F484809

General Info

Members Datasets Scaffolds Average Seq Length
889 343 889 232

Family's Representative Sequence

Representative Sequence 3300049768|Ga0501271_007320|Ga0501271_007320_20_793
Length 257
Sequence LAGYLLPLRLRRSCPSVLRTNGDELIALFDRKDQSEDELVSGSDAATRALSVAAVENDFVEGVYDKLAKVYDLIFGPTLHPGRLRAIERMDIQPGERVLEVGVGTGINLSLYPTHCHVTGIDFSSSMLEKARERVARKDIHSVRLLQMDAADLKFSTDSFDIVYAPYLISVVPDPVRVAQEMRRVCRPGGRIVFLNHFLSPNPILSRAERMISPMTIHIGFKSDLDLPAFLAQADLKPISIEKVNIPKIWSLVTSVK

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
192 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
193 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
220 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
221 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
222 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
223 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
224 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
225 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
226 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
227 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
228 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
229 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
294 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
295 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
296 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
297 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
324 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
325 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
329 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
330 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
336 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.3
Nodule 0
Rhizoplane 4.95
Rhizosphere 88.53
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10021937 3300001991 Bacteria 1222
2 JGI24744J21845_10009333 3300002077 Bacteria 2012
3 Ga0007416J51690_1062403 3300003577 Bacteria 854
4 Ga0032354_1051467 3300003693 Unclassified 975
5 Ga0058863_11348119 3300004799 Bacteria 776
6 Ga0058863_11372655 3300004799 Bacteria 984
7 Ga0058861_11984245 3300004800 Bacteria 948
8 Ga0058860_11794914 3300004801 Bacteria 867
9 Ga0065714_10136143 3300005288 Bacteria 1208
10 Ga0065712_10000477 3300005290 Bacteria 12101
11 Ga0065712_10003522 3300005290 Bacteria 6689
12 Ga0065712_10076567 3300005290 Bacteria 3638
13 Ga0065712_10102239 3300005290 Bacteria 2014
14 Ga0065712_10141289 3300005290 Bacteria 1448
15 Ga0065712_10200589 3300005290 Bacteria 1110
16 Ga0065715_10019037 3300005293 Archaea 2903
17 Ga0065715_10026217 3300005293 Unclassified 1919
18 Ga0065715_10090283 3300005293 Bacteria 7300
19 Ga0065715_10092283 3300005293 Bacteria 5203
20 Ga0065715_10094975 3300005293 Bacteria 4176
21 Ga0065715_10101127 3300005293 Bacteria 3234
22 Ga0065715_10114217 3300005293 Bacteria 2459
23 Ga0065715_10175914 3300005293 Bacteria 1512
24 Ga0065715_10204893 3300005293 Unclassified 1342
25 Ga0065715_10222887 3300005293 Bacteria 1264
26 Ga0065715_10311319 3300005293 Bacteria 1020
27 Ga0065715_10326582 3300005293 Bacteria 991
28 Ga0065715_10399287 3300005293 Bacteria 883
29 Ga0065715_10439296 3300005293 Bacteria 838
30 Ga0065707_10106216 3300005295 Bacteria 2606
31 Ga0065707_10118059 3300005295 Bacteria 2195
32 Ga0065707_10148463 3300005295 Bacteria 1670
33 Ga0065707_10202475 3300005295 Bacteria 1304
34 Ga0065707_10463193 3300005295 Bacteria 789
35 Ga0070683_100001987 3300005329 Bacteria 16026
36 Ga0070683_100056388 3300005329 Bacteria 3649
37 Ga0070683_100086019 3300005329 Bacteria 2948
38 Ga0070683_100375192 3300005329 Bacteria 1355
39 Ga0070690_100106953 3300005330 Bacteria 1861
40 Ga0070690_100177091 3300005330 Unclassified 1472
41 Ga0070670_100008366 3300005331 Bacteria 8819
42 Ga0070670_100020564 3300005331 Bacteria 5676
43 Ga0070670_100029005 3300005331 Bacteria 4763
44 Ga0070670_100045833 3300005331 Bacteria 3759
45 Ga0070670_100104607 3300005331 Bacteria 2438
46 Ga0070670_100147463 3300005331 Bacteria 2036
47 Ga0070677_10029454 3300005333 Bacteria 2082
48 Ga0070677_10166242 3300005333 Bacteria 1039
49 Ga0070677_10174544 3300005333 Bacteria 1019
50 Ga0068869_100156595 3300005334 Bacteria 1771
51 Ga0068869_100512305 3300005334 Bacteria 1003
52 Ga0070666_10047548 3300005335 Bacteria 2880
53 Ga0070666_10146555 3300005335 Bacteria 1646
54 Ga0070666_10269532 3300005335 Unclassified 1208
55 Ga0070680_100153809 3300005336 Unclassified 1932
56 Ga0070682_100150697 3300005337 Bacteria 1595
57 Ga0068868_100077209 3300005338 Bacteria 2664
58 Ga0068868_100080478 3300005338 Unclassified 2611
59 Ga0070689_100020431 3300005340 Bacteria 4913
60 Ga0070691_10054188 3300005341 Unclassified 1920
61 Ga0070687_100067214 3300005343 Bacteria 1912
62 Ga0070687_100091944 3300005343 Unclassified 1680
63 Ga0070661_100002279 3300005344 Bacteria 13174
64 Ga0070661_100091577 3300005344 Unclassified 2252
65 Ga0070661_100157775 3300005344 Bacteria 1717
66 Ga0070661_100286701 3300005344 Bacteria 1279
67 Ga0070661_100297700 3300005344 Bacteria 1255
68 Ga0070692_10106275 3300005345 Unclassified 1546
69 Ga0070669_100005348 3300005353 Bacteria 9267
70 Ga0070669_100517555 3300005353 Bacteria 991
71 Ga0070675_100044442 3300005354 Bacteria 3633
72 Ga0070675_100115369 3300005354 Unclassified 2277
73 Ga0070675_100128235 3300005354 Bacteria 2160
74 Ga0070671_100008914 3300005355 Bacteria 8048
75 Ga0070671_100036708 3300005355 Bacteria 4064
76 Ga0070671_100049389 3300005355 Bacteria 3501
77 Ga0070671_100193937 3300005355 Unclassified 1722
78 Ga0070671_100281269 3300005355 Unclassified 1415
79 Ga0070671_100874014 3300005355 Bacteria 785
80 Ga0070674_100086763 3300005356 Bacteria 2249
81 Ga0070674_100165719 3300005356 Bacteria 1680
82 Ga0070674_100307388 3300005356 Archaea 1266
83 Ga0070674_100314870 3300005356 Bacteria 1252
84 Ga0070674_100503535 3300005356 Unclassified 1009
85 Ga0070673_100003223 3300005364 Bacteria 10120
86 Ga0070673_100016706 3300005364 Bacteria 5200
87 Ga0070673_100784806 3300005364 Unclassified 879
88 Ga0070688_100017161 3300005365 Bacteria 4154
89 Ga0070659_100246438 3300005366 Unclassified 1480
90 Ga0070667_100255150 3300005367 Bacteria 1569
91 Ga0070667_100370374 3300005367 Bacteria 1300
92 Ga0070709_10154525 3300005434 Bacteria 1589
93 Ga0070709_10185749 3300005434 Bacteria 1463
94 Ga0070713_100005536 3300005436 Bacteria 8652
95 Ga0070710_10363301 3300005437 Bacteria 961
96 Ga0070710_10406993 3300005437 Bacteria 913
97 Ga0070701_10036952 3300005438 Bacteria 2463
98 Ga0070711_100092535 3300005439 Bacteria 2182
99 Ga0070711_100310796 3300005439 Unclassified 1256
100 Ga0070705_100258142 3300005440 Bacteria 1227
101 Ga0070705_100279163 3300005440 Bacteria 1187
