F484943
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 894 | 446 | 782 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10108743|Ga0307414_101087433 |
| Length | 193 |
| Sequence | MPRANAVPLATIAAIAAPVRGAGENAVAARLLHMFTPNSLSGDKPEQYAQLAQQAQALVAGEHDRIANAANLSALVYHALPRLNWVGFYFFDGNELVVGPFQGLPACIRIPLDKGVCGAAARSGQTQRVPDVDAFDGHVACDSASRSELVVPLFRNDVLVGVFDLDSPDLDRFDVTDQRGIEELARIFVRSLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 3 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 4 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 5 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 6 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 7 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 8 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 9 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 10 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 11 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 12 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 13 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 14 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 15 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 16 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 17 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 18 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 19 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 20 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 21 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 22 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 23 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 24 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 25 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 26 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 27 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 28 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 29 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 30 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 31 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 32 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 33 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 34 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 35 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 36 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 37 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 38 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 39 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 40 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 41 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 42 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 43 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 44 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 45 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 46 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 47 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 48 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 49 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 50 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 51 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 52 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 53 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 54 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 55 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 56 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 57 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 58 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 59 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 60 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 61 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 62 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 63 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 64 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 65 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 66 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 67 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 68 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 69 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 70 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 71 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 72 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 73 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 74 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 75 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 76 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 77 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 78 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 79 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 80 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 81 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 82 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 83 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 84 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 85 | 2941479691 | |||
| 86 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 87 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 88 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 89 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 90 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 91 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 92 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 93 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 94 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 95 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 96 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 97 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 98 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 99 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 100 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 101 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 102 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 103 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 104 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 105 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 106 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 107 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 108 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 109 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 110 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 111 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 112 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 113 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 114 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 115 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 116 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 117 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 118 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 119 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 120 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 121 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 122 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 123 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 124 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 141 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 142 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 143 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 147 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 149 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 150 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 151 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 152 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 153 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 154 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 155 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 156 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 157 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 159 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 160 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 171 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 172 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 174 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 175 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 176 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 177 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 187 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 188 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 189 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 190 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 193 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 209 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 256 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 257 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 258 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 259 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 260 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 261 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 262 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 263 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 264 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 265 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 266 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 267 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 268 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 269 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 270 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 271 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 272 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 273 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 274 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 275 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 276 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 277 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 278 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 280 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 283 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 284 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 285 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 286 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 287 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 288 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 289 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 290 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 291 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 299 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 301 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 302 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 303 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 304 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 305 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 306 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 307 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 308 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 309 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 310 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 311 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 312 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 313 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 314 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 315 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 316 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 317 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 318 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 319 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 320 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 321 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 322 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 323 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 324 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 360 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 364 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 365 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 366 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 367 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 368 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 369 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 370 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 371 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 372 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 373 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 374 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 375 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 376 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 377 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 378 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 379 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 380 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 406 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 407 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 408 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 409 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 414 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 415 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 416 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 417 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 421 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 422 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 423 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 424 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 425 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 426 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 427 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 428 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 430 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 431 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 432 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 433 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 436 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 437 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 438 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 439 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 440 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 441 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 442 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 443 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 444 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 445 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 446 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.36 |
| Metatranscriptomes | 0.11 |
| Isolates | 12.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 15.66 |
| Nodule | 0.11 |
| Rhizoplane | 4.59 |
| Rhizosphere | 57.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3802179 | 2162886007 | Bacteria | 1037 |
| 2 | SwRhRL2b_contig_46047 | 2162886007 | Bacteria | 1444 |
| 3 | JGI25152J39213_1000025 | 3300002773 | Bacteria | 103262 |
| 4 | JGI25150J39212_1000066 | 3300002774 | Bacteria | 63677 |
| 5 | JGI25151J46595_10000117 | 3300003187 | Bacteria | 106850 |
| 6 | JGI25151J46595_10000139 | 3300003187 | Bacteria | 96000 |
| 7 | JGI25151J46595_10016266 | 3300003187 | Bacteria | 3258 |
| 8 | JGI25151J46595_10019101 | 3300003187 | Bacteria | 2921 |
