0004558 3300048925 Bacteria 17082
632 Ga0496122_0008632 3300048925 Bacteria 10937
633 Ga0496122_0016201 3300048925 Bacteria 7078
634 Ga0496122_0016730 3300048925 Bacteria 6911
635 Ga0496122_0016983 3300048925 Bacteria 6837
636 Ga0496122_0019102 3300048925 Bacteria 6283
637 Ga0496122_0023374 3300048925 Bacteria 5452
638 Ga0496122_0028118 3300048925 Bacteria 4784
639 Ga0496122_0069527 3300048925 Bacteria 2521
640 Ga0496122_0132678 3300048925 Bacteria 1578
641 Ga0496122_0147744 3300048925 Bacteria 1457
642 Ga0496122_0415413 3300048925 Bacteria 678
643 Ga0496123_0000541 3300048926 Bacteria 64921
644 Ga0496123_0000763 3300048926 Bacteria 52065
645 Ga0496123_0000898 3300048926 Bacteria 47136
646 Ga0496123_0005012 3300048926 Bacteria 13560
647 Ga0496123_0016396 3300048926 Bacteria 6019
648 Ga0496123_0021598 3300048926 Bacteria 4997
649 Ga0496123_0023409 3300048926 Bacteria 4728
650 Ga0496123_0025056 3300048926 Bacteria 4509
651 Ga0496123_0039571 3300048926 Bacteria 3296
652 Ga0496123_0085479 3300048926 Bacteria 1897
653 Ga0496123_0110347 3300048926 Bacteria 1574
654 Ga0496124_0000006 3300048927 Bacteria 904259
655 Ga0496124_0000128 3300048927 Bacteria 157194
656 Ga0496124_0001971 3300048927 Bacteria 28014
657 Ga0496124_0005006 3300048927 Bacteria 15151
658 Ga0496124_0005062 3300048927 Bacteria 15040
659 Ga0496124_0010412 3300048927 Bacteria 9416
660 Ga0496124_0013859 3300048927 Bacteria 7841
661 Ga0496124_0024389 3300048927 Bacteria 5501
662 Ga0496124_0030838 3300048927 Bacteria 4751
663 Ga0496124_0035514 3300048927 Bacteria 4360
664 Ga0496124_0057851 3300048927 Bacteria 3264
665 Ga0496124_0085690 3300048927 Bacteria 2581
666 Ga0496124_0315708 3300048927 Bacteria 1121
667 Ga0496125_0000121 3300048928 Bacteria 174971
668 Ga0496125_0000475 3300048928 Bacteria 71075
669 Ga0496125_0001304 3300048928 Bacteria 36984
670 Ga0496125_0001928 3300048928 Bacteria 28389
671 Ga0496125_0004706 3300048928 Bacteria 15551
672 Ga0496125_0022077 3300048928 Bacteria 5917
673 Ga0496125_0119744 3300048928 Bacteria 1881
674 Ga0496125_0196998 3300048928 Bacteria 1323
675 Ga0496125_0218453 3300048928 Bacteria 1230
676 Ga0496126_0002184 3300048929 Bacteria 27192
677 Ga0496126_0003535 3300048929 Bacteria 19652
678 Ga0496126_0003936 3300048929 Bacteria 18181
679 Ga0496126_0009281 3300048929 Bacteria 10480
680 Ga0496126_0011601 3300048929 Bacteria 9095
681 Ga0496126_0028258 3300048929 Bacteria 5346
682 Ga0496126_0032355 3300048929 Bacteria 4927
683 Ga0496126_0037947 3300048929 Bacteria 4486
684 Ga0496126_0080107 3300048929 Bacteria 2890
685 Ga0496126_0139530 3300048929 Bacteria 2088
686 Ga0496126_0201615 3300048929 Bacteria 1680
687 Ga0496126_0567491 3300048929 Bacteria 898
688 Ga0501290_008728 3300049513 Bacteria 1285
689 Ga0501300_009142 3300049523 Bacteria 1448
690 Ga0501318_083574 3300049534 Bacteria 520
691 Ga0501031_0091160 3300049568 Bacteria 1988
692 Ga0501031_0156969 3300049568 Bacteria 1487
693 Ga0501032_0012431 3300049569 Bacteria 6083
694 Ga0501032_0355852 3300049569 Bacteria 943
695 Ga0501033_0011027 3300049570 Bacteria 6921
696 Ga0501033_0042754 3300049570 Bacteria 3377
697 Ga0501033_0176994 3300049570 Bacteria 1530
698 Ga0501033_0179126 3300049570 Bacteria 1520
699 Ga0501034_0000275 3300049571 Bacteria 92805
700 Ga0501034_0000473 3300049571 Bacteria 66214
701 Ga0501034_0057134 3300049571 Bacteria 3923
702 Ga0501034_0107153 3300049571 Bacteria 2787
703 Ga0501034_0876298 3300049571 Bacteria 787
704 Ga0501034_1229232 3300049571 Bacteria 627
705 Ga0501036_0007849 3300049572 Bacteria 8731
706 Ga0501036_0028501 3300049572 Bacteria 4718
707 Ga0501036_0126887 3300049572 Bacteria 2155
708 Ga0501036_0376426 3300049572 Bacteria 1185
709 Ga0501037_0022240 3300049573 Bacteria 4692
710 Ga0501037_0197202 3300049573 Bacteria 1424
711 Ga0501038_0004044 3300049574 Bacteria 13629
712 Ga0501038_0043636 3300049574 Bacteria 3898
713 Ga0501038_0058536 3300049574 Bacteria 3303
714 Ga0501039_0003853 3300049575 Bacteria 11261
715 Ga0501039_0072692 3300049575 Bacteria 2672
716 Ga0501040_0001206 3300049576 Bacteria 16460
717 Ga0501041_0001968 3300049577 Bacteria 11551
718 Ga0501042_0000931 3300049578 Bacteria 16497
719 Ga0501043_0004623 3300049579 Bacteria 11162
720 Ga0501043_0024241 3300049579 Bacteria 4761
721 Ga0501043_0045876 3300049579 Bacteria 3436
722 Ga0501043_0061394 3300049579 Bacteria 2952
723 Ga0501043_0222397 3300049579 Bacteria 1460
724 Ga0501046_0011112 3300049580 Bacteria 7710
725 Ga0501047_0170711 3300049581 Bacteria 2044
726 Ga0501047_0226790 3300049581 Bacteria 1723
727 Ga0501047_0308235 3300049581 Bacteria 1424
728 Ga0501048_0011120 3300049582 Bacteria 6710
729 Ga0501068_0000860 3300049584 Bacteria 15814
730 Ga0501070_0113135 3300049586 Bacteria 2243
731 Ga0501070_0114001 3300049586 Bacteria 2233
732 Ga0501071_0006996 3300049587 Bacteria 7366
733 Ga0501072_0001665 3300049588 Bacteria 16559
734 Ga0501073_0370358 3300049589 Bacteria 989
735 Ga0501074_0124231 3300049590 Bacteria 1845
736 Ga0501075_0000858 3300049591 Bacteria 19148
737 Ga0501076_0002159 3300049592 Bacteria 13483
738 Ga0501077_0004578 3300049593 Bacteria 8401
739 Ga0501235_055770 3300049669 Bacteria 921
740 Ga0501252_030715 3300049682 Bacteria 743
741 Ga0501257_077886 3300049686 Bacteria 852
742 Ga0501225_0016499 3300049705 Bacteria 2054
743 Ga0501225_0052492 3300049705 Bacteria 1137
744 Ga0501079_0002189 3300049741 Bacteria 14087
745 Ga0501080_0009101 3300049742 Bacteria 9039
746 Ga0501080_0050291 3300049742 Bacteria 3880
747 Ga0501080_0851953 3300049742 Bacteria 797
748 Ga0501081_0000359 3300049743 Bacteria 24723
749 Ga0501081_1348875 3300049743 Bacteria 541
750 Ga0501083_0071631 3300049744 Bacteria 2304
751 Ga0501263_040836 3300049760 Bacteria 681
752 Ga0501265_006501 3300049762 Bacteria 1361
753 Ga0501268_035049 3300049765 Bacteria 924
754 Ga0501275_001320 3300049772 Bacteria 2474
755 Ga0501035_0035887 3300049822 Bacteria 4497
756 Ga0501035_0188478 3300049822 Bacteria 1774
757 Ga0501035_0258322 3300049822 Bacteria 1477
758 Ga0501044_0034937 3300049823 Bacteria 5266
759 Ga0501044_0192180 3300049823 Bacteria 2003
760 Ga0501045_0025348 3300049824 Bacteria 4262
761 nmdc:mga00v17_10491_c1 3300050491 Bacteria 5060
762 nmdc:mga00v17_110193_c1 3300050491 Bacteria 1746
763 nmdc:mga00v17_28595_c1 3300050491 Bacteria 3266
764 nmdc:mga00v17_31379_c1 3300050491 Bacteria 3134
765 nmdc:mga00v17_338_c1 3300050491 Bacteria 22037
766 nmdc:mga00v17_608898_c1 3300050491 Bacteria 704
767 nmdc:mga00v17_96017_c1 3300050491 Bacteria 1867
768 nmdc:mga0sz30_209046_c1 3300050516 Bacteria 867
769 Ga0500635_0002379 3300053080 Bacteria 4652
770 Ga0500651_0012399 3300053093 Bacteria 5168
771 Ga0500650_0150147 3300053098 Bacteria 1078
772 Ga0500555_003420 3300053103 Bacteria 4524
773 Ga0500556_0149718 3300053104 Bacteria 919
774 Ga0500652_000207 3300053131 Bacteria 22588
775 Ga0500658_0398222 3300053134 Bacteria 630
776 Ga0500588_0022794 3300053146 Bacteria 1709
777 Ga0500622_0296335 3300053156 Bacteria 691
778 Ga0500634_0005943 3300053161 Bacteria 5857
779 Ga0500609_027077 3300053731 Bacteria 786
780 Ga0501084_0007709 3300054114 Bacteria 8869
781 Ga0501082_0000368 3300060353 Bacteria 39768
782 Ga0530510_0000025 3300061734 Bacteria 67946

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041498 Ga0451841_0842399 Ga0451841_0842399_75_566 152
2 3300037466 Ga0395898_0743001 Ga0395898_0743001_30_497 154
3 iso_pu_bacteria 2671180694 2673818988 154
4 iso_pu_bacteria 2643221559 2643816867 155
5 iso_pu_bacteria 2643221573 2643881153 155
6 iso_pu_bacteria 2643221586 2643939288 155
7 iso_pu_bacteria 2643221612 2644077963 155
8 iso_pu_bacteria 2643221720 2644661924 155
9 iso_pu_bacteria 2643221727 2644696264 155
10 iso_pu_bacteria 2643221728 2644700064 155