102 Ga0070700_100115987 3300005441 Bacteria 1787
103 Ga0070700_100293652 3300005441 Bacteria 1183
104 Ga0070700_100524330 3300005441 Bacteria 916
105 Ga0070694_100015345 3300005444 Bacteria 4810
106 Ga0070694_100276075 3300005444 Bacteria 1280
107 Ga0070663_100133932 3300005455 Bacteria 1885
108 Ga0070663_100293534 3300005455 Bacteria 1299
109 Ga0070663_100366603 3300005455 Bacteria 1170
110 Ga0070678_100046570 3300005456 Bacteria 3110
111 Ga0070678_100121707 3300005456 Bacteria 2059
112 Ga0070678_100208935 3300005456 Bacteria 1616
113 Ga0070678_100446703 3300005456 Bacteria 1132
114 Ga0070662_100045226 3300005457 Bacteria 3157
115 Ga0070662_100154485 3300005457 Bacteria 1790
116 Ga0070662_100224390 3300005457 Bacteria 1501
117 Ga0070681_10024457 3300005458 Bacteria 6081
118 Ga0068867_100056868 3300005459 Bacteria 2895
119 Ga0070685_10038720 3300005466 Bacteria 2705
120 Ga0070685_10144521 3300005466 Bacteria 1501
121 Ga0070706_100275725 3300005467 Bacteria 1569
122 Ga0070707_100102722 3300005468 Bacteria 2770
123 Ga0070698_100069706 3300005471 Bacteria 3529
124 Ga0070698_100535601 3300005471 Bacteria 1110
125 Ga0070698_100849368 3300005471 Bacteria 858
126 Ga0070699_100006964 3300005518 Bacteria 9828
127 Ga0070699_100045871 3300005518 Bacteria 3782
128 Ga0070679_100020355 3300005530 Bacteria 6467
129 Ga0070679_100276835 3300005530 Bacteria 1631
130 Ga0070679_100411424 3300005530 Bacteria 1298
131 Ga0070684_100001908 3300005535 Bacteria 15287
132 Ga0070684_100148274 3300005535 Bacteria 2124
133 Ga0070697_100212294 3300005536 Bacteria 1648
134 Ga0070672_100007337 3300005543 Bacteria 7476
135 Ga0070672_100050952 3300005543 Bacteria 3227
136 Ga0070672_100051514 3300005543 Bacteria 3211
137 Ga0070672_100092368 3300005543 Bacteria 2443
138 Ga0070672_100137211 3300005543 Bacteria 2015
139 Ga0070672_100448753 3300005543 Bacteria 1111
140 Ga0070686_100005561 3300005544 Bacteria 6974
141 Ga0070686_100029678 3300005544 Bacteria 3329
142 Ga0070686_100056865 3300005544 Bacteria 2511
143 Ga0070686_100269276 3300005544 Bacteria 1252
144 Ga0070686_100298513 3300005544 Bacteria 1194
145 Ga0070693_100052330 3300005547 Unclassified 2340
146 Ga0070665_100246070 3300005548 Bacteria 1789
147 Ga0070665_100279617 3300005548 Bacteria 1671
148 Ga0070665_100475268 3300005548 Bacteria 1260
149 Ga0070665_100649983 3300005548 Bacteria 1067
150 Ga0070665_100832596 3300005548 Bacteria 936
151 Ga0070704_100237233 3300005549 Bacteria 1491
152 Ga0070704_100615141 3300005549 Bacteria 956
153 Ga0068855_100080579 3300005563 Bacteria 3775
154 Ga0068855_100221347 3300005563 Bacteria 2122
155 Ga0068855_100625399 3300005563 Bacteria 1159
156 Ga0070664_100001311 3300005564 Bacteria 19875
157 Ga0070664_100039698 3300005564 Bacteria 3967
158 Ga0070664_100066848 3300005564 Bacteria 3070
159 Ga0070664_100129074 3300005564 Bacteria 2220
160 Ga0068857_100244031 3300005577 Bacteria 1645
161 Ga0068854_100007928 3300005578 Bacteria 6798
162 Ga0068854_100142525 3300005578 Unclassified 1840
163 Ga0068856_100074414 3300005614 Bacteria 3363
164 Ga0068856_100481988 3300005614 Bacteria 1261
165 Ga0070702_100076737 3300005615 Bacteria 1989
166 Ga0068852_100108436 3300005616 Bacteria 2520
167 Ga0068852_100330431 3300005616 Bacteria 1483
168 Ga0068852_100848307 3300005616 Unclassified 929
169 Ga0068859_100429179 3300005617 Bacteria 1418
170 Ga0068859_100563900 3300005617 Bacteria 1233
171 Ga0068864_100042976 3300005618 Bacteria 3868
172 Ga0068864_100105772 3300005618 Unclassified 2501
173 Ga0068864_100259513 3300005618 Bacteria 1616
174 Ga0068861_100242043 3300005719 Bacteria 1535
175 Ga0068861_100278751 3300005719 Bacteria 1439
176 Ga0068861_100293311 3300005719 Unclassified 1405
177 Ga0068870_10064703 3300005840 Bacteria 1976
178 Ga0068863_100004415 3300005841 Bacteria 13870
179 Ga0068863_100088210 3300005841 Bacteria 2940
180 Ga0068863_100119807 3300005841 Unclassified 2509
181 Ga0068863_100815521 3300005841 Bacteria 931
182 Ga0068860_100077343 3300005843 Bacteria 3164
183 Ga0068860_100159922 3300005843 Unclassified 2171
184 Ga0068860_100341714 3300005843 Bacteria 1472
185 Ga0068860_100658006 3300005843 Bacteria 1056
186 Ga0068862_100122790 3300005844 Bacteria 2291
187 Ga0068862_100413101 3300005844 Bacteria 1265
188 Ga0068862_100637461 3300005844 Bacteria 1027
189 Ga0081539_10047867 3300005985 Unclassified 2437
190 Ga0070717_10049452 3300006028 Bacteria 3451
191 Ga0070717_10369932 3300006028 Bacteria 1284
192 Ga0075365_10046799 3300006038 Bacteria 2842
193 Ga0075365_10140043 3300006038 Bacteria 1679
194 Ga0075365_10148327 3300006038 Unclassified 1631
195 Ga0075368_10079634 3300006042 Bacteria 1332
196 Ga0075368_10109320 3300006042 Bacteria 1139
197 Ga0075363_100105179 3300006048 Bacteria 1565
198 Ga0075364_10001527 3300006051 Bacteria 12608
199 Ga0075364_10027904 3300006051 Bacteria 3609
200 Ga0075364_10057320 3300006051 Bacteria 2551
201 Ga0075364_10098488 3300006051 Bacteria 1945
202 Ga0070716_100098595 3300006173 Bacteria 1786
203 Ga0070716_100107250 3300006173 Bacteria 1724
204 Ga0075362_10036132 3300006177 Bacteria 2160
205 Ga0075362_10068370 3300006177 Unclassified 1618
206 Ga0075367_10007468 3300006178 Bacteria 5598
207 Ga0075367_10019063 3300006178 Bacteria 3798
208 Ga0075367_10026547 3300006178 Bacteria 3286
209 Ga0075367_10406317 3300006178 Bacteria 861
210 Ga0075369_10017347 3300006186 Bacteria 2917
211 Ga0075369_10127423 3300006186 Bacteria 1155
212 Ga0075366_10012901 3300006195 Bacteria 4749
213 Ga0075366_10020773 3300006195 Unclassified 3811
214 Ga0075366_10077657 3300006195 Bacteria 1981
215 Ga0075366_10113346 3300006195 Bacteria 1632
216 Ga0075366_10360145 3300006195 Bacteria 893
217 Ga0097621_100024680 3300006237 Bacteria 4697
218 Ga0097621_100682212 3300006237 Bacteria 945
219 Ga0075370_10009908 3300006353 Bacteria 4965
220 Ga0075370_10156368 3300006353 Bacteria 1337
221 Ga0075370_10375382 3300006353 Unclassified 851
222 Ga0075428_100000815 3300006844 Bacteria 32626
223 Ga0075428_100004986 3300006844 Bacteria 14743
224 Ga0075428_100010827 3300006844 Bacteria 10138
225 Ga0075428_100043003 3300006844 Bacteria 4967
226 Ga0075428_100075808 3300006844 Bacteria 3672
227 Ga0075428_100465421 3300006844 Bacteria 1354
228 Ga0075428_100724724 3300006844 Bacteria 1059
229 Ga0075430_100000790 3300006846 Bacteria 24524
230 Ga0075430_100049111 3300006846 Bacteria 3562
231 Ga0075430_100181980 3300006846 Unclassified 1748
232 Ga0075430_100363129 3300006846 Bacteria 1196
233 Ga0075430_100635419 3300006846 Unclassified 880
234 Ga0075431_100014813 3300006847 Bacteria 7894
235 Ga0075431_100017202 3300006847 Bacteria 7347
236 Ga0075431_100030446 3300006847 Bacteria 5559
237 Ga0075431_100095960 3300006847 Bacteria 3061