| 9 | JGI25151J46595_10038704 | 3300003187 | Bacteria | 1771 |
| 10 | JGI25153J46596_10000101 | 3300003215 | Bacteria | 96639 |
| 11 | rootH2_10038994 | 3300003320 | Bacteria | 6203 |
| 12 | Ga0055538_1000164 | 3300003751 | Bacteria | 43510 |
| 13 | Ga0055535_1002595 | 3300003761 | Bacteria | 6072 |
| 14 | Ga0055535_1009874 | 3300003761 | Bacteria | 1609 |
| 15 | Ga0055526_1000183 | 3300003771 | Bacteria | 54759 |
| 16 | Ga0055526_1001045 | 3300003771 | Bacteria | 20206 |
| 17 | Ga0055526_1004844 | 3300003771 | Bacteria | 7941 |
| 18 | Ga0055537_1000028 | 3300003773 | Bacteria | 102200 |
| 19 | Ga0055537_1000314 | 3300003773 | Bacteria | 33100 |
| 20 | Ga0055524_1000461 | 3300003775 | Bacteria | 33100 |
| 21 | Ga0055524_1018198 | 3300003775 | Bacteria | 2447 |
| 22 | Ga0055536_1001419 | 3300003781 | Bacteria | 14468 |
| 23 | Ga0055536_1001978 | 3300003781 | Bacteria | 11747 |
| 24 | Ga0055536_1002334 | 3300003781 | Bacteria | 10736 |
| 25 | Ga0055536_1019619 | 3300003781 | Bacteria | 2119 |
| 26 | Ga0055536_1022683 | 3300003781 | Bacteria | 1865 |
| 27 | Ga0055536_1030270 | 3300003781 | Bacteria | 1438 |
| 28 | Ga0055534_1000180 | 3300003784 | Bacteria | 46550 |
| 29 | Ga0055534_1000302 | 3300003784 | Bacteria | 33100 |
| 30 | Ga0055528_1000172 | 3300003790 | Bacteria | 54759 |
| 31 | Ga0055528_1000262 | 3300003790 | Bacteria | 44658 |
| 32 | Ga0055530_10000784 | 3300003791 | Bacteria | 26455 |
| 33 | Ga0055530_10001075 | 3300003791 | Bacteria | 21506 |
| 34 | Ga0055530_10002332 | 3300003791 | Bacteria | 12397 |
| 35 | Ga0055530_10049130 | 3300003791 | Bacteria | 988 |
| 36 | Ga0055530_10080760 | 3300003791 | Bacteria | 683 |
| 37 | Ga0055531_10010004 | 3300003794 | Bacteria | 4777 |
| 38 | Ga0055531_10010801 | 3300003794 | Bacteria | 4493 |
| 39 | Ga0055531_10014958 | 3300003794 | Bacteria | 3457 |
| 40 | Ga0055531_10026654 | 3300003794 | Bacteria | 2053 |
| 41 | Ga0055531_10026698 | 3300003794 | Bacteria | 2050 |
| 42 | Ga0055531_10034540 | 3300003794 | Bacteria | 1602 |
| 43 | Ga0055541_1000253 | 3300003841 | Bacteria | 19354 |
| 44 | Ga0055541_1020817 | 3300003841 | Bacteria | 770 |
| 45 | Ga0058692_1000026 | 3300003856 | Bacteria | 203096 |
| 46 | Ga0058692_1000040 | 3300003856 | Bacteria | 132805 |
| 47 | Ga0065165_1016213 | 3300005262 | Bacteria | 2800 |
| 48 | Ga0065714_10275140 | 3300005288 | Bacteria | 732 |
| 49 | Ga0065704_10033986 | 3300005289 | Bacteria | 1037 |
| 50 | Ga0065704_10071027 | 3300005289 | Bacteria | 13649 |
| 51 | Ga0065704_10098809 | 3300005289 | Bacteria | 2338 |
| 52 | Ga0065704_10457457 | 3300005289 | Bacteria | 694 |
| 53 | Ga0065715_10161706 | 3300005293 | Bacteria | 1622 |
| 54 | Ga0070658_10013884 | 3300005327 | Bacteria | 6466 |
| 55 | Ga0070670_100011457 | 3300005331 | Bacteria | 7585 |
| 56 | Ga0070670_100050456 | 3300005331 | Bacteria | 3575 |
| 57 | Ga0070670_100294827 | 3300005331 | Bacteria | 1418 |
| 58 | Ga0070670_100317434 | 3300005331 | Bacteria | 1365 |
| 59 | Ga0070670_101153080 | 3300005331 | Bacteria | 707 |
| 60 | Ga0070666_10274967 | 3300005335 | Bacteria | 1196 |
| 61 | Ga0070680_100027857 | 3300005336 | Bacteria | 4527 |
| 62 | Ga0070680_100168041 | 3300005336 | Bacteria | 1845 |
| 63 | Ga0070680_100504777 | 3300005336 | Bacteria | 1035 |
| 64 | Ga0070660_100437854 | 3300005339 | Bacteria | 1083 |
| 65 | Ga0070691_10001219 | 3300005341 | Bacteria | 10820 |
| 66 | Ga0070668_100008075 | 3300005347 | Bacteria | 7816 |
| 67 | Ga0070668_100056289 | 3300005347 | Bacteria | 3037 |
| 68 | Ga0070668_100318540 | 3300005347 | Bacteria | 1309 |
| 69 | Ga0070669_100011958 | 3300005353 | Bacteria | 6160 |
| 70 | Ga0070669_100033911 | 3300005353 | Bacteria | 3694 |
| 71 | Ga0070669_100292934 | 3300005353 | Bacteria | 1307 |
| 72 | Ga0070669_101526823 | 3300005353 | Bacteria | 581 |
| 73 | Ga0070675_100106930 | 3300005354 | Bacteria | 2362 |
| 74 | Ga0070675_100250156 | 3300005354 | Bacteria | 1551 |
| 75 | Ga0070675_100442360 | 3300005354 | Bacteria | 1165 |
| 76 | Ga0070675_100841081 | 3300005354 | Bacteria | 840 |
| 77 | Ga0070671_100109163 | 3300005355 | Bacteria | 2323 |
| 78 | Ga0070671_100554437 | 3300005355 | Bacteria | 991 |
| 79 | Ga0070674_100014888 | 3300005356 | Bacteria | 4843 |
| 80 | Ga0070659_101358036 | 3300005366 | Bacteria | 631 |
| 81 | Ga0070667_100887726 | 3300005367 | Bacteria | 830 |
| 82 | Ga0070705_100202730 | 3300005440 | Bacteria | 1361 |
| 83 | Ga0070678_100061918 | 3300005456 | Bacteria | 2760 |
| 84 | Ga0070662_100766456 | 3300005457 | Bacteria | 819 |
| 85 | Ga0070681_10000625 | 3300005458 | Bacteria | 29017 |
| 86 | Ga0070681_10191696 | 3300005458 | Bacteria | 1964 |
| 87 | Ga0068867_100127289 | 3300005459 | Bacteria | 1975 |
| 88 | Ga0070679_100016885 | 3300005530 | Bacteria | 7055 |
| 89 | Ga0070679_100106292 | 3300005530 | Bacteria | 2792 |
| 90 | Ga0070679_100326324 | 3300005530 | Bacteria | 1484 |
| 91 | Ga0070672_100001204 | 3300005543 | Bacteria | 15828 |
| 92 | Ga0070672_100515988 | 3300005543 | Bacteria | 1035 |
| 93 | Ga0070672_101458262 | 3300005543 | Bacteria | 613 |
| 94 | Ga0070693_100018623 | 3300005547 | Bacteria | 3631 |
| 95 | Ga0070665_100005654 | 3300005548 | Bacteria | 12855 |
| 96 | Ga0070665_100007318 | 3300005548 | Bacteria | 11230 |
| 97 | Ga0070665_100104205 | 3300005548 | Bacteria | 2839 |
| 98 | Ga0070665_100596980 | 3300005548 | Bacteria | 1117 |
| 99 | Ga0070665_102291851 | 3300005548 | Bacteria | 543 |
| 100 | Ga0068855_100026332 | 3300005563 | Bacteria | 6957 |
| 101 | Ga0068855_100555681 | 3300005563 | Bacteria | 1242 |
| 102 | Ga0070664_100502989 | 3300005564 | Bacteria | 1117 |
| 103 | Ga0068857_100054874 | 3300005577 | Bacteria | 3536 |
| 104 | Ga0068857_100442624 | 3300005577 | Bacteria | 1214 |
| 105 | Ga0068856_100079882 | 3300005614 | Bacteria | 3244 |
| 106 | Ga0068852_100700428 | 3300005616 | Bacteria | 1023 |
| 107 | Ga0068864_100241186 | 3300005618 | Bacteria | 1675 |
| 108 | Ga0068861_101559593 | 3300005719 | Bacteria | 650 |
| 109 | Ga0075365_10177577 | 3300006038 | Bacteria | 1488 |
| 110 | Ga0075365_10633675 | 3300006038 | Bacteria | 756 |
| 111 | Ga0075368_10047232 | 3300006042 | Bacteria | 1704 |
| 112 | Ga0075363_100130488 | 3300006048 | Bacteria | 1409 |
| 113 | Ga0075364_10000005 | 3300006051 | Bacteria | 93405 |
| 114 | Ga0075364_10033668 | 3300006051 | Bacteria | 3301 |
| 115 | Ga0075364_10039167 | 3300006051 | Bacteria | 3072 |
| 116 | Ga0075364_10118436 | 3300006051 | Bacteria | 1771 |
| 117 | Ga0075364_10204290 | 3300006051 | Bacteria | 1339 |
| 118 | Ga0075364_10312604 | 3300006051 | Bacteria | 1070 |
| 119 | Ga0070712_100259432 | 3300006175 | Bacteria | 1392 |
| 120 | Ga0075362_10071327 | 3300006177 | Bacteria | 1587 |
| 121 | Ga0075369_10129978 | 3300006186 | Bacteria | 1144 |
| 122 | Ga0105251_10001131 | 3300009011 | Bacteria | 23181 |
| 123 | Ga0105251_10004086 | 3300009011 | Bacteria | 10221 |
| 124 | Ga0105244_10018430 | 3300009036 | Bacteria | 3917 |
| 125 | Ga0105244_10070874 | 3300009036 | Bacteria | 1738 |
| 126 | Ga0105244_10319381 | 3300009036 | Bacteria | 717 |
| 127 | Ga0105240_10015095 | 3300009093 | Bacteria | 10514 |
| 128 | Ga0105240_10029298 | 3300009093 | Bacteria | 7175 |
| 129 | Ga0105245_10155857 | 3300009098 | Bacteria | 2163 |
| 130 | Ga0105247_10650881 | 3300009101 | Bacteria | 787 |
| 131 | Ga0105243_10009739 | 3300009148 | Bacteria | 7319 |
| 132 | Ga0105243_10032820 | 3300009148 | Bacteria | 4013 |
| 133 | Ga0105241_10062611 | 3300009174 | Bacteria | 2868 |
| 134 | Ga0105242_10329799 | 3300009176 | Bacteria | 1403 |
| 135 | Ga0105242_10970637 | 3300009176 | Bacteria | 855 |
| 136 | Ga0105248_10002072 | 3300009177 | Bacteria | 22185 |
| 137 | Ga0105248_11043579 | 3300009177 | Bacteria | 923 |
| 138 | Ga0105248_12362639 | 3300009177 | Bacteria | 605 |
| 139 | Ga0105238_10194061 | 3300009551 | Bacteria | 2006 |
| 140 | Ga0105032_101190 | 3300009979 | Bacteria | 2403 |
| 141 | Ga0105029_110633 | 3300009984 | Bacteria | 698 |
| 142 | Ga0105239_10016256 | 3300010375 | Bacteria | 8229 |
| 143 | Ga0105239_12211901 | 3300010375 | Bacteria | 640 |
| 144 | Ga0157318_1004328 | 3300012482 | Bacteria | 861 |
| 145 | Ga0157319_1015394 | 3300012497 | Bacteria | 683 |
| 146 | Ga0157314_1001703 | 3300012500 | Bacteria | 1547 |
| 147 | Ga0157338_1070602 | 3300012515 | Bacteria | 544 |
| 148 | Ga0157373_10068840 | 3300013100 | Bacteria | 2502 |
| 149 | Ga0157371_10000658 | 3300013102 | Bacteria | 40993 |
| 150 | Ga0157371_10043343 | 3300013102 | Bacteria | 3205 |
| 151 | Ga0157371_10316042 | 3300013102 | Bacteria | 1133 |
| 152 | Ga0157371_10574622 | 3300013102 | Bacteria | 837 |
| 153 | Ga0157370_10016314 | 3300013104 | Bacteria | 7525 |
| 154 | Ga0157370_10239140 | 3300013104 | Bacteria | 1680 |
| 155 | Ga0157370_10271084 | 3300013104 | Bacteria | 1568 |
| 156 | Ga0157369_10020199 | 3300013105 | Bacteria | 7448 |
| 157 | Ga0157369_10070214 | 3300013105 | Bacteria | 3763 |
| 158 | Ga0157374_10144870 | 3300013296 | Bacteria | 2307 |
| 159 | Ga0157378_10091347 | 3300013297 | Bacteria | 2768 |
| 160 | Ga0157378_10633571 | 3300013297 | Bacteria | 1083 |
| 161 | Ga0157372_10111602 | 3300013307 | Bacteria | 3133 |
| 162 | Ga0157375_10029463 | 3300013308 | Bacteria | 5162 |
| 163 | Ga0157375_10213409 | 3300013308 | Bacteria | 2088 |
| 164 | Ga0157375_10502640 | 3300013308 | Bacteria | 1376 |
| 165 | Ga0157380_10097097 | 3300014326 | Bacteria | 2444 |
| 166 | Ga0157380_10935501 | 3300014326 | Bacteria | 896 |
| 167 | Ga0182008_10000730 | 3300014497 | Bacteria | 23330 |
| 168 | Ga0182008_10013902 | 3300014497 | Bacteria | 4224 |
| 169 | Ga0182008_10024004 | 3300014497 | Bacteria | 3107 |
| 170 | Ga0182006_1015620 | 3300015261 | Bacteria | 3252 |
| 171 | Ga0182006_1065014 | 3300015261 | Bacteria | 1366 |
| 172 | Ga0182007_10000025 | 3300015262 | Bacteria | 172058 |
| 173 | Ga0182005_1000063 | 3300015265 | Bacteria | 97663 |
| 174 | Ga0182005_1004147 | 3300015265 | Bacteria | 4737 |
| 175 | Ga0183360_10003 | 3300015689 | Bacteria | 713221 |
| 176 | Ga0163161_10004635 | 3300017792 | Bacteria | 9565 |
| 177 | Ga0163161_10012078 | 3300017792 | Bacteria | 5990 |
| 178 | Ga0163161_10040670 | 3300017792 | Bacteria | 3339 |
| 179 | Ga0163161_10161692 | 3300017792 | Bacteria | 1707 |
| 180 | Ga0163161_10343145 | 3300017792 | Bacteria | 1185 |
| 181 | Ga0163161_10562756 | 3300017792 | Bacteria | 936 |
| 182 | Ga0213875_10329094 | 3300021388 | Bacteria | 724 |
| 183 | Ga0209784_100084 | 3300025224 | Bacteria | 125995 |
| 184 | Ga0209566_100092 | 3300025225 | Bacteria | 137641 |
| 185 | Ga0209566_100122 | 3300025225 | Bacteria | 101406 |
| 186 | Ga0209566_111607 | 3300025225 | Bacteria | 858 |
| 187 | Ga0209147_112588 | 3300025229 | Unclassified | 904 |
| 188 | Ga0209258_101493 | 3300025242 | Bacteria | 8003 |
| 189 | Ga0207425_1000040 | 3300025245 | Bacteria | 218121 |
| 190 | Ga0207425_1024176 | 3300025245 | Bacteria | 1264 |
| 191 | Ga0207425_1049150 | 3300025245 | Bacteria | 776 |
| 192 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 193 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 194 | Ga0209565_1000037 | 3300025263 | Bacteria | 289371 |
| 195 | Ga0209565_1024592 | 3300025263 | Bacteria | 1224 |
| 196 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 197 | Ga0209673_1000032 | 3300025273 | Bacteria | 339956 |
| 198 | Ga0209673_1009916 | 3300025273 | Bacteria | 4070 |
| 199 | Ga0209673_1056213 | 3300025273 | Bacteria | 1009 |
| 200 | Ga0209130_1007940 | 3300025284 | Bacteria | 3200 |
| 201 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 202 | Ga0209675_1000020 | 3300025291 | Bacteria | 335854 |
| 203 | Ga0209675_1010710 | 3300025291 | Bacteria | 3106 |
| 204 | Ga0209675_1019174 | 3300025291 | Bacteria | 1890 |
| 205 | Ga0209676_1000063 | 3300025292 | Bacteria | 322025 |
| 206 | Ga0209676_1000149 | 3300025292 | Bacteria | 167854 |
| 207 | Ga0209676_1000199 | 3300025292 | Bacteria | 134270 |
| 208 | Ga0209676_1000610 | 3300025292 | Bacteria | 52296 |
| 209 | Ga0209676_1004196 | 3300025292 | Bacteria | 8178 |
| 210 | Ga0209676_1011454 | 3300025292 | Bacteria | 3573 |
| 211 | Ga0209676_1017123 | 3300025292 | Bacteria | 2579 |
| 212 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 213 | Ga0209025_1000030 | 3300025294 | Bacteria | 441196 |
| 214 | Ga0209025_1006488 | 3300025294 | Bacteria | 9053 |
| 215 | Ga0209025_1007306 | 3300025294 | Bacteria | 8285 |
| 216 | Ga0209025_1009758 | 3300025294 | Bacteria | 6628 |
| 217 | Ga0209025_1012032 | 3300025294 | Bacteria | 5607 |
| 218 | Ga0209025_1033326 | 3300025294 | Bacteria | 2382 |
| 219 | Ga0209025_1039683 | 3300025294 | Bacteria | 2049 |
| 220 | Ga0209025_1043666 | 3300025294 | Bacteria | 1884 |
| 221 | Ga0209025_1097167 | 3300025294 | Bacteria | 944 |
| 222 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 223 | Ga0209564_1000951 | 3300025295 | Bacteria | 37038 |
| 224 | Ga0209564_1004958 | 3300025295 | Bacteria | 7855 |
| 225 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 226 | Ga0209758_1012563 | 3300025297 | Bacteria | 4723 |
| 227 | Ga0209050_1000189 | 3300025298 | Bacteria | 138610 |
| 228 | Ga0209050_1000199 | 3300025298 | Bacteria | 134682 |
| 229 | Ga0209050_1000794 | 3300025298 | Bacteria | 44654 |
| 230 | Ga0209050_1001310 | 3300025298 | Bacteria | 27931 |
| 231 | Ga0209050_1007848 | 3300025298 | Bacteria | 5862 |
| 232 | Ga0209050_1047328 | 3300025298 | Bacteria | 1121 |
| 233 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 234 | Ga0209256_1001838 | 3300025299 | Bacteria | 19738 |
| 235 | Ga0209256_1002507 | 3300025299 | Bacteria | 14781 |
| 236 | Ga0209256_1003521 | 3300025299 | Bacteria | 10900 |
| 237 | Ga0209256_1006653 | 3300025299 | Bacteria | 6015 |
| 238 | Ga0209256_1048142 | 3300025299 | Bacteria | 1045 |
| 239 | Ga0209051_1013273 | 3300025303 | Bacteria | 3931 |
| 240 | Ga0209257_1000078 | 3300025304 | Bacteria | 317483 |
| 241 | Ga0209257_1000086 | 3300025304 | Bacteria | 287437 |
| 242 | Ga0209257_1001558 | 3300025304 | Bacteria | 26541 |
| 243 | Ga0209257_1001969 | 3300025304 | Bacteria | 22127 |
| 244 | Ga0209257_1002257 | 3300025304 | Bacteria | 19699 |
| 245 | Ga0209257_1003701 | 3300025304 | Bacteria | 12719 |
| 246 | Ga0209257_1012493 | 3300025304 | Bacteria | 3914 |
| 247 | Ga0209257_1023282 | 3300025304 | Bacteria | 2181 |
| 248 | Ga0209257_1025141 | 3300025304 | Bacteria | 2041 |
| 249 | Ga0209257_1071658 | 3300025304 | Bacteria | 911 |
| 250 | Ga0207655_1068386 | 3300025728 | Bacteria | 1332 |
| 251 | Ga0207713_1000253 | 3300025735 | Bacteria | 66728 |
| 252 | Ga0207713_1023662 | 3300025735 | Bacteria | 2885 |
| 253 | Ga0207680_10652729 | 3300025903 | Bacteria | 753 |
| 254 | Ga0207705_10078723 | 3300025909 | Bacteria | 2399 |
| 255 | Ga0207654_10020676 | 3300025911 | Bacteria | 3494 |
| 256 | Ga0207707_10001167 | 3300025912 | Bacteria | 24740 |
| 257 | Ga0207707_10295362 | 3300025912 | Bacteria | 1402 |
| 258 | Ga0207695_10051073 | 3300025913 | Bacteria | 4344 |
| 259 | Ga0207695_10151847 | 3300025913 | Bacteria | 2255 |
| 260 | Ga0207693_10136936 | 3300025915 | Bacteria | 1925 |
| 261 | Ga0207660_10007789 | 3300025917 | Bacteria | 6933 |
| 262 | Ga0207660_10358631 | 3300025917 | Bacteria | 1169 |
| 263 | Ga0207657_10025581 | 3300025919 | Bacteria | 5440 |
| 264 | Ga0207649_11136356 | 3300025920 | Bacteria | 617 |
| 265 | Ga0207652_10003496 | 3300025921 | Bacteria | 12949 |
| 266 | Ga0207652_10111470 | 3300025921 | Bacteria | 2426 |
| 267 | Ga0207652_10198608 | 3300025921 | Bacteria | 1805 |
| 268 | Ga0207681_10025032 | 3300025923 | Bacteria | 3835 |
| 269 | Ga0207681_10217484 | 3300025923 | Bacteria | 1476 |
| 270 | Ga0207681_10471331 | 3300025923 | Bacteria | 1024 |
| 271 | Ga0207694_10324880 | 3300025924 | Bacteria | 1270 |
| 272 | Ga0207650_10008541 | 3300025925 | Bacteria | 6994 |
| 273 | Ga0207650_10033189 | 3300025925 | Bacteria | 3737 |
| 274 | Ga0207650_10129489 | 3300025925 | Bacteria | 1973 |
| 275 | Ga0207659_10077556 | 3300025926 | Bacteria | 2446 |