11 iso_pu_bacteria 2643221731 2644715508 155
12 iso_pu_bacteria 2643221732 2644726812 155
13 iso_pu_bacteria 2721755693 2723602094 155
14 iso_pu_bacteria 2728369359 2730138160 155
15 iso_pu_bacteria 2738543010 2739229854 155
16 iso_pu_bacteria 2751185905 2753812364 155
17 iso_pu_bacteria 2802428803 2802439904 155
18 iso_pu_bacteria 2818991465 2819708976 155
19 iso_pu_bacteria 2842882022 2842884785 155
20 iso_pu_bacteria 2864733723 2864738553 155
21 iso_pu_bacteria 2889276214 2889278163 155
22 iso_pu_bacteria 2904113452 2904119032 155
23 iso_pu_bacteria 2904524088 2904524185 155
24 iso_pu_bacteria 2904595352 2904598090 155
25 iso_pu_bacteria 2919143609 2919147238 155
26 iso_pu_bacteria 2919517244 2919519143 155
27 iso_pu_bacteria 2919713450 2919717298 155
28 iso_pu_bacteria 2919720352 2919723510 155
29 iso_pu_bacteria 2928093941 2928095963 155
30 iso_pu_bacteria 2929004312 2929006667 155
31 iso_pu_bacteria 2929206907 2929211067 155
32 iso_pu_bacteria 2960319331 2960319581 155
33 iso_pu_bacteria 2960375949 2960381208 155
34 iso_pu_bacteria 2996706504 2996706891 155
35 iso_pu_bacteria 3006988479 3006988625 155
36 iso_pu_bacteria 648028048 648168604 155
37 iso_pu_bacteria 8022893055 8022898489 155
38 iso_pu_bacteria 8022914991 8022917640 155
39 iso_pu_bacteria 8054280661 8054280827 155
40 iso_pu_bacteria 2540341094 2540607848 156
41 iso_pu_bacteria 2547132130 2547503412 156
42 iso_pu_bacteria 2548877040 2550903578 156
43 iso_pu_bacteria 2571042143 2571530584 156
44 iso_pu_bacteria 2576861471 2578459803 156
45 iso_pu_bacteria 2599185292 2599904398 156
46 iso_pu_bacteria 2643221569 2643863656 156
47 iso_pu_bacteria 2643221593 2643977471 156
48 iso_pu_bacteria 2643221594 2643982858 156
49 iso_pu_bacteria 2643221621 2644123315 156
50 iso_pu_bacteria 2747842428 2747949660 156
51 iso_pu_bacteria 2747842501 2748018993 156
52 iso_pu_bacteria 2765235840 2765577503 156
53 iso_pu_bacteria 2808606395 2809033448 156
54 iso_pu_bacteria 2808606399 2809056215 156
55 iso_pu_bacteria 2816332141 2816519273 156
56 iso_pu_bacteria 2818991457 2819662474 156
57 iso_pu_bacteria 2842391507 2842392499 156
58 iso_pu_bacteria 2842757796 2842761389 156
59 iso_pu_bacteria 2852649853 2852653539 156
60 iso_pu_bacteria 2852684882 2852687804 156
61 iso_pu_bacteria 2857442823 2857445828 156
62 iso_pu_bacteria 2857537821 2857538048 156
63 iso_pu_bacteria 2857542790 2857543852 156
64 iso_pu_bacteria 2858950400 2858955450 156
65 iso_pu_bacteria 2860837431 2860840626 156
66 iso_pu_bacteria 2874220319 2874224354 156
67 iso_pu_bacteria 2894414249 2894416581 156
68 iso_pu_bacteria 2907202186 2907206216 156
69 iso_pu_bacteria 2919089067 2919091964 156
70 iso_pu_bacteria 2919130084 2919132023 156
71 iso_pu_bacteria 2919134579 2919135224 156
72 iso_pu_bacteria 2919513703 2919514868 156
73 iso_pu_bacteria 2919675420 2919677346 156
74 iso_pu_bacteria 2928496128 2928499499 156
75 iso_pu_bacteria 2929195423 2929199238 156
76 iso_pu_bacteria 2931380184 2931382242 156
77 iso_pu_bacteria 2937610967 2937610975 156
78 iso_pu_bacteria 2939589442 2939592406 156
79 iso_pu_bacteria 2939622612 2939624729 156
80 iso_pu_bacteria 2939626828 2939630314 156
81 iso_pu_bacteria 2941475908 2941477540 156
82 iso_pu_bacteria 2941479691 2941484296 156
83 iso_pu_bacteria 2941489479 2941493310 156
84 iso_pu_bacteria 2961047084 2961051118 156
85 iso_pu_bacteria 2961064222 2961065417 156
86 iso_pu_bacteria 2962290636 2962293837 156
87 iso_pu_bacteria 2969136845 2969139831 156
88 iso_pu_bacteria 2969765954 2969769701 156
89 iso_pu_bacteria 2969770375 2969772764 156
90 iso_pu_bacteria 2974307012 2974310240 156
91 iso_pu_bacteria 2977247770 2977250967 156
92 iso_pu_bacteria 2980492589 2980495620 156
93 iso_pu_bacteria 2984514374 2984514540 156
94 iso_pu_bacteria 2987605356 2987608888 156
95 iso_pu_bacteria 2995948881 2995953375 156
96 iso_pu_bacteria 8003014200 8003017515 156
97 iso_pu_bacteria 8021622325 8021625253 156
98 iso_pu_bacteria 8021626552 8021627528 156
99 iso_pu_bacteria 8021648035 8021649218 156
100 iso_pu_bacteria 8022653035 8022654784 156
101 iso_pu_bacteria 8054465665 8054465911 156
102 3300031727 Ga0316576_10321852 Ga0316576_103218521 157
103 3300035398 Ga0316574_0244884 Ga0316574_0244884_575_1057 157
104 3300035398 Ga0316574_0461989 Ga0316574_0461989_235_723 157
105 3300036712 Ga0316584_0515278 Ga0316584_0515278_326_808 157
106 3300041441 Ga0451787_691700 Ga0451787_691700_422_907 157
107 iso_pu_bacteria 2551306166 2552111426 157
108 iso_pu_bacteria 2571042365 2572255915 157
109 iso_pu_bacteria 2643221579 2643908336 157
110 iso_pu_bacteria 2643221581 2643914639 157
111 iso_pu_bacteria 2842780639 2842782670 157
112 iso_pu_bacteria 2842888712 2842890266 157
113 iso_pu_bacteria 2895498888 2895501447 157
114 iso_pu_bacteria 2895511927 2895514590 157
115 iso_pu_bacteria 2895522137 2895523928 157
116 iso_pu_bacteria 2895525241 2895528272 157
117 iso_pu_bacteria 2923516293 2923517067 157
118 iso_pu_bacteria 8002869464 8002870896 157
119 3300005331 Ga0070670_100050456 Ga0070670_1000504563 158
120 3300005335 Ga0070666_10274967 Ga0070666_102749672 158
121 3300005353 Ga0070669_100033911 Ga0070669_1000339113 158
122 3300005354 Ga0070675_100442360 Ga0070675_1004423602 158
123 3300005355 Ga0070671_100554437 Ga0070671_1005544371 158
124 3300005356 Ga0070674_100014888 Ga0070674_1000148884 158
125 3300005367 Ga0070667_100887726 Ga0070667_1008877262 158
126 3300005459 Ga0068867_100127289 Ga0068867_1001272891 158
127 3300005543 Ga0070672_100001204 Ga0070672_1000012045 158
128 3300005618 Ga0068864_100241186 Ga0068864_1002411862 158
129 3300009176 Ga0105242_10329799 Ga0105242_103297992 158
130 3300013297 Ga0157378_10633571 Ga0157378_106335712 158
131 3300013308 Ga0157375_10213409 Ga0157375_102134092 158
132 3300025903 Ga0207680_10652729 Ga0207680_106527292 158
133 3300025920 Ga0207649_11136356 Ga0207649_111363562 158
134 3300025925 Ga0207650_10033189 Ga0207650_100331893 158
135 3300025931 Ga0207644_10560895 Ga0207644_105608952 158
136 3300025937 Ga0207669_10049010 Ga0207669_100490102 158
137 3300025940 Ga0207691_10018899 Ga0207691_100188992 158
138 3300025986 Ga0207658_10332020 Ga0207658_103320202 158
139 3300026089 Ga0207648_10444570 Ga0207648_104445702 158
140 3300041512 Ga0451853_2512039 Ga0451853_2512039_10_492 158
141 3300046537 Ga0495598_0024218 Ga0495598_0024218_194_691 158
142 3300046539 Ga0495621_0025179 Ga0495621_0025179_407_904 158
143 3300048911 Ga0496108_0909007 Ga0496108_0909007_213_695 158
144 iso_pu_bacteria 2818991441 2819568830 158
145 3300005327 Ga0070658_10013884 Ga0070658_100138847 159
146 3300005336 Ga0070680_100027857 Ga0070680_1000278574 159
147 3300005341 Ga0070691_10001219 Ga0070691_100012196 159
148 3300005458 Ga0070681_10000625 Ga0070681_100006253 159
149 3300005530 Ga0070679_100016885 Ga0070679_1000168857 159
150 3300005548 Ga0070665_100005654 Ga0070665_10000565417 159
151 3300005563 Ga0068855_100026332 Ga0068855_1000263327 159
152 3300005614 Ga0068856_100079882 Ga0068856_1000798823 159
153 3300006175 Ga0070712_100259432 Ga0070712_1002594322 159
154 3300009093 Ga0105240_10015095 Ga0105240_100150959 159
155 3300009551 Ga0105238_10194061 Ga0105238_101940612 159
156 3300010375 Ga0105239_12211901 Ga0105239_122119011 159
157 3300025225 Ga0209566_100122 Ga0209566_10012223 159
158 3300025225 Ga0209566_111607 Ga0209566_1116072 159
159 3300025304 Ga0209257_1071658 Ga0209257_10716581 159
160 3300025912 Ga0207707_10001167 Ga0207707_100011672 159
161 3300025913 Ga0207695_10151847 Ga0207695_101518472 159
162 3300025915 Ga0207693_10136936 Ga0207693_101369363 159
163 3300025917 Ga0207660_10007789 Ga0207660_100077893 159
164 3300025921 Ga0207652_10003496 Ga0207652_1000349611 159
165 3300025924 Ga0207694_10324880 Ga0207694_103248802 159