238 Ga0075431_100144689 3300006847 Bacteria 2450
239 Ga0075431_100385364 3300006847 Bacteria 1405
240 Ga0075431_100602075 3300006847 Bacteria 1083
241 Ga0075431_100849846 3300006847 Bacteria 884
242 Ga0075433_10002477 3300006852 Bacteria 14047
243 Ga0075433_10065014 3300006852 Bacteria 3199
244 Ga0075433_10070272 3300006852 Bacteria 3077
245 Ga0075433_10121539 3300006852 Bacteria 2319
246 Ga0075433_10128598 3300006852 Bacteria 2250
247 Ga0075433_10148937 3300006852 Bacteria 2081
248 Ga0075434_100000298 3300006871 Bacteria 35329
249 Ga0075434_100006405 3300006871 Bacteria 10788
250 Ga0075434_100067873 3300006871 Bacteria 3552
251 Ga0075434_100115686 3300006871 Bacteria 2695
252 Ga0075434_100189802 3300006871 Unclassified 2075
253 Ga0075434_100447375 3300006871 Bacteria 1313
254 Ga0075434_100509532 3300006871 Bacteria 1224
255 Ga0075434_100708638 3300006871 Unclassified 1024
256 Ga0075429_100010093 3300006880 Bacteria 8182
257 Ga0075429_100066198 3300006880 Bacteria 3145
258 Ga0075429_100106911 3300006880 Bacteria 2445
259 Ga0075429_100386693 3300006880 Bacteria 1225
260 Ga0068865_100010738 3300006881 Bacteria 5708
261 Ga0075436_100006302 3300006914 Bacteria 8128
262 Ga0075436_100016213 3300006914 Bacteria 5101
263 Ga0075436_100081620 3300006914 Bacteria 2242
264 Ga0075436_100482047 3300006914 Bacteria 906
265 Ga0097620_100429119 3300006931 Bacteria 1418
266 Ga0097620_100563901 3300006931 Bacteria 1233
267 Ga0075435_100001342 3300007076 Bacteria 15839
268 Ga0075435_100003529 3300007076 Bacteria 10616
269 Ga0075435_100020505 3300007076 Bacteria 5066
270 Ga0075435_100022425 3300007076 Bacteria 4872
271 Ga0075435_100048138 3300007076 Bacteria 3424
272 Ga0075435_100144823 3300007076 Bacteria 1995
273 Ga0075435_100307123 3300007076 Bacteria 1357
274 Ga0105240_10119156 3300009093 Bacteria 3180
275 Ga0105240_10181718 3300009093 Bacteria 2481
276 Ga0105240_10249664 3300009093 Bacteria 2053
277 Ga0105240_11062314 3300009093 Bacteria 863
278 Ga0111539_10000159 3300009094 Bacteria 76817
279 Ga0111539_10001132 3300009094 Bacteria 35254
280 Ga0111539_10005818 3300009094 Bacteria 15942
281 Ga0111539_10091748 3300009094 Bacteria 3569
282 Ga0111539_10108298 3300009094 Bacteria 3261
283 Ga0111539_10142013 3300009094 Bacteria 2811
284 Ga0111539_10150068 3300009094 Bacteria 2728
285 Ga0111539_10321933 3300009094 Bacteria 1799
286 Ga0111539_10495438 3300009094 Bacteria 1423
287 Ga0111539_10524650 3300009094 Bacteria 1380
288 Ga0111539_10555551 3300009094 Bacteria 1337
289 Ga0105245_10167129 3300009098 Bacteria 2092
290 Ga0105245_10205491 3300009098 Bacteria 1893
291 Ga0105245_11067305 3300009098 Unclassified 853
292 Ga0114129_10003080 3300009147 Bacteria 23394
293 Ga0114129_10004686 3300009147 Bacteria 19320
294 Ga0114129_10005936 3300009147 Bacteria 17285
295 Ga0114129_10005947 3300009147 Bacteria 17271
296 Ga0114129_10014940 3300009147 Bacteria 11062
297 Ga0114129_10015136 3300009147 Bacteria 10979
298 Ga0114129_10015339 3300009147 Bacteria 10902
299 Ga0114129_10018206 3300009147 Bacteria 10001
300 Ga0114129_10020092 3300009147 Bacteria 9506
301 Ga0114129_10020475 3300009147 Bacteria 9409
302 Ga0114129_10166577 3300009147 Bacteria 3007
303 Ga0114129_10349182 3300009147 Bacteria 1960
304 Ga0114129_10479429 3300009147 Bacteria 1628
305 Ga0114129_11105235 3300009147 Bacteria 992
306 Ga0105243_10059416 3300009148 Bacteria 3051
307 Ga0105243_10488889 3300009148 Bacteria 1163
308 Ga0105243_10616293 3300009148 Bacteria 1047
309 Ga0105241_10092922 3300009174 Bacteria 2383
310 Ga0105241_10170541 3300009174 Bacteria 1797
311 Ga0105241_10413795 3300009174 Bacteria 1185
312 Ga0105242_10075189 3300009176 Bacteria 2812
313 Ga0105242_10096956 3300009176 Bacteria 2492
314 Ga0105242_10191186 3300009176 Bacteria 1812
315 Ga0105242_10199882 3300009176 Bacteria 1775
316 Ga0105248_10008294 3300009177 Bacteria 11413
317 Ga0105248_10167534 3300009177 Bacteria 2476
318 Ga0105248_10173918 3300009177 Bacteria 2427
319 Ga0105248_10196066 3300009177 Unclassified 2275
320 Ga0105248_10281996 3300009177 Bacteria 1870
321 Ga0105248_10653983 3300009177 Bacteria 1186
322 Ga0105248_10856437 3300009177 Bacteria 1026
323 Ga0105237_10837143 3300009545 Bacteria 927
324 Ga0105238_10353014 3300009551 Bacteria 1460
325 Ga0105238_10386033 3300009551 Bacteria 1392
326 Ga0105249_10060895 3300009553 Bacteria 3463
327 Ga0105249_10167198 3300009553 Unclassified 2130
328 Ga0105249_10235170 3300009553 Bacteria 1809
329 Ga0105249_10514252 3300009553 Bacteria 1244
330 Ga0105249_10687924 3300009553 Unclassified 1082
331 Ga0105239_11002943 3300010375 Bacteria 960
332 Ga0105246_10063426 3300011119 Bacteria 2577
333 Ga0157370_10450483 3300013104 Bacteria 1183
334 Ga0157369_10290850 3300013105 Bacteria 1701
335 Ga0157374_10208906 3300013296 Bacteria 1914
336 Ga0157374_10432775 3300013296 Bacteria 1315
337 Ga0157374_10488361 3300013296 Bacteria 1235
338 Ga0163162_10049950 3300013306 Unclassified 4194
339 Ga0163162_10289786 3300013306 Bacteria 1769
340 Ga0157372_10253205 3300013307 Bacteria 2044
341 Ga0157372_10331013 3300013307 Unclassified 1774
342 Ga0157372_10341479 3300013307 Bacteria 1744
343 Ga0157372_11385527 3300013307 Unclassified 811
344 Ga0157375_10028868 3300013308 Bacteria 5208
345 Ga0157375_11009335 3300013308 Bacteria 972
346 Ga0157375_11029739 3300013308 Bacteria 962
347 Ga0157375_11031597 3300013308 Bacteria 961
348 Ga0163163_10083729 3300014325 Bacteria 3195
349 Ga0163163_10113490 3300014325 Bacteria 2740
350 Ga0163163_10117285 3300014325 Bacteria 2694
351 Ga0163163_10133092 3300014325 Bacteria 2527
352 Ga0163163_10742363 3300014325 Bacteria 1045
353 Ga0157380_10007670 3300014326 Bacteria 7678
354 Ga0157380_10020788 3300014326 Bacteria 4913
355 Ga0157380_10092269 3300014326 Bacteria 2502
356 Ga0157380_10211859 3300014326 Bacteria 1727
357 Ga0157380_10417305 3300014326 Bacteria 1279
358 Ga0157380_11082613 3300014326 Bacteria 840
359 Ga0157379_10020355 3300014968 Bacteria 5866
360 Ga0157379_10140554 3300014968 Bacteria 2177
361 Ga0157379_10202064 3300014968 Bacteria 1797
362 Ga0157376_10047766 3300014969 Bacteria 3536
363 Ga0157376_10179769 3300014969 Bacteria 1933
364 Ga0157376_10279250 3300014969 Unclassified 1572
365 Ga0157376_10924861 3300014969 Bacteria 891
366 Ga0163161_10079418 3300017792 Bacteria 2413
367 Ga0207673_1003453 3300025290 Bacteria 1850
368 Ga0207697_10001568 3300025315 Bacteria 12343
369 Ga0207697_10054229 3300025315 Bacteria 1661
370 Ga0207697_10184009 3300025315 Unclassified 916
371 Ga0207682_10067805 3300025893 Bacteria 1506
372 Ga0207688_10004015 3300025901 Bacteria 8014
373 Ga0207688_10053367 3300025901 Bacteria 2267
374 Ga0207688_10195398 3300025901 Bacteria 1212
375 Ga0207688_10296179 3300025901 Unclassified 988