| 276 | Ga0207659_10244659 | 3300025926 | Bacteria | 1453 |
| 277 | Ga0207644_10006436 | 3300025931 | Bacteria | 7653 |
| 278 | Ga0207644_10111606 | 3300025931 | Bacteria | 2068 |
| 279 | Ga0207644_10560895 | 3300025931 | Bacteria | 946 |
| 280 | Ga0207690_10874258 | 3300025932 | Bacteria | 745 |
| 281 | Ga0207709_10001569 | 3300025935 | Bacteria | 15656 |
| 282 | Ga0207709_10075898 | 3300025935 | Bacteria | 2150 |
| 283 | Ga0207669_10049010 | 3300025937 | Bacteria | 2514 |
| 284 | Ga0207691_10018899 | 3300025940 | Bacteria | 6527 |
| 285 | Ga0207711_10002243 | 3300025941 | Bacteria | 17327 |
| 286 | Ga0207711_10468665 | 3300025941 | Bacteria | 1173 |
| 287 | Ga0207711_10566441 | 3300025941 | Bacteria | 1060 |
| 288 | Ga0207667_10040754 | 3300025949 | Bacteria | 4943 |
| 289 | Ga0207667_10464492 | 3300025949 | Bacteria | 1285 |
| 290 | Ga0207651_10409869 | 3300025960 | Bacteria | 1155 |
| 291 | Ga0207668_10004601 | 3300025972 | Bacteria | 8112 |
| 292 | Ga0207668_10024065 | 3300025972 | Bacteria | 3925 |
| 293 | Ga0207640_11214820 | 3300025981 | Bacteria | 671 |
| 294 | Ga0207658_10332020 | 3300025986 | Bacteria | 1319 |
| 295 | Ga0207708_10921796 | 3300026075 | Bacteria | 757 |
| 296 | Ga0207702_10175258 | 3300026078 | Bacteria | 1970 |
| 297 | Ga0207648_10444570 | 3300026089 | Bacteria | 1180 |
| 298 | Ga0207674_10010009 | 3300026116 | Bacteria | 10791 |
| 299 | Ga0207675_100671875 | 3300026118 | Bacteria | 1043 |
| 300 | Ga0207683_10095515 | 3300026121 | Bacteria | 2650 |
| 301 | Ga0207683_10802538 | 3300026121 | Bacteria | 873 |
| 302 | Ga0209371_1000028 | 3300027312 | Bacteria | 429688 |
| 303 | Ga0209371_1000048 | 3300027312 | Bacteria | 281705 |
| 304 | Ga0209371_1010826 | 3300027312 | Bacteria | 2765 |
| 305 | Ga0209981_1042102 | 3300027378 | Bacteria | 684 |
| 306 | Ga0209984_1009274 | 3300027424 | Bacteria | 1249 |
| 307 | Ga0209995_1010920 | 3300027471 | Bacteria | 1475 |
| 308 | Ga0209999_1004632 | 3300027543 | Bacteria | 2469 |
| 309 | Ga0209970_1006158 | 3300027614 | Bacteria | 1969 |
| 310 | Ga0209970_1007034 | 3300027614 | Bacteria | 1844 |
| 311 | Ga0209983_1001083 | 3300027665 | Bacteria | 6013 |
| 312 | Ga0209983_1027086 | 3300027665 | Bacteria | 1213 |
| 313 | Ga0209971_1000758 | 3300027682 | Bacteria | 8335 |
| 314 | Ga0209971_1012091 | 3300027682 | Bacteria | 2043 |
| 315 | Ga0209974_10010835 | 3300027876 | Bacteria | 3071 |
| 316 | Ga0209974_10019745 | 3300027876 | Bacteria | 2234 |
| 317 | Ga0209974_10025126 | 3300027876 | Bacteria | 1972 |
| 318 | Ga0268266_10001436 | 3300028379 | Bacteria | 28384 |
| 319 | Ga0268266_10024900 | 3300028379 | Bacteria | 5092 |
| 320 | Ga0268266_10054746 | 3300028379 | Bacteria | 3429 |
| 321 | Ga0268266_11412684 | 3300028379 | Bacteria | 671 |
| 322 | Ga0268265_10103400 | 3300028380 | Bacteria | 2307 |
| 323 | Ga0307515_10286484 | 3300028794 | Bacteria | 1348 |
| 324 | Ga0268256_1000030 | 3300030500 | Bacteria | 429688 |
| 325 | Ga0268256_1000049 | 3300030500 | Bacteria | 307229 |
| 326 | Ga0268256_1010567 | 3300030500 | Bacteria | 2982 |
| 327 | Ga0316177_1019699 | 3300030731 | Bacteria | 3600 |
| 328 | Ga0316177_1090695 | 3300030731 | Bacteria | 1889 |
| 329 | Ga0316176_1178239 | 3300030732 | Bacteria | 2187 |
| 330 | Ga0314311_1198609 | 3300030733 | Bacteria | 2084 |
| 331 | Ga0314311_1212235 | 3300030733 | Bacteria | 2734 |
| 332 | Ga0316178_1100148 | 3300030735 | Bacteria | 909 |
| 333 | Ga0316180_1135407 | 3300030736 | Bacteria | 976 |
| 334 | Ga0316183_1032517 | 3300030742 | Bacteria | 3263 |
| 335 | Ga0316183_1156169 | 3300030742 | Bacteria | 1292 |
| 336 | Ga0316182_1090418 | 3300030745 | Bacteria | 1168 |
| 337 | Ga0316182_1113265 | 3300030745 | Bacteria | 1959 |
| 338 | Ga0316182_1139274 | 3300030745 | Bacteria | 1715 |
| 339 | Ga0307513_10002045 | 3300031456 | Bacteria | 28381 |
| 340 | Ga0307513_10310084 | 3300031456 | Bacteria | 1341 |
| 341 | Ga0307509_10753553 | 3300031507 | Bacteria | 639 |
| 342 | Ga0307408_100049397 | 3300031548 | Bacteria | 3021 |
| 343 | Ga0307408_100058931 | 3300031548 | Bacteria | 2793 |
| 344 | Ga0307408_100059523 | 3300031548 | Bacteria | 2780 |
| 345 | Ga0307408_100740267 | 3300031548 | Bacteria | 887 |
| 346 | Ga0307408_100758912 | 3300031548 | Bacteria | 877 |
| 347 | Ga0307408_101243580 | 3300031548 | Bacteria | 696 |
| 348 | Ga0316576_10321852 | 3300031727 | Bacteria | 1153 |
| 349 | Ga0307405_10223600 | 3300031731 | Bacteria | 1383 |
| 350 | Ga0307405_10234444 | 3300031731 | Bacteria | 1355 |
| 351 | Ga0307405_11036510 | 3300031731 | Bacteria | 702 |
| 352 | Ga0307413_10006572 | 3300031824 | Bacteria | 5325 |
| 353 | Ga0307413_10007402 | 3300031824 | Bacteria | 5097 |
| 354 | Ga0307413_10079998 | 3300031824 | Bacteria | 2091 |
| 355 | Ga0307413_10100253 | 3300031824 | Bacteria | 1912 |
| 356 | Ga0307413_10147237 | 3300031824 | Bacteria | 1636 |
| 357 | Ga0307413_10214365 | 3300031824 | Bacteria | 1401 |
| 358 | Ga0307413_10241967 | 3300031824 | Bacteria | 1333 |
| 359 | Ga0307413_10457698 | 3300031824 | Bacteria | 1014 |
| 360 | Ga0307413_10495350 | 3300031824 | Bacteria | 980 |
| 361 | Ga0307413_10554644 | 3300031824 | Bacteria | 933 |
| 362 | Ga0307410_10084596 | 3300031852 | Bacteria | 2237 |
| 363 | Ga0307410_10417360 | 3300031852 | Bacteria | 1088 |
| 364 | Ga0307410_10554581 | 3300031852 | Bacteria | 953 |
| 365 | Ga0307406_10008217 | 3300031901 | Bacteria | 5817 |
| 366 | Ga0307406_10149539 | 3300031901 | Bacteria | 1664 |
| 367 | Ga0307406_10257809 | 3300031901 | Bacteria | 1317 |
| 368 | Ga0307406_10466902 | 3300031901 | Bacteria | 1016 |
| 369 | Ga0307406_10629293 | 3300031901 | Bacteria | 888 |
| 370 | Ga0307412_10000087 | 3300031911 | Bacteria | 84138 |
| 371 | Ga0307412_10002247 | 3300031911 | Bacteria | 10705 |
| 372 | Ga0307412_10064564 | 3300031911 | Bacteria | 2474 |
| 373 | Ga0307412_10187844 | 3300031911 | Bacteria | 1560 |
| 374 | Ga0307412_10339356 | 3300031911 | Bacteria | 1202 |
| 375 | Ga0307412_10520922 | 3300031911 | Bacteria | 993 |
| 376 | Ga0307412_10889744 | 3300031911 | Bacteria | 779 |
| 377 | Ga0307412_11545596 | 3300031911 | Bacteria | 604 |
| 378 | Ga0307409_100510405 | 3300031995 | Bacteria | 1172 |
| 379 | Ga0307409_102321007 | 3300031995 | Bacteria | 566 |
| 380 | Ga0307416_100006969 | 3300032002 | Bacteria | 7126 |
| 381 | Ga0307416_100023561 | 3300032002 | Bacteria | 4470 |
| 382 | Ga0307416_100343905 | 3300032002 | Bacteria | 1506 |
| 383 | Ga0307416_100438009 | 3300032002 | Bacteria | 1356 |
| 384 | Ga0307416_100496923 | 3300032002 | Bacteria | 1283 |
| 385 | Ga0307416_101605709 | 3300032002 | Bacteria | 755 |
| 386 | Ga0307416_102083253 | 3300032002 | Bacteria | 669 |
| 387 | Ga0307414_10000159 | 3300032004 | Bacteria | 45131 |
| 388 | Ga0307414_10004389 | 3300032004 | Bacteria | 7659 |
| 389 | Ga0307414_10017345 | 3300032004 | Bacteria | 4402 |
| 390 | Ga0307414_10019952 | 3300032004 | Bacteria | 4166 |
| 391 | Ga0307414_10023608 | 3300032004 | Bacteria | 3904 |
| 392 | Ga0307414_10054278 | 3300032004 | Bacteria | 2799 |
| 393 | Ga0307414_10094518 | 3300032004 | Bacteria | 2231 |
| 394 | Ga0307414_10108743 | 3300032004 | Bacteria | 2104 |
| 395 | Ga0307414_10135051 | 3300032004 | Bacteria | 1922 |
| 396 | Ga0307414_10498444 | 3300032004 | Bacteria | 1077 |
| 397 | Ga0307414_10521656 | 3300032004 | Bacteria | 1054 |
| 398 | Ga0307414_11196948 | 3300032004 | Bacteria | 703 |
| 399 | Ga0307411_10051787 | 3300032005 | Bacteria | 2680 |
| 400 | Ga0307411_10119139 | 3300032005 | Bacteria | 1906 |
| 401 | Ga0307411_10180443 | 3300032005 | Bacteria | 1602 |
| 402 | Ga0307411_10310407 | 3300032005 | Bacteria | 1269 |
| 403 | Ga0307411_10526672 | 3300032005 | Bacteria | 1004 |
| 404 | Ga0307411_10639650 | 3300032005 | Bacteria | 919 |
| 405 | Ga0307411_10759786 | 3300032005 | Bacteria | 850 |
| 406 | Ga0307411_11092444 | 3300032005 | Bacteria | 718 |
| 407 | Ga0316574_0244884 | 3300035398 | Bacteria | 1146 |
| 408 | Ga0316574_0461989 | 3300035398 | Bacteria | 794 |
| 409 | Ga0373937_0181755 | 3300036401 | Bacteria | 1975 |
| 410 | Ga0373937_1595327 | 3300036401 | Bacteria | 600 |
| 411 | Ga0316584_0515278 | 3300036712 | Bacteria | 839 |
| 412 | Ga0395899_0352222 | 3300037312 | Bacteria | 984 |
| 413 | Ga0395898_0743001 | 3300037466 | Bacteria | 923 |
| 414 | Ga0395905_0002859 | 3300037471 | Bacteria | 18881 |
| 415 | Ga0395905_0016448 | 3300037471 | Bacteria | 7031 |
| 416 | Ga0395905_0477278 | 3300037471 | Bacteria | 1146 |
| 417 | Ga0436364_0744029 | 3300037853 | Bacteria | 3696 |
| 418 | Ga0395901_0020794 | 3300038443 | Bacteria | 6718 |
| 419 | Ga0237819_00279 | 3300038705 | Bacteria | 18711 |
| 420 | Ga0237819_02264 | 3300038705 | Bacteria | 4030 |
| 421 | Ga0237816_01687 | 3300039145 | Bacteria | 1766 |
| 422 | Ga0439436_0004641 | 3300041404 | Bacteria | 4213 |
| 423 | Ga0439436_0032076 | 3300041404 | Bacteria | 1524 |
| 424 | Ga0439447_000033 | 3300041407 | Bacteria | 49181 |
| 425 | Ga0439461_0085376 | 3300041410 | Bacteria | 750 |
| 426 | Ga0439465_0003016 | 3300041413 | Bacteria | 5502 |
| 427 | Ga0439465_0044755 | 3300041413 | Bacteria | 1438 |
| 428 | Ga0439465_0049197 | 3300041413 | Bacteria | 1376 |
| 429 | Ga0451787_691700 | 3300041441 | Bacteria | 979 |
| 430 | Ga0451791_0061126 | 3300041451 | Bacteria | 1443 |
| 431 | Ga0451793_0248173 | 3300041452 | Bacteria | 1158 |
| 432 | Ga0451797_0206176 | 3300041453 | Bacteria | 803 |
| 433 | Ga0451797_0209795 | 3300041453 | Bacteria | 2573 |
| 434 | Ga0451797_0510974 | 3300041453 | Bacteria | 1113 |
| 435 | Ga0451797_1381519 | 3300041453 | Bacteria | 674 |
| 436 | Ga0451795_1281766 | 3300041456 | Bacteria | 2072 |
| 437 | Ga0451800_0961261 | 3300041459 | Bacteria | 1327 |
| 438 | Ga0451800_1014250 | 3300041459 | Bacteria | 2965 |
| 439 | Ga0451802_1249029 | 3300041460 | Bacteria | 1378 |
| 440 | Ga0451802_1339368 | 3300041460 | Bacteria | 777 |
| 441 | Ga0451802_1567617 | 3300041460 | Bacteria | 1438 |
| 442 | Ga0451806_130861 | 3300041462 | Bacteria | 3982 |
| 443 | Ga0451807_0759871 | 3300041486 | Bacteria | 1643 |
| 444 | Ga0451807_0894472 | 3300041486 | Bacteria | 914 |
| 445 | Ga0451807_1140346 | 3300041486 | Bacteria | 1134 |
| 446 | Ga0451807_2568450 | 3300041486 | Bacteria | 634 |
| 447 | Ga0451833_1204446 | 3300041491 | Bacteria | 547 |
| 448 | Ga0451833_1243150 | 3300041491 | Bacteria | 628 |
| 449 | Ga0451835_1055552 | 3300041492 | Bacteria | 586 |
| 450 | Ga0451837_0766626 | 3300041494 | Bacteria | 1008 |
| 451 | Ga0451837_1042500 | 3300041494 | Bacteria | 2185 |
| 452 | Ga0451837_1185966 | 3300041494 | Bacteria | 737 |
| 453 | Ga0451839_0654108 | 3300041496 | Bacteria | 1064 |
| 454 | Ga0451841_0842399 | 3300041498 | Bacteria | 743 |
| 455 | Ga0451845_0504423 | 3300041501 | Bacteria | 584 |
| 456 | Ga0451843_0501131 | 3300041509 | Bacteria | 2276 |
| 457 | Ga0451843_0984714 | 3300041509 | Bacteria | 682 |
| 458 | Ga0451853_1276073 | 3300041512 | Bacteria | 554 |
| 459 | Ga0451853_2512039 | 3300041512 | Bacteria | 647 |
| 460 | Ga0451853_2928858 | 3300041512 | Bacteria | 743 |
| 461 | Ga0451853_3785856 | 3300041512 | Bacteria | 1516 |
| 462 | Ga0439433_0016096 | 3300041999 | Bacteria | 1654 |
| 463 | Ga0439433_0055837 | 3300041999 | Bacteria | 936 |
| 464 | Ga0439433_0100366 | 3300041999 | Bacteria | 718 |
| 465 | Ga0439433_0100772 | 3300041999 | Bacteria | 716 |
| 466 | Ga0439445_0005312 | 3300042004 | Bacteria | 2934 |
| 467 | Ga0439445_0042303 | 3300042004 | Bacteria | 1213 |
| 468 | Ga0439432_006084 | 3300042006 | Bacteria | 4324 |
| 469 | Ga0439432_011439 | 3300042006 | Bacteria | 3059 |
| 470 | Ga0439432_019376 | 3300042006 | Bacteria | 2267 |
| 471 | Ga0439432_019821 | 3300042006 | Bacteria | 2238 |
| 472 | Ga0439432_029249 | 3300042006 | Bacteria | 1792 |
| 473 | Ga0439449_0000650 | 3300042007 | Bacteria | 13086 |
| 474 | Ga0439449_0002587 | 3300042007 | Bacteria | 7058 |
| 475 | Ga0439449_0003784 | 3300042007 | Bacteria | 5856 |
| 476 | Ga0439449_0006088 | 3300042007 | Bacteria | 4612 |
| 477 | Ga0439449_0009505 | 3300042007 | Bacteria | 3684 |
| 478 | Ga0439449_0014318 | 3300042007 | Bacteria | 2981 |
| 479 | Ga0439449_0068772 | 3300042007 | Bacteria | 1305 |
| 480 | Ga0439452_016951 | 3300042010 | Bacteria | 1970 |
| 481 | Ga0439462_0008072 | 3300042015 | Bacteria | 2648 |
| 482 | Ga0439462_0017511 | 3300042015 | Bacteria | 1856 |
| 483 | Ga0439462_0071841 | 3300042015 | Bacteria | 940 |
| 484 | Ga0450911_000371 | 3300042115 | Bacteria | 14936 |
| 485 | Ga0450899_006367 | 3300042135 | Bacteria | 1278 |
| 486 | Ga0439446_0048727 | 3300042156 | Bacteria | 1262 |
| 487 | Ga0439446_0142766 | 3300042156 | Bacteria | 783 |
| 488 | Ga0439434_0025040 | 3300042435 | Bacteria | 1801 |
| 489 | Ga0439434_0266653 | 3300042435 | Bacteria | 588 |
| 490 | Ga0450893_0096079 | 3300042532 | Bacteria | 600 |
| 491 | Ga0451577_0015288 | 3300042876 | Bacteria | 7142 |
| 492 | Ga0439440_0010673 | 3300042993 | Bacteria | 1925 |
| 493 | Ga0453684_0000316 | 3300044712 | Bacteria | 204457 |
| 494 | Ga0453684_0089807 | 3300044712 | Bacteria | 3798 |
| 495 | Ga0451576_0000128 | 3300045051 | Bacteria | 192071 |
| 496 | Ga0466967_0218258 | 3300045976 | Bacteria | 1811 |
| 497 | Ga0495627_000853 | 3300046453 | Bacteria | 21817 |
| 498 | Ga0495627_066089 | 3300046453 | Bacteria | 1062 |
| 499 | Ga0495627_072249 | 3300046453 | Bacteria | 1006 |
| 500 | Ga0495590_0024956 | 3300046457 | Bacteria | 2104 |
| 501 | Ga0495591_013488 | 3300046458 | Bacteria | 2987 |
| 502 | Ga0495638_0001228 | 3300046460 | Bacteria | 24256 |
| 503 | Ga0495638_0030301 | 3300046460 | Bacteria | 3484 |
| 504 | Ga0495638_0147851 | 3300046460 | Bacteria | 1365 |
| 505 | Ga0495607_0218148 | 3300046501 | Bacteria | 934 |
| 506 | Ga0495606_0021112 | 3300046507 | Bacteria | 4776 |
| 507 | Ga0495610_0001130 | 3300046512 | Bacteria | 24312 |
| 508 | Ga0495610_0021459 | 3300046512 | Bacteria | 3551 |
| 509 | Ga0495616_0016650 | 3300046513 | Bacteria | 4064 |
| 510 | Ga0495631_0000369 | 3300046518 | Bacteria | 30975 |
| 511 | Ga0495632_0089096 | 3300046519 | Bacteria | 1465 |
| 512 | Ga0495643_0003775 | 3300046522 | Bacteria | 10950 |
| 513 | Ga0495663_0000899 | 3300046525 | Bacteria | 10023 |
| 514 | Ga0495663_0013048 | 3300046525 | Bacteria | 2321 |
| 515 | Ga0495663_0025795 | 3300046525 | Bacteria | 1716 |
| 516 | Ga0495663_0058290 | 3300046525 | Bacteria | 1210 |
| 517 | Ga0495654_0107423 | 3300046530 | Bacteria | 1276 |
| 518 | Ga0495598_0024218 | 3300046537 | Bacteria | 1643 |
| 519 | Ga0495621_0002787 | 3300046539 | Bacteria | 4751 |
| 520 | Ga0495621_0008296 | 3300046539 | Bacteria | 3109 |
| 521 | Ga0495621_0025179 | 3300046539 | Bacteria | 1997 |
| 522 | Ga0495622_0135747 | 3300046557 | Bacteria | 1119 |
| 523 | Ga0495633_0001102 | 3300046558 | Bacteria | 21787 |
| 524 | Ga0495633_0003816 | 3300046558 | Bacteria | 9863 |
| 525 | Ga0495633_0011696 | 3300046558 | Bacteria | 4713 |
| 526 | Ga0495633_0041280 | 3300046558 | Bacteria | 2194 |
| 527 | Ga0495633_0043736 | 3300046558 | Bacteria | 2124 |
| 528 | Ga0495633_0264369 | 3300046558 | Bacteria | 784 |
| 529 | Ga0495656_0001943 | 3300046615 | Bacteria | 6814 |
| 530 | Ga0495656_0002508 | 3300046615 | Bacteria | 6105 |
| 531 | Ga0495656_0004358 | 3300046615 | Bacteria | 4839 |
| 532 | Ga0495656_0067967 | 3300046615 | Bacteria | 1574 |
| 533 | Ga0495656_0232697 | 3300046615 | Bacteria | 925 |
| 534 | Ga0495668_0000960 | 3300046616 | Bacteria | 32037 |
| 535 | Ga0495625_0096632 | 3300046660 | Bacteria | 2035 |
| 536 | Ga0495659_0008952 | 3300046664 | Bacteria | 3189 |
| 537 | Ga0495670_0275136 | 3300046691 | Bacteria | 900 |
| 538 | Ga0495671_0083413 | 3300046692 | Bacteria | 1566 |
| 539 | Ga0495660_0004923 | 3300046810 | Bacteria | 8048 |
| 540 | Ga0495660_0113172 | 3300046810 | Bacteria | 1382 |
| 541 | Ga0495660_0155429 | 3300046810 | Bacteria | 1126 |
| 542 | Ga0495636_0013289 | 3300047318 | Bacteria | 3266 |
| 543 | Ga0495636_0028691 | 3300047318 | Bacteria | 2270 |