166 3300025925 Ga0207650_10129489 Ga0207650_101294893 159
167 3300025949 Ga0207667_10040754 Ga0207667_100407542 159
168 3300025981 Ga0207640_11214820 Ga0207640_112148201 159
169 3300026078 Ga0207702_10175258 Ga0207702_101752582 159
170 3300028379 Ga0268266_10001436 Ga0268266_1000143619 159
171 3300031507 Ga0307509_10753553 Ga0307509_107535532 159
172 3300032002 Ga0307416_100343905 Ga0307416_1003439052 159
173 3300037312 Ga0395899_0352222 Ga0395899_0352222_173_652 159
174 3300041492 Ga0451835_1055552 Ga0451835_1055552_37_549 159
175 3300044712 Ga0453684_0000316 Ga0453684_0000316_202126_202608 159
176 3300045051 Ga0451576_0000128 Ga0451576_0000128_189740_190222 159
177 3300045976 Ga0466967_0218258 Ga0466967_0218258_181_681 159
178 3300046457 Ga0495590_0024956 Ga0495590_0024956_481_960 159
179 3300046557 Ga0495622_0135747 Ga0495622_0135747_88_570 159
180 3300046810 Ga0495660_0113172 Ga0495660_0113172_121_600 159
181 3300046810 Ga0495660_0155429 Ga0495660_0155429_525_1004 159
182 3300048904 Ga0496101_1336992 Ga0496101_1336992_48_530 159
183 3300048916 Ga0496113_0491132 Ga0496113_0491132_423_923 159
184 3300048919 Ga0496116_0042398 Ga0496116_0042398_1330_1809 159
185 3300048921 Ga0496118_0009765 Ga0496118_0009765_7684_8163 159
186 3300048921 Ga0496118_0546112 Ga0496118_0546112_55_534 159
187 3300048922 Ga0496119_0016440 Ga0496119_0016440_3492_3971 159
188 3300048923 Ga0496120_0003036 Ga0496120_0003036_15188_15667 159
189 3300048924 Ga0496121_0005386 Ga0496121_0005386_14745_15224 159
190 3300048924 Ga0496121_0035993 Ga0496121_0035993_3827_4306 159
191 3300048924 Ga0496121_0080844 Ga0496121_0080844_1062_1541 159
192 3300048925 Ga0496122_0023374 Ga0496122_0023374_2600_3079 159
193 3300048925 Ga0496122_0415413 Ga0496122_0415413_159_638 159
194 3300048926 Ga0496123_0023409 Ga0496123_0023409_3631_4110 159
195 3300048927 Ga0496124_0085690 Ga0496124_0085690_305_784 159
196 3300048928 Ga0496125_0001304 Ga0496125_0001304_9385_9864 159
197 3300048929 Ga0496126_0011601 Ga0496126_0011601_5992_6471 159
198 3300049534 Ga0501318_083574 Ga0501318_083574_26_508 159
199 3300053093 Ga0500651_0012399 Ga0500651_0012399_1321_1815 159
200 3300053098 Ga0500650_0150147 Ga0500650_0150147_141_635 159
201 3300053103 Ga0500555_003420 Ga0500555_003420_3583_4077 159
202 3300053104 Ga0500556_0149718 Ga0500556_0149718_393_887 159
203 3300053146 Ga0500588_0022794 Ga0500588_0022794_108_602 159
204 2162886007 SwRhRL2b_contig_3802179 SwRhRL2b_0364.00006860 160
205 2162886007 SwRhRL2b_contig_46047 SwRhRL2b_0932.00007830 160
206 3300002773 JGI25152J39213_1000025 JGI25152J39213_100002544 160
207 3300002774 JGI25150J39212_1000066 JGI25150J39212_100006655 160
208 3300003187 JGI25151J46595_10000117 JGI25151J46595_1000011784 160
209 3300003187 JGI25151J46595_10000139 JGI25151J46595_1000013957 160
210 3300003187 JGI25151J46595_10016266 JGI25151J46595_100162662 160
211 3300003187 JGI25151J46595_10019101 JGI25151J46595_100191012 160
212 3300003187 JGI25151J46595_10038704 JGI25151J46595_100387043 160
213 3300003215 JGI25153J46596_10000101 JGI25153J46596_1000010157 160
214 3300003320 rootH2_10038994 rootH2_100389944 160
215 3300003751 Ga0055538_1000164 Ga0055538_10001645 160
216 3300003761 Ga0055535_1002595 Ga0055535_10025958 160
217 3300003761 Ga0055535_1009874 Ga0055535_10098743 160
218 3300003771 Ga0055526_1000183 Ga0055526_100018335 160
219 3300003771 Ga0055526_1001045 Ga0055526_10010459 160
220 3300003771 Ga0055526_1004844 Ga0055526_10048444 160
221 3300003773 Ga0055537_1000028 Ga0055537_100002892 160
222 3300003773 Ga0055537_1000314 Ga0055537_100031435 160
223 3300003775 Ga0055524_1000461 Ga0055524_10004612 160
224 3300003775 Ga0055524_1018198 Ga0055524_10181981 160
225 3300003781 Ga0055536_1001419 Ga0055536_10014193 160
226 3300003781 Ga0055536_1001978 Ga0055536_10019788 160
227 3300003781 Ga0055536_1002334 Ga0055536_10023345 160
228 3300003781 Ga0055536_1019619 Ga0055536_10196192 160
229 3300003781 Ga0055536_1022683 Ga0055536_10226833 160
230 3300003781 Ga0055536_1030270 Ga0055536_10302701 160
231 3300003784 Ga0055534_1000180 Ga0055534_100018026 160
232 3300003784 Ga0055534_1000302 Ga0055534_10003022 160
233 3300003790 Ga0055528_1000172 Ga0055528_100017235 160
234 3300003790 Ga0055528_1000262 Ga0055528_100026223 160
235 3300003791 Ga0055530_10000784 Ga0055530_1000078410 160
236 3300003791 Ga0055530_10001075 Ga0055530_1000107513 160
237 3300003791 Ga0055530_10002332 Ga0055530_1000233212 160
238 3300003791 Ga0055530_10049130 Ga0055530_100491302 160
239 3300003791 Ga0055530_10080760 Ga0055530_100807601 160
240 3300003794 Ga0055531_10010004 Ga0055531_100100044 160
241 3300003794 Ga0055531_10010801 Ga0055531_100108014 160
242 3300003794 Ga0055531_10014958 Ga0055531_100149582 160
243 3300003794 Ga0055531_10026654 Ga0055531_100266543 160
244 3300003794 Ga0055531_10026698 Ga0055531_100266982 160
245 3300003794 Ga0055531_10034540 Ga0055531_100345403 160
246 3300003841 Ga0055541_1000253 Ga0055541_10002531 160
247 3300003841 Ga0055541_1020817 Ga0055541_10208172 160
248 3300003856 Ga0058692_1000026 Ga0058692_1000026119 160
249 3300003856 Ga0058692_1000040 Ga0058692_100004042 160
250 3300005262 Ga0065165_1016213 Ga0065165_10162134 160
251 3300005288 Ga0065714_10275140 Ga0065714_102751402 160
252 3300005289 Ga0065704_10033986 Ga0065704_100339861 160
253 3300005289 Ga0065704_10071027 Ga0065704_100710274 160
254 3300005289 Ga0065704_10098809 Ga0065704_100988093 160
255 3300005289 Ga0065704_10457457 Ga0065704_104574572 160
256 3300005293 Ga0065715_10161706 Ga0065715_101617062 160
257 3300005331 Ga0070670_100011457 Ga0070670_1000114575 160
258 3300005331 Ga0070670_100294827 Ga0070670_1002948272 160
259 3300005331 Ga0070670_100317434 Ga0070670_1003174342 160
260 3300005331 Ga0070670_101153080 Ga0070670_1011530801 160
261 3300005336 Ga0070680_100168041 Ga0070680_1001680413 160
262 3300005336 Ga0070680_100504777 Ga0070680_1005047772 160
263 3300005339 Ga0070660_100437854 Ga0070660_1004378541 160
264 3300005347 Ga0070668_100008075 Ga0070668_1000080757 160
265 3300005347 Ga0070668_100056289 Ga0070668_1000562892 160
266 3300005347 Ga0070668_100318540 Ga0070668_1003185402 160
267 3300005353 Ga0070669_100011958 Ga0070669_1000119584 160
268 3300005353 Ga0070669_100292934 Ga0070669_1002929342 160
269 3300005353 Ga0070669_101526823 Ga0070669_1015268231 160
270 3300005354 Ga0070675_100106930 Ga0070675_1001069303 160
271 3300005354 Ga0070675_100250156 Ga0070675_1002501561 160
272 3300005354 Ga0070675_100841081 Ga0070675_1008410811 160
273 3300005355 Ga0070671_100109163 Ga0070671_1001091632 160
274 3300005366 Ga0070659_101358036 Ga0070659_1013580361 160
275 3300005440 Ga0070705_100202730 Ga0070705_1002027302 160
276 3300005456 Ga0070678_100061918 Ga0070678_1000619182 160
277 3300005457 Ga0070662_100766456 Ga0070662_1007664561 160
278 3300005458 Ga0070681_10191696 Ga0070681_101916963 160
279 3300005530 Ga0070679_100106292 Ga0070679_1001062922 160
280 3300005530 Ga0070679_100326324 Ga0070679_1003263242 160
281 3300005543 Ga0070672_100515988 Ga0070672_1005159881 160
282 3300005543 Ga0070672_101458262 Ga0070672_1014582622 160
283 3300005547 Ga0070693_100018623 Ga0070693_1000186234 160
284 3300005548 Ga0070665_100007318 Ga0070665_1000073184 160
285 3300005548 Ga0070665_100104205 Ga0070665_1001042054 160
286 3300005548 Ga0070665_100596980 Ga0070665_1005969802 160
287 3300005548 Ga0070665_102291851 Ga0070665_1022918511 160
288 3300005563 Ga0068855_100555681 Ga0068855_1005556812 160
289 3300005564 Ga0070664_100502989 Ga0070664_1005029892 160
290 3300005577 Ga0068857_100054874 Ga0068857_1000548744 160
291 3300005577 Ga0068857_100442624 Ga0068857_1004426242 160
292 3300005616 Ga0068852_100700428 Ga0068852_1007004282 160