376 Ga0207688_10305952 3300025901 Bacteria 973
377 Ga0207680_10110387 3300025903 Bacteria 1783
378 Ga0207685_10116977 3300025905 Bacteria 1164
379 Ga0207699_10124627 3300025906 Bacteria 1671
380 Ga0207699_10179719 3300025906 Bacteria 1421
381 Ga0207645_10012713 3300025907 Bacteria 5707
382 Ga0207645_10313286 3300025907 Bacteria 1046
383 Ga0207643_10147725 3300025908 Bacteria 1407
384 Ga0207654_10182794 3300025911 Bacteria 1369
385 Ga0207654_10302017 3300025911 Bacteria 1089
386 Ga0207707_10375601 3300025912 Bacteria 1222
387 Ga0207695_10323025 3300025913 Bacteria 1433
388 Ga0207663_10034360 3300025916 Bacteria 3031
389 Ga0207663_10275514 3300025916 Unclassified 1248
390 Ga0207660_10214060 3300025917 Bacteria 1510
391 Ga0207660_10323607 3300025917 Bacteria 1232
392 Ga0207662_10030434 3300025918 Bacteria 3132
393 Ga0207649_10276376 3300025920 Bacteria 1219
394 Ga0207649_10687926 3300025920 Bacteria 792
395 Ga0207652_10087310 3300025921 Bacteria 2735
396 Ga0207652_10395690 3300025921 Bacteria 1247
397 Ga0207652_10858722 3300025921 Bacteria 803
398 Ga0207646_10523838 3300025922 Unclassified 1067
399 Ga0207681_10022922 3300025923 Bacteria 3987
400 Ga0207681_10028318 3300025923 Bacteria 3628
401 Ga0207681_10630557 3300025923 Unclassified 888
402 Ga0207650_10053739 3300025925 Bacteria 2986
403 Ga0207650_10262410 3300025925 Bacteria 1401
404 Ga0207659_10083887 3300025926 Bacteria 2363
405 Ga0207659_10296959 3300025926 Bacteria 1325
406 Ga0207659_10341509 3300025926 Bacteria 1240
407 Ga0207659_10415188 3300025926 Bacteria 1128
408 Ga0207659_10739620 3300025926 Unclassified 843
409 Ga0207644_10031400 3300025931 Bacteria 3700
410 Ga0207644_10040068 3300025931 Bacteria 3310
411 Ga0207644_10384004 3300025931 Bacteria 1146
412 Ga0207690_10021122 3300025932 Bacteria 4032
413 Ga0207690_10279631 3300025932 Bacteria 1299
414 Ga0207706_10220706 3300025933 Bacteria 1660
415 Ga0207706_10313831 3300025933 Unclassified 1365
416 Ga0207706_10316390 3300025933 Bacteria 1359
417 Ga0207706_10352660 3300025933 Bacteria 1279
418 Ga0207706_10414114 3300025933 Bacteria 1168
419 Ga0207706_10499052 3300025933 Bacteria 1050
420 Ga0207686_10150383 3300025934 Bacteria 1620
421 Ga0207686_10301651 3300025934 Bacteria 1190
422 Ga0207709_10131390 3300025935 Bacteria 1707
423 Ga0207669_10012024 3300025937 Bacteria 4239
424 Ga0207669_10027751 3300025937 Bacteria 3105
425 Ga0207669_10120945 3300025937 Bacteria 1777
426 Ga0207669_10440284 3300025937 Bacteria 1030
427 Ga0207704_10116046 3300025938 Bacteria 1821
428 Ga0207665_10095209 3300025939 Bacteria 2069
429 Ga0207691_10012110 3300025940 Bacteria 8267
430 Ga0207691_10053824 3300025940 Bacteria 3673
431 Ga0207691_10053870 3300025940 Bacteria 3671
432 Ga0207691_10058645 3300025940 Bacteria 3501
433 Ga0207691_10079921 3300025940 Bacteria 2942
434 Ga0207691_10257260 3300025940 Unclassified 1505
435 Ga0207711_10050180 3300025941 Bacteria 3572
436 Ga0207711_10059923 3300025941 Bacteria 3278
437 Ga0207711_10189605 3300025941 Bacteria 1873
438 Ga0207711_10303301 3300025941 Bacteria 1473
439 Ga0207711_10347361 3300025941 Bacteria 1373
440 Ga0207711_10636473 3300025941 Bacteria 995
441 Ga0207689_10053462 3300025942 Bacteria 3327
442 Ga0207689_10507555 3300025942 Bacteria 1011
443 Ga0207661_10026010 3300025944 Bacteria 4455
444 Ga0207661_10045422 3300025944 Bacteria 3477
445 Ga0207661_10162472 3300025944 Bacteria 1939
446 Ga0207661_10165018 3300025944 Bacteria 1924
447 Ga0207679_10002292 3300025945 Bacteria 11801
448 Ga0207679_10076051 3300025945 Bacteria 2550
449 Ga0207679_10313861 3300025945 Bacteria 1355
450 Ga0207679_10321934 3300025945 Bacteria 1339
451 Ga0207679_10414307 3300025945 Bacteria 1188
452 Ga0207667_10263672 3300025949 Unclassified 1762
453 Ga0207667_10304950 3300025949 Bacteria 1627
454 Ga0207651_10004078 3300025960 Bacteria 7281
455 Ga0207651_10321873 3300025960 Bacteria 1293
456 Ga0207651_10387428 3300025960 Bacteria 1186
457 Ga0207712_10208920 3300025961 Bacteria 1553
458 Ga0207712_10219097 3300025961 Bacteria 1520
459 Ga0207712_10720588 3300025961 Bacteria 872
460 Ga0207668_10181457 3300025972 Bacteria 1661
461 Ga0207668_10493406 3300025972 Bacteria 1052
462 Ga0207640_10011327 3300025981 Bacteria 5047
463 Ga0207640_10397743 3300025981 Bacteria 1121
464 Ga0207658_10023108 3300025986 Bacteria 4337
465 Ga0207658_10478428 3300025986 Bacteria 1106
466 Ga0207678_10049029 3300026067 Bacteria 3649
467 Ga0207678_10076647 3300026067 Bacteria 2864
468 Ga0207678_10156509 3300026067 Bacteria 1946
469 Ga0207678_10250266 3300026067 Bacteria 1517
470 Ga0207678_10300597 3300026067 Archaea 1379
471 Ga0207708_10011422 3300026075 Bacteria 6613
472 Ga0207708_10148869 3300026075 Bacteria 1841
473 Ga0207708_10257132 3300026075 Bacteria 1409
474 Ga0207708_10266817 3300026075 Bacteria 1383
475 Ga0207708_10282220 3300026075 Bacteria 1346
476 Ga0207702_10133137 3300026078 Bacteria 2239
477 Ga0207702_10240774 3300026078 Bacteria 1695
478 Ga0207702_10369360 3300026078 Bacteria 1377
479 Ga0207641_10000667 3300026088 Bacteria 37425
480 Ga0207641_10733992 3300026088 Bacteria 974
481 Ga0207648_10039115 3300026089 Bacteria 4170
482 Ga0207648_10119632 3300026089 Bacteria 2315
483 Ga0207676_10046378 3300026095 Bacteria 3363
484 Ga0207676_10095408 3300026095 Bacteria 2453
485 Ga0207676_10107700 3300026095 Bacteria 2325
486 Ga0207675_100119993 3300026118 Bacteria 2487
487 Ga0207675_100487984 3300026118 Bacteria 1225
488 Ga0207675_100552154 3300026118 Unclassified 1151
489 Ga0207683_10024772 3300026121 Bacteria 5170
490 Ga0207683_10266084 3300026121 Unclassified 1566
491 Ga0207683_10377008 3300026121 Bacteria 1304
492 Ga0207683_10545856 3300026121 Bacteria 1071
493 Ga0207698_10927288 3300026142 Unclassified 879
494 Ga0209971_1028914 3300027682 Bacteria 1327
495 Ga0209813_10008064 3300027866 Bacteria 2649
496 Ga0207428_10001075 3300027907 Bacteria 29809
497 Ga0207428_10002569 3300027907 Bacteria 18144
498 Ga0207428_10009844 3300027907 Bacteria 8562
499 Ga0207428_10021461 3300027907 Bacteria 5468
500 Ga0207428_10073487 3300027907 Bacteria 2682
501 Ga0207428_10097373 3300027907 Unclassified 2277
502 Ga0207428_10183348 3300027907 Unclassified 1581
503 Ga0268266_10090768 3300028379 Bacteria 2678
504 Ga0268266_10249785 3300028379 Bacteria 1640
505 Ga0268266_10254068 3300028379 Bacteria 1627
506 Ga0268266_10548745 3300028379 Bacteria 1107
507 Ga0268265_10271588 3300028380 Bacteria 1513
508 Ga0268265_10350986 3300028380 Bacteria 1347
509 Ga0268265_10407880 3300028380 Bacteria 1258
510 Ga0268265_10467261 3300028380 Bacteria 1182
511 Ga0268264_10316667 3300028381 Bacteria 1474
512 Ga0268264_10325045 3300028381 Bacteria 1456
513 Ga0307408_100083765 3300031548 Bacteria 2390