| 544 | Ga0495636_0030645 | 3300047318 | Bacteria | 2200 |
| 545 | Ga0495636_0060586 | 3300047318 | Bacteria | 1599 |
| 546 | Ga0495636_0062891 | 3300047318 | Bacteria | 1571 |
| 547 | Ga0495672_0000079 | 3300047320 | Bacteria | 161885 |
| 548 | Ga0495672_0026243 | 3300047320 | Bacteria | 3719 |
| 549 | Ga0495672_0076591 | 3300047320 | Bacteria | 1878 |
| 550 | Ga0495685_081273 | 3300047447 | Bacteria | 1079 |
| 551 | Ga0495681_0033084 | 3300047470 | Bacteria | 2594 |
| 552 | Ga0495681_0101672 | 3300047470 | Bacteria | 1256 |
| 553 | Ga0495686_0012567 | 3300047472 | Bacteria | 5919 |
| 554 | Ga0495615_0279499 | 3300048090 | Bacteria | 536 |
| 555 | Ga0496101_0119291 | 3300048904 | Bacteria | 1993 |
| 556 | Ga0496101_0254279 | 3300048904 | Bacteria | 1369 |
| 557 | Ga0496101_1336992 | 3300048904 | Bacteria | 560 |
| 558 | Ga0496102_0328648 | 3300048905 | Bacteria | 1440 |
| 559 | Ga0496103_0127295 | 3300048906 | Bacteria | 1625 |
| 560 | Ga0496105_0401066 | 3300048908 | Bacteria | 1089 |
| 561 | Ga0496106_0123063 | 3300048909 | Bacteria | 2029 |
| 562 | Ga0496107_0139447 | 3300048910 | Bacteria | 1792 |
| 563 | Ga0496108_0404326 | 3300048911 | Bacteria | 1192 |
| 564 | Ga0496108_0909007 | 3300048911 | Bacteria | 755 |
| 565 | Ga0496109_0192086 | 3300048912 | Bacteria | 1919 |
| 566 | Ga0496109_0204493 | 3300048912 | Bacteria | 1856 |
| 567 | Ga0496110_0063713 | 3300048913 | Bacteria | 3258 |
| 568 | Ga0496111_0298825 | 3300048914 | Bacteria | 1193 |
| 569 | Ga0496111_0406901 | 3300048914 | Bacteria | 1005 |
| 570 | Ga0496111_0444681 | 3300048914 | Bacteria | 956 |
| 571 | Ga0496112_0449356 | 3300048915 | Bacteria | 1226 |
| 572 | Ga0496113_0004036 | 3300048916 | Bacteria | 8936 |
| 573 | Ga0496113_0026815 | 3300048916 | Bacteria | 4124 |
| 574 | Ga0496113_0046556 | 3300048916 | Bacteria | 3220 |
| 575 | Ga0496113_0491132 | 3300048916 | Bacteria | 986 |
| 576 | Ga0496114_0001425 | 3300048917 | Bacteria | 18148 |
| 577 | Ga0496116_0000742 | 3300048919 | Bacteria | 41599 |
| 578 | Ga0496116_0004402 | 3300048919 | Bacteria | 13471 |
| 579 | Ga0496116_0006168 | 3300048919 | Bacteria | 10962 |
| 580 | Ga0496116_0015795 | 3300048919 | Bacteria | 5947 |
| 581 | Ga0496116_0020093 | 3300048919 | Bacteria | 5084 |
| 582 | Ga0496116_0023042 | 3300048919 | Bacteria | 4647 |
| 583 | Ga0496116_0030969 | 3300048919 | Bacteria | 3837 |
| 584 | Ga0496116_0042398 | 3300048919 | Bacteria | 3111 |
| 585 | Ga0496116_0282868 | 3300048919 | Bacteria | 802 |
| 586 | Ga0496117_0000483 | 3300048920 | Bacteria | 66226 |
| 587 | Ga0496117_0001569 | 3300048920 | Bacteria | 32439 |
| 588 | Ga0496117_0001801 | 3300048920 | Bacteria | 29132 |
| 589 | Ga0496117_0005801 | 3300048920 | Bacteria | 12806 |
| 590 | Ga0496117_0009988 | 3300048920 | Bacteria | 8726 |
| 591 | Ga0496117_0015910 | 3300048920 | Bacteria | 6373 |
| 592 | Ga0496117_0050192 | 3300048920 | Bacteria | 2960 |
| 593 | Ga0496117_0053529 | 3300048920 | Bacteria | 2835 |
| 594 | Ga0496117_0071182 | 3300048920 | Bacteria | 2331 |
| 595 | Ga0496118_0000732 | 3300048921 | Bacteria | 53036 |
| 596 | Ga0496118_0002860 | 3300048921 | Bacteria | 22520 |
| 597 | Ga0496118_0005588 | 3300048921 | Bacteria | 14220 |
| 598 | Ga0496118_0009765 | 3300048921 | Bacteria | 9625 |
| 599 | Ga0496118_0010427 | 3300048921 | Bacteria | 9205 |
| 600 | Ga0496118_0014077 | 3300048921 | Bacteria | 7507 |
| 601 | Ga0496118_0031298 | 3300048921 | Bacteria | 4413 |
| 602 | Ga0496118_0031992 | 3300048921 | Bacteria | 4345 |
| 603 | Ga0496118_0058232 | 3300048921 | Bacteria | 2889 |
| 604 | Ga0496118_0092602 | 3300048921 | Bacteria | 2073 |
| 605 | Ga0496118_0546112 | 3300048921 | Bacteria | 566 |
| 606 | Ga0496119_0001225 | 3300048922 | Bacteria | 31961 |
| 607 | Ga0496119_0001601 | 3300048922 | Bacteria | 26908 |
| 608 | Ga0496119_0003714 | 3300048922 | Bacteria | 15636 |
| 609 | Ga0496119_0016440 | 3300048922 | Bacteria | 5631 |
| 610 | Ga0496119_0026613 | 3300048922 | Bacteria | 4005 |
| 611 | Ga0496120_0000262 | 3300048923 | Bacteria | 88205 |
| 612 | Ga0496120_0000564 | 3300048923 | Bacteria | 56487 |
| 613 | Ga0496120_0003036 | 3300048923 | Bacteria | 15844 |
| 614 | Ga0496120_0003756 | 3300048923 | Bacteria | 13441 |
| 615 | Ga0496120_0012681 | 3300048923 | Bacteria | 5719 |
| 616 | Ga0496120_0167909 | 3300048923 | Bacteria | 1088 |
| 617 | Ga0496121_0000165 | 3300048924 | Bacteria | 145052 |
| 618 | Ga0496121_0001145 | 3300048924 | Bacteria | 46506 |
| 619 | Ga0496121_0005386 | 3300048924 | Bacteria | 16439 |
| 620 | Ga0496121_0006141 | 3300048924 | Bacteria | 15082 |
| 621 | Ga0496121_0016056 | 3300048924 | Bacteria | 7760 |
| 622 | Ga0496121_0035993 | 3300048924 | Bacteria | 4421 |
| 623 | Ga0496121_0074701 | 3300048924 | Bacteria | 2710 |
| 624 | Ga0496121_0080844 | 3300048924 | Bacteria | 2574 |
| 625 | Ga0496121_0095467 | 3300048924 | Bacteria | 2311 |
| 626 | Ga0496121_0127008 | 3300048924 | Bacteria | 1915 |
| 627 | Ga0496121_0528919 | 3300048924 | Bacteria | 742 |
| 628 | Ga0496122_0000537 | 3300048925 | Bacteria | 78505 |
| 629 | Ga0496122_0000736 | 3300048925 | Bacteria | 63894 |
| 630 | Ga0496122_0001070 | 3300048925 | Bacteria | 47552 |
| 631 | Ga0496122_0004558 | 3300048925 | Bacteria | 17082 |
| 632 | Ga0496122_0008632 | 3300048925 | Bacteria | 10937 |
| 633 | Ga0496122_0016201 | 3300048925 | Bacteria | 7078 |
| 634 | Ga0496122_0016730 | 3300048925 | Bacteria | 6911 |
| 635 | Ga0496122_0016983 | 3300048925 | Bacteria | 6837 |
| 636 | Ga0496122_0019102 | 3300048925 | Bacteria | 6283 |
| 637 | Ga0496122_0023374 | 3300048925 | Bacteria | 5452 |
| 638 | Ga0496122_0028118 | 3300048925 | Bacteria | 4784 |
| 639 | Ga0496122_0069527 | 3300048925 | Bacteria | 2521 |
| 640 | Ga0496122_0132678 | 3300048925 | Bacteria | 1578 |
| 641 | Ga0496122_0147744 | 3300048925 | Bacteria | 1457 |
| 642 | Ga0496122_0415413 | 3300048925 | Bacteria | 678 |
| 643 | Ga0496123_0000541 | 3300048926 | Bacteria | 64921 |
| 644 | Ga0496123_0000763 | 3300048926 | Bacteria | 52065 |
| 645 | Ga0496123_0000898 | 3300048926 | Bacteria | 47136 |
| 646 | Ga0496123_0005012 | 3300048926 | Bacteria | 13560 |
| 647 | Ga0496123_0016396 | 3300048926 | Bacteria | 6019 |
| 648 | Ga0496123_0021598 | 3300048926 | Bacteria | 4997 |
| 649 | Ga0496123_0023409 | 3300048926 | Bacteria | 4728 |
| 650 | Ga0496123_0025056 | 3300048926 | Bacteria | 4509 |
| 651 | Ga0496123_0039571 | 3300048926 | Bacteria | 3296 |
| 652 | Ga0496123_0085479 | 3300048926 | Bacteria | 1897 |
| 653 | Ga0496123_0110347 | 3300048926 | Bacteria | 1574 |
| 654 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 655 | Ga0496124_0000128 | 3300048927 | Bacteria | 157194 |
| 656 | Ga0496124_0001971 | 3300048927 | Bacteria | 28014 |
| 657 | Ga0496124_0005006 | 3300048927 | Bacteria | 15151 |
| 658 | Ga0496124_0005062 | 3300048927 | Bacteria | 15040 |
| 659 | Ga0496124_0010412 | 3300048927 | Bacteria | 9416 |
| 660 | Ga0496124_0013859 | 3300048927 | Bacteria | 7841 |
| 661 | Ga0496124_0024389 | 3300048927 | Bacteria | 5501 |
| 662 | Ga0496124_0030838 | 3300048927 | Bacteria | 4751 |
| 663 | Ga0496124_0035514 | 3300048927 | Bacteria | 4360 |
| 664 | Ga0496124_0057851 | 3300048927 | Bacteria | 3264 |
| 665 | Ga0496124_0085690 | 3300048927 | Bacteria | 2581 |
| 666 | Ga0496124_0315708 | 3300048927 | Bacteria | 1121 |
| 667 | Ga0496125_0000121 | 3300048928 | Bacteria | 174971 |
| 668 | Ga0496125_0000475 | 3300048928 | Bacteria | 71075 |
| 669 | Ga0496125_0001304 | 3300048928 | Bacteria | 36984 |
| 670 | Ga0496125_0001928 | 3300048928 | Bacteria | 28389 |
| 671 | Ga0496125_0004706 | 3300048928 | Bacteria | 15551 |
| 672 | Ga0496125_0022077 | 3300048928 | Bacteria | 5917 |
| 673 | Ga0496125_0119744 | 3300048928 | Bacteria | 1881 |
| 674 | Ga0496125_0196998 | 3300048928 | Bacteria | 1323 |
| 675 | Ga0496125_0218453 | 3300048928 | Bacteria | 1230 |
| 676 | Ga0496126_0002184 | 3300048929 | Bacteria | 27192 |
| 677 | Ga0496126_0003535 | 3300048929 | Bacteria | 19652 |
| 678 | Ga0496126_0003936 | 3300048929 | Bacteria | 18181 |
| 679 | Ga0496126_0009281 | 3300048929 | Bacteria | 10480 |
| 680 | Ga0496126_0011601 | 3300048929 | Bacteria | 9095 |
| 681 | Ga0496126_0028258 | 3300048929 | Bacteria | 5346 |
| 682 | Ga0496126_0032355 | 3300048929 | Bacteria | 4927 |
| 683 | Ga0496126_0037947 | 3300048929 | Bacteria | 4486 |
| 684 | Ga0496126_0080107 | 3300048929 | Bacteria | 2890 |
| 685 | Ga0496126_0139530 | 3300048929 | Bacteria | 2088 |
| 686 | Ga0496126_0201615 | 3300048929 | Bacteria | 1680 |
| 687 | Ga0496126_0567491 | 3300048929 | Bacteria | 898 |
| 688 | Ga0501290_008728 | 3300049513 | Bacteria | 1285 |
| 689 | Ga0501300_009142 | 3300049523 | Bacteria | 1448 |
| 690 | Ga0501318_083574 | 3300049534 | Bacteria | 520 |
| 691 | Ga0501031_0091160 | 3300049568 | Bacteria | 1988 |
| 692 | Ga0501031_0156969 | 3300049568 | Bacteria | 1487 |
| 693 | Ga0501032_0012431 | 3300049569 | Bacteria | 6083 |
| 694 | Ga0501032_0355852 | 3300049569 | Bacteria | 943 |
| 695 | Ga0501033_0011027 | 3300049570 | Bacteria | 6921 |
| 696 | Ga0501033_0042754 | 3300049570 | Bacteria | 3377 |
| 697 | Ga0501033_0176994 | 3300049570 | Bacteria | 1530 |
| 698 | Ga0501033_0179126 | 3300049570 | Bacteria | 1520 |
| 699 | Ga0501034_0000275 | 3300049571 | Bacteria | 92805 |
| 700 | Ga0501034_0000473 | 3300049571 | Bacteria | 66214 |
| 701 | Ga0501034_0057134 | 3300049571 | Bacteria | 3923 |
| 702 | Ga0501034_0107153 | 3300049571 | Bacteria | 2787 |
| 703 | Ga0501034_0876298 | 3300049571 | Bacteria | 787 |
| 704 | Ga0501034_1229232 | 3300049571 | Bacteria | 627 |
| 705 | Ga0501036_0007849 | 3300049572 | Bacteria | 8731 |
| 706 | Ga0501036_0028501 | 3300049572 | Bacteria | 4718 |
| 707 | Ga0501036_0126887 | 3300049572 | Bacteria | 2155 |
| 708 | Ga0501036_0376426 | 3300049572 | Bacteria | 1185 |
| 709 | Ga0501037_0022240 | 3300049573 | Bacteria | 4692 |
| 710 | Ga0501037_0197202 | 3300049573 | Bacteria | 1424 |
| 711 | Ga0501038_0004044 | 3300049574 | Bacteria | 13629 |
| 712 | Ga0501038_0043636 | 3300049574 | Bacteria | 3898 |
| 713 | Ga0501038_0058536 | 3300049574 | Bacteria | 3303 |
| 714 | Ga0501039_0003853 | 3300049575 | Bacteria | 11261 |
| 715 | Ga0501039_0072692 | 3300049575 | Bacteria | 2672 |
| 716 | Ga0501040_0001206 | 3300049576 | Bacteria | 16460 |
| 717 | Ga0501041_0001968 | 3300049577 | Bacteria | 11551 |
| 718 | Ga0501042_0000931 | 3300049578 | Bacteria | 16497 |
| 719 | Ga0501043_0004623 | 3300049579 | Bacteria | 11162 |
| 720 | Ga0501043_0024241 | 3300049579 | Bacteria | 4761 |
| 721 | Ga0501043_0045876 | 3300049579 | Bacteria | 3436 |
| 722 | Ga0501043_0061394 | 3300049579 | Bacteria | 2952 |
| 723 | Ga0501043_0222397 | 3300049579 | Bacteria | 1460 |
| 724 | Ga0501046_0011112 | 3300049580 | Bacteria | 7710 |
| 725 | Ga0501047_0170711 | 3300049581 | Bacteria | 2044 |
| 726 | Ga0501047_0226790 | 3300049581 | Bacteria | 1723 |
| 727 | Ga0501047_0308235 | 3300049581 | Bacteria | 1424 |
| 728 | Ga0501048_0011120 | 3300049582 | Bacteria | 6710 |
| 729 | Ga0501068_0000860 | 3300049584 | Bacteria | 15814 |
| 730 | Ga0501070_0113135 | 3300049586 | Bacteria | 2243 |
| 731 | Ga0501070_0114001 | 3300049586 | Bacteria | 2233 |
| 732 | Ga0501071_0006996 | 3300049587 | Bacteria | 7366 |
| 733 | Ga0501072_0001665 | 3300049588 | Bacteria | 16559 |
| 734 | Ga0501073_0370358 | 3300049589 | Bacteria | 989 |
| 735 | Ga0501074_0124231 | 3300049590 | Bacteria | 1845 |
| 736 | Ga0501075_0000858 | 3300049591 | Bacteria | 19148 |
| 737 | Ga0501076_0002159 | 3300049592 | Bacteria | 13483 |
| 738 | Ga0501077_0004578 | 3300049593 | Bacteria | 8401 |
| 739 | Ga0501235_055770 | 3300049669 | Bacteria | 921 |
| 740 | Ga0501252_030715 | 3300049682 | Bacteria | 743 |
| 741 | Ga0501257_077886 | 3300049686 | Bacteria | 852 |
| 742 | Ga0501225_0016499 | 3300049705 | Bacteria | 2054 |
| 743 | Ga0501225_0052492 | 3300049705 | Bacteria | 1137 |
| 744 | Ga0501079_0002189 | 3300049741 | Bacteria | 14087 |
| 745 | Ga0501080_0009101 | 3300049742 | Bacteria | 9039 |
| 746 | Ga0501080_0050291 | 3300049742 | Bacteria | 3880 |
| 747 | Ga0501080_0851953 | 3300049742 | Bacteria | 797 |
| 748 | Ga0501081_0000359 | 3300049743 | Bacteria | 24723 |
| 749 | Ga0501081_1348875 | 3300049743 | Bacteria | 541 |
| 750 | Ga0501083_0071631 | 3300049744 | Bacteria | 2304 |
| 751 | Ga0501263_040836 | 3300049760 | Bacteria | 681 |
| 752 | Ga0501265_006501 | 3300049762 | Bacteria | 1361 |
| 753 | Ga0501268_035049 | 3300049765 | Bacteria | 924 |
| 754 | Ga0501275_001320 | 3300049772 | Bacteria | 2474 |
| 755 | Ga0501035_0035887 | 3300049822 | Bacteria | 4497 |
| 756 | Ga0501035_0188478 | 3300049822 | Bacteria | 1774 |
| 757 | Ga0501035_0258322 | 3300049822 | Bacteria | 1477 |
| 758 | Ga0501044_0034937 | 3300049823 | Bacteria | 5266 |
| 759 | Ga0501044_0192180 | 3300049823 | Bacteria | 2003 |
| 760 | Ga0501045_0025348 | 3300049824 | Bacteria | 4262 |
| 761 | nmdc:mga00v17_10491_c1 | 3300050491 | Bacteria | 5060 |
| 762 | nmdc:mga00v17_110193_c1 | 3300050491 | Bacteria | 1746 |
| 763 | nmdc:mga00v17_28595_c1 | 3300050491 | Bacteria | 3266 |
| 764 | nmdc:mga00v17_31379_c1 | 3300050491 | Bacteria | 3134 |
| 765 | nmdc:mga00v17_338_c1 | 3300050491 | Bacteria | 22037 |
| 766 | nmdc:mga00v17_608898_c1 | 3300050491 | Bacteria | 704 |
| 767 | nmdc:mga00v17_96017_c1 | 3300050491 | Bacteria | 1867 |
| 768 | nmdc:mga0sz30_209046_c1 | 3300050516 | Bacteria | 867 |
| 769 | Ga0500635_0002379 | 3300053080 | Bacteria | 4652 |
| 770 | Ga0500651_0012399 | 3300053093 | Bacteria | 5168 |
| 771 | Ga0500650_0150147 | 3300053098 | Bacteria | 1078 |
| 772 | Ga0500555_003420 | 3300053103 | Bacteria | 4524 |
| 773 | Ga0500556_0149718 | 3300053104 | Bacteria | 919 |
| 774 | Ga0500652_000207 | 3300053131 | Bacteria | 22588 |
| 775 | Ga0500658_0398222 | 3300053134 | Bacteria | 630 |
| 776 | Ga0500588_0022794 | 3300053146 | Bacteria | 1709 |
| 777 | Ga0500622_0296335 | 3300053156 | Bacteria | 691 |
| 778 | Ga0500634_0005943 | 3300053161 | Bacteria | 5857 |
| 779 | Ga0500609_027077 | 3300053731 | Bacteria | 786 |
| 780 | Ga0501084_0007709 | 3300054114 | Bacteria | 8869 |
| 781 | Ga0501082_0000368 | 3300060353 | Bacteria | 39768 |
| 782 | Ga0530510_0000025 | 3300061734 | Bacteria | 67946 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041498 | Ga0451841_0842399 | Ga0451841_0842399_75_566 | 152 |
| 2 | 3300037466 | Ga0395898_0743001 | Ga0395898_0743001_30_497 | 154 |
| 3 | iso_pu_bacteria | 2671180694 | 2673818988 | 154 |
| 4 | iso_pu_bacteria | 2643221559 | 2643816867 | 155 |
| 5 | iso_pu_bacteria | 2643221573 | 2643881153 | 155 |
| 6 | iso_pu_bacteria | 2643221586 | 2643939288 | 155 |
| 7 | iso_pu_bacteria | 2643221612 | 2644077963 | 155 |
| 8 | iso_pu_bacteria | 2643221720 | 2644661924 | 155 |
| 9 | iso_pu_bacteria | 2643221727 | 2644696264 | 155 |
| 10 | iso_pu_bacteria | 2643221728 | 2644700064 | 155 |
| 11 | iso_pu_bacteria | 2643221731 | 2644715508 | 155 |
| 12 | iso_pu_bacteria | 2643221732 | 2644726812 | 155 |
| 13 | iso_pu_bacteria | 2721755693 | 2723602094 | 155 |
| 14 | iso_pu_bacteria | 2728369359 | 2730138160 | 155 |
| 15 | iso_pu_bacteria | 2738543010 | 2739229854 | 155 |
| 16 | iso_pu_bacteria | 2751185905 | 2753812364 | 155 |
| 17 | iso_pu_bacteria | 2802428803 | 2802439904 | 155 |
| 18 | iso_pu_bacteria | 2818991465 | 2819708976 | 155 |
| 19 | iso_pu_bacteria | 2842882022 | 2842884785 | 155 |
| 20 | iso_pu_bacteria | 2864733723 | 2864738553 | 155 |
| 21 | iso_pu_bacteria | 2889276214 | 2889278163 | 155 |
| 22 | iso_pu_bacteria | 2904113452 | 2904119032 | 155 |
| 23 | iso_pu_bacteria | 2904524088 | 2904524185 | 155 |
| 24 | iso_pu_bacteria | 2904595352 | 2904598090 | 155 |
| 25 | iso_pu_bacteria | 2919143609 | 2919147238 | 155 |
| 26 | iso_pu_bacteria | 2919517244 | 2919519143 | 155 |
| 27 | iso_pu_bacteria | 2919713450 | 2919717298 | 155 |
| 28 | iso_pu_bacteria | 2919720352 | 2919723510 | 155 |
| 29 | iso_pu_bacteria | 2928093941 | 2928095963 | 155 |