293 3300005719 Ga0068861_101559593 Ga0068861_1015595931 160
294 3300006038 Ga0075365_10177577 Ga0075365_101775772 160
295 3300006038 Ga0075365_10633675 Ga0075365_106336752 160
296 3300006042 Ga0075368_10047232 Ga0075368_100472322 160
297 3300006048 Ga0075363_100130488 Ga0075363_1001304881 160
298 3300006051 Ga0075364_10000005 Ga0075364_1000000554 160
299 3300006051 Ga0075364_10033668 Ga0075364_100336684 160
300 3300006051 Ga0075364_10039167 Ga0075364_100391672 160
301 3300006051 Ga0075364_10118436 Ga0075364_101184362 160
302 3300006051 Ga0075364_10204290 Ga0075364_102042902 160
303 3300006051 Ga0075364_10312604 Ga0075364_103126042 160
304 3300006177 Ga0075362_10071327 Ga0075362_100713272 160
305 3300006186 Ga0075369_10129978 Ga0075369_101299782 160
306 3300009011 Ga0105251_10001131 Ga0105251_1000113112 160
307 3300009011 Ga0105251_10004086 Ga0105251_1000408611 160
308 3300009036 Ga0105244_10018430 Ga0105244_100184304 160
309 3300009036 Ga0105244_10070874 Ga0105244_100708743 160
310 3300009036 Ga0105244_10319381 Ga0105244_103193812 160
311 3300009093 Ga0105240_10029298 Ga0105240_100292986 160
312 3300009098 Ga0105245_10155857 Ga0105245_101558572 160
313 3300009101 Ga0105247_10650881 Ga0105247_106508811 160
314 3300009148 Ga0105243_10009739 Ga0105243_100097394 160
315 3300009148 Ga0105243_10032820 Ga0105243_100328202 160
316 3300009174 Ga0105241_10062611 Ga0105241_100626114 160
317 3300009176 Ga0105242_10970637 Ga0105242_109706372 160
318 3300009177 Ga0105248_10002072 Ga0105248_100020724 160
319 3300009177 Ga0105248_11043579 Ga0105248_110435792 160
320 3300009177 Ga0105248_12362639 Ga0105248_123626392 160
321 3300009979 Ga0105032_101190 Ga0105032_1011903 160
322 3300009984 Ga0105029_110633 Ga0105029_1106331 160
323 3300010375 Ga0105239_10016256 Ga0105239_100162567 160
324 3300012482 Ga0157318_1004328 Ga0157318_10043282 160
325 3300012497 Ga0157319_1015394 Ga0157319_10153941 160
326 3300012500 Ga0157314_1001703 Ga0157314_10017032 160
327 3300012515 Ga0157338_1070602 Ga0157338_10706021 160
328 3300013100 Ga0157373_10068840 Ga0157373_100688403 160
329 3300013102 Ga0157371_10000658 Ga0157371_1000065815 160
330 3300013102 Ga0157371_10043343 Ga0157371_100433433 160
331 3300013102 Ga0157371_10316042 Ga0157371_103160422 160
332 3300013102 Ga0157371_10574622 Ga0157371_105746221 160
333 3300013104 Ga0157370_10016314 Ga0157370_100163145 160
334 3300013104 Ga0157370_10239140 Ga0157370_102391403 160
335 3300013104 Ga0157370_10271084 Ga0157370_102710843 160
336 3300013105 Ga0157369_10020199 Ga0157369_100201992 160
337 3300013105 Ga0157369_10070214 Ga0157369_100702142 160
338 3300013296 Ga0157374_10144870 Ga0157374_101448704 160
339 3300013297 Ga0157378_10091347 Ga0157378_100913473 160
340 3300013307 Ga0157372_10111602 Ga0157372_101116024 160
341 3300013308 Ga0157375_10029463 Ga0157375_100294633 160
342 3300013308 Ga0157375_10502640 Ga0157375_105026401 160
343 3300014326 Ga0157380_10097097 Ga0157380_100970972 160
344 3300014326 Ga0157380_10935501 Ga0157380_109355012 160
345 3300014497 Ga0182008_10000730 Ga0182008_1000073015 160
346 3300014497 Ga0182008_10013902 Ga0182008_100139023 160
347 3300014497 Ga0182008_10024004 Ga0182008_100240042 160
348 3300015261 Ga0182006_1015620 Ga0182006_10156204 160
349 3300015261 Ga0182006_1065014 Ga0182006_10650143 160
350 3300015262 Ga0182007_10000025 Ga0182007_1000002519 160
351 3300015265 Ga0182005_1000063 Ga0182005_100006334 160
352 3300015265 Ga0182005_1004147 Ga0182005_10041471 160
353 3300015689 Ga0183360_10003 Ga0183360_10003157 160
354 3300017792 Ga0163161_10004635 Ga0163161_100046353 160
355 3300017792 Ga0163161_10012078 Ga0163161_100120783 160
356 3300017792 Ga0163161_10040670 Ga0163161_100406704 160
357 3300017792 Ga0163161_10161692 Ga0163161_101616922 160
358 3300017792 Ga0163161_10343145 Ga0163161_103431452 160
359 3300017792 Ga0163161_10562756 Ga0163161_105627562 160
360 3300021388 Ga0213875_10329094 Ga0213875_103290941 160
361 3300025224 Ga0209784_100084 Ga0209784_10008431 160
362 3300025225 Ga0209566_100092 Ga0209566_10009291 160
363 3300025229 Ga0209147_112588 Ga0209147_1125881 160
364 3300025242 Ga0209258_101493 Ga0209258_1014932 160
365 3300025245 Ga0207425_1000040 Ga0207425_1000040175 160
366 3300025245 Ga0207425_1024176 Ga0207425_10241761 160
367 3300025245 Ga0207425_1049150 Ga0207425_10491502 160
368 3300025258 Ga0209129_1000011 Ga0209129_100001187 160
369 3300025263 Ga0209565_1000002 Ga0209565_1000002157 160
370 3300025263 Ga0209565_1000037 Ga0209565_1000037107 160
371 3300025263 Ga0209565_1024592 Ga0209565_10245922 160
372 3300025273 Ga0209673_1000002 Ga0209673_1000002157 160
373 3300025273 Ga0209673_1000032 Ga0209673_1000032211 160
374 3300025273 Ga0209673_1009916 Ga0209673_10099163 160
375 3300025273 Ga0209673_1056213 Ga0209673_10562132 160
376 3300025284 Ga0209130_1007940 Ga0209130_10079401 160
377 3300025291 Ga0209675_1000002 Ga0209675_1000002157 160
378 3300025291 Ga0209675_1000020 Ga0209675_1000020142 160
379 3300025291 Ga0209675_1010710 Ga0209675_10107106 160
380 3300025291 Ga0209675_1019174 Ga0209675_10191742 160
381 3300025292 Ga0209676_1000063 Ga0209676_1000063230 160
382 3300025292 Ga0209676_1000149 Ga0209676_100014927 160
383 3300025292 Ga0209676_1000199 Ga0209676_1000199101 160
384 3300025292 Ga0209676_1000610 Ga0209676_100061013 160
385 3300025292 Ga0209676_1004196 Ga0209676_10041964 160
386 3300025292 Ga0209676_1011454 Ga0209676_10114544 160
387 3300025292 Ga0209676_1017123 Ga0209676_10171232 160
388 3300025294 Ga0209025_1000002 Ga0209025_1000002710 160
389 3300025294 Ga0209025_1000030 Ga0209025_1000030345 160
390 3300025294 Ga0209025_1006488 Ga0209025_10064886 160
391 3300025294 Ga0209025_1007306 Ga0209025_10073064 160
392 3300025294 Ga0209025_1009758 Ga0209025_10097586 160
393 3300025294 Ga0209025_1012032 Ga0209025_10120323 160
394 3300025294 Ga0209025_1033326 Ga0209025_10333262 160
395 3300025294 Ga0209025_1039683 Ga0209025_10396834 160
396 3300025294 Ga0209025_1043666 Ga0209025_10436662 160
397 3300025294 Ga0209025_1097167 Ga0209025_10971672 160
398 3300025295 Ga0209564_1000004 Ga0209564_1000004158 160
399 3300025295 Ga0209564_1000951 Ga0209564_100095121 160
400 3300025295 Ga0209564_1004958 Ga0209564_10049582 160
401 3300025297 Ga0209758_1000003 Ga0209758_1000003717 160
402 3300025297 Ga0209758_1012563 Ga0209758_10125633 160
403 3300025298 Ga0209050_1000189 Ga0209050_100018948 160
404 3300025298 Ga0209050_1000199 Ga0209050_100019910 160
405 3300025298 Ga0209050_1000794 Ga0209050_100079412 160
406 3300025298 Ga0209050_1001310 Ga0209050_100131021 160
407 3300025298 Ga0209050_1007848 Ga0209050_10078484 160
408 3300025298 Ga0209050_1047328 Ga0209050_10473282 160
409 3300025299 Ga0209256_1000004 Ga0209256_1000004158 160
410 3300025299 Ga0209256_1001838 Ga0209256_10018389 160
411 3300025299 Ga0209256_1002507 Ga0209256_10025073 160
412 3300025299 Ga0209256_1003521 Ga0209256_10035214 160
413 3300025299 Ga0209256_1006653 Ga0209256_10066534 160
414 3300025299 Ga0209256_1048142 Ga0209256_10481421 160
415 3300025303 Ga0209051_1013273 Ga0209051_10132733 160
416 3300025304 Ga0209257_1000078 Ga0209257_100007832 160
417 3300025304 Ga0209257_1000086 Ga0209257_1000086243 160
418 3300025304 Ga0209257_1001558 Ga0209257_100155815 160
419 3300025304 Ga0209257_1001969 Ga0209257_10019693 160
420 3300025304 Ga0209257_1002257 Ga0209257_100225710 160
421 3300025304 Ga0209257_1003701 Ga0209257_100370112 160
422 3300025304 Ga0209257_1012493 Ga0209257_10124933 160
423 3300025304 Ga0209257_1023282 Ga0209257_10232823 160
424 3300025304 Ga0209257_1025141 Ga0209257_10251413 160
425 3300025728 Ga0207655_1068386 Ga0207655_10683861 160
426 3300025735 Ga0207713_1000253 Ga0207713_100025313 160
427 3300025735 Ga0207713_1023662 Ga0207713_10236623 160