514 Ga0307408_100121996 3300031548 Unclassified 2020
515 Ga0265314_10061270 3300031711 Unclassified 2563
516 Ga0307405_10108849 3300031731 Bacteria 1873
517 Ga0307405_10112770 3300031731 Bacteria 1845
518 Ga0307405_10123446 3300031731 Bacteria 1776
519 Ga0307413_10339984 3300031824 Bacteria 1154
520 Ga0307410_10124228 3300031852 Bacteria 1887
521 Ga0307406_10356004 3300031901 Bacteria 1146
522 Ga0307406_10609972 3300031901 Bacteria 901
523 Ga0307407_10094231 3300031903 Bacteria 1843
524 Ga0307412_10567391 3300031911 Bacteria 956
525 Ga0307409_100048523 3300031995 Bacteria 3232
526 Ga0307409_100159718 3300031995 Bacteria 1969
527 Ga0307409_100165738 3300031995 Bacteria 1939
528 Ga0307409_100190286 3300031995 Unclassified 1826
529 Ga0307409_100217530 3300031995 Bacteria 1722
530 Ga0307409_100435609 3300031995 Unclassified 1261
531 Ga0307409_101080386 3300031995 Bacteria 823
532 Ga0307416_100029805 3300032002 Bacteria 4083
533 Ga0307416_100045644 3300032002 Bacteria 3452
534 Ga0307416_100100825 3300032002 Bacteria 2512
535 Ga0307416_100110060 3300032002 Unclassified 2425
536 Ga0307416_100164543 3300032002 Unclassified 2056
537 Ga0307416_100174027 3300032002 Bacteria 2008
538 Ga0307416_100267712 3300032002 Unclassified 1675
539 Ga0307416_100292462 3300032002 Unclassified 1613
540 Ga0307414_10210073 3300032004 Bacteria 1590
541 Ga0307414_10292082 3300032004 Bacteria 1375
542 Ga0307414_10661173 3300032004 Bacteria 943
543 Ga0307411_10101415 3300032005 Bacteria 2037
544 Ga0307411_10223112 3300032005 Bacteria 1463
545 Ga0307415_100157787 3300032126 Bacteria 1754
546 Ga0307415_100308104 3300032126 Unclassified 1315
547 Ga0307415_100750888 3300032126 Bacteria 886
548 Ga0307415_100876209 3300032126 Bacteria 826
549 Ga0373948_0001350 3300034817 Bacteria 3370
550 Ga0373958_0044725 3300034819 Bacteria 917
551 Ga0373959_0028671 3300034820 Bacteria 1112
552 Ga0373938_0003342 3300034957 Bacteria 2625
553 Ga0373938_0061598 3300034957 Bacteria 879
554 Ga0373929_0000830 3300035085 Bacteria 6021
555 Ga0373940_0007532 3300035088 Bacteria 2461
556 Ga0373949_0002959 3300035090 Bacteria 4181
557 Ga0373951_0000480 3300035091 Bacteria 11448
558 Ga0373951_0025185 3300035091 Bacteria 1381
559 Ga0373952_0000212 3300035092 Bacteria 9165
560 Ga0373923_0069114 3300035111 Bacteria 1514
561 Ga0373923_0117452 3300035111 Unclassified 1186
562 Ga0373932_0000133 3300035112 Bacteria 21018
563 Ga0373939_0000812 3300035114 Bacteria 7708
564 Ga0373939_0039327 3300035114 Bacteria 1415
565 Ga0373939_0103554 3300035114 Bacteria 981
566 Ga0373941_0002759 3300035115 Bacteria 3899
567 Ga0373953_0033591 3300035117 Bacteria 2008
568 Ga0373960_0018506 3300035121 Bacteria 1817
569 Ga0373960_0075443 3300035121 Bacteria 1051
570 Ga0373943_0003044 3300035170 Bacteria 7617
571 Ga0373946_0004691 3300035171 Bacteria 4909
572 Ga0373946_0037118 3300035171 Bacteria 1979
573 Ga0373946_0061675 3300035171 Bacteria 1597
574 Ga0373955_0254619 3300035172 Unclassified 1053
575 Ga0373942_0005700 3300035207 Bacteria 2885
576 Ga0373961_0000926 3300035241 Bacteria 9781
577 Ga0373961_0009027 3300035241 Bacteria 2434
578 Ga0373961_0014747 3300035241 Unclassified 1989
579 Ga0373962_0000594 3300035242 Bacteria 8175
580 Ga0373962_0047046 3300035242 Unclassified 1233
581 Ga0373924_0035310 3300035410 Unclassified 2027
582 Ga0373924_0087859 3300035410 Bacteria 1328
583 Ga0373924_0171337 3300035410 Bacteria 954
584 Ga0373931_0001600 3300035691 Bacteria 9790
585 Ga0373931_0071850 3300035691 Bacteria 1891
586 Ga0373931_0158454 3300035691 Bacteria 1325
587 Ga0373935_0012031 3300035692 Bacteria 5201
588 Ga0373935_0186047 3300035692 Bacteria 1428
589 Ga0373933_0055618 3300035724 Bacteria 2374
590 Ga0373947_0069335 3300035725 Bacteria 2158
591 Ga0373937_0001133 3300036401 Bacteria 22430
592 Ga0373937_0036918 3300036401 Bacteria 4453
593 Ga0373937_0275752 3300036401 Bacteria 1588
594 Ga0373925_0003703 3300037068 Bacteria 11742
595 Ga0373925_0015321 3300037068 Bacteria 5545
596 Ga0373925_0739910 3300037068 Unclassified 811
597 Ga0395905_0793217 3300037471 Bacteria 850
598 Ga0395901_0728084 3300038443 Bacteria 987
599 Ga0439436_0082332 3300041404 Bacteria 896
600 Ga0439436_0082972 3300041404 Bacteria 892
601 Ga0439439_0013816 3300041406 Bacteria 1960
602 Ga0451795_0441604 3300041456 Bacteria 970
603 Ga0451849_1405725 3300041505 Unclassified 884
604 Ga0439433_0011412 3300041999 Bacteria 1946
605 Ga0439451_041683 3300042009 Bacteria 921
606 Ga0450920_005476 3300042122 Bacteria 2257
607 Ga0450896_001975 3300042133 Bacteria 2606
608 Ga0450898_007257 3300042134 Bacteria 1722
609 Ga0450899_018353 3300042135 Bacteria 809
610 Ga0439446_0019965 3300042156 Bacteria 1885
611 Ga0439434_0088557 3300042435 Unclassified 988
612 Ga0439435_0000936 3300042436 Bacteria 5068
613 Ga0439435_0010222 3300042436 Bacteria 2221
614 Ga0439435_0058046 3300042436 Unclassified 1122
615 Ga0439435_0116821 3300042436 Unclassified 832
616 Ga0439460_0011420 3300042461 Bacteria 2289
617 Ga0451577_0151231 3300042876 Bacteria 2088
618 Ga0453684_0400144 3300044712 Bacteria 1538
619 Ga0451576_0003826 3300045051 Bacteria 20230
620 Ga0451576_0302997 3300045051 Unclassified 1672
621 Ga0451576_1103677 3300045051 Unclassified 830
622 Ga0495603_0057471 3300046455 Bacteria 2302
623 Ga0495603_0102714 3300046455 Bacteria 1669
624 Ga0495629_0285534 3300046459 Bacteria 1132
625 Ga0495638_0003705 3300046460 Bacteria 11892
626 Ga0495580_0330700 3300046472 Bacteria 1035
627 Ga0495639_0100086 3300046475 Bacteria 1368
628 Ga0495594_0110689 3300046499 Bacteria 1549
629 Ga0495608_0140252 3300046511 Bacteria 1543
630 Ga0495630_0485819 3300046517 Bacteria 947
631 Ga0495652_0170262 3300046529 Unclassified 1682
632 Ga0495586_0188589 3300046535 Bacteria 1168
633 Ga0495587_0038631 3300046536 Bacteria 2861
634 Ga0495667_0097822 3300046559 Unclassified 1900
635 Ga0495667_0229425 3300046559 Bacteria 1184
636 Ga0495634_0216819 3300046642 Bacteria 1183
637 Ga0495635_0497936 3300046663 Bacteria 802
638 Ga0495599_0326441 3300046678 Unclassified 923
639 Ga0495647_0240858 3300046681 Bacteria 803
640 Ga0495658_0060984 3300046683 Unclassified 2165
641 Ga0495658_0481972 3300046683 Bacteria 793
642 Ga0495613_0006752 3300046689 Bacteria 8570
643 Ga0495600_0215870 3300046809 Bacteria 1228
644 Ga0495674_0011154 3300047319 Bacteria 8484
645 Ga0495672_0066901 3300047320 Bacteria 2048
646 Ga0495684_0000226 3300047471 Bacteria 44097
647 Ga0495684_0517052 3300047471 Bacteria 818
648 Ga0496100_0036166 3300048903 Bacteria 3112
649 Ga0496100_0255931 3300048903 Bacteria 1297
650 Ga0496100_0428151 3300048903 Bacteria 1012
651 Ga0496101_0001396 3300048904 Bacteria 14449
652 Ga0496101_0047743 3300048904 Bacteria 3075
653 Ga0496101_0125721 3300048904 Bacteria 1943