| 30 | iso_pu_bacteria | 2929004312 | 2929006667 | 155 |
| 31 | iso_pu_bacteria | 2929206907 | 2929211067 | 155 |
| 32 | iso_pu_bacteria | 2960319331 | 2960319581 | 155 |
| 33 | iso_pu_bacteria | 2960375949 | 2960381208 | 155 |
| 34 | iso_pu_bacteria | 2996706504 | 2996706891 | 155 |
| 35 | iso_pu_bacteria | 3006988479 | 3006988625 | 155 |
| 36 | iso_pu_bacteria | 648028048 | 648168604 | 155 |
| 37 | iso_pu_bacteria | 8022893055 | 8022898489 | 155 |
| 38 | iso_pu_bacteria | 8022914991 | 8022917640 | 155 |
| 39 | iso_pu_bacteria | 8054280661 | 8054280827 | 155 |
| 40 | iso_pu_bacteria | 2540341094 | 2540607848 | 156 |
| 41 | iso_pu_bacteria | 2547132130 | 2547503412 | 156 |
| 42 | iso_pu_bacteria | 2548877040 | 2550903578 | 156 |
| 43 | iso_pu_bacteria | 2571042143 | 2571530584 | 156 |
| 44 | iso_pu_bacteria | 2576861471 | 2578459803 | 156 |
| 45 | iso_pu_bacteria | 2599185292 | 2599904398 | 156 |
| 46 | iso_pu_bacteria | 2643221569 | 2643863656 | 156 |
| 47 | iso_pu_bacteria | 2643221593 | 2643977471 | 156 |
| 48 | iso_pu_bacteria | 2643221594 | 2643982858 | 156 |
| 49 | iso_pu_bacteria | 2643221621 | 2644123315 | 156 |
| 50 | iso_pu_bacteria | 2747842428 | 2747949660 | 156 |
| 51 | iso_pu_bacteria | 2747842501 | 2748018993 | 156 |
| 52 | iso_pu_bacteria | 2765235840 | 2765577503 | 156 |
| 53 | iso_pu_bacteria | 2808606395 | 2809033448 | 156 |
| 54 | iso_pu_bacteria | 2808606399 | 2809056215 | 156 |
| 55 | iso_pu_bacteria | 2816332141 | 2816519273 | 156 |
| 56 | iso_pu_bacteria | 2818991457 | 2819662474 | 156 |
| 57 | iso_pu_bacteria | 2842391507 | 2842392499 | 156 |
| 58 | iso_pu_bacteria | 2842757796 | 2842761389 | 156 |
| 59 | iso_pu_bacteria | 2852649853 | 2852653539 | 156 |
| 60 | iso_pu_bacteria | 2852684882 | 2852687804 | 156 |
| 61 | iso_pu_bacteria | 2857442823 | 2857445828 | 156 |
| 62 | iso_pu_bacteria | 2857537821 | 2857538048 | 156 |
| 63 | iso_pu_bacteria | 2857542790 | 2857543852 | 156 |
| 64 | iso_pu_bacteria | 2858950400 | 2858955450 | 156 |
| 65 | iso_pu_bacteria | 2860837431 | 2860840626 | 156 |
| 66 | iso_pu_bacteria | 2874220319 | 2874224354 | 156 |
| 67 | iso_pu_bacteria | 2894414249 | 2894416581 | 156 |
| 68 | iso_pu_bacteria | 2907202186 | 2907206216 | 156 |
| 69 | iso_pu_bacteria | 2919089067 | 2919091964 | 156 |
| 70 | iso_pu_bacteria | 2919130084 | 2919132023 | 156 |
| 71 | iso_pu_bacteria | 2919134579 | 2919135224 | 156 |
| 72 | iso_pu_bacteria | 2919513703 | 2919514868 | 156 |
| 73 | iso_pu_bacteria | 2919675420 | 2919677346 | 156 |
| 74 | iso_pu_bacteria | 2928496128 | 2928499499 | 156 |
| 75 | iso_pu_bacteria | 2929195423 | 2929199238 | 156 |
| 76 | iso_pu_bacteria | 2931380184 | 2931382242 | 156 |
| 77 | iso_pu_bacteria | 2937610967 | 2937610975 | 156 |
| 78 | iso_pu_bacteria | 2939589442 | 2939592406 | 156 |
| 79 | iso_pu_bacteria | 2939622612 | 2939624729 | 156 |
| 80 | iso_pu_bacteria | 2939626828 | 2939630314 | 156 |
| 81 | iso_pu_bacteria | 2941475908 | 2941477540 | 156 |
| 82 | iso_pu_bacteria | 2941479691 | 2941484296 | 156 |
| 83 | iso_pu_bacteria | 2941489479 | 2941493310 | 156 |
| 84 | iso_pu_bacteria | 2961047084 | 2961051118 | 156 |
| 85 | iso_pu_bacteria | 2961064222 | 2961065417 | 156 |
| 86 | iso_pu_bacteria | 2962290636 | 2962293837 | 156 |
| 87 | iso_pu_bacteria | 2969136845 | 2969139831 | 156 |
| 88 | iso_pu_bacteria | 2969765954 | 2969769701 | 156 |
| 89 | iso_pu_bacteria | 2969770375 | 2969772764 | 156 |
| 90 | iso_pu_bacteria | 2974307012 | 2974310240 | 156 |
| 91 | iso_pu_bacteria | 2977247770 | 2977250967 | 156 |
| 92 | iso_pu_bacteria | 2980492589 | 2980495620 | 156 |
| 93 | iso_pu_bacteria | 2984514374 | 2984514540 | 156 |
| 94 | iso_pu_bacteria | 2987605356 | 2987608888 | 156 |
| 95 | iso_pu_bacteria | 2995948881 | 2995953375 | 156 |
| 96 | iso_pu_bacteria | 8003014200 | 8003017515 | 156 |
| 97 | iso_pu_bacteria | 8021622325 | 8021625253 | 156 |
| 98 | iso_pu_bacteria | 8021626552 | 8021627528 | 156 |
| 99 | iso_pu_bacteria | 8021648035 | 8021649218 | 156 |
| 100 | iso_pu_bacteria | 8022653035 | 8022654784 | 156 |
| 101 | iso_pu_bacteria | 8054465665 | 8054465911 | 156 |
| 102 | 3300031727 | Ga0316576_10321852 | Ga0316576_103218521 | 157 |
| 103 | 3300035398 | Ga0316574_0244884 | Ga0316574_0244884_575_1057 | 157 |
| 104 | 3300035398 | Ga0316574_0461989 | Ga0316574_0461989_235_723 | 157 |
| 105 | 3300036712 | Ga0316584_0515278 | Ga0316584_0515278_326_808 | 157 |
| 106 | 3300041441 | Ga0451787_691700 | Ga0451787_691700_422_907 | 157 |
| 107 | iso_pu_bacteria | 2551306166 | 2552111426 | 157 |
| 108 | iso_pu_bacteria | 2571042365 | 2572255915 | 157 |
| 109 | iso_pu_bacteria | 2643221579 | 2643908336 | 157 |
| 110 | iso_pu_bacteria | 2643221581 | 2643914639 | 157 |
| 111 | iso_pu_bacteria | 2842780639 | 2842782670 | 157 |
| 112 | iso_pu_bacteria | 2842888712 | 2842890266 | 157 |
| 113 | iso_pu_bacteria | 2895498888 | 2895501447 | 157 |
| 114 | iso_pu_bacteria | 2895511927 | 2895514590 | 157 |
| 115 | iso_pu_bacteria | 2895522137 | 2895523928 | 157 |
| 116 | iso_pu_bacteria | 2895525241 | 2895528272 | 157 |
| 117 | iso_pu_bacteria | 2923516293 | 2923517067 | 157 |
| 118 | iso_pu_bacteria | 8002869464 | 8002870896 | 157 |
| 119 | 3300005331 | Ga0070670_100050456 | Ga0070670_1000504563 | 158 |
| 120 | 3300005335 | Ga0070666_10274967 | Ga0070666_102749672 | 158 |
| 121 | 3300005353 | Ga0070669_100033911 | Ga0070669_1000339113 | 158 |
| 122 | 3300005354 | Ga0070675_100442360 | Ga0070675_1004423602 | 158 |
| 123 | 3300005355 | Ga0070671_100554437 | Ga0070671_1005544371 | 158 |
| 124 | 3300005356 | Ga0070674_100014888 | Ga0070674_1000148884 | 158 |
| 125 | 3300005367 | Ga0070667_100887726 | Ga0070667_1008877262 | 158 |
| 126 | 3300005459 | Ga0068867_100127289 | Ga0068867_1001272891 | 158 |
| 127 | 3300005543 | Ga0070672_100001204 | Ga0070672_1000012045 | 158 |
| 128 | 3300005618 | Ga0068864_100241186 | Ga0068864_1002411862 | 158 |
| 129 | 3300009176 | Ga0105242_10329799 | Ga0105242_103297992 | 158 |
| 130 | 3300013297 | Ga0157378_10633571 | Ga0157378_106335712 | 158 |
| 131 | 3300013308 | Ga0157375_10213409 | Ga0157375_102134092 | 158 |
| 132 | 3300025903 | Ga0207680_10652729 | Ga0207680_106527292 | 158 |
| 133 | 3300025920 | Ga0207649_11136356 | Ga0207649_111363562 | 158 |
| 134 | 3300025925 | Ga0207650_10033189 | Ga0207650_100331893 | 158 |
| 135 | 3300025931 | Ga0207644_10560895 | Ga0207644_105608952 | 158 |
| 136 | 3300025937 | Ga0207669_10049010 | Ga0207669_100490102 | 158 |
| 137 | 3300025940 | Ga0207691_10018899 | Ga0207691_100188992 | 158 |
| 138 | 3300025986 | Ga0207658_10332020 | Ga0207658_103320202 | 158 |
| 139 | 3300026089 | Ga0207648_10444570 | Ga0207648_104445702 | 158 |
| 140 | 3300041512 | Ga0451853_2512039 | Ga0451853_2512039_10_492 | 158 |
| 141 | 3300046537 | Ga0495598_0024218 | Ga0495598_0024218_194_691 | 158 |
| 142 | 3300046539 | Ga0495621_0025179 | Ga0495621_0025179_407_904 | 158 |
| 143 | 3300048911 | Ga0496108_0909007 | Ga0496108_0909007_213_695 | 158 |
| 144 | iso_pu_bacteria | 2818991441 | 2819568830 | 158 |
| 145 | 3300005327 | Ga0070658_10013884 | Ga0070658_100138847 | 159 |
| 146 | 3300005336 | Ga0070680_100027857 | Ga0070680_1000278574 | 159 |
| 147 | 3300005341 | Ga0070691_10001219 | Ga0070691_100012196 | 159 |
| 148 | 3300005458 | Ga0070681_10000625 | Ga0070681_100006253 | 159 |
| 149 | 3300005530 | Ga0070679_100016885 | Ga0070679_1000168857 | 159 |
| 150 | 3300005548 | Ga0070665_100005654 | Ga0070665_10000565417 | 159 |
| 151 | 3300005563 | Ga0068855_100026332 | Ga0068855_1000263327 | 159 |
| 152 | 3300005614 | Ga0068856_100079882 | Ga0068856_1000798823 | 159 |
| 153 | 3300006175 | Ga0070712_100259432 | Ga0070712_1002594322 | 159 |
| 154 | 3300009093 | Ga0105240_10015095 | Ga0105240_100150959 | 159 |
| 155 | 3300009551 | Ga0105238_10194061 | Ga0105238_101940612 | 159 |
| 156 | 3300010375 | Ga0105239_12211901 | Ga0105239_122119011 | 159 |
| 157 | 3300025225 | Ga0209566_100122 | Ga0209566_10012223 | 159 |
| 158 | 3300025225 | Ga0209566_111607 | Ga0209566_1116072 | 159 |
| 159 | 3300025304 | Ga0209257_1071658 | Ga0209257_10716581 | 159 |
| 160 | 3300025912 | Ga0207707_10001167 | Ga0207707_100011672 | 159 |
| 161 | 3300025913 | Ga0207695_10151847 | Ga0207695_101518472 | 159 |
| 162 | 3300025915 | Ga0207693_10136936 | Ga0207693_101369363 | 159 |
| 163 | 3300025917 | Ga0207660_10007789 | Ga0207660_100077893 | 159 |
| 164 | 3300025921 | Ga0207652_10003496 | Ga0207652_1000349611 | 159 |
| 165 | 3300025924 | Ga0207694_10324880 | Ga0207694_103248802 | 159 |
| 166 | 3300025925 | Ga0207650_10129489 | Ga0207650_101294893 | 159 |
| 167 | 3300025949 | Ga0207667_10040754 | Ga0207667_100407542 | 159 |
| 168 | 3300025981 | Ga0207640_11214820 | Ga0207640_112148201 | 159 |
| 169 | 3300026078 | Ga0207702_10175258 | Ga0207702_101752582 | 159 |
| 170 | 3300028379 | Ga0268266_10001436 | Ga0268266_1000143619 | 159 |
| 171 | 3300031507 | Ga0307509_10753553 | Ga0307509_107535532 | 159 |
| 172 | 3300032002 | Ga0307416_100343905 | Ga0307416_1003439052 | 159 |
| 173 | 3300037312 | Ga0395899_0352222 | Ga0395899_0352222_173_652 | 159 |
| 174 | 3300041492 | Ga0451835_1055552 | Ga0451835_1055552_37_549 | 159 |
| 175 | 3300044712 | Ga0453684_0000316 | Ga0453684_0000316_202126_202608 | 159 |
| 176 | 3300045051 | Ga0451576_0000128 | Ga0451576_0000128_189740_190222 | 159 |
| 177 | 3300045976 | Ga0466967_0218258 | Ga0466967_0218258_181_681 | 159 |
| 178 | 3300046457 | Ga0495590_0024956 | Ga0495590_0024956_481_960 | 159 |
| 179 | 3300046557 | Ga0495622_0135747 | Ga0495622_0135747_88_570 | 159 |
| 180 | 3300046810 | Ga0495660_0113172 | Ga0495660_0113172_121_600 | 159 |
| 181 | 3300046810 | Ga0495660_0155429 | Ga0495660_0155429_525_1004 | 159 |
| 182 | 3300048904 | Ga0496101_1336992 | Ga0496101_1336992_48_530 | 159 |
| 183 | 3300048916 | Ga0496113_0491132 | Ga0496113_0491132_423_923 | 159 |
| 184 | 3300048919 | Ga0496116_0042398 | Ga0496116_0042398_1330_1809 | 159 |
| 185 | 3300048921 | Ga0496118_0009765 | Ga0496118_0009765_7684_8163 | 159 |
| 186 | 3300048921 | Ga0496118_0546112 | Ga0496118_0546112_55_534 | 159 |
| 187 | 3300048922 | Ga0496119_0016440 | Ga0496119_0016440_3492_3971 | 159 |
| 188 | 3300048923 | Ga0496120_0003036 | Ga0496120_0003036_15188_15667 | 159 |
| 189 | 3300048924 | Ga0496121_0005386 | Ga0496121_0005386_14745_15224 | 159 |
| 190 | 3300048924 | Ga0496121_0035993 | Ga0496121_0035993_3827_4306 | 159 |
| 191 | 3300048924 | Ga0496121_0080844 | Ga0496121_0080844_1062_1541 | 159 |
| 192 | 3300048925 | Ga0496122_0023374 | Ga0496122_0023374_2600_3079 | 159 |
| 193 | 3300048925 | Ga0496122_0415413 | Ga0496122_0415413_159_638 | 159 |
| 194 | 3300048926 | Ga0496123_0023409 | Ga0496123_0023409_3631_4110 | 159 |
| 195 | 3300048927 | Ga0496124_0085690 | Ga0496124_0085690_305_784 | 159 |
| 196 | 3300048928 | Ga0496125_0001304 | Ga0496125_0001304_9385_9864 | 159 |
| 197 | 3300048929 | Ga0496126_0011601 | Ga0496126_0011601_5992_6471 | 159 |
| 198 | 3300049534 | Ga0501318_083574 | Ga0501318_083574_26_508 | 159 |
| 199 | 3300053093 | Ga0500651_0012399 | Ga0500651_0012399_1321_1815 | 159 |
| 200 | 3300053098 | Ga0500650_0150147 | Ga0500650_0150147_141_635 | 159 |
| 201 | 3300053103 | Ga0500555_003420 | Ga0500555_003420_3583_4077 | 159 |
| 202 | 3300053104 | Ga0500556_0149718 | Ga0500556_0149718_393_887 | 159 |
| 203 | 3300053146 | Ga0500588_0022794 | Ga0500588_0022794_108_602 | 159 |
| 204 | 2162886007 | SwRhRL2b_contig_3802179 | SwRhRL2b_0364.00006860 | 160 |
| 205 | 2162886007 | SwRhRL2b_contig_46047 | SwRhRL2b_0932.00007830 | 160 |
| 206 | 3300002773 | JGI25152J39213_1000025 | JGI25152J39213_100002544 | 160 |
| 207 | 3300002774 | JGI25150J39212_1000066 | JGI25150J39212_100006655 | 160 |
| 208 | 3300003187 | JGI25151J46595_10000117 | JGI25151J46595_1000011784 | 160 |
| 209 | 3300003187 | JGI25151J46595_10000139 | JGI25151J46595_1000013957 | 160 |
| 210 | 3300003187 | JGI25151J46595_10016266 | JGI25151J46595_100162662 | 160 |
| 211 | 3300003187 | JGI25151J46595_10019101 | JGI25151J46595_100191012 | 160 |
| 212 | 3300003187 | JGI25151J46595_10038704 | JGI25151J46595_100387043 | 160 |
| 213 | 3300003215 | JGI25153J46596_10000101 | JGI25153J46596_1000010157 | 160 |
| 214 | 3300003320 | rootH2_10038994 | rootH2_100389944 | 160 |
| 215 | 3300003751 | Ga0055538_1000164 | Ga0055538_10001645 | 160 |
| 216 | 3300003761 | Ga0055535_1002595 | Ga0055535_10025958 | 160 |
| 217 | 3300003761 | Ga0055535_1009874 | Ga0055535_10098743 | 160 |
| 218 | 3300003771 | Ga0055526_1000183 | Ga0055526_100018335 | 160 |
| 219 | 3300003771 | Ga0055526_1001045 | Ga0055526_10010459 | 160 |
| 220 | 3300003771 | Ga0055526_1004844 | Ga0055526_10048444 | 160 |
| 221 | 3300003773 | Ga0055537_1000028 | Ga0055537_100002892 | 160 |
| 222 | 3300003773 | Ga0055537_1000314 | Ga0055537_100031435 | 160 |
| 223 | 3300003775 | Ga0055524_1000461 | Ga0055524_10004612 | 160 |
| 224 | 3300003775 | Ga0055524_1018198 | Ga0055524_10181981 | 160 |
| 225 | 3300003781 | Ga0055536_1001419 | Ga0055536_10014193 | 160 |
| 226 | 3300003781 | Ga0055536_1001978 | Ga0055536_10019788 | 160 |
| 227 | 3300003781 | Ga0055536_1002334 | Ga0055536_10023345 | 160 |
| 228 | 3300003781 | Ga0055536_1019619 | Ga0055536_10196192 | 160 |
| 229 | 3300003781 | Ga0055536_1022683 | Ga0055536_10226833 | 160 |
| 230 | 3300003781 | Ga0055536_1030270 | Ga0055536_10302701 | 160 |
| 231 | 3300003784 | Ga0055534_1000180 | Ga0055534_100018026 | 160 |
| 232 | 3300003784 | Ga0055534_1000302 | Ga0055534_10003022 | 160 |
| 233 | 3300003790 | Ga0055528_1000172 | Ga0055528_100017235 | 160 |
| 234 | 3300003790 | Ga0055528_1000262 | Ga0055528_100026223 | 160 |
| 235 | 3300003791 | Ga0055530_10000784 | Ga0055530_1000078410 | 160 |
| 236 | 3300003791 | Ga0055530_10001075 | Ga0055530_1000107513 | 160 |
| 237 | 3300003791 | Ga0055530_10002332 | Ga0055530_1000233212 | 160 |
| 238 | 3300003791 | Ga0055530_10049130 | Ga0055530_100491302 | 160 |
| 239 | 3300003791 | Ga0055530_10080760 | Ga0055530_100807601 | 160 |
| 240 | 3300003794 | Ga0055531_10010004 | Ga0055531_100100044 | 160 |
| 241 | 3300003794 | Ga0055531_10010801 | Ga0055531_100108014 | 160 |
| 242 | 3300003794 | Ga0055531_10014958 | Ga0055531_100149582 | 160 |
| 243 | 3300003794 | Ga0055531_10026654 | Ga0055531_100266543 | 160 |
| 244 | 3300003794 | Ga0055531_10026698 | Ga0055531_100266982 | 160 |
| 245 | 3300003794 | Ga0055531_10034540 | Ga0055531_100345403 | 160 |
| 246 | 3300003841 | Ga0055541_1000253 | Ga0055541_10002531 | 160 |
| 247 | 3300003841 | Ga0055541_1020817 | Ga0055541_10208172 | 160 |
| 248 | 3300003856 | Ga0058692_1000026 | Ga0058692_1000026119 | 160 |
| 249 | 3300003856 | Ga0058692_1000040 | Ga0058692_100004042 | 160 |
| 250 | 3300005262 | Ga0065165_1016213 | Ga0065165_10162134 | 160 |
| 251 | 3300005288 | Ga0065714_10275140 | Ga0065714_102751402 | 160 |
| 252 | 3300005289 | Ga0065704_10033986 | Ga0065704_100339861 | 160 |
| 253 | 3300005289 | Ga0065704_10071027 | Ga0065704_100710274 | 160 |
| 254 | 3300005289 | Ga0065704_10098809 | Ga0065704_100988093 | 160 |
| 255 | 3300005289 | Ga0065704_10457457 | Ga0065704_104574572 | 160 |
| 256 | 3300005293 | Ga0065715_10161706 | Ga0065715_101617062 | 160 |
| 257 | 3300005331 | Ga0070670_100011457 | Ga0070670_1000114575 | 160 |
| 258 | 3300005331 | Ga0070670_100294827 | Ga0070670_1002948272 | 160 |
| 259 | 3300005331 | Ga0070670_100317434 | Ga0070670_1003174342 | 160 |
| 260 | 3300005331 | Ga0070670_101153080 | Ga0070670_1011530801 | 160 |
| 261 | 3300005336 | Ga0070680_100168041 | Ga0070680_1001680413 | 160 |
| 262 | 3300005336 | Ga0070680_100504777 | Ga0070680_1005047772 | 160 |
| 263 | 3300005339 | Ga0070660_100437854 | Ga0070660_1004378541 | 160 |
| 264 | 3300005347 | Ga0070668_100008075 | Ga0070668_1000080757 | 160 |
| 265 | 3300005347 | Ga0070668_100056289 | Ga0070668_1000562892 | 160 |
| 266 | 3300005347 | Ga0070668_100318540 | Ga0070668_1003185402 | 160 |