428 3300025909 Ga0207705_10078723 Ga0207705_100787232 160
429 3300025911 Ga0207654_10020676 Ga0207654_100206763 160
430 3300025912 Ga0207707_10295362 Ga0207707_102953622 160
431 3300025913 Ga0207695_10051073 Ga0207695_100510734 160
432 3300025917 Ga0207660_10358631 Ga0207660_103586312 160
433 3300025919 Ga0207657_10025581 Ga0207657_100255813 160
434 3300025921 Ga0207652_10111470 Ga0207652_101114702 160
435 3300025921 Ga0207652_10198608 Ga0207652_101986082 160
436 3300025923 Ga0207681_10025032 Ga0207681_100250324 160
437 3300025923 Ga0207681_10217484 Ga0207681_102174842 160
438 3300025923 Ga0207681_10471331 Ga0207681_104713312 160
439 3300025925 Ga0207650_10008541 Ga0207650_100085415 160
440 3300025926 Ga0207659_10077556 Ga0207659_100775562 160
441 3300025926 Ga0207659_10244659 Ga0207659_102446592 160
442 3300025931 Ga0207644_10006436 Ga0207644_100064367 160
443 3300025931 Ga0207644_10111606 Ga0207644_101116062 160
444 3300025932 Ga0207690_10874258 Ga0207690_108742581 160
445 3300025935 Ga0207709_10001569 Ga0207709_1000156911 160
446 3300025935 Ga0207709_10075898 Ga0207709_100758982 160
447 3300025941 Ga0207711_10002243 Ga0207711_1000224315 160
448 3300025941 Ga0207711_10468665 Ga0207711_104686652 160
449 3300025941 Ga0207711_10566441 Ga0207711_105664412 160
450 3300025949 Ga0207667_10464492 Ga0207667_104644922 160
451 3300025960 Ga0207651_10409869 Ga0207651_104098692 160
452 3300025972 Ga0207668_10004601 Ga0207668_100046014 160
453 3300025972 Ga0207668_10024065 Ga0207668_100240654 160
454 3300026075 Ga0207708_10921796 Ga0207708_109217961 160
455 3300026116 Ga0207674_10010009 Ga0207674_100100096 160
456 3300026118 Ga0207675_100671875 Ga0207675_1006718752 160
457 3300026121 Ga0207683_10095515 Ga0207683_100955152 160
458 3300026121 Ga0207683_10802538 Ga0207683_108025382 160
459 3300027312 Ga0209371_1000028 Ga0209371_1000028142 160
460 3300027312 Ga0209371_1000048 Ga0209371_1000048171 160
461 3300027312 Ga0209371_1010826 Ga0209371_10108262 160
462 3300027378 Ga0209981_1042102 Ga0209981_10421022 160
463 3300027424 Ga0209984_1009274 Ga0209984_10092742 160
464 3300027471 Ga0209995_1010920 Ga0209995_10109203 160
465 3300027543 Ga0209999_1004632 Ga0209999_10046321 160
466 3300027614 Ga0209970_1006158 Ga0209970_10061583 160
467 3300027614 Ga0209970_1007034 Ga0209970_10070342 160
468 3300027665 Ga0209983_1001083 Ga0209983_10010833 160
469 3300027665 Ga0209983_1027086 Ga0209983_10270862 160
470 3300027682 Ga0209971_1000758 Ga0209971_10007583 160
471 3300027682 Ga0209971_1012091 Ga0209971_10120913 160
472 3300027876 Ga0209974_10010835 Ga0209974_100108353 160
473 3300027876 Ga0209974_10019745 Ga0209974_100197452 160
474 3300027876 Ga0209974_10025126 Ga0209974_100251262 160
475 3300028379 Ga0268266_10024900 Ga0268266_100249004 160
476 3300028379 Ga0268266_10054746 Ga0268266_100547464 160
477 3300028379 Ga0268266_11412684 Ga0268266_114126841 160
478 3300028380 Ga0268265_10103400 Ga0268265_101034003 160
479 3300028794 Ga0307515_10286484 Ga0307515_102864842 160
480 3300030500 Ga0268256_1000030 Ga0268256_1000030252 160
481 3300030500 Ga0268256_1000049 Ga0268256_100004997 160
482 3300030500 Ga0268256_1010567 Ga0268256_10105674 160
483 3300030731 Ga0316177_1019699 Ga0316177_10196994 160
484 3300030731 Ga0316177_1090695 Ga0316177_10906952 160
485 3300030732 Ga0316176_1178239 Ga0316176_11782393 160
486 3300030733 Ga0314311_1198609 Ga0314311_11986093 160
487 3300030733 Ga0314311_1212235 Ga0314311_12122352 160
488 3300030735 Ga0316178_1100148 Ga0316178_11001482 160
489 3300030736 Ga0316180_1135407 Ga0316180_11354072 160
490 3300030742 Ga0316183_1032517 Ga0316183_10325171 160
491 3300030742 Ga0316183_1156169 Ga0316183_11561691 160
492 3300030745 Ga0316182_1090418 Ga0316182_10904181 160
493 3300030745 Ga0316182_1113265 Ga0316182_11132652 160
494 3300030745 Ga0316182_1139274 Ga0316182_11392743 160
495 3300031456 Ga0307513_10002045 Ga0307513_100020455 160
496 3300031456 Ga0307513_10310084 Ga0307513_103100842 160
497 3300031548 Ga0307408_100049397 Ga0307408_1000493972 160
498 3300031548 Ga0307408_100058931 Ga0307408_1000589312 160
499 3300031548 Ga0307408_100059523 Ga0307408_1000595233 160
500 3300031548 Ga0307408_100740267 Ga0307408_1007402672 160
501 3300031548 Ga0307408_100758912 Ga0307408_1007589122 160
502 3300031548 Ga0307408_101243580 Ga0307408_1012435801 160
503 3300031731 Ga0307405_10223600 Ga0307405_102236002 160
504 3300031731 Ga0307405_10234444 Ga0307405_102344442 160
505 3300031731 Ga0307405_11036510 Ga0307405_110365101 160
506 3300031824 Ga0307413_10006572 Ga0307413_100065723 160
507 3300031824 Ga0307413_10007402 Ga0307413_100074023 160
508 3300031824 Ga0307413_10079998 Ga0307413_100799983 160
509 3300031824 Ga0307413_10100253 Ga0307413_101002532 160
510 3300031824 Ga0307413_10147237 Ga0307413_101472373 160
511 3300031824 Ga0307413_10214365 Ga0307413_102143653 160
512 3300031824 Ga0307413_10241967 Ga0307413_102419672 160
513 3300031824 Ga0307413_10457698 Ga0307413_104576982 160
514 3300031824 Ga0307413_10495350 Ga0307413_104953501 160
515 3300031824 Ga0307413_10554644 Ga0307413_105546442 160
516 3300031852 Ga0307410_10084596 Ga0307410_100845962 160
517 3300031852 Ga0307410_10417360 Ga0307410_104173601 160
518 3300031852 Ga0307410_10554581 Ga0307410_105545811 160
519 3300031901 Ga0307406_10008217 Ga0307406_100082178 160
520 3300031901 Ga0307406_10149539 Ga0307406_101495392 160
521 3300031901 Ga0307406_10257809 Ga0307406_102578092 160
522 3300031901 Ga0307406_10466902 Ga0307406_104669022 160
523 3300031901 Ga0307406_10629293 Ga0307406_106292932 160
524 3300031911 Ga0307412_10000087 Ga0307412_1000008740 160
525 3300031911 Ga0307412_10002247 Ga0307412_1000224711 160
526 3300031911 Ga0307412_10064564 Ga0307412_100645642 160
527 3300031911 Ga0307412_10187844 Ga0307412_101878443 160
528 3300031911 Ga0307412_10339356 Ga0307412_103393561 160
529 3300031911 Ga0307412_10520922 Ga0307412_105209221 160
530 3300031911 Ga0307412_10889744 Ga0307412_108897442 160
531 3300031911 Ga0307412_11545596 Ga0307412_115455961 160
532 3300031995 Ga0307409_100510405 Ga0307409_1005104052 160
533 3300031995 Ga0307409_102321007 Ga0307409_1023210071 160
534 3300032002 Ga0307416_100006969 Ga0307416_1000069696 160
535 3300032002 Ga0307416_100023561 Ga0307416_1000235612 160
536 3300032002 Ga0307416_100438009 Ga0307416_1004380092 160
537 3300032002 Ga0307416_100496923 Ga0307416_1004969232 160
538 3300032002 Ga0307416_101605709 Ga0307416_1016057091 160
539 3300032002 Ga0307416_102083253 Ga0307416_1020832532 160
540 3300032004 Ga0307414_10000159 Ga0307414_100001596 160
541 3300032004 Ga0307414_10004389 Ga0307414_100043895 160
542 3300032004 Ga0307414_10017345 Ga0307414_100173454 160
543 3300032004 Ga0307414_10019952 Ga0307414_100199524 160
544 3300032004 Ga0307414_10023608 Ga0307414_100236084 160
545 3300032004 Ga0307414_10054278 Ga0307414_100542783 160
546 3300032004 Ga0307414_10094518 Ga0307414_100945182 160
547 3300032004 Ga0307414_10108743 Ga0307414_101087433 160
548 3300032004 Ga0307414_10135051 Ga0307414_101350512 160
549 3300032004 Ga0307414_10498444 Ga0307414_104984442 160
550 3300032004 Ga0307414_10521656 Ga0307414_105216561 160
551 3300032004 Ga0307414_11196948 Ga0307414_111969482 160
552 3300032005 Ga0307411_10051787 Ga0307411_100517872 160
553 3300032005 Ga0307411_10119139 Ga0307411_101191392 160
554 3300032005 Ga0307411_10180443 Ga0307411_101804432 160
555 3300032005 Ga0307411_10310407 Ga0307411_103104071 160
556 3300032005 Ga0307411_10526672 Ga0307411_105266722 160
557 3300032005 Ga0307411_10639650 Ga0307411_106396502 160
558 3300032005 Ga0307411_10759786 Ga0307411_107597862 160
559 3300032005 Ga0307411_11092444 Ga0307411_110924442 160
560 3300036401 Ga0373937_0181755 Ga0373937_0181755_454_936 160