654 Ga0496102_0064346 3300048905 Bacteria 3359
655 Ga0496102_0190663 3300048905 Unclassified 1931
656 Ga0496102_0278369 3300048905 Bacteria 1577
657 Ga0496103_0161951 3300048906 Bacteria 1435
658 Ga0496104_0008772 3300048907 Bacteria 8990
659 Ga0496104_0017991 3300048907 Bacteria 6443
660 Ga0496104_0404124 3300048907 Bacteria 1278
661 Ga0496104_0544745 3300048907 Bacteria 1071
662 Ga0496105_0073215 3300048908 Unclassified 2831
663 Ga0496105_0079560 3300048908 Bacteria 2707
664 Ga0496105_0523944 3300048908 Bacteria 928
665 Ga0496106_0031956 3300048909 Bacteria 3923
666 Ga0496106_0349207 3300048909 Unclassified 1188
667 Ga0496106_0580931 3300048909 Bacteria 898
668 Ga0496106_0786111 3300048909 Bacteria 755
669 Ga0496107_0386571 3300048910 Bacteria 1041
670 Ga0496108_0072827 3300048911 Unclassified 2901
671 Ga0496108_0105953 3300048911 Bacteria 2401
672 Ga0496108_0295716 3300048911 Unclassified 1410
673 Ga0496108_0343433 3300048911 Bacteria 1302
674 Ga0496108_0469910 3300048911 Bacteria 1099
675 Ga0496109_0008449 3300048912 Bacteria 8755
676 Ga0496109_0423920 3300048912 Bacteria 1257
677 Ga0496110_0001028 3300048913 Bacteria 19617
678 Ga0496110_0047039 3300048913 Bacteria 3776
679 Ga0496110_0171715 3300048913 Bacteria 1967
680 Ga0496110_0282315 3300048913 Bacteria 1512
681 Ga0496111_0002876 3300048914 Bacteria 10513
682 Ga0496112_0012055 3300048915 Bacteria 7930
683 Ga0496112_0130428 3300048915 Bacteria 2485
684 Ga0496112_0474870 3300048915 Bacteria 1187
685 Ga0496114_0003318 3300048917 Bacteria 12366
686 Ga0496114_0016205 3300048917 Bacteria 6001
687 Ga0496114_0198069 3300048917 Bacteria 1758
688 Ga0496114_0773237 3300048917 Unclassified 838
689 Ga0496115_0052754 3300048918 Bacteria 3263
690 Ga0496115_0160647 3300048918 Bacteria 1857
691 Ga0501292_012949 3300049515 Bacteria 1278
692 Ga0501292_023063 3300049515 Unclassified 1016
693 Ga0501031_0430097 3300049568 Unclassified 853
694 Ga0501032_0371644 3300049569 Unclassified 920
695 Ga0501034_0028871 3300049571 Bacteria 5642
696 Ga0501034_0083559 3300049571 Bacteria 3195
697 Ga0501036_0121886 3300049572 Bacteria 2202
698 Ga0501036_0384228 3300049572 Unclassified 1171
699 Ga0501036_0424489 3300049572 Unclassified 1108
700 Ga0501039_0105191 3300049575 Bacteria 2204
701 Ga0501039_0198160 3300049575 Bacteria 1579
702 Ga0501039_0276605 3300049575 Unclassified 1320
703 Ga0501039_0627805 3300049575 Bacteria 842
704 Ga0501040_0118695 3300049576 Bacteria 1855
705 Ga0501040_0125178 3300049576 Bacteria 1805
706 Ga0501041_0442327 3300049577 Unclassified 825
707 Ga0501042_0101822 3300049578 Bacteria 2066
708 Ga0501042_0292817 3300049578 Unclassified 1176
709 Ga0501043_0097525 3300049579 Unclassified 2311
710 Ga0501046_0236032 3300049580 Unclassified 1350
711 Ga0501047_0048474 3300049581 Bacteria 4102
712 Ga0501048_0247109 3300049582 Unclassified 1266
713 Ga0501048_0573170 3300049582 Bacteria 810
714 Ga0501067_0127915 3300049583 Bacteria 1413
715 Ga0501069_0061543 3300049585 Bacteria 2096
716 Ga0501069_0154185 3300049585 Unclassified 1321
717 Ga0501071_0061541 3300049587 Bacteria 2719
718 Ga0501071_0161634 3300049587 Unclassified 1674
719 Ga0501071_0236836 3300049587 Bacteria 1376
720 Ga0501071_0461530 3300049587 Unclassified 973
721 Ga0501072_0012676 3300049588 Bacteria 6446
722 Ga0501072_0076812 3300049588 Bacteria 2643
723 Ga0501072_0151136 3300049588 Unclassified 1851
724 Ga0501072_0451560 3300049588 Bacteria 1018
725 Ga0501073_0000430 3300049589 Bacteria 28781
726 Ga0501073_0258642 3300049589 Bacteria 1201
727 Ga0501074_0059878 3300049590 Bacteria 2743
728 Ga0501074_0139387 3300049590 Bacteria 1735
729 Ga0501075_0025723 3300049591 Bacteria 4325
730 Ga0501075_0055996 3300049591 Bacteria 2968
731 Ga0501075_0065169 3300049591 Bacteria 2748
732 Ga0501075_0326697 3300049591 Bacteria 1169
733 Ga0501076_0029968 3300049592 Bacteria 4236
734 Ga0501076_0128736 3300049592 Bacteria 2052
735 Ga0501076_0344214 3300049592 Bacteria 1224
736 Ga0501076_0485570 3300049592 Unclassified 1018
737 Ga0501076_0639980 3300049592 Unclassified 877
738 Ga0501077_0230533 3300049593 Bacteria 1177
739 Ga0501235_009852 3300049669 Bacteria 2090
740 Ga0501239_011728 3300049672 Unclassified 983
741 Ga0501225_0068745 3300049705 Bacteria 1005
742 Ga0501079_0043341 3300049741 Bacteria 3473
743 Ga0501079_0061678 3300049741 Bacteria 2892
744 Ga0501079_0331616 3300049741 Bacteria 1192
745 Ga0501079_0361626 3300049741 Unclassified 1137
746 Ga0501080_0102502 3300049742 Bacteria 2655
747 Ga0501080_0225902 3300049742 Bacteria 1712
748 Ga0501080_0309341 3300049742 Unclassified 1432
749 Ga0501081_0063095 3300049743 Bacteria 2571
750 Ga0501081_0198816 3300049743 Unclassified 1453
751 Ga0501271_007320 3300049768 Unclassified 1110
752 Ga0501044_0004662 3300049823 Bacteria 15342
753 Ga0501045_0146040 3300049824 Unclassified 1759
754 Ga0501045_0371839 3300049824 Bacteria 1064
755 Ga0501045_0378093 3300049824 Bacteria 1054
756 nmdc:mga03683_30439_c1 3300050489 Bacteria 2160
757 nmdc:mga03683_63536_c1 3300050489 Unclassified 1565
758 nmdc:mga00v17_23849_c1 3300050491 Bacteria 3543
759 nmdc:mga00v17_321748_c1 3300050491 Bacteria 1005
760 nmdc:mga00v17_445680_c1 3300050491 Bacteria 841
761 nmdc:mga00v17_57772_c1 3300050491 Bacteria 2374
762 nmdc:mga00v17_66060_c1 3300050491 Bacteria 2233
763 nmdc:mga0yw44_132762_c1 3300050492 Bacteria 1613
764 nmdc:mga0yw44_146583_c1 3300050492 Bacteria 1537
765 nmdc:mga0yw44_72645_c1 3300050492 Unclassified 2139
766 nmdc:mga0k408_13316_c1 3300050493 Bacteria 4508
767 nmdc:mga0k408_202559_c1 3300050493 Unclassified 1185
768 nmdc:mga0k408_25762_c1 3300050493 Bacteria 3332
769 nmdc:mga0k408_35378_c1 3300050493 Bacteria 2864
770 nmdc:mga06z11_11222_c1 3300050494 Unclassified 3854
771 nmdc:mga06z11_17107_c1 3300050494 Bacteria 3283
772 nmdc:mga06z11_51310_c1 3300050494 Bacteria 2112
773 nmdc:mga06z11_66634_c1 3300050494 Bacteria 1894
774 nmdc:mga04h51_8770_c1 3300050495 Bacteria 2715
775 nmdc:mga07m45_168497_c1 3300050496 Bacteria 1272
776 nmdc:mga07m45_31196_c1 3300050496 Bacteria 2953
777 nmdc:mga05p37_1011882_c1 3300050507 Bacteria 881
778 nmdc:mga05p37_12570_c1 3300050507 Bacteria 10109
779 nmdc:mga05p37_1500_c2 3300050507 Bacteria 23791
780 nmdc:mga05p37_17645_c1 3300050507 Bacteria 8612
781 nmdc:mga05p37_221081_c1 3300050507 Bacteria 1771
782 nmdc:mga05p37_257111_c1 3300050507 Bacteria 2092
783 nmdc:mga05p37_27903_c2 3300050507 Bacteria 6521
784 nmdc:mga05p37_32706_c1 3300050507 Bacteria 6363
785 nmdc:mga05p37_5123_c1 3300050507 Bacteria 15369
786 nmdc:mga05p37_5835_c2 3300050507 Bacteria 10997
787 nmdc:mga05p37_65145_c1 3300050507 Bacteria 4484
788 nmdc:mga05p37_71086_c1 3300050507 Bacteria 4281
789 nmdc:mga09592_150062_c1 3300050508 Bacteria 2011