| 267 | 3300005353 | Ga0070669_100011958 | Ga0070669_1000119584 | 160 |
| 268 | 3300005353 | Ga0070669_100292934 | Ga0070669_1002929342 | 160 |
| 269 | 3300005353 | Ga0070669_101526823 | Ga0070669_1015268231 | 160 |
| 270 | 3300005354 | Ga0070675_100106930 | Ga0070675_1001069303 | 160 |
| 271 | 3300005354 | Ga0070675_100250156 | Ga0070675_1002501561 | 160 |
| 272 | 3300005354 | Ga0070675_100841081 | Ga0070675_1008410811 | 160 |
| 273 | 3300005355 | Ga0070671_100109163 | Ga0070671_1001091632 | 160 |
| 274 | 3300005366 | Ga0070659_101358036 | Ga0070659_1013580361 | 160 |
| 275 | 3300005440 | Ga0070705_100202730 | Ga0070705_1002027302 | 160 |
| 276 | 3300005456 | Ga0070678_100061918 | Ga0070678_1000619182 | 160 |
| 277 | 3300005457 | Ga0070662_100766456 | Ga0070662_1007664561 | 160 |
| 278 | 3300005458 | Ga0070681_10191696 | Ga0070681_101916963 | 160 |
| 279 | 3300005530 | Ga0070679_100106292 | Ga0070679_1001062922 | 160 |
| 280 | 3300005530 | Ga0070679_100326324 | Ga0070679_1003263242 | 160 |
| 281 | 3300005543 | Ga0070672_100515988 | Ga0070672_1005159881 | 160 |
| 282 | 3300005543 | Ga0070672_101458262 | Ga0070672_1014582622 | 160 |
| 283 | 3300005547 | Ga0070693_100018623 | Ga0070693_1000186234 | 160 |
| 284 | 3300005548 | Ga0070665_100007318 | Ga0070665_1000073184 | 160 |
| 285 | 3300005548 | Ga0070665_100104205 | Ga0070665_1001042054 | 160 |
| 286 | 3300005548 | Ga0070665_100596980 | Ga0070665_1005969802 | 160 |
| 287 | 3300005548 | Ga0070665_102291851 | Ga0070665_1022918511 | 160 |
| 288 | 3300005563 | Ga0068855_100555681 | Ga0068855_1005556812 | 160 |
| 289 | 3300005564 | Ga0070664_100502989 | Ga0070664_1005029892 | 160 |
| 290 | 3300005577 | Ga0068857_100054874 | Ga0068857_1000548744 | 160 |
| 291 | 3300005577 | Ga0068857_100442624 | Ga0068857_1004426242 | 160 |
| 292 | 3300005616 | Ga0068852_100700428 | Ga0068852_1007004282 | 160 |
| 293 | 3300005719 | Ga0068861_101559593 | Ga0068861_1015595931 | 160 |
| 294 | 3300006038 | Ga0075365_10177577 | Ga0075365_101775772 | 160 |
| 295 | 3300006038 | Ga0075365_10633675 | Ga0075365_106336752 | 160 |
| 296 | 3300006042 | Ga0075368_10047232 | Ga0075368_100472322 | 160 |
| 297 | 3300006048 | Ga0075363_100130488 | Ga0075363_1001304881 | 160 |
| 298 | 3300006051 | Ga0075364_10000005 | Ga0075364_1000000554 | 160 |
| 299 | 3300006051 | Ga0075364_10033668 | Ga0075364_100336684 | 160 |
| 300 | 3300006051 | Ga0075364_10039167 | Ga0075364_100391672 | 160 |
| 301 | 3300006051 | Ga0075364_10118436 | Ga0075364_101184362 | 160 |
| 302 | 3300006051 | Ga0075364_10204290 | Ga0075364_102042902 | 160 |
| 303 | 3300006051 | Ga0075364_10312604 | Ga0075364_103126042 | 160 |
| 304 | 3300006177 | Ga0075362_10071327 | Ga0075362_100713272 | 160 |
| 305 | 3300006186 | Ga0075369_10129978 | Ga0075369_101299782 | 160 |
| 306 | 3300009011 | Ga0105251_10001131 | Ga0105251_1000113112 | 160 |
| 307 | 3300009011 | Ga0105251_10004086 | Ga0105251_1000408611 | 160 |
| 308 | 3300009036 | Ga0105244_10018430 | Ga0105244_100184304 | 160 |
| 309 | 3300009036 | Ga0105244_10070874 | Ga0105244_100708743 | 160 |
| 310 | 3300009036 | Ga0105244_10319381 | Ga0105244_103193812 | 160 |
| 311 | 3300009093 | Ga0105240_10029298 | Ga0105240_100292986 | 160 |
| 312 | 3300009098 | Ga0105245_10155857 | Ga0105245_101558572 | 160 |
| 313 | 3300009101 | Ga0105247_10650881 | Ga0105247_106508811 | 160 |
| 314 | 3300009148 | Ga0105243_10009739 | Ga0105243_100097394 | 160 |
| 315 | 3300009148 | Ga0105243_10032820 | Ga0105243_100328202 | 160 |
| 316 | 3300009174 | Ga0105241_10062611 | Ga0105241_100626114 | 160 |
| 317 | 3300009176 | Ga0105242_10970637 | Ga0105242_109706372 | 160 |
| 318 | 3300009177 | Ga0105248_10002072 | Ga0105248_100020724 | 160 |
| 319 | 3300009177 | Ga0105248_11043579 | Ga0105248_110435792 | 160 |
| 320 | 3300009177 | Ga0105248_12362639 | Ga0105248_123626392 | 160 |
| 321 | 3300009979 | Ga0105032_101190 | Ga0105032_1011903 | 160 |
| 322 | 3300009984 | Ga0105029_110633 | Ga0105029_1106331 | 160 |
| 323 | 3300010375 | Ga0105239_10016256 | Ga0105239_100162567 | 160 |
| 324 | 3300012482 | Ga0157318_1004328 | Ga0157318_10043282 | 160 |
| 325 | 3300012497 | Ga0157319_1015394 | Ga0157319_10153941 | 160 |
| 326 | 3300012500 | Ga0157314_1001703 | Ga0157314_10017032 | 160 |
| 327 | 3300012515 | Ga0157338_1070602 | Ga0157338_10706021 | 160 |
| 328 | 3300013100 | Ga0157373_10068840 | Ga0157373_100688403 | 160 |
| 329 | 3300013102 | Ga0157371_10000658 | Ga0157371_1000065815 | 160 |
| 330 | 3300013102 | Ga0157371_10043343 | Ga0157371_100433433 | 160 |
| 331 | 3300013102 | Ga0157371_10316042 | Ga0157371_103160422 | 160 |
| 332 | 3300013102 | Ga0157371_10574622 | Ga0157371_105746221 | 160 |
| 333 | 3300013104 | Ga0157370_10016314 | Ga0157370_100163145 | 160 |
| 334 | 3300013104 | Ga0157370_10239140 | Ga0157370_102391403 | 160 |
| 335 | 3300013104 | Ga0157370_10271084 | Ga0157370_102710843 | 160 |
| 336 | 3300013105 | Ga0157369_10020199 | Ga0157369_100201992 | 160 |
| 337 | 3300013105 | Ga0157369_10070214 | Ga0157369_100702142 | 160 |
| 338 | 3300013296 | Ga0157374_10144870 | Ga0157374_101448704 | 160 |
| 339 | 3300013297 | Ga0157378_10091347 | Ga0157378_100913473 | 160 |
| 340 | 3300013307 | Ga0157372_10111602 | Ga0157372_101116024 | 160 |
| 341 | 3300013308 | Ga0157375_10029463 | Ga0157375_100294633 | 160 |
| 342 | 3300013308 | Ga0157375_10502640 | Ga0157375_105026401 | 160 |
| 343 | 3300014326 | Ga0157380_10097097 | Ga0157380_100970972 | 160 |
| 344 | 3300014326 | Ga0157380_10935501 | Ga0157380_109355012 | 160 |
| 345 | 3300014497 | Ga0182008_10000730 | Ga0182008_1000073015 | 160 |
| 346 | 3300014497 | Ga0182008_10013902 | Ga0182008_100139023 | 160 |
| 347 | 3300014497 | Ga0182008_10024004 | Ga0182008_100240042 | 160 |
| 348 | 3300015261 | Ga0182006_1015620 | Ga0182006_10156204 | 160 |
| 349 | 3300015261 | Ga0182006_1065014 | Ga0182006_10650143 | 160 |
| 350 | 3300015262 | Ga0182007_10000025 | Ga0182007_1000002519 | 160 |
| 351 | 3300015265 | Ga0182005_1000063 | Ga0182005_100006334 | 160 |
| 352 | 3300015265 | Ga0182005_1004147 | Ga0182005_10041471 | 160 |
| 353 | 3300015689 | Ga0183360_10003 | Ga0183360_10003157 | 160 |
| 354 | 3300017792 | Ga0163161_10004635 | Ga0163161_100046353 | 160 |
| 355 | 3300017792 | Ga0163161_10012078 | Ga0163161_100120783 | 160 |
| 356 | 3300017792 | Ga0163161_10040670 | Ga0163161_100406704 | 160 |
| 357 | 3300017792 | Ga0163161_10161692 | Ga0163161_101616922 | 160 |
| 358 | 3300017792 | Ga0163161_10343145 | Ga0163161_103431452 | 160 |
| 359 | 3300017792 | Ga0163161_10562756 | Ga0163161_105627562 | 160 |
| 360 | 3300021388 | Ga0213875_10329094 | Ga0213875_103290941 | 160 |
| 361 | 3300025224 | Ga0209784_100084 | Ga0209784_10008431 | 160 |
| 362 | 3300025225 | Ga0209566_100092 | Ga0209566_10009291 | 160 |
| 363 | 3300025229 | Ga0209147_112588 | Ga0209147_1125881 | 160 |
| 364 | 3300025242 | Ga0209258_101493 | Ga0209258_1014932 | 160 |
| 365 | 3300025245 | Ga0207425_1000040 | Ga0207425_1000040175 | 160 |
| 366 | 3300025245 | Ga0207425_1024176 | Ga0207425_10241761 | 160 |
| 367 | 3300025245 | Ga0207425_1049150 | Ga0207425_10491502 | 160 |
| 368 | 3300025258 | Ga0209129_1000011 | Ga0209129_100001187 | 160 |
| 369 | 3300025263 | Ga0209565_1000002 | Ga0209565_1000002157 | 160 |
| 370 | 3300025263 | Ga0209565_1000037 | Ga0209565_1000037107 | 160 |
| 371 | 3300025263 | Ga0209565_1024592 | Ga0209565_10245922 | 160 |
| 372 | 3300025273 | Ga0209673_1000002 | Ga0209673_1000002157 | 160 |
| 373 | 3300025273 | Ga0209673_1000032 | Ga0209673_1000032211 | 160 |
| 374 | 3300025273 | Ga0209673_1009916 | Ga0209673_10099163 | 160 |
| 375 | 3300025273 | Ga0209673_1056213 | Ga0209673_10562132 | 160 |
| 376 | 3300025284 | Ga0209130_1007940 | Ga0209130_10079401 | 160 |
| 377 | 3300025291 | Ga0209675_1000002 | Ga0209675_1000002157 | 160 |
| 378 | 3300025291 | Ga0209675_1000020 | Ga0209675_1000020142 | 160 |
| 379 | 3300025291 | Ga0209675_1010710 | Ga0209675_10107106 | 160 |
| 380 | 3300025291 | Ga0209675_1019174 | Ga0209675_10191742 | 160 |
| 381 | 3300025292 | Ga0209676_1000063 | Ga0209676_1000063230 | 160 |
| 382 | 3300025292 | Ga0209676_1000149 | Ga0209676_100014927 | 160 |
| 383 | 3300025292 | Ga0209676_1000199 | Ga0209676_1000199101 | 160 |
| 384 | 3300025292 | Ga0209676_1000610 | Ga0209676_100061013 | 160 |
| 385 | 3300025292 | Ga0209676_1004196 | Ga0209676_10041964 | 160 |
| 386 | 3300025292 | Ga0209676_1011454 | Ga0209676_10114544 | 160 |
| 387 | 3300025292 | Ga0209676_1017123 | Ga0209676_10171232 | 160 |
| 388 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002710 | 160 |
| 389 | 3300025294 | Ga0209025_1000030 | Ga0209025_1000030345 | 160 |
| 390 | 3300025294 | Ga0209025_1006488 | Ga0209025_10064886 | 160 |
| 391 | 3300025294 | Ga0209025_1007306 | Ga0209025_10073064 | 160 |
| 392 | 3300025294 | Ga0209025_1009758 | Ga0209025_10097586 | 160 |
| 393 | 3300025294 | Ga0209025_1012032 | Ga0209025_10120323 | 160 |
| 394 | 3300025294 | Ga0209025_1033326 | Ga0209025_10333262 | 160 |
| 395 | 3300025294 | Ga0209025_1039683 | Ga0209025_10396834 | 160 |
| 396 | 3300025294 | Ga0209025_1043666 | Ga0209025_10436662 | 160 |
| 397 | 3300025294 | Ga0209025_1097167 | Ga0209025_10971672 | 160 |
| 398 | 3300025295 | Ga0209564_1000004 | Ga0209564_1000004158 | 160 |
| 399 | 3300025295 | Ga0209564_1000951 | Ga0209564_100095121 | 160 |
| 400 | 3300025295 | Ga0209564_1004958 | Ga0209564_10049582 | 160 |
| 401 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003717 | 160 |
| 402 | 3300025297 | Ga0209758_1012563 | Ga0209758_10125633 | 160 |
| 403 | 3300025298 | Ga0209050_1000189 | Ga0209050_100018948 | 160 |
| 404 | 3300025298 | Ga0209050_1000199 | Ga0209050_100019910 | 160 |
| 405 | 3300025298 | Ga0209050_1000794 | Ga0209050_100079412 | 160 |
| 406 | 3300025298 | Ga0209050_1001310 | Ga0209050_100131021 | 160 |
| 407 | 3300025298 | Ga0209050_1007848 | Ga0209050_10078484 | 160 |
| 408 | 3300025298 | Ga0209050_1047328 | Ga0209050_10473282 | 160 |
| 409 | 3300025299 | Ga0209256_1000004 | Ga0209256_1000004158 | 160 |
| 410 | 3300025299 | Ga0209256_1001838 | Ga0209256_10018389 | 160 |
| 411 | 3300025299 | Ga0209256_1002507 | Ga0209256_10025073 | 160 |
| 412 | 3300025299 | Ga0209256_1003521 | Ga0209256_10035214 | 160 |
| 413 | 3300025299 | Ga0209256_1006653 | Ga0209256_10066534 | 160 |
| 414 | 3300025299 | Ga0209256_1048142 | Ga0209256_10481421 | 160 |
| 415 | 3300025303 | Ga0209051_1013273 | Ga0209051_10132733 | 160 |
| 416 | 3300025304 | Ga0209257_1000078 | Ga0209257_100007832 | 160 |
| 417 | 3300025304 | Ga0209257_1000086 | Ga0209257_1000086243 | 160 |
| 418 | 3300025304 | Ga0209257_1001558 | Ga0209257_100155815 | 160 |
| 419 | 3300025304 | Ga0209257_1001969 | Ga0209257_10019693 | 160 |
| 420 | 3300025304 | Ga0209257_1002257 | Ga0209257_100225710 | 160 |
| 421 | 3300025304 | Ga0209257_1003701 | Ga0209257_100370112 | 160 |
| 422 | 3300025304 | Ga0209257_1012493 | Ga0209257_10124933 | 160 |
| 423 | 3300025304 | Ga0209257_1023282 | Ga0209257_10232823 | 160 |
| 424 | 3300025304 | Ga0209257_1025141 | Ga0209257_10251413 | 160 |
| 425 | 3300025728 | Ga0207655_1068386 | Ga0207655_10683861 | 160 |
| 426 | 3300025735 | Ga0207713_1000253 | Ga0207713_100025313 | 160 |
| 427 | 3300025735 | Ga0207713_1023662 | Ga0207713_10236623 | 160 |
| 428 | 3300025909 | Ga0207705_10078723 | Ga0207705_100787232 | 160 |
| 429 | 3300025911 | Ga0207654_10020676 | Ga0207654_100206763 | 160 |
| 430 | 3300025912 | Ga0207707_10295362 | Ga0207707_102953622 | 160 |
| 431 | 3300025913 | Ga0207695_10051073 | Ga0207695_100510734 | 160 |
| 432 | 3300025917 | Ga0207660_10358631 | Ga0207660_103586312 | 160 |
| 433 | 3300025919 | Ga0207657_10025581 | Ga0207657_100255813 | 160 |
| 434 | 3300025921 | Ga0207652_10111470 | Ga0207652_101114702 | 160 |
| 435 | 3300025921 | Ga0207652_10198608 | Ga0207652_101986082 | 160 |
| 436 | 3300025923 | Ga0207681_10025032 | Ga0207681_100250324 | 160 |
| 437 | 3300025923 | Ga0207681_10217484 | Ga0207681_102174842 | 160 |
| 438 | 3300025923 | Ga0207681_10471331 | Ga0207681_104713312 | 160 |
| 439 | 3300025925 | Ga0207650_10008541 | Ga0207650_100085415 | 160 |
| 440 | 3300025926 | Ga0207659_10077556 | Ga0207659_100775562 | 160 |
| 441 | 3300025926 | Ga0207659_10244659 | Ga0207659_102446592 | 160 |
| 442 | 3300025931 | Ga0207644_10006436 | Ga0207644_100064367 | 160 |
| 443 | 3300025931 | Ga0207644_10111606 | Ga0207644_101116062 | 160 |
| 444 | 3300025932 | Ga0207690_10874258 | Ga0207690_108742581 | 160 |
| 445 | 3300025935 | Ga0207709_10001569 | Ga0207709_1000156911 | 160 |
| 446 | 3300025935 | Ga0207709_10075898 | Ga0207709_100758982 | 160 |
| 447 | 3300025941 | Ga0207711_10002243 | Ga0207711_1000224315 | 160 |
| 448 | 3300025941 | Ga0207711_10468665 | Ga0207711_104686652 | 160 |
| 449 | 3300025941 | Ga0207711_10566441 | Ga0207711_105664412 | 160 |
| 450 | 3300025949 | Ga0207667_10464492 | Ga0207667_104644922 | 160 |
| 451 | 3300025960 | Ga0207651_10409869 | Ga0207651_104098692 | 160 |
| 452 | 3300025972 | Ga0207668_10004601 | Ga0207668_100046014 | 160 |
| 453 | 3300025972 | Ga0207668_10024065 | Ga0207668_100240654 | 160 |
| 454 | 3300026075 | Ga0207708_10921796 | Ga0207708_109217961 | 160 |
| 455 | 3300026116 | Ga0207674_10010009 | Ga0207674_100100096 | 160 |
| 456 | 3300026118 | Ga0207675_100671875 | Ga0207675_1006718752 | 160 |
| 457 | 3300026121 | Ga0207683_10095515 | Ga0207683_100955152 | 160 |
| 458 | 3300026121 | Ga0207683_10802538 | Ga0207683_108025382 | 160 |
| 459 | 3300027312 | Ga0209371_1000028 | Ga0209371_1000028142 | 160 |
| 460 | 3300027312 | Ga0209371_1000048 | Ga0209371_1000048171 | 160 |
| 461 | 3300027312 | Ga0209371_1010826 | Ga0209371_10108262 | 160 |
| 462 | 3300027378 | Ga0209981_1042102 | Ga0209981_10421022 | 160 |
| 463 | 3300027424 | Ga0209984_1009274 | Ga0209984_10092742 | 160 |
| 464 | 3300027471 | Ga0209995_1010920 | Ga0209995_10109203 | 160 |
| 465 | 3300027543 | Ga0209999_1004632 | Ga0209999_10046321 | 160 |
| 466 | 3300027614 | Ga0209970_1006158 | Ga0209970_10061583 | 160 |
| 467 | 3300027614 | Ga0209970_1007034 | Ga0209970_10070342 | 160 |
| 468 | 3300027665 | Ga0209983_1001083 | Ga0209983_10010833 | 160 |
| 469 | 3300027665 | Ga0209983_1027086 | Ga0209983_10270862 | 160 |
| 470 | 3300027682 | Ga0209971_1000758 | Ga0209971_10007583 | 160 |
| 471 | 3300027682 | Ga0209971_1012091 | Ga0209971_10120913 | 160 |
| 472 | 3300027876 | Ga0209974_10010835 | Ga0209974_100108353 | 160 |
| 473 | 3300027876 | Ga0209974_10019745 | Ga0209974_100197452 | 160 |
| 474 | 3300027876 | Ga0209974_10025126 | Ga0209974_100251262 | 160 |
| 475 | 3300028379 | Ga0268266_10024900 | Ga0268266_100249004 | 160 |
| 476 | 3300028379 | Ga0268266_10054746 | Ga0268266_100547464 | 160 |
| 477 | 3300028379 | Ga0268266_11412684 | Ga0268266_114126841 | 160 |
| 478 | 3300028380 | Ga0268265_10103400 | Ga0268265_101034003 | 160 |
| 479 | 3300028794 | Ga0307515_10286484 | Ga0307515_102864842 | 160 |
| 480 | 3300030500 | Ga0268256_1000030 | Ga0268256_1000030252 | 160 |
| 481 | 3300030500 | Ga0268256_1000049 | Ga0268256_100004997 | 160 |
| 482 | 3300030500 | Ga0268256_1010567 | Ga0268256_10105674 | 160 |
| 483 | 3300030731 | Ga0316177_1019699 | Ga0316177_10196994 | 160 |
| 484 | 3300030731 | Ga0316177_1090695 | Ga0316177_10906952 | 160 |
| 485 | 3300030732 | Ga0316176_1178239 | Ga0316176_11782393 | 160 |
| 486 | 3300030733 | Ga0314311_1198609 | Ga0314311_11986093 | 160 |
| 487 | 3300030733 | Ga0314311_1212235 | Ga0314311_12122352 | 160 |
| 488 | 3300030735 | Ga0316178_1100148 | Ga0316178_11001482 | 160 |
| 489 | 3300030736 | Ga0316180_1135407 | Ga0316180_11354072 | 160 |
| 490 | 3300030742 | Ga0316183_1032517 | Ga0316183_10325171 | 160 |
| 491 | 3300030742 | Ga0316183_1156169 | Ga0316183_11561691 | 160 |
| 492 | 3300030745 | Ga0316182_1090418 | Ga0316182_10904181 | 160 |
| 493 | 3300030745 | Ga0316182_1113265 | Ga0316182_11132652 | 160 |
| 494 | 3300030745 | Ga0316182_1139274 | Ga0316182_11392743 | 160 |
| 495 | 3300031456 | Ga0307513_10002045 | Ga0307513_100020455 | 160 |