561 3300036401 Ga0373937_1595327 Ga0373937_1595327_91_573 160
562 3300037471 Ga0395905_0002859 Ga0395905_0002859_15119_15601 160
563 3300037471 Ga0395905_0016448 Ga0395905_0016448_2089_2571 160
564 3300037471 Ga0395905_0477278 Ga0395905_0477278_352_834 160
565 3300037853 Ga0436364_0744029 Ga0436364_0744029_2772_3290 160
566 3300038443 Ga0395901_0020794 Ga0395901_0020794_2433_2915 160
567 3300038705 Ga0237819_00279 Ga0237819_00279_12499_12981 160
568 3300038705 Ga0237819_02264 Ga0237819_02264_3300_3782 160
569 3300039145 Ga0237816_01687 Ga0237816_01687_889_1374 160
570 3300041404 Ga0439436_0004641 Ga0439436_0004641_691_1176 160
571 3300041404 Ga0439436_0032076 Ga0439436_0032076_181_666 160
572 3300041407 Ga0439447_000033 Ga0439447_000033_31278_31760 160
573 3300041410 Ga0439461_0085376 Ga0439461_0085376_61_546 160
574 3300041413 Ga0439465_0003016 Ga0439465_0003016_4290_4775 160
575 3300041413 Ga0439465_0044755 Ga0439465_0044755_214_699 160
576 3300041413 Ga0439465_0049197 Ga0439465_0049197_775_1260 160
577 3300041451 Ga0451791_0061126 Ga0451791_0061126_450_932 160
578 3300041452 Ga0451793_0248173 Ga0451793_0248173_174_659 160
579 3300041453 Ga0451797_0206176 Ga0451797_0206176_96_581 160
580 3300041453 Ga0451797_0209795 Ga0451797_0209795_360_845 160
581 3300041453 Ga0451797_0510974 Ga0451797_0510974_360_848 160
582 3300041453 Ga0451797_1381519 Ga0451797_1381519_100_582 160
583 3300041456 Ga0451795_1281766 Ga0451795_1281766_289_774 160
584 3300041459 Ga0451800_0961261 Ga0451800_0961261_478_963 160
585 3300041459 Ga0451800_1014250 Ga0451800_1014250_2065_2550 160
586 3300041460 Ga0451802_1249029 Ga0451802_1249029_834_1319 160
587 3300041460 Ga0451802_1339368 Ga0451802_1339368_120_608 160
588 3300041460 Ga0451802_1567617 Ga0451802_1567617_675_1160 160
589 3300041462 Ga0451806_130861 Ga0451806_130861_3084_3569 160
590 3300041486 Ga0451807_0759871 Ga0451807_0759871_370_855 160
591 3300041486 Ga0451807_0894472 Ga0451807_0894472_276_761 160
592 3300041486 Ga0451807_1140346 Ga0451807_1140346_369_854 160
593 3300041486 Ga0451807_2568450 Ga0451807_2568450_127_624 160
594 3300041491 Ga0451833_1204446 Ga0451833_1204446_41_529 160
595 3300041491 Ga0451833_1243150 Ga0451833_1243150_35_520 160
596 3300041494 Ga0451837_0766626 Ga0451837_0766626_47_529 160
597 3300041494 Ga0451837_1042500 Ga0451837_1042500_1526_2011 160
598 3300041494 Ga0451837_1185966 Ga0451837_1185966_44_526 160
599 3300041496 Ga0451839_0654108 Ga0451839_0654108_414_899 160
600 3300041501 Ga0451845_0504423 Ga0451845_0504423_50_535 160
601 3300041509 Ga0451843_0501131 Ga0451843_0501131_923_1408 160
602 3300041509 Ga0451843_0984714 Ga0451843_0984714_158_643 160
603 3300041512 Ga0451853_1276073 Ga0451853_1276073_12_518 160
604 3300041512 Ga0451853_2928858 Ga0451853_2928858_174_656 160
605 3300041512 Ga0451853_3785856 Ga0451853_3785856_242_727 160
606 3300041999 Ga0439433_0016096 Ga0439433_0016096_1090_1575 160
607 3300041999 Ga0439433_0055837 Ga0439433_0055837_21_506 160
608 3300041999 Ga0439433_0100366 Ga0439433_0100366_193_678 160
609 3300041999 Ga0439433_0100772 Ga0439433_0100772_12_497 160
610 3300042004 Ga0439445_0005312 Ga0439445_0005312_1987_2472 160
611 3300042004 Ga0439445_0042303 Ga0439445_0042303_616_1101 160
612 3300042006 Ga0439432_006084 Ga0439432_006084_2683_3168 160
613 3300042006 Ga0439432_011439 Ga0439432_011439_1274_1756 160
614 3300042006 Ga0439432_019376 Ga0439432_019376_355_840 160
615 3300042006 Ga0439432_019821 Ga0439432_019821_190_672 160
616 3300042006 Ga0439432_029249 Ga0439432_029249_227_733 160
617 3300042007 Ga0439449_0000650 Ga0439449_0000650_576_1061 160
618 3300042007 Ga0439449_0002587 Ga0439449_0002587_2124_2609 160
619 3300042007 Ga0439449_0003784 Ga0439449_0003784_852_1337 160
620 3300042007 Ga0439449_0006088 Ga0439449_0006088_918_1403 160
621 3300042007 Ga0439449_0009505 Ga0439449_0009505_2873_3358 160
622 3300042007 Ga0439449_0014318 Ga0439449_0014318_414_899 160
623 3300042007 Ga0439449_0068772 Ga0439449_0068772_283_828 160
624 3300042010 Ga0439452_016951 Ga0439452_016951_290_775 160
625 3300042015 Ga0439462_0008072 Ga0439462_0008072_197_682 160
626 3300042015 Ga0439462_0017511 Ga0439462_0017511_515_1000 160
627 3300042015 Ga0439462_0071841 Ga0439462_0071841_418_903 160
628 3300042115 Ga0450911_000371 Ga0450911_000371_2177_2659 160
629 3300042135 Ga0450899_006367 Ga0450899_006367_449_934 160
630 3300042156 Ga0439446_0048727 Ga0439446_0048727_578_1063 160
631 3300042156 Ga0439446_0142766 Ga0439446_0142766_68_553 160
632 3300042435 Ga0439434_0025040 Ga0439434_0025040_257_742 160
633 3300042435 Ga0439434_0266653 Ga0439434_0266653_70_555 160
634 3300042532 Ga0450893_0096079 Ga0450893_0096079_50_535 160
635 3300042876 Ga0451577_0015288 Ga0451577_0015288_4156_4650 160
636 3300042993 Ga0439440_0010673 Ga0439440_0010673_636_1124 160
637 3300044712 Ga0453684_0089807 Ga0453684_0089807_580_1074 160
638 3300046453 Ga0495627_000853 Ga0495627_000853_15073_15555 160
639 3300046453 Ga0495627_066089 Ga0495627_066089_344_826 160
640 3300046453 Ga0495627_072249 Ga0495627_072249_481_963 160
641 3300046458 Ga0495591_013488 Ga0495591_013488_1603_2085 160
642 3300046460 Ga0495638_0001228 Ga0495638_0001228_7802_8284 160
643 3300046460 Ga0495638_0030301 Ga0495638_0030301_565_1050 160
644 3300046460 Ga0495638_0147851 Ga0495638_0147851_499_996 160
645 3300046501 Ga0495607_0218148 Ga0495607_0218148_254_739 160
646 3300046507 Ga0495606_0021112 Ga0495606_0021112_1617_2102 160
647 3300046512 Ga0495610_0001130 Ga0495610_0001130_9684_10166 160
648 3300046512 Ga0495610_0021459 Ga0495610_0021459_2920_3405 160
649 3300046513 Ga0495616_0016650 Ga0495616_0016650_2413_2898 160
650 3300046518 Ga0495631_0000369 Ga0495631_0000369_20797_21279 160
651 3300046519 Ga0495632_0089096 Ga0495632_0089096_136_618 160
652 3300046522 Ga0495643_0003775 Ga0495643_0003775_774_1256 160
653 3300046525 Ga0495663_0000899 Ga0495663_0000899_5100_5582 160
654 3300046525 Ga0495663_0013048 Ga0495663_0013048_970_1455 160
655 3300046525 Ga0495663_0025795 Ga0495663_0025795_445_927 160
656 3300046525 Ga0495663_0058290 Ga0495663_0058290_285_767 160
657 3300046530 Ga0495654_0107423 Ga0495654_0107423_352_837 160
658 3300046539 Ga0495621_0002787 Ga0495621_0002787_1862_2344 160
659 3300046539 Ga0495621_0008296 Ga0495621_0008296_2072_2557 160
660 3300046558 Ga0495633_0001102 Ga0495633_0001102_8040_8522 160
661 3300046558 Ga0495633_0003816 Ga0495633_0003816_2558_3040 160
662 3300046558 Ga0495633_0011696 Ga0495633_0011696_2608_3090 160
663 3300046558 Ga0495633_0041280 Ga0495633_0041280_1299_1781 160
664 3300046558 Ga0495633_0043736 Ga0495633_0043736_1050_1532 160
665 3300046558 Ga0495633_0264369 Ga0495633_0264369_41_523 160
666 3300046615 Ga0495656_0001943 Ga0495656_0001943_1299_1781 160
667 3300046615 Ga0495656_0002508 Ga0495656_0002508_3590_4075 160
668 3300046615 Ga0495656_0004358 Ga0495656_0004358_1276_1761 160
669 3300046615 Ga0495656_0067967 Ga0495656_0067967_1048_1530 160
670 3300046615 Ga0495656_0232697 Ga0495656_0232697_57_542 160
671 3300046616 Ga0495668_0000960 Ga0495668_0000960_5143_5625 160
672 3300046660 Ga0495625_0096632 Ga0495625_0096632_456_941 160
673 3300046664 Ga0495659_0008952 Ga0495659_0008952_1052_1534 160
674 3300046691 Ga0495670_0275136 Ga0495670_0275136_215_700 160
675 3300046692 Ga0495671_0083413 Ga0495671_0083413_673_1158 160
676 3300046810 Ga0495660_0004923 Ga0495660_0004923_5605_6087 160
677 3300047318 Ga0495636_0013289 Ga0495636_0013289_1345_1830 160
678 3300047318 Ga0495636_0028691 Ga0495636_0028691_372_857 160
679 3300047318 Ga0495636_0030645 Ga0495636_0030645_518_1003 160
680 3300047318 Ga0495636_0060586 Ga0495636_0060586_189_671 160
681 3300047318 Ga0495636_0062891 Ga0495636_0062891_532_1017 160