790 nmdc:mga09592_165039_c1 3300050508 Bacteria 1914
791 nmdc:mga09592_27688_c1 3300050508 Bacteria 4705
792 nmdc:mga09592_378024_c1 3300050508 Bacteria 1225
793 nmdc:mga09592_405460_c1 3300050508 Bacteria 1178
794 nmdc:mga09592_585007_c1 3300050508 Unclassified 957
795 nmdc:mga09592_9342_c1 3300050508 Bacteria 7973
796 nmdc:mga0qj67_124572_c1 3300050509 Bacteria 2085
797 nmdc:mga0qj67_188403_c1 3300050509 Bacteria 1677
798 nmdc:mga0qj67_202563_c1 3300050509 Unclassified 1612
799 nmdc:mga0qj67_31764_c1 3300050509 Unclassified 4115
800 nmdc:mga0qj67_4023_c1 3300050509 Bacteria 10645
801 nmdc:mga0qj67_88363_c1 3300050509 Bacteria 2488
802 nmdc:mga0qj67_96447_c1 3300050509 Bacteria 2381
803 nmdc:mga06r32_154420_c1 3300050510 Bacteria 2276
804 nmdc:mga06r32_176978_c1 3300050510 Bacteria 2118
805 nmdc:mga06r32_188657_c1 3300050510 Unclassified 2049
806 nmdc:mga06r32_53035_c1 3300050510 Bacteria 3885
807 nmdc:mga06r32_6030_c1 3300050510 Bacteria 10903
808 nmdc:mga06r32_652058_c1 3300050510 Bacteria 1021
809 nmdc:mga08y16_207016_c1 3300050511 Bacteria 2032
810 nmdc:mga08y16_254922_c1 3300050511 Bacteria 1813
811 nmdc:mga08y16_286616_c1 3300050511 Bacteria 1698
812 nmdc:mga08y16_506030_c1 3300050511 Bacteria 1227
813 nmdc:mga08y16_53398_c1 3300050511 Bacteria 4226
814 nmdc:mga08y16_61798_c1 3300050511 Bacteria 3911
815 nmdc:mga08y16_76858_c1 3300050511 Bacteria 3480
816 nmdc:mga08y16_89520_c1 3300050511 Bacteria 3207
817 nmdc:mga08y16_95715_c1 3300050511 Bacteria 3093
818 nmdc:mga08y16_99921_c1 3300050511 Bacteria 3021
819 nmdc:mga0n895_20034_c1 3300050512 Bacteria 6229
820 nmdc:mga0n895_219225_c1 3300050512 Bacteria 1932
821 nmdc:mga0n895_229_c1 3300050512 Bacteria 35421
822 nmdc:mga0n895_361484_c1 3300050512 Bacteria 1470
823 nmdc:mga0n895_427657_c1 3300050512 Unclassified 1338
824 nmdc:mga0n895_567231_c1 3300050512 Bacteria 1140
825 nmdc:mga0n895_71478_c1 3300050512 Bacteria 3441
826 nmdc:mga0rr50_103323_c1 3300050513 Unclassified 2243
827 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
828 nmdc:mga0rr50_159586_c1 3300050513 Bacteria 1829
829 nmdc:mga0rr50_219879_c1 3300050513 Bacteria 1568
830 nmdc:mga0rr50_22513_c1 3300050513 Bacteria 4327
831 nmdc:mga0rr50_250679_c1 3300050513 Bacteria 1470
832 nmdc:mga0rr50_3194_c1 3300050513 Bacteria 9370
833 nmdc:mga0rr50_45565_c1 3300050513 Bacteria 3224
834 nmdc:mga0rr50_602822_c1 3300050513 Unclassified 936
835 nmdc:mga0rr50_709628_c1 3300050513 Bacteria 858
836 nmdc:mga08x19_12392_c1 3300050514 Bacteria 5136
837 nmdc:mga08x19_72724_c1 3300050514 Bacteria 2243
838 nmdc:mga0a205_104477_c1 3300050515 Bacteria 2732
839 nmdc:mga0a205_138828_c1 3300050515 Bacteria 2331
840 nmdc:mga0a205_147733_c1 3300050515 Bacteria 2251
841 nmdc:mga0a205_18545_c1 3300050515 Bacteria 6544
842 nmdc:mga0a205_203041_c1 3300050515 Bacteria 1872
843 nmdc:mga0a205_257708_c1 3300050515 Bacteria 1622
844 nmdc:mga0a205_8071_c1 3300050515 Bacteria 9572
845 Ga0495601_0027119 3300053077 Bacteria 3541
846 Ga0495601_0264364 3300053077 Unclassified 1123
847 Ga0495601_0278148 3300053077 Bacteria 1091
848 Ga0495595_0018713 3300053084 Bacteria 2996
849 Ga0495619_0003775 3300053085 Bacteria 9743
850 Ga0495619_0012315 3300053085 Bacteria 5383
851 Ga0495619_0044076 3300053085 Bacteria 2927
852 Ga0495619_0067617 3300053085 Archaea 2386
853 Ga0495619_0302189 3300053085 Bacteria 1108
854 Ga0500641_0009818 3300053096 Bacteria 3447
855 Ga0500555_007562 3300053103 Bacteria 3087
856 Ga0500592_003976 3300053116 Bacteria 2361
857 Ga0500568_0004866 3300053139 Bacteria 7092
858 Ga0500616_0000567 3300053153 Bacteria 45260
859 Ga0500627_0221183 3300053158 Unclassified 845
860 Ga0500645_000402 3300053730 Bacteria 30326
861 Ga0500599_012921 3300053736 Bacteria 1125
862 Ga0501084_0028086 3300054114 Bacteria 4702
863 Ga0501084_0235088 3300054114 Bacteria 1547
864 Ga0501084_0257956 3300054114 Bacteria 1472
865 Ga0501084_0318615 3300054114 Bacteria 1313
866 Ga0590071_000026 3300059421 Bacteria 37861
867 Ga0590071_000236 3300059421 Bacteria 16159
868 Ga0590074_002005 3300059423 Bacteria 3332
869 Ga0590075_000068 3300059424 Bacteria 25784
870 Ga0590075_000183 3300059424 Bacteria 17452
871 Ga0590075_010098 3300059424 Bacteria 2270
872 Ga0590077_000212 3300059426 Bacteria 16714
873 Ga0590077_000467 3300059426 Bacteria 11366
874 Ga0587084_035243 3300059477 Unclassified 825
875 Ga0587091_027257 3300059511 Bacteria 1047
876 Ga0587091_057831 3300059511 Bacteria 815
877 Ga0587115_023167 3300059626 Bacteria 879
878 Ga0587062_031957 3300059639 Bacteria 811
879 Ga0587069_025428 3300059642 Bacteria 921
880 Ga0587071_027528 3300060344 Bacteria 1078
881 Ga0587071_046805 3300060344 Bacteria 884
882 Ga0501082_0171402 3300060353 Bacteria 1887
883 Ga0501082_0239270 3300060353 Unclassified 1580
884 Ga0501082_0301322 3300060353 Unclassified 1396
885 Ga0501082_0344687 3300060353 Bacteria 1298
886 Ga0530510_0060229 3300061734 Bacteria 2747
887 Ga0530510_0071377 3300061734 Bacteria 2521
888 Ga0530510_0099621 3300061734 Bacteria 2125
889 Ga0530510_0432236 3300061734 Unclassified 994

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006178 Ga0075367_10406317 Ga0075367_104063172 204
2 3300048915 Ga0496112_0474870 Ga0496112_0474870_552_1172 206
3 3300049588 Ga0501072_0151136 Ga0501072_0151136_1181_1801 206
4 3300046663 Ga0495635_0497936 Ga0495635_0497936_163_786 207
5 3300005336 Ga0070680_100153809 Ga0070680_1001538093 210
6 3300009094 Ga0111539_10142013 Ga0111539_101420133 210
7 3300028380 Ga0268265_10407880 Ga0268265_104078801 210
8 3300050511 nmdc:mga08y16_61798_c1 nmdc:mga08y16_61798_c1_2433_3116 210
9 3300025972 Ga0207668_10181457 Ga0207668_101814571 214
10 3300005293 Ga0065715_10101127 Ga0065715_101011273 217
11 3300005293 Ga0065715_10326582 Ga0065715_103265821 217
12 3300005295 Ga0065707_10106216 Ga0065707_101062162 217
13 3300005330 Ga0070690_100106953 Ga0070690_1001069533 217
14 3300005334 Ga0068869_100156595 Ga0068869_1001565953 217
15 3300005337 Ga0070682_100150697 Ga0070682_1001506972 217
16 3300005341 Ga0070691_10054188 Ga0070691_100541882 217
17 3300005343 Ga0070687_100091944 Ga0070687_1000919442 217
18 3300005353 Ga0070669_100517555 Ga0070669_1005175551 217
19 3300005354 Ga0070675_100115369 Ga0070675_1001153693 217
20 3300005364 Ga0070673_100003223 Ga0070673_10000322312 217
21 3300005365 Ga0070688_100017161 Ga0070688_1000171613 217
22 3300005438 Ga0070701_10036952 Ga0070701_100369523 217
23 3300005444 Ga0070694_100015345 Ga0070694_1000153454 217
24 3300005457 Ga0070662_100154485 Ga0070662_1001544853 217
25 3300005459 Ga0068867_100056868 Ga0068867_1000568682 217
26 3300005544 Ga0070686_100029678 Ga0070686_1000296783 217
27 3300049569 Ga0501032_0371644 Ga0501032_0371644_10_672 220
28 3300031711 Ga0265314_10061270 Ga0265314_100612702 222
29 3300005719 Ga0068861_100293311 Ga0068861_1002933112 223
30 3300006042 Ga0075368_10079634 Ga0075368_100796342 223
31 3300006178 Ga0075367_10019063 Ga0075367_100190633 223
32 3300006195 Ga0075366_10012901 Ga0075366_100129013 223
33 3300006353 Ga0075370_10156368 Ga0075370_101563681 223
34 3300026118 Ga0207675_100552154 Ga0207675_1005521542 223
35 3300027866 Ga0209813_10008064 Ga0209813_100080642 223
36 3300049592 Ga0501076_0485570 Ga0501076_0485570_86_760 223
37 3300050493 nmdc:mga0k408_25762_c1 nmdc:mga0k408_25762_c1_877_1551 223
38 3300050494 nmdc:mga06z11_66634_c1 nmdc:mga06z11_66634_c1_865_1539 223
39 3300050495 nmdc:mga04h51_8770_c1 nmdc:mga04h51_8770_c1_258_932 223
40 3300050496 nmdc:mga07m45_168497_c1 nmdc:mga07m45_168497_c1_477_1151 223
41 3300053158 Ga0500627_0221183 Ga0500627_0221183_54_728 223
42 3300006914 Ga0075436_100482047 Ga0075436_1004820471 226
43 3300041505 Ga0451849_1405725 Ga0451849_1405725_63_743 226
44 3300004799 Ga0058863_11348119 Ga0058863_113481191 227
45 3300005288 Ga0065714_10136143 Ga0065714_101361432 227
46 3300005290 Ga0065712_10003522 Ga0065712_100035222 227
47 3300005331 Ga0070670_100008366 Ga0070670_10000836610 227
48 3300005344 Ga0070661_100091577 Ga0070661_1000915772 227
49 3300005441 Ga0070700_100115987 Ga0070700_1001159872 227
50 3300005444 Ga0070694_100276075 Ga0070694_1002760752 227
51 3300005564 Ga0070664_100039698 Ga0070664_1000396984 227
52 3300005617 Ga0068859_100429179 Ga0068859_1004291793 227
53 3300005618 Ga0068864_100105772 Ga0068864_1001057723 227
54 3300005985 Ga0081539_10047867 Ga0081539_100478672 227
55 3300006844 Ga0075428_100465421 Ga0075428_1004654211 227
56 3300006844 Ga0075428_100724724 Ga0075428_1007247242 227
57 3300006846 Ga0075430_100181980 Ga0075430_1001819802 227
58 3300006931 Ga0097620_100429119 Ga0097620_1004291193 227
59 3300009094 Ga0111539_10005818 Ga0111539_1000581811 227
60 3300009553 Ga0105249_10687924 Ga0105249_106879241 227
61 3300014325 Ga0163163_10113490 Ga0163163_101134904 227
62 3300014326 Ga0157380_10007670 Ga0157380_100076707 227
63 3300014326 Ga0157380_10020788 Ga0157380_100207886 227
64 3300025917 Ga0207660_10214060 Ga0207660_102140603 227
65 3300025925 Ga0207650_10053739 Ga0207650_100537391 227
66 3300025945 Ga0207679_10313861 Ga0207679_103138612 227
67 3300026075 Ga0207708_10148869 Ga0207708_101488692 227
68 3300027907 Ga0207428_10001075 Ga0207428_1000107522 227
69 3300027907 Ga0207428_10183348 Ga0207428_101833483 227
70 3300028380 Ga0268265_10271588 Ga0268265_102715882 227
71 3300031995 Ga0307409_100435609 Ga0307409_1004356092 227
72 3300032002 Ga0307416_100292462 Ga0307416_1002924623 227
73 3300032004 Ga0307414_10292082 Ga0307414_102920821 227
74 3300032005 Ga0307411_10101415 Ga0307411_101014152 227
75 3300049587 Ga0501071_0236836 Ga0501071_0236836_243_926 227
76 3300049589 Ga0501073_0000430 Ga0501073_0000430_21870_22553 227
77 3300049590 Ga0501074_0059878 Ga0501074_0059878_2008_2691 227
78 3300049669 Ga0501235_009852 Ga0501235_009852_206_889 227
79 3300050509 nmdc:mga0qj67_202563_c1 nmdc:mga0qj67_202563_c1_461_1144 227
80 3300050511 nmdc:mga08y16_53398_c1 nmdc:mga08y16_53398_c1_624_1307 227
81 3300005290 Ga0065712_10200589 Ga0065712_102005892 228
82 3300005293 Ga0065715_10114217 Ga0065715_101142172 228
83 3300005293 Ga0065715_10222887 Ga0065715_102228872 228
84 3300005329 Ga0070683_100056388 Ga0070683_1000563881 228
85 3300005434 Ga0070709_10154525 Ga0070709_101545252 228
86 3300005437 Ga0070710_10406993 Ga0070710_104069932 228
87 3300005543 Ga0070672_100051514 Ga0070672_1000515143 228
88 3300005563 Ga0068855_100625399 Ga0068855_1006253991 228
89 3300005616 Ga0068852_100848307 Ga0068852_1008483071 228
90 3300006038 Ga0075365_10140043 Ga0075365_101400432 228
91 3300006048 Ga0075363_100105179 Ga0075363_1001051793 228
92 3300006051 Ga0075364_10001527 Ga0075364_100015278 228
93 3300006051 Ga0075364_10027904 Ga0075364_100279045 228
94 3300006051 Ga0075364_10057320 Ga0075364_100573202 228
95 3300006173 Ga0070716_100098595 Ga0070716_1000985952 228
96 3300006177 Ga0075362_10036132 Ga0075362_100361324 228
97 3300006178 Ga0075367_10026547 Ga0075367_100265474 228
98 3300006186 Ga0075369_10017347 Ga0075369_100173472 228
99 3300006186 Ga0075369_10127423 Ga0075369_101274231 228
100 3300006195 Ga0075366_10077657 Ga0075366_100776573 228
101 3300006195 Ga0075366_10113346 Ga0075366_101133462 228
102 3300006353 Ga0075370_10009908 Ga0075370_100099085 228
103 3300006852 Ga0075433_10128598 Ga0075433_101285982 228
104 3300006871 Ga0075434_100447375 Ga0075434_1004473752 228
105 3300009093 Ga0105240_10119156 Ga0105240_101191561 228
106 3300009147 Ga0114129_10003080 Ga0114129_100030805 228
107 3300009177 Ga0105248_10856437 Ga0105248_108564372 228
108 3300013296 Ga0157374_10208906 Ga0157374_102089062 228
109 3300013307 Ga0157372_11385527 Ga0157372_113855271 228
110 3300014969 Ga0157376_10179769 Ga0157376_101797692 228
111 3300025906 Ga0207699_10124627 Ga0207699_101246272 228
112 3300025922 Ga0207646_10523838 Ga0207646_105238382 228
113 3300025939 Ga0207665_10095209 Ga0207665_100952092 228
114 3300025940 Ga0207691_10053824 Ga0207691_100538243 228
115 3300025941 Ga0207711_10636473 Ga0207711_106364732 228
116 3300025944 Ga0207661_10026010 Ga0207661_100260102 228
117 3300025945 Ga0207679_10076051 Ga0207679_100760512 228
118 3300026142 Ga0207698_10927288 Ga0207698_109272882 228
119 3300035111 Ga0373923_0069114 Ga0373923_0069114_58_744 228
120 3300042436 Ga0439435_0010222 Ga0439435_0010222_947_1648 228
121 3300042461 Ga0439460_0011420 Ga0439460_0011420_1457_2158 228
122 3300046455 Ga0495603_0102714 Ga0495603_0102714_340_1026 228
123 3300046559 Ga0495667_0229425 Ga0495667_0229425_274_960 228
124 3300046642 Ga0495634_0216819 Ga0495634_0216819_379_1068 228
125 3300048907 Ga0496104_0544745 Ga0496104_0544745_260_946 228
126 3300049571 Ga0501034_0028871 Ga0501034_0028871_3234_3920 228
127 3300049575 Ga0501039_0627805 Ga0501039_0627805_91_786 228
128 3300049577 Ga0501041_0442327 Ga0501041_0442327_90_785 228
129 3300049587 Ga0501071_0461530 Ga0501071_0461530_21_716 228
130 3300049588 Ga0501072_0012676 Ga0501072_0012676_2247_2942 228
131 3300049741 Ga0501079_0043341 Ga0501079_0043341_934_1629 228
132 3300049742 Ga0501080_0102502 Ga0501080_0102502_1874_2560 228
133 3300049743 Ga0501081_0063095 Ga0501081_0063095_1793_2488 228
134 3300050489 nmdc:mga03683_30439_c1 nmdc:mga03683_30439_c1_1416_2102 228
135 3300050491 nmdc:mga00v17_23849_c1 nmdc:mga00v17_23849_c1_2404_3090 228
136 3300050491 nmdc:mga00v17_321748_c1 nmdc:mga00v17_321748_c1_12_698 228
137 3300050491 nmdc:mga00v17_445680_c1 nmdc:mga00v17_445680_c1_126_812 228
138 3300050491 nmdc:mga00v17_66060_c1 nmdc