| 496 | 3300031456 | Ga0307513_10310084 | Ga0307513_103100842 | 160 |
| 497 | 3300031548 | Ga0307408_100049397 | Ga0307408_1000493972 | 160 |
| 498 | 3300031548 | Ga0307408_100058931 | Ga0307408_1000589312 | 160 |
| 499 | 3300031548 | Ga0307408_100059523 | Ga0307408_1000595233 | 160 |
| 500 | 3300031548 | Ga0307408_100740267 | Ga0307408_1007402672 | 160 |
| 501 | 3300031548 | Ga0307408_100758912 | Ga0307408_1007589122 | 160 |
| 502 | 3300031548 | Ga0307408_101243580 | Ga0307408_1012435801 | 160 |
| 503 | 3300031731 | Ga0307405_10223600 | Ga0307405_102236002 | 160 |
| 504 | 3300031731 | Ga0307405_10234444 | Ga0307405_102344442 | 160 |
| 505 | 3300031731 | Ga0307405_11036510 | Ga0307405_110365101 | 160 |
| 506 | 3300031824 | Ga0307413_10006572 | Ga0307413_100065723 | 160 |
| 507 | 3300031824 | Ga0307413_10007402 | Ga0307413_100074023 | 160 |
| 508 | 3300031824 | Ga0307413_10079998 | Ga0307413_100799983 | 160 |
| 509 | 3300031824 | Ga0307413_10100253 | Ga0307413_101002532 | 160 |
| 510 | 3300031824 | Ga0307413_10147237 | Ga0307413_101472373 | 160 |
| 511 | 3300031824 | Ga0307413_10214365 | Ga0307413_102143653 | 160 |
| 512 | 3300031824 | Ga0307413_10241967 | Ga0307413_102419672 | 160 |
| 513 | 3300031824 | Ga0307413_10457698 | Ga0307413_104576982 | 160 |
| 514 | 3300031824 | Ga0307413_10495350 | Ga0307413_104953501 | 160 |
| 515 | 3300031824 | Ga0307413_10554644 | Ga0307413_105546442 | 160 |
| 516 | 3300031852 | Ga0307410_10084596 | Ga0307410_100845962 | 160 |
| 517 | 3300031852 | Ga0307410_10417360 | Ga0307410_104173601 | 160 |
| 518 | 3300031852 | Ga0307410_10554581 | Ga0307410_105545811 | 160 |
| 519 | 3300031901 | Ga0307406_10008217 | Ga0307406_100082178 | 160 |
| 520 | 3300031901 | Ga0307406_10149539 | Ga0307406_101495392 | 160 |
| 521 | 3300031901 | Ga0307406_10257809 | Ga0307406_102578092 | 160 |
| 522 | 3300031901 | Ga0307406_10466902 | Ga0307406_104669022 | 160 |
| 523 | 3300031901 | Ga0307406_10629293 | Ga0307406_106292932 | 160 |
| 524 | 3300031911 | Ga0307412_10000087 | Ga0307412_1000008740 | 160 |
| 525 | 3300031911 | Ga0307412_10002247 | Ga0307412_1000224711 | 160 |
| 526 | 3300031911 | Ga0307412_10064564 | Ga0307412_100645642 | 160 |
| 527 | 3300031911 | Ga0307412_10187844 | Ga0307412_101878443 | 160 |
| 528 | 3300031911 | Ga0307412_10339356 | Ga0307412_103393561 | 160 |
| 529 | 3300031911 | Ga0307412_10520922 | Ga0307412_105209221 | 160 |
| 530 | 3300031911 | Ga0307412_10889744 | Ga0307412_108897442 | 160 |
| 531 | 3300031911 | Ga0307412_11545596 | Ga0307412_115455961 | 160 |
| 532 | 3300031995 | Ga0307409_100510405 | Ga0307409_1005104052 | 160 |
| 533 | 3300031995 | Ga0307409_102321007 | Ga0307409_1023210071 | 160 |
| 534 | 3300032002 | Ga0307416_100006969 | Ga0307416_1000069696 | 160 |
| 535 | 3300032002 | Ga0307416_100023561 | Ga0307416_1000235612 | 160 |
| 536 | 3300032002 | Ga0307416_100438009 | Ga0307416_1004380092 | 160 |
| 537 | 3300032002 | Ga0307416_100496923 | Ga0307416_1004969232 | 160 |
| 538 | 3300032002 | Ga0307416_101605709 | Ga0307416_1016057091 | 160 |
| 539 | 3300032002 | Ga0307416_102083253 | Ga0307416_1020832532 | 160 |
| 540 | 3300032004 | Ga0307414_10000159 | Ga0307414_100001596 | 160 |
| 541 | 3300032004 | Ga0307414_10004389 | Ga0307414_100043895 | 160 |
| 542 | 3300032004 | Ga0307414_10017345 | Ga0307414_100173454 | 160 |
| 543 | 3300032004 | Ga0307414_10019952 | Ga0307414_100199524 | 160 |
| 544 | 3300032004 | Ga0307414_10023608 | Ga0307414_100236084 | 160 |
| 545 | 3300032004 | Ga0307414_10054278 | Ga0307414_100542783 | 160 |
| 546 | 3300032004 | Ga0307414_10094518 | Ga0307414_100945182 | 160 |
| 547 | 3300032004 | Ga0307414_10108743 | Ga0307414_101087433 | 160 |
| 548 | 3300032004 | Ga0307414_10135051 | Ga0307414_101350512 | 160 |
| 549 | 3300032004 | Ga0307414_10498444 | Ga0307414_104984442 | 160 |
| 550 | 3300032004 | Ga0307414_10521656 | Ga0307414_105216561 | 160 |
| 551 | 3300032004 | Ga0307414_11196948 | Ga0307414_111969482 | 160 |
| 552 | 3300032005 | Ga0307411_10051787 | Ga0307411_100517872 | 160 |
| 553 | 3300032005 | Ga0307411_10119139 | Ga0307411_101191392 | 160 |
| 554 | 3300032005 | Ga0307411_10180443 | Ga0307411_101804432 | 160 |
| 555 | 3300032005 | Ga0307411_10310407 | Ga0307411_103104071 | 160 |
| 556 | 3300032005 | Ga0307411_10526672 | Ga0307411_105266722 | 160 |
| 557 | 3300032005 | Ga0307411_10639650 | Ga0307411_106396502 | 160 |
| 558 | 3300032005 | Ga0307411_10759786 | Ga0307411_107597862 | 160 |
| 559 | 3300032005 | Ga0307411_11092444 | Ga0307411_110924442 | 160 |
| 560 | 3300036401 | Ga0373937_0181755 | Ga0373937_0181755_454_936 | 160 |
| 561 | 3300036401 | Ga0373937_1595327 | Ga0373937_1595327_91_573 | 160 |
| 562 | 3300037471 | Ga0395905_0002859 | Ga0395905_0002859_15119_15601 | 160 |
| 563 | 3300037471 | Ga0395905_0016448 | Ga0395905_0016448_2089_2571 | 160 |
| 564 | 3300037471 | Ga0395905_0477278 | Ga0395905_0477278_352_834 | 160 |
| 565 | 3300037853 | Ga0436364_0744029 | Ga0436364_0744029_2772_3290 | 160 |
| 566 | 3300038443 | Ga0395901_0020794 | Ga0395901_0020794_2433_2915 | 160 |
| 567 | 3300038705 | Ga0237819_00279 | Ga0237819_00279_12499_12981 | 160 |
| 568 | 3300038705 | Ga0237819_02264 | Ga0237819_02264_3300_3782 | 160 |
| 569 | 3300039145 | Ga0237816_01687 | Ga0237816_01687_889_1374 | 160 |
| 570 | 3300041404 | Ga0439436_0004641 | Ga0439436_0004641_691_1176 | 160 |
| 571 | 3300041404 | Ga0439436_0032076 | Ga0439436_0032076_181_666 | 160 |
| 572 | 3300041407 | Ga0439447_000033 | Ga0439447_000033_31278_31760 | 160 |
| 573 | 3300041410 | Ga0439461_0085376 | Ga0439461_0085376_61_546 | 160 |
| 574 | 3300041413 | Ga0439465_0003016 | Ga0439465_0003016_4290_4775 | 160 |
| 575 | 3300041413 | Ga0439465_0044755 | Ga0439465_0044755_214_699 | 160 |
| 576 | 3300041413 | Ga0439465_0049197 | Ga0439465_0049197_775_1260 | 160 |
| 577 | 3300041451 | Ga0451791_0061126 | Ga0451791_0061126_450_932 | 160 |
| 578 | 3300041452 | Ga0451793_0248173 | Ga0451793_0248173_174_659 | 160 |
| 579 | 3300041453 | Ga0451797_0206176 | Ga0451797_0206176_96_581 | 160 |
| 580 | 3300041453 | Ga0451797_0209795 | Ga0451797_0209795_360_845 | 160 |
| 581 | 3300041453 | Ga0451797_0510974 | Ga0451797_0510974_360_848 | 160 |
| 582 | 3300041453 | Ga0451797_1381519 | Ga0451797_1381519_100_582 | 160 |
| 583 | 3300041456 | Ga0451795_1281766 | Ga0451795_1281766_289_774 | 160 |
| 584 | 3300041459 | Ga0451800_0961261 | Ga0451800_0961261_478_963 | 160 |
| 585 | 3300041459 | Ga0451800_1014250 | Ga0451800_1014250_2065_2550 | 160 |
| 586 | 3300041460 | Ga0451802_1249029 | Ga0451802_1249029_834_1319 | 160 |
| 587 | 3300041460 | Ga0451802_1339368 | Ga0451802_1339368_120_608 | 160 |
| 588 | 3300041460 | Ga0451802_1567617 | Ga0451802_1567617_675_1160 | 160 |
| 589 | 3300041462 | Ga0451806_130861 | Ga0451806_130861_3084_3569 | 160 |
| 590 | 3300041486 | Ga0451807_0759871 | Ga0451807_0759871_370_855 | 160 |
| 591 | 3300041486 | Ga0451807_0894472 | Ga0451807_0894472_276_761 | 160 |
| 592 | 3300041486 | Ga0451807_1140346 | Ga0451807_1140346_369_854 | 160 |
| 593 | 3300041486 | Ga0451807_2568450 | Ga0451807_2568450_127_624 | 160 |
| 594 | 3300041491 | Ga0451833_1204446 | Ga0451833_1204446_41_529 | 160 |
| 595 | 3300041491 | Ga0451833_1243150 | Ga0451833_1243150_35_520 | 160 |
| 596 | 3300041494 | Ga0451837_0766626 | Ga0451837_0766626_47_529 | 160 |
| 597 | 3300041494 | Ga0451837_1042500 | Ga0451837_1042500_1526_2011 | 160 |
| 598 | 3300041494 | Ga0451837_1185966 | Ga0451837_1185966_44_526 | 160 |
| 599 | 3300041496 | Ga0451839_0654108 | Ga0451839_0654108_414_899 | 160 |
| 600 | 3300041501 | Ga0451845_0504423 | Ga0451845_0504423_50_535 | 160 |
| 601 | 3300041509 | Ga0451843_0501131 | Ga0451843_0501131_923_1408 | 160 |
| 602 | 3300041509 | Ga0451843_0984714 | Ga0451843_0984714_158_643 | 160 |
| 603 | 3300041512 | Ga0451853_1276073 | Ga0451853_1276073_12_518 | 160 |
| 604 | 3300041512 | Ga0451853_2928858 | Ga0451853_2928858_174_656 | 160 |
| 605 | 3300041512 | Ga0451853_3785856 | Ga0451853_3785856_242_727 | 160 |
| 606 | 3300041999 | Ga0439433_0016096 | Ga0439433_0016096_1090_1575 | 160 |
| 607 | 3300041999 | Ga0439433_0055837 | Ga0439433_0055837_21_506 | 160 |
| 608 | 3300041999 | Ga0439433_0100366 | Ga0439433_0100366_193_678 | 160 |
| 609 | 3300041999 | Ga0439433_0100772 | Ga0439433_0100772_12_497 | 160 |
| 610 | 3300042004 | Ga0439445_0005312 | Ga0439445_0005312_1987_2472 | 160 |
| 611 | 3300042004 | Ga0439445_0042303 | Ga0439445_0042303_616_1101 | 160 |
| 612 | 3300042006 | Ga0439432_006084 | Ga0439432_006084_2683_3168 | 160 |
| 613 | 3300042006 | Ga0439432_011439 | Ga0439432_011439_1274_1756 | 160 |
| 614 | 3300042006 | Ga0439432_019376 | Ga0439432_019376_355_840 | 160 |
| 615 | 3300042006 | Ga0439432_019821 | Ga0439432_019821_190_672 | 160 |
| 616 | 3300042006 | Ga0439432_029249 | Ga0439432_029249_227_733 | 160 |
| 617 | 3300042007 | Ga0439449_0000650 | Ga0439449_0000650_576_1061 | 160 |
| 618 | 3300042007 | Ga0439449_0002587 | Ga0439449_0002587_2124_2609 | 160 |
| 619 | 3300042007 | Ga0439449_0003784 | Ga0439449_0003784_852_1337 | 160 |
| 620 | 3300042007 | Ga0439449_0006088 | Ga0439449_0006088_918_1403 | 160 |
| 621 | 3300042007 | Ga0439449_0009505 | Ga0439449_0009505_2873_3358 | 160 |
| 622 | 3300042007 | Ga0439449_0014318 | Ga0439449_0014318_414_899 | 160 |
| 623 | 3300042007 | Ga0439449_0068772 | Ga0439449_0068772_283_828 | 160 |
| 624 | 3300042010 | Ga0439452_016951 | Ga0439452_016951_290_775 | 160 |
| 625 | 3300042015 | Ga0439462_0008072 | Ga0439462_0008072_197_682 | 160 |
| 626 | 3300042015 | Ga0439462_0017511 | Ga0439462_0017511_515_1000 | 160 |
| 627 | 3300042015 | Ga0439462_0071841 | Ga0439462_0071841_418_903 | 160 |
| 628 | 3300042115 | Ga0450911_000371 | Ga0450911_000371_2177_2659 | 160 |
| 629 | 3300042135 | Ga0450899_006367 | Ga0450899_006367_449_934 | 160 |
| 630 | 3300042156 | Ga0439446_0048727 | Ga0439446_0048727_578_1063 | 160 |
| 631 | 3300042156 | Ga0439446_0142766 | Ga0439446_0142766_68_553 | 160 |
| 632 | 3300042435 | Ga0439434_0025040 | Ga0439434_0025040_257_742 | 160 |
| 633 | 3300042435 | Ga0439434_0266653 | Ga0439434_0266653_70_555 | 160 |
| 634 | 3300042532 | Ga0450893_0096079 | Ga0450893_0096079_50_535 | 160 |
| 635 | 3300042876 | Ga0451577_0015288 | Ga0451577_0015288_4156_4650 | 160 |
| 636 | 3300042993 | Ga0439440_0010673 | Ga0439440_0010673_636_1124 | 160 |
| 637 | 3300044712 | Ga0453684_0089807 | Ga0453684_0089807_580_1074 | 160 |
| 638 | 3300046453 | Ga0495627_000853 | Ga0495627_000853_15073_15555 | 160 |
| 639 | 3300046453 | Ga0495627_066089 | Ga0495627_066089_344_826 | 160 |
| 640 | 3300046453 | Ga0495627_072249 | Ga0495627_072249_481_963 | 160 |
| 641 | 3300046458 | Ga0495591_013488 | Ga0495591_013488_1603_2085 | 160 |
| 642 | 3300046460 | Ga0495638_0001228 | Ga0495638_0001228_7802_8284 | 160 |
| 643 | 3300046460 | Ga0495638_0030301 | Ga0495638_0030301_565_1050 | 160 |
| 644 | 3300046460 | Ga0495638_0147851 | Ga0495638_0147851_499_996 | 160 |
| 645 | 3300046501 | Ga0495607_0218148 | Ga0495607_0218148_254_739 | 160 |
| 646 | 3300046507 | Ga0495606_0021112 | Ga0495606_0021112_1617_2102 | 160 |
| 647 | 3300046512 | Ga0495610_0001130 | Ga0495610_0001130_9684_10166 | 160 |
| 648 | 3300046512 | Ga0495610_0021459 | Ga0495610_0021459_2920_3405 | 160 |
| 649 | 3300046513 | Ga0495616_0016650 | Ga0495616_0016650_2413_2898 | 160 |
| 650 | 3300046518 | Ga0495631_0000369 | Ga0495631_0000369_20797_21279 | 160 |
| 651 | 3300046519 | Ga0495632_0089096 | Ga0495632_0089096_136_618 | 160 |
| 652 | 3300046522 | Ga0495643_0003775 | Ga0495643_0003775_774_1256 | 160 |
| 653 | 3300046525 | Ga0495663_0000899 | Ga0495663_0000899_5100_5582 | 160 |
| 654 | 3300046525 | Ga0495663_0013048 | Ga0495663_0013048_970_1455 | 160 |
| 655 | 3300046525 | Ga0495663_0025795 | Ga0495663_0025795_445_927 | 160 |
| 656 | 3300046525 | Ga0495663_0058290 | Ga0495663_0058290_285_767 | 160 |
| 657 | 3300046530 | Ga0495654_0107423 | Ga0495654_0107423_352_837 | 160 |
| 658 | 3300046539 | Ga0495621_0002787 | Ga0495621_0002787_1862_2344 | 160 |
| 659 | 3300046539 | Ga0495621_0008296 | Ga0495621_0008296_2072_2557 | 160 |
| 660 | 3300046558 | Ga0495633_0001102 | Ga0495633_0001102_8040_8522 | 160 |
| 661 | 3300046558 | Ga0495633_0003816 | Ga0495633_0003816_2558_3040 | 160 |
| 662 | 3300046558 | Ga0495633_0011696 | Ga0495633_0011696_2608_3090 | 160 |
| 663 | 3300046558 | Ga0495633_0041280 | Ga0495633_0041280_1299_1781 | 160 |
| 664 | 3300046558 | Ga0495633_0043736 | Ga0495633_0043736_1050_1532 | 160 |
| 665 | 3300046558 | Ga0495633_0264369 | Ga0495633_0264369_41_523 | 160 |
| 666 | 3300046615 | Ga0495656_0001943 | Ga0495656_0001943_1299_1781 | 160 |
| 667 | 3300046615 | Ga0495656_0002508 | Ga0495656_0002508_3590_4075 | 160 |
| 668 | 3300046615 | Ga0495656_0004358 | Ga0495656_0004358_1276_1761 | 160 |
| 669 | 3300046615 | Ga0495656_0067967 | Ga0495656_0067967_1048_1530 | 160 |
| 670 | 3300046615 | Ga0495656_0232697 | Ga0495656_0232697_57_542 | 160 |
| 671 | 3300046616 | Ga0495668_0000960 | Ga0495668_0000960_5143_5625 | 160 |
| 672 | 3300046660 | Ga0495625_0096632 | Ga0495625_0096632_456_941 | 160 |
| 673 | 3300046664 | Ga0495659_0008952 | Ga0495659_0008952_1052_1534 | 160 |
| 674 | 3300046691 | Ga0495670_0275136 | Ga0495670_0275136_215_700 | 160 |
| 675 | 3300046692 | Ga0495671_0083413 | Ga0495671_0083413_673_1158 | 160 |
| 676 | 3300046810 | Ga0495660_0004923 | Ga0495660_0004923_5605_6087 | 160 |
| 677 | 3300047318 | Ga0495636_0013289 | Ga0495636_0013289_1345_1830 | 160 |
| 678 | 3300047318 | Ga0495636_0028691 | Ga0495636_0028691_372_857 | 160 |
| 679 | 3300047318 | Ga0495636_0030645 | Ga0495636_0030645_518_1003 | 160 |
| 680 | 3300047318 | Ga0495636_0060586 | Ga0495636_0060586_189_671 | 160 |
| 681 | 3300047318 | Ga0495636_0062891 | Ga0495636_0062891_532_1017 | 160 |
| 682 | 3300047320 | Ga0495672_0000079 | Ga0495672_0000079_77085_77567 | 160 |
| 683 | 3300047320 | Ga0495672_0026243 | Ga0495672_0026243_2233_2715 | 160 |
| 684 | 3300047320 | Ga0495672_0076591 | Ga0495672_0076591_283_765 | 160 |
| 685 | 3300047447 | Ga0495685_081273 | Ga0495685_081273_171_653 | 160 |
| 686 | 3300047470 | Ga0495681_0033084 | Ga0495681_0033084_417_971 | 160 |
| 687 | 3300047470 | Ga0495681_0101672 | Ga0495681_0101672_738_1220 | 160 |
| 688 | 3300047472 | Ga0495686_0012567 | Ga0495686_0012567_2427_2909 | 160 |
| 689 | 3300048090 | Ga0495615_0279499 | Ga0495615_0279499_15_497 | 160 |
| 690 | 3300048904 | Ga0496101_0119291 | Ga0496101_0119291_777_1259 | 160 |
| 691 | 3300048904 | Ga0496101_0254279 | Ga0496101_0254279_513_995 | 160 |
| 692 | 3300048905 | Ga0496102_0328648 | Ga0496102_0328648_801_1298 | 160 |
| 693 | 3300048906 | Ga0496103_0127295 | Ga0496103_0127295_283_765 | 160 |
| 694 | 3300048908 | Ga0496105_0401066 | Ga0496105_0401066_379_861 | 160 |
| 695 | 3300048909 | Ga0496106_0123063 | Ga0496106_0123063_422_904 | 160 |
| 696 | 3300048910 | Ga0496107_0139447 | Ga0496107_0139447_1126_1608 | 160 |
| 697 | 3300048911 | Ga0496108_0404326 | Ga0496108_0404326_332_814 | 160 |
| 698 | 3300048912 | Ga0496109_0192086 | Ga0496109_0192086_560_1042 | 160 |
| 699 | 3300048912 | Ga0496109_0204493 | Ga0496109_0204493_847_1329 | 160 |
| 700 | 3300048913 | Ga0496110_0063713 | Ga0496110_0063713_2023_2505 | 160 |
| 701 | 3300048914 | Ga0496111_0298825 | Ga0496111_0298825_369_851 | 160 |
| 702 | 3300048914 | Ga0496111_0406901 | Ga0496111_0406901_182_664 | 160 |
| 703 | 3300048914 | Ga0496111_0444681 | Ga0496111_0444681_199_681 | 160 |
| 704 | 3300048915 | Ga0496112_0449356 | Ga0496112_0449356_412_894 | 160 |
| 705 | 3300048916 | Ga0496113_0004036 | Ga0496113_0004036_7242_7724 | 160 |
| 706 | 3300048916 | Ga0496113_0026815 | Ga0496113_0026815_1243_1725 | 160 |
| 707 | 3300048916 | Ga0496113_0046556 | Ga0496113_0046556_1889_2371 | 160 |
| 708 | 3300048917 | Ga0496114_0001425 | Ga0496114_0001425_7850_8335 | 160 |
| 709 | 3300048919 | Ga0496116_0000742 | Ga0496116_0000742_21381_21863 | 160 |