682 3300047320 Ga0495672_0000079 Ga0495672_0000079_77085_77567 160
683 3300047320 Ga0495672_0026243 Ga0495672_0026243_2233_2715 160
684 3300047320 Ga0495672_0076591 Ga0495672_0076591_283_765 160
685 3300047447 Ga0495685_081273 Ga0495685_081273_171_653 160
686 3300047470 Ga0495681_0033084 Ga0495681_0033084_417_971 160
687 3300047470 Ga0495681_0101672 Ga0495681_0101672_738_1220 160
688 3300047472 Ga0495686_0012567 Ga0495686_0012567_2427_2909 160
689 3300048090 Ga0495615_0279499 Ga0495615_0279499_15_497 160
690 3300048904 Ga0496101_0119291 Ga0496101_0119291_777_1259 160
691 3300048904 Ga0496101_0254279 Ga0496101_0254279_513_995 160
692 3300048905 Ga0496102_0328648 Ga0496102_0328648_801_1298 160
693 3300048906 Ga0496103_0127295 Ga0496103_0127295_283_765 160
694 3300048908 Ga0496105_0401066 Ga0496105_0401066_379_861 160
695 3300048909 Ga0496106_0123063 Ga0496106_0123063_422_904 160
696 3300048910 Ga0496107_0139447 Ga0496107_0139447_1126_1608 160
697 3300048911 Ga0496108_0404326 Ga0496108_0404326_332_814 160
698 3300048912 Ga0496109_0192086 Ga0496109_0192086_560_1042 160
699 3300048912 Ga0496109_0204493 Ga0496109_0204493_847_1329 160
700 3300048913 Ga0496110_0063713 Ga0496110_0063713_2023_2505 160
701 3300048914 Ga0496111_0298825 Ga0496111_0298825_369_851 160
702 3300048914 Ga0496111_0406901 Ga0496111_0406901_182_664 160
703 3300048914 Ga0496111_0444681 Ga0496111_0444681_199_681 160
704 3300048915 Ga0496112_0449356 Ga0496112_0449356_412_894 160
705 3300048916 Ga0496113_0004036 Ga0496113_0004036_7242_7724 160
706 3300048916 Ga0496113_0026815 Ga0496113_0026815_1243_1725 160
707 3300048916 Ga0496113_0046556 Ga0496113_0046556_1889_2371 160
708 3300048917 Ga0496114_0001425 Ga0496114_0001425_7850_8335 160
709 3300048919 Ga0496116_0000742 Ga0496116_0000742_21381_21863 160
710 3300048919 Ga0496116_0004402 Ga0496116_0004402_8241_8726 160
711 3300048919 Ga0496116_0006168 Ga0496116_0006168_8922_9404 160
712 3300048919 Ga0496116_0015795 Ga0496116_0015795_2474_2956 160
713 3300048919 Ga0496116_0020093 Ga0496116_0020093_2703_3185 160
714 3300048919 Ga0496116_0023042 Ga0496116_0023042_858_1361 160
715 3300048919 Ga0496116_0030969 Ga0496116_0030969_773_1258 160
716 3300048919 Ga0496116_0282868 Ga0496116_0282868_127_630 160
717 3300048920 Ga0496117_0000483 Ga0496117_0000483_49832_50314 160
718 3300048920 Ga0496117_0001569 Ga0496117_0001569_26180_26662 160
719 3300048920 Ga0496117_0001801 Ga0496117_0001801_20854_21336 160
720 3300048920 Ga0496117_0005801 Ga0496117_0005801_10699_11181 160
721 3300048920 Ga0496117_0009988 Ga0496117_0009988_6746_7231 160
722 3300048920 Ga0496117_0015910 Ga0496117_0015910_3351_3833 160
723 3300048920 Ga0496117_0050192 Ga0496117_0050192_1122_1607 160
724 3300048920 Ga0496117_0053529 Ga0496117_0053529_1843_2346 160
725 3300048920 Ga0496117_0071182 Ga0496117_0071182_531_1013 160
726 3300048921 Ga0496118_0000732 Ga0496118_0000732_34098_34580 160
727 3300048921 Ga0496118_0002860 Ga0496118_0002860_17364_17846 160
728 3300048921 Ga0496118_0005588 Ga0496118_0005588_12087_12569 160
729 3300048921 Ga0496118_0010427 Ga0496118_0010427_2600_3082 160
730 3300048921 Ga0496118_0014077 Ga0496118_0014077_6179_6661 160
731 3300048921 Ga0496118_0031298 Ga0496118_0031298_2367_2849 160
732 3300048921 Ga0496118_0031992 Ga0496118_0031992_1569_2054 160
733 3300048921 Ga0496118_0058232 Ga0496118_0058232_1014_1508 160
734 3300048921 Ga0496118_0092602 Ga0496118_0092602_1061_1543 160
735 3300048922 Ga0496119_0001225 Ga0496119_0001225_24928_25410 160
736 3300048922 Ga0496119_0001601 Ga0496119_0001601_7760_8242 160
737 3300048922 Ga0496119_0003714 Ga0496119_0003714_9640_10143 160
738 3300048922 Ga0496119_0026613 Ga0496119_0026613_2638_3123 160
739 3300048923 Ga0496120_0000262 Ga0496120_0000262_24947_25429 160
740 3300048923 Ga0496120_0000564 Ga0496120_0000564_22260_22742 160
741 3300048923 Ga0496120_0003756 Ga0496120_0003756_4730_5233 160
742 3300048923 Ga0496120_0012681 Ga0496120_0012681_2529_3014 160
743 3300048923 Ga0496120_0167909 Ga0496120_0167909_39_542 160
744 3300048924 Ga0496121_0000165 Ga0496121_0000165_32811_33296 160
745 3300048924 Ga0496121_0001145 Ga0496121_0001145_979_1461 160
746 3300048924 Ga0496121_0006141 Ga0496121_0006141_1875_2357 160
747 3300048924 Ga0496121_0016056 Ga0496121_0016056_2495_2977 160
748 3300048924 Ga0496121_0074701 Ga0496121_0074701_815_1297 160
749 3300048924 Ga0496121_0095467 Ga0496121_0095467_291_776 160
750 3300048924 Ga0496121_0127008 Ga0496121_0127008_811_1293 160
751 3300048924 Ga0496121_0528919 Ga0496121_0528919_146_631 160
752 3300048925 Ga0496122_0000537 Ga0496122_0000537_52005_52487 160
753 3300048925 Ga0496122_0000736 Ga0496122_0000736_63049_63534 160
754 3300048925 Ga0496122_0001070 Ga0496122_0001070_1044_1526 160
755 3300048925 Ga0496122_0004558 Ga0496122_0004558_5660_6145 160
756 3300048925 Ga0496122_0008632 Ga0496122_0008632_3419_3901 160
757 3300048925 Ga0496122_0016201 Ga0496122_0016201_4626_5129 160
758 3300048925 Ga0496122_0016730 Ga0496122_0016730_5806_6288 160
759 3300048925 Ga0496122_0016983 Ga0496122_0016983_781_1263 160
760 3300048925 Ga0496122_0019102 Ga0496122_0019102_3626_4147 160
761 3300048925 Ga0496122_0028118 Ga0496122_0028118_2690_3172 160
762 3300048925 Ga0496122_0069527 Ga0496122_0069527_96_581 160
763 3300048925 Ga0496122_0132678 Ga0496122_0132678_733_1218 160
764 3300048925 Ga0496122_0147744 Ga0496122_0147744_421_903 160
765 3300048926 Ga0496123_0000541 Ga0496123_0000541_8983_9465 160
766 3300048926 Ga0496123_0000763 Ga0496123_0000763_42431_42916 160
767 3300048926 Ga0496123_0000898 Ga0496123_0000898_45611_46093 160
768 3300048926 Ga0496123_0005012 Ga0496123_0005012_5299_5784 160
769 3300048926 Ga0496123_0016396 Ga0496123_0016396_1530_2012 160
770 3300048926 Ga0496123_0021598 Ga0496123_0021598_2215_2697 160
771 3300048926 Ga0496123_0025056 Ga0496123_0025056_2343_2825 160
772 3300048926 Ga0496123_0039571 Ga0496123_0039571_100_585 160
773 3300048926 Ga0496123_0085479 Ga0496123_0085479_1061_1543 160
774 3300048926 Ga0496123_0110347 Ga0496123_0110347_22_507 160
775 3300048927 Ga0496124_0000006 Ga0496124_0000006_243309_243794 160
776 3300048927 Ga0496124_0000128 Ga0496124_0000128_137650_138153 160
777 3300048927 Ga0496124_0001971 Ga0496124_0001971_5968_6450 160
778 3300048927 Ga0496124_0005006 Ga0496124_0005006_2211_2693 160
779 3300048927 Ga0496124_0005062 Ga0496124_0005062_7852_8334 160
780 3300048927 Ga0496124_0010412 Ga0496124_0010412_3841_4323 160
781 3300048927 Ga0496124_0013859 Ga0496124_0013859_5015_5497 160
782 3300048927 Ga0496124_0024389 Ga0496124_0024389_3012_3497 160
783 3300048927 Ga0496124_0030838 Ga0496124_0030838_3733_4215 160
784 3300048927 Ga0496124_0035514 Ga0496124_0035514_1341_1823 160
785 3300048927 Ga0496124_0057851 Ga0496124_0057851_608_1093 160
786 3300048927 Ga0496124_0315708 Ga0496124_0315708_569_1051 160
787 3300048928 Ga0496125_0000121 Ga0496125_0000121_43266_43751 160
788 3300048928 Ga0496125_0000475 Ga0496125_0000475_51663_52145 160
789 3300048928 Ga0496125_0001928 Ga0496125_0001928_9305_9787 160
790 3300048928 Ga0496125_0004706 Ga0496125_0004706_6934_7416 160
791 3300048928 Ga0496125_0022077 Ga0496125_0022077_4750_5232 160
792 3300048928 Ga0496125_0119744 Ga0496125_0119744_747_1229 160
793 3300048928 Ga0496125_0196998 Ga0496125_0196998_360_845 160
794 3300048928 Ga0496125_0218453 Ga0496125_0218453_394_876 160
795 3300048929 Ga0496126_0002184 Ga0496126_0002184_17411_17914 160
796 3300048929 Ga0496126_0003535 Ga0496126_0003535_9339_9821 160
797 3300048929 Ga0496126_0003936 Ga0496126_0003936_13045_13548 160
798 3300048929 Ga0496126_0009281 Ga0496126_0009281_1609_2094 160
799 3300048929 Ga0496126_0028258 Ga0496126_0028258_4621_5103 160
800 3300048929 Ga0496126_0032355 Ga0496126_0032355_1738_2223 160
801 3300048929 Ga0496126_0037947 Ga0496126_0037947_1675_2160 160
802 3300048929 Ga0496126_0080107 Ga0496126_0080107_1269_1754 160
803 3300048929 Ga0496126_0139530 Ga0496126_0139530_1068_1550 160
804 3300048929 Ga0496126_0201615 Ga0496126_0201615_332_826 160
805 3300048929 Ga0496126_0567491 Ga0496126_0567491_192_674 160
806 3300049513 Ga0501290_008728 Ga0501290_008728_585_1076 160
807 3300049523 Ga0501300_009142 Ga0501300_009142_220_711 160
808 3300049568 Ga0501031_0091160 Ga0501031_0091160_57_545 160
809 3300049568 Ga0501031_0156969 Ga0501031_0156969_485_973 160
810 3300049569 Ga0501032_0012431 Ga0501032_0012431_1288_1776 160
811 3300049569 Ga0501032_0355852 Ga0501032_0355852_269_754 160
812 3300049570 Ga0501033_0011027 Ga0501033_0011027_588_1082 160
813 3300049570 Ga0501033_0042754 Ga0501033_0042754_1656_2141 160
814 3300049570 Ga0501033_0176994 Ga0501033_0176994_357_845 160
815 3300049570 Ga0501033_0179126 Ga0501033_0179126_431_919 160
816 3300049571 Ga0501034_0000275 Ga0501034_0000275_4836_5321 160
817 3300049571 Ga0501034_0000473 Ga0501034_0000473_64463_64945 160
818 3300049571 Ga0501034_0057134 Ga0501034_0057134_2494_2982 160
819 3300049571 Ga0501034_0107153 Ga0501034_0107153_1459_1947 160
820 3300049571 Ga0501034_0876298 Ga0501034_0876298_27_515 160
821 3300049571 Ga0501034_1229232 Ga0501034_1229232_70_564 160
822 3300049572 Ga0501036_0007849 Ga0501036_0007849_7469_7963 160
823 3300049572 Ga0501036_0028501 Ga0501036_0028501_1130_1618 160
824 3300049572 Ga0501036_0126887 Ga0501036_0126887_1482_1985 160
825 3300049572 Ga0501036_0376426 Ga0501036_0376426_54_542 160
826 3300049573 Ga0501037_0022240 Ga0501037_0022240_613_1101 160
827 3300049573 Ga0501037_0197202 Ga0501037_0197202_739_1233 160
828 3300049574 Ga0501038_0004044 Ga0501038_0004044_13117_13611 160
829 3300049574 Ga0501038_0043636 Ga0501038_0043636_78_566 160
830 3300049574 Ga0501038_0058536 Ga0501038_0058536_1546_2034 160
831 3300049575 Ga0501039_0003853 Ga0501039_0003853_7359_7853 160
832 3300049575 Ga0501039_0072692 Ga0501039_0072692_794_1282 160
833 3300049576 Ga0501040_0001206 Ga0501040_0001206_6071_6565 160
834 3300049577 Ga0501041_0001968 Ga0501041_0001968_7800_8294 160
835 3300049578 Ga0501042_0000931 Ga0501042_0000931_8176_8670 160
836 3300049579 Ga0501043_0004623 Ga0501043_0004623_5463_5948 160
837 3300049579 Ga0501043_0024241 Ga0501043_0024241_961_1449 160
838 3300049579 Ga0501043_0045876 Ga0501043_0045876_1902_2390 160
839 3300049579 Ga0501043_0061394 Ga0501043_0061394_2366_2860 160
840 3300049579 Ga0501043_0222397 Ga0501043_0222397_390_878 160
841 3300049580 Ga0501046_0011112 Ga0501046_0011112_2199_2693 160
842 3300049581 Ga0501047_0170711 Ga0501047_0170711_1362_1850 160
843 3300049581 Ga0501047_0226790 Ga0501047_0226790_162_650 160
844 3300049581 Ga0501047_0308235 Ga0501047_0308235_236_724 160
845 3300049582 Ga0501048_0011120 Ga0501048_0011120_2991_3485 160
846 3300049584 Ga0501068_0000860 Ga0501068_0000860_12464_12958 160
847 3300049586 Ga0501070_0113135 Ga0501070_0113135_837_1325 160
848 3300049586 Ga0501070_0114001 Ga0501070_0114001_558_1046 160
849 3300049587 Ga0501071_0006996 Ga0501071_0006996_1977_2471 160
850 3300049588 Ga0501072_0001665 Ga0501072_0001665_14278_14772 160
851 3300049589 Ga0501073_0370358 Ga0501073_0370358_383_871 160
852 3300049590 Ga0501074_0124231 Ga0501074_0124231_1162_1656 160
853 3300049591 Ga0501075_0000858 Ga0501075_0000858_14776_15270 160
854 3300049592 Ga0501076_0002159 Ga0501076_0002159_4553_5047 160
855 3300049593 Ga0501077_0004578 Ga0501077_0004578_2935_3429 160
856 3300049669 Ga0501235_055770 Ga0501235_055770_277_771 160
857 3300049682 Ga0501252_030715 Ga0501252_030715_91_576 160
858 3300049686 Ga0501257_077886 Ga0501257_077886_276_770 160
859 3300049705 Ga0501225_0016499 Ga0501225_0016499_902_1387 160
860 3300049705 Ga0501225_0052492 Ga0501225_0052492_88_573 160
861 3300049741 Ga0501079_0002189 Ga0501079_0002189_9455_9949 160
862 3300049742 Ga0501080_0009101 Ga0501080_0009101_7725_8219 160
863 3300049742 Ga0501080_0050291 Ga0501080_0050291_379_867 160
864 3300049742 Ga0501080_0851953 Ga0501080_0851953_202_690 160
865 3300049743 Ga0501081_0000359 Ga0501081_0000359_16428_16922 160
866 3300049743 Ga0501081_1348875 Ga0501081_1348875_34_522 160
867 3300049744 Ga0501083_0071631 Ga0501083_0071631_429_923 160
868 3300049760 Ga0501263_040836 Ga0501263_040836_52_546 160
869 3300049762 Ga0501265_006501 Ga0501265_006501_808_1299 160
870 3300049765 Ga0501268_035049 Ga0501268_035049_91_585 160
871 3300049772 Ga0501275_001320 Ga0501275_001320_1269_1760 160
872 3300049822 Ga0501035_0035887 Ga0501035_0035887_196_690 160
873 3300049822 Ga0501035_0188478 Ga0501035_0188478_889_1392 160
874 3300049822 Ga0501035_0258322 Ga0501035_0258322_110_598 160
875 3300049823 Ga0501044_0034937 Ga0501044_0034937_3369_3857 160
876 3300049823 Ga0501044_0192180 Ga0501044_0192180_1209_1697 160
877 3300049824 Ga0501045_0025348 Ga0501045_0025348_2623_3117 160
878 3300050491 nmdc:mga00v17_10491_c1 nmdc:mga00v17_10491_c1_927_1424 160
879 3300050491 nmdc:mga00v17_110193_c1 nmdc:mga00v17_110193_c1_156_641 160
880 3300050491 nmdc:mga00v17_28595_c1 nmdc:mga00v17_28595_c1_1813_2295 160
881 3300050491 nmdc:mga00v17_31379_c1 nmdc:mga00v17_31379_c1_1800_2282 160
882 3300050491 nmdc:mga00v17_338_c1 nmdc:mga00v17_338_c1_14326_14808 160
883 3300050491 nmdc:mga00v17_608898_c1 nmdc:mga00v17_608898_c1_19_501 160
884 3300050491 nmdc:mga00v17_96017_c1 nmdc:mga00v17_96017_c1_748_1233 160
885 3300050516 nmdc:mga0sz30_209046_c1 nmdc:mga0sz30_209046_c1_333_818 160
886 3300053080 Ga0500635_0002379 Ga0500635_0002379_2493_2993 160
887 3300053131 Ga0500652_000207 Ga0500652_000207_17982_18482 160
888 3300053134 Ga0500658_0398222 Ga0500658_0398222_110_595 160
889 3300053156 Ga0500622_0296335 Ga0500622_0296335_13_498 160
890 3300053161 Ga0500634_0005943 Ga0500634_0005943_5328_5810 160
891 3300053731 Ga0500609_027077 Ga0500609_027077_69_554 160
892 3300054114 Ga0501084_0007709 Ga0501084_0007709_6997_7491 160
893 3300060353 Ga0501082_0000368 Ga0501082_0000368_35426_35920 160
894 3300061734 Ga0530510_0000025 Ga0530510_0000025_21873_22367 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01590

GAF

GAF domain

64

192

0.83

PF13185

GAF_2

GAF domain

67

190

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rfb-assembly1.cif.gz_A structure of frmsr 0.9729 15 160
3ksf-assembly3.cif.gz_F structure of frmsr of staphylococcus aureus (reduced form) 0.9726 15 160
5hl6-assembly1.cif.gz_A crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis 0.9691 9 159
5hl6-assembly1.cif.gz_B crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis 0.9675 8 159
1vhm-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.9587 10 158
ID Description Score Start End Superfamily
3rfbA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9729 15 160 3.30.450.40
1vhmA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9587 10 158 3.30.450.40
af_Q4DSC2_14_185_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9455 10 160 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9425 3 156 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9252 3 156 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A6G9YTU0-F1-model_v4 GAF domain-containing protein 0.9972 2 159 GO:0005829
GO:0033745
AF-G7GX58-F1-model_v4 GAF domain-containing protein 0.9964 15 160 GO:0005829
GO:0033745
AF-A0A2T2Z690-F1-model_v4 GAF domain-containing protein 0.996 11 159 GO:0005829
GO:0033745
AF-A0A0S2DC16-F1-model_v4 GAF domain protein 0.9957 19 160 GO:0005829
GO:0033745
AF-A0A3C0JB42-F1-model_v4 Diguanylate cyclase 0.9956 1 119 GO:0005829
GO:0033745

Feature Viewer

pLDDT pTM Quality
94.95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map