| 710 | 3300048919 | Ga0496116_0004402 | Ga0496116_0004402_8241_8726 | 160 |
| 711 | 3300048919 | Ga0496116_0006168 | Ga0496116_0006168_8922_9404 | 160 |
| 712 | 3300048919 | Ga0496116_0015795 | Ga0496116_0015795_2474_2956 | 160 |
| 713 | 3300048919 | Ga0496116_0020093 | Ga0496116_0020093_2703_3185 | 160 |
| 714 | 3300048919 | Ga0496116_0023042 | Ga0496116_0023042_858_1361 | 160 |
| 715 | 3300048919 | Ga0496116_0030969 | Ga0496116_0030969_773_1258 | 160 |
| 716 | 3300048919 | Ga0496116_0282868 | Ga0496116_0282868_127_630 | 160 |
| 717 | 3300048920 | Ga0496117_0000483 | Ga0496117_0000483_49832_50314 | 160 |
| 718 | 3300048920 | Ga0496117_0001569 | Ga0496117_0001569_26180_26662 | 160 |
| 719 | 3300048920 | Ga0496117_0001801 | Ga0496117_0001801_20854_21336 | 160 |
| 720 | 3300048920 | Ga0496117_0005801 | Ga0496117_0005801_10699_11181 | 160 |
| 721 | 3300048920 | Ga0496117_0009988 | Ga0496117_0009988_6746_7231 | 160 |
| 722 | 3300048920 | Ga0496117_0015910 | Ga0496117_0015910_3351_3833 | 160 |
| 723 | 3300048920 | Ga0496117_0050192 | Ga0496117_0050192_1122_1607 | 160 |
| 724 | 3300048920 | Ga0496117_0053529 | Ga0496117_0053529_1843_2346 | 160 |
| 725 | 3300048920 | Ga0496117_0071182 | Ga0496117_0071182_531_1013 | 160 |
| 726 | 3300048921 | Ga0496118_0000732 | Ga0496118_0000732_34098_34580 | 160 |
| 727 | 3300048921 | Ga0496118_0002860 | Ga0496118_0002860_17364_17846 | 160 |
| 728 | 3300048921 | Ga0496118_0005588 | Ga0496118_0005588_12087_12569 | 160 |
| 729 | 3300048921 | Ga0496118_0010427 | Ga0496118_0010427_2600_3082 | 160 |
| 730 | 3300048921 | Ga0496118_0014077 | Ga0496118_0014077_6179_6661 | 160 |
| 731 | 3300048921 | Ga0496118_0031298 | Ga0496118_0031298_2367_2849 | 160 |
| 732 | 3300048921 | Ga0496118_0031992 | Ga0496118_0031992_1569_2054 | 160 |
| 733 | 3300048921 | Ga0496118_0058232 | Ga0496118_0058232_1014_1508 | 160 |
| 734 | 3300048921 | Ga0496118_0092602 | Ga0496118_0092602_1061_1543 | 160 |
| 735 | 3300048922 | Ga0496119_0001225 | Ga0496119_0001225_24928_25410 | 160 |
| 736 | 3300048922 | Ga0496119_0001601 | Ga0496119_0001601_7760_8242 | 160 |
| 737 | 3300048922 | Ga0496119_0003714 | Ga0496119_0003714_9640_10143 | 160 |
| 738 | 3300048922 | Ga0496119_0026613 | Ga0496119_0026613_2638_3123 | 160 |
| 739 | 3300048923 | Ga0496120_0000262 | Ga0496120_0000262_24947_25429 | 160 |
| 740 | 3300048923 | Ga0496120_0000564 | Ga0496120_0000564_22260_22742 | 160 |
| 741 | 3300048923 | Ga0496120_0003756 | Ga0496120_0003756_4730_5233 | 160 |
| 742 | 3300048923 | Ga0496120_0012681 | Ga0496120_0012681_2529_3014 | 160 |
| 743 | 3300048923 | Ga0496120_0167909 | Ga0496120_0167909_39_542 | 160 |
| 744 | 3300048924 | Ga0496121_0000165 | Ga0496121_0000165_32811_33296 | 160 |
| 745 | 3300048924 | Ga0496121_0001145 | Ga0496121_0001145_979_1461 | 160 |
| 746 | 3300048924 | Ga0496121_0006141 | Ga0496121_0006141_1875_2357 | 160 |
| 747 | 3300048924 | Ga0496121_0016056 | Ga0496121_0016056_2495_2977 | 160 |
| 748 | 3300048924 | Ga0496121_0074701 | Ga0496121_0074701_815_1297 | 160 |
| 749 | 3300048924 | Ga0496121_0095467 | Ga0496121_0095467_291_776 | 160 |
| 750 | 3300048924 | Ga0496121_0127008 | Ga0496121_0127008_811_1293 | 160 |
| 751 | 3300048924 | Ga0496121_0528919 | Ga0496121_0528919_146_631 | 160 |
| 752 | 3300048925 | Ga0496122_0000537 | Ga0496122_0000537_52005_52487 | 160 |
| 753 | 3300048925 | Ga0496122_0000736 | Ga0496122_0000736_63049_63534 | 160 |
| 754 | 3300048925 | Ga0496122_0001070 | Ga0496122_0001070_1044_1526 | 160 |
| 755 | 3300048925 | Ga0496122_0004558 | Ga0496122_0004558_5660_6145 | 160 |
| 756 | 3300048925 | Ga0496122_0008632 | Ga0496122_0008632_3419_3901 | 160 |
| 757 | 3300048925 | Ga0496122_0016201 | Ga0496122_0016201_4626_5129 | 160 |
| 758 | 3300048925 | Ga0496122_0016730 | Ga0496122_0016730_5806_6288 | 160 |
| 759 | 3300048925 | Ga0496122_0016983 | Ga0496122_0016983_781_1263 | 160 |
| 760 | 3300048925 | Ga0496122_0019102 | Ga0496122_0019102_3626_4147 | 160 |
| 761 | 3300048925 | Ga0496122_0028118 | Ga0496122_0028118_2690_3172 | 160 |
| 762 | 3300048925 | Ga0496122_0069527 | Ga0496122_0069527_96_581 | 160 |
| 763 | 3300048925 | Ga0496122_0132678 | Ga0496122_0132678_733_1218 | 160 |
| 764 | 3300048925 | Ga0496122_0147744 | Ga0496122_0147744_421_903 | 160 |
| 765 | 3300048926 | Ga0496123_0000541 | Ga0496123_0000541_8983_9465 | 160 |
| 766 | 3300048926 | Ga0496123_0000763 | Ga0496123_0000763_42431_42916 | 160 |
| 767 | 3300048926 | Ga0496123_0000898 | Ga0496123_0000898_45611_46093 | 160 |
| 768 | 3300048926 | Ga0496123_0005012 | Ga0496123_0005012_5299_5784 | 160 |
| 769 | 3300048926 | Ga0496123_0016396 | Ga0496123_0016396_1530_2012 | 160 |
| 770 | 3300048926 | Ga0496123_0021598 | Ga0496123_0021598_2215_2697 | 160 |
| 771 | 3300048926 | Ga0496123_0025056 | Ga0496123_0025056_2343_2825 | 160 |
| 772 | 3300048926 | Ga0496123_0039571 | Ga0496123_0039571_100_585 | 160 |
| 773 | 3300048926 | Ga0496123_0085479 | Ga0496123_0085479_1061_1543 | 160 |
| 774 | 3300048926 | Ga0496123_0110347 | Ga0496123_0110347_22_507 | 160 |
| 775 | 3300048927 | Ga0496124_0000006 | Ga0496124_0000006_243309_243794 | 160 |
| 776 | 3300048927 | Ga0496124_0000128 | Ga0496124_0000128_137650_138153 | 160 |
| 777 | 3300048927 | Ga0496124_0001971 | Ga0496124_0001971_5968_6450 | 160 |
| 778 | 3300048927 | Ga0496124_0005006 | Ga0496124_0005006_2211_2693 | 160 |
| 779 | 3300048927 | Ga0496124_0005062 | Ga0496124_0005062_7852_8334 | 160 |
| 780 | 3300048927 | Ga0496124_0010412 | Ga0496124_0010412_3841_4323 | 160 |
| 781 | 3300048927 | Ga0496124_0013859 | Ga0496124_0013859_5015_5497 | 160 |
| 782 | 3300048927 | Ga0496124_0024389 | Ga0496124_0024389_3012_3497 | 160 |
| 783 | 3300048927 | Ga0496124_0030838 | Ga0496124_0030838_3733_4215 | 160 |
| 784 | 3300048927 | Ga0496124_0035514 | Ga0496124_0035514_1341_1823 | 160 |
| 785 | 3300048927 | Ga0496124_0057851 | Ga0496124_0057851_608_1093 | 160 |
| 786 | 3300048927 | Ga0496124_0315708 | Ga0496124_0315708_569_1051 | 160 |
| 787 | 3300048928 | Ga0496125_0000121 | Ga0496125_0000121_43266_43751 | 160 |
| 788 | 3300048928 | Ga0496125_0000475 | Ga0496125_0000475_51663_52145 | 160 |
| 789 | 3300048928 | Ga0496125_0001928 | Ga0496125_0001928_9305_9787 | 160 |
| 790 | 3300048928 | Ga0496125_0004706 | Ga0496125_0004706_6934_7416 | 160 |
| 791 | 3300048928 | Ga0496125_0022077 | Ga0496125_0022077_4750_5232 | 160 |
| 792 | 3300048928 | Ga0496125_0119744 | Ga0496125_0119744_747_1229 | 160 |
| 793 | 3300048928 | Ga0496125_0196998 | Ga0496125_0196998_360_845 | 160 |
| 794 | 3300048928 | Ga0496125_0218453 | Ga0496125_0218453_394_876 | 160 |
| 795 | 3300048929 | Ga0496126_0002184 | Ga0496126_0002184_17411_17914 | 160 |
| 796 | 3300048929 | Ga0496126_0003535 | Ga0496126_0003535_9339_9821 | 160 |
| 797 | 3300048929 | Ga0496126_0003936 | Ga0496126_0003936_13045_13548 | 160 |
| 798 | 3300048929 | Ga0496126_0009281 | Ga0496126_0009281_1609_2094 | 160 |
| 799 | 3300048929 | Ga0496126_0028258 | Ga0496126_0028258_4621_5103 | 160 |
| 800 | 3300048929 | Ga0496126_0032355 | Ga0496126_0032355_1738_2223 | 160 |
| 801 | 3300048929 | Ga0496126_0037947 | Ga0496126_0037947_1675_2160 | 160 |
| 802 | 3300048929 | Ga0496126_0080107 | Ga0496126_0080107_1269_1754 | 160 |
| 803 | 3300048929 | Ga0496126_0139530 | Ga0496126_0139530_1068_1550 | 160 |
| 804 | 3300048929 | Ga0496126_0201615 | Ga0496126_0201615_332_826 | 160 |
| 805 | 3300048929 | Ga0496126_0567491 | Ga0496126_0567491_192_674 | 160 |
| 806 | 3300049513 | Ga0501290_008728 | Ga0501290_008728_585_1076 | 160 |
| 807 | 3300049523 | Ga0501300_009142 | Ga0501300_009142_220_711 | 160 |
| 808 | 3300049568 | Ga0501031_0091160 | Ga0501031_0091160_57_545 | 160 |
| 809 | 3300049568 | Ga0501031_0156969 | Ga0501031_0156969_485_973 | 160 |
| 810 | 3300049569 | Ga0501032_0012431 | Ga0501032_0012431_1288_1776 | 160 |
| 811 | 3300049569 | Ga0501032_0355852 | Ga0501032_0355852_269_754 | 160 |
| 812 | 3300049570 | Ga0501033_0011027 | Ga0501033_0011027_588_1082 | 160 |
| 813 | 3300049570 | Ga0501033_0042754 | Ga0501033_0042754_1656_2141 | 160 |
| 814 | 3300049570 | Ga0501033_0176994 | Ga0501033_0176994_357_845 | 160 |
| 815 | 3300049570 | Ga0501033_0179126 | Ga0501033_0179126_431_919 | 160 |
| 816 | 3300049571 | Ga0501034_0000275 | Ga0501034_0000275_4836_5321 | 160 |
| 817 | 3300049571 | Ga0501034_0000473 | Ga0501034_0000473_64463_64945 | 160 |
| 818 | 3300049571 | Ga0501034_0057134 | Ga0501034_0057134_2494_2982 | 160 |
| 819 | 3300049571 | Ga0501034_0107153 | Ga0501034_0107153_1459_1947 | 160 |
| 820 | 3300049571 | Ga0501034_0876298 | Ga0501034_0876298_27_515 | 160 |
| 821 | 3300049571 | Ga0501034_1229232 | Ga0501034_1229232_70_564 | 160 |
| 822 | 3300049572 | Ga0501036_0007849 | Ga0501036_0007849_7469_7963 | 160 |
| 823 | 3300049572 | Ga0501036_0028501 | Ga0501036_0028501_1130_1618 | 160 |
| 824 | 3300049572 | Ga0501036_0126887 | Ga0501036_0126887_1482_1985 | 160 |
| 825 | 3300049572 | Ga0501036_0376426 | Ga0501036_0376426_54_542 | 160 |
| 826 | 3300049573 | Ga0501037_0022240 | Ga0501037_0022240_613_1101 | 160 |
| 827 | 3300049573 | Ga0501037_0197202 | Ga0501037_0197202_739_1233 | 160 |
| 828 | 3300049574 | Ga0501038_0004044 | Ga0501038_0004044_13117_13611 | 160 |
| 829 | 3300049574 | Ga0501038_0043636 | Ga0501038_0043636_78_566 | 160 |
| 830 | 3300049574 | Ga0501038_0058536 | Ga0501038_0058536_1546_2034 | 160 |
| 831 | 3300049575 | Ga0501039_0003853 | Ga0501039_0003853_7359_7853 | 160 |
| 832 | 3300049575 | Ga0501039_0072692 | Ga0501039_0072692_794_1282 | 160 |
| 833 | 3300049576 | Ga0501040_0001206 | Ga0501040_0001206_6071_6565 | 160 |
| 834 | 3300049577 | Ga0501041_0001968 | Ga0501041_0001968_7800_8294 | 160 |
| 835 | 3300049578 | Ga0501042_0000931 | Ga0501042_0000931_8176_8670 | 160 |
| 836 | 3300049579 | Ga0501043_0004623 | Ga0501043_0004623_5463_5948 | 160 |
| 837 | 3300049579 | Ga0501043_0024241 | Ga0501043_0024241_961_1449 | 160 |
| 838 | 3300049579 | Ga0501043_0045876 | Ga0501043_0045876_1902_2390 | 160 |
| 839 | 3300049579 | Ga0501043_0061394 | Ga0501043_0061394_2366_2860 | 160 |
| 840 | 3300049579 | Ga0501043_0222397 | Ga0501043_0222397_390_878 | 160 |
| 841 | 3300049580 | Ga0501046_0011112 | Ga0501046_0011112_2199_2693 | 160 |
| 842 | 3300049581 | Ga0501047_0170711 | Ga0501047_0170711_1362_1850 | 160 |
| 843 | 3300049581 | Ga0501047_0226790 | Ga0501047_0226790_162_650 | 160 |
| 844 | 3300049581 | Ga0501047_0308235 | Ga0501047_0308235_236_724 | 160 |
| 845 | 3300049582 | Ga0501048_0011120 | Ga0501048_0011120_2991_3485 | 160 |
| 846 | 3300049584 | Ga0501068_0000860 | Ga0501068_0000860_12464_12958 | 160 |
| 847 | 3300049586 | Ga0501070_0113135 | Ga0501070_0113135_837_1325 | 160 |
| 848 | 3300049586 | Ga0501070_0114001 | Ga0501070_0114001_558_1046 | 160 |
| 849 | 3300049587 | Ga0501071_0006996 | Ga0501071_0006996_1977_2471 | 160 |
| 850 | 3300049588 | Ga0501072_0001665 | Ga0501072_0001665_14278_14772 | 160 |
| 851 | 3300049589 | Ga0501073_0370358 | Ga0501073_0370358_383_871 | 160 |
| 852 | 3300049590 | Ga0501074_0124231 | Ga0501074_0124231_1162_1656 | 160 |
| 853 | 3300049591 | Ga0501075_0000858 | Ga0501075_0000858_14776_15270 | 160 |
| 854 | 3300049592 | Ga0501076_0002159 | Ga0501076_0002159_4553_5047 | 160 |
| 855 | 3300049593 | Ga0501077_0004578 | Ga0501077_0004578_2935_3429 | 160 |
| 856 | 3300049669 | Ga0501235_055770 | Ga0501235_055770_277_771 | 160 |
| 857 | 3300049682 | Ga0501252_030715 | Ga0501252_030715_91_576 | 160 |
| 858 | 3300049686 | Ga0501257_077886 | Ga0501257_077886_276_770 | 160 |
| 859 | 3300049705 | Ga0501225_0016499 | Ga0501225_0016499_902_1387 | 160 |
| 860 | 3300049705 | Ga0501225_0052492 | Ga0501225_0052492_88_573 | 160 |
| 861 | 3300049741 | Ga0501079_0002189 | Ga0501079_0002189_9455_9949 | 160 |
| 862 | 3300049742 | Ga0501080_0009101 | Ga0501080_0009101_7725_8219 | 160 |
| 863 | 3300049742 | Ga0501080_0050291 | Ga0501080_0050291_379_867 | 160 |
| 864 | 3300049742 | Ga0501080_0851953 | Ga0501080_0851953_202_690 | 160 |
| 865 | 3300049743 | Ga0501081_0000359 | Ga0501081_0000359_16428_16922 | 160 |
| 866 | 3300049743 | Ga0501081_1348875 | Ga0501081_1348875_34_522 | 160 |
| 867 | 3300049744 | Ga0501083_0071631 | Ga0501083_0071631_429_923 | 160 |
| 868 | 3300049760 | Ga0501263_040836 | Ga0501263_040836_52_546 | 160 |
| 869 | 3300049762 | Ga0501265_006501 | Ga0501265_006501_808_1299 | 160 |
| 870 | 3300049765 | Ga0501268_035049 | Ga0501268_035049_91_585 | 160 |
| 871 | 3300049772 | Ga0501275_001320 | Ga0501275_001320_1269_1760 | 160 |
| 872 | 3300049822 | Ga0501035_0035887 | Ga0501035_0035887_196_690 | 160 |
| 873 | 3300049822 | Ga0501035_0188478 | Ga0501035_0188478_889_1392 | 160 |
| 874 | 3300049822 | Ga0501035_0258322 | Ga0501035_0258322_110_598 | 160 |
| 875 | 3300049823 | Ga0501044_0034937 | Ga0501044_0034937_3369_3857 | 160 |
| 876 | 3300049823 | Ga0501044_0192180 | Ga0501044_0192180_1209_1697 | 160 |
| 877 | 3300049824 | Ga0501045_0025348 | Ga0501045_0025348_2623_3117 | 160 |
| 878 | 3300050491 | nmdc:mga00v17_10491_c1 | nmdc:mga00v17_10491_c1_927_1424 | 160 |
| 879 | 3300050491 | nmdc:mga00v17_110193_c1 | nmdc:mga00v17_110193_c1_156_641 | 160 |
| 880 | 3300050491 | nmdc:mga00v17_28595_c1 | nmdc:mga00v17_28595_c1_1813_2295 | 160 |
| 881 | 3300050491 | nmdc:mga00v17_31379_c1 | nmdc:mga00v17_31379_c1_1800_2282 | 160 |
| 882 | 3300050491 | nmdc:mga00v17_338_c1 | nmdc:mga00v17_338_c1_14326_14808 | 160 |
| 883 | 3300050491 | nmdc:mga00v17_608898_c1 | nmdc:mga00v17_608898_c1_19_501 | 160 |
| 884 | 3300050491 | nmdc:mga00v17_96017_c1 | nmdc:mga00v17_96017_c1_748_1233 | 160 |
| 885 | 3300050516 | nmdc:mga0sz30_209046_c1 | nmdc:mga0sz30_209046_c1_333_818 | 160 |
| 886 | 3300053080 | Ga0500635_0002379 | Ga0500635_0002379_2493_2993 | 160 |
| 887 | 3300053131 | Ga0500652_000207 | Ga0500652_000207_17982_18482 | 160 |
| 888 | 3300053134 | Ga0500658_0398222 | Ga0500658_0398222_110_595 | 160 |
| 889 | 3300053156 | Ga0500622_0296335 | Ga0500622_0296335_13_498 | 160 |
| 890 | 3300053161 | Ga0500634_0005943 | Ga0500634_0005943_5328_5810 | 160 |
| 891 | 3300053731 | Ga0500609_027077 | Ga0500609_027077_69_554 | 160 |
| 892 | 3300054114 | Ga0501084_0007709 | Ga0501084_0007709_6997_7491 | 160 |
| 893 | 3300060353 | Ga0501082_0000368 | Ga0501082_0000368_35426_35920 | 160 |
| 894 | 3300061734 | Ga0530510_0000025 | Ga0530510_0000025_21873_22367 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rfb-assembly1.cif.gz_A | structure of frmsr | 0.9729 | 15 | 160 |
| 3ksf-assembly3.cif.gz_F | structure of frmsr of staphylococcus aureus (reduced form) | 0.9726 | 15 | 160 |
| 5hl6-assembly1.cif.gz_A | crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis | 0.9691 | 9 | 159 |
| 5hl6-assembly1.cif.gz_B | crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis | 0.9675 | 8 | 159 |
| 1vhm-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.9587 | 10 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rfbA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9729 | 15 | 160 | 3.30.450.40 |
| 1vhmA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9587 | 10 | 158 | 3.30.450.40 |
| af_Q4DSC2_14_185_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9455 | 10 | 160 | 3.30.450.40 |
| af_Q8MTJ7_3_158_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9425 | 3 | 156 | 3.30.450.40 |
| af_Q8MTJ7_3_158_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9252 | 3 | 156 | 3.30.450.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G9YTU0-F1-model_v4 | GAF domain-containing protein | 0.9972 | 2 | 159 |
GO:0005829
GO:0033745 |
| AF-G7GX58-F1-model_v4 | GAF domain-containing protein | 0.9964 | 15 | 160 |
GO:0005829
GO:0033745 |
| AF-A0A2T2Z690-F1-model_v4 | GAF domain-containing protein | 0.996 | 11 | 159 |
GO:0005829
GO:0033745 |
| AF-A0A0S2DC16-F1-model_v4 | GAF domain protein | 0.9957 | 19 | 160 |
GO:0005829
GO:0033745 |
| AF-A0A3C0JB42-F1-model_v4 | Diguanylate cyclase | 0.9956 | 1 | 119 |
GO:0005829
GO:0033745 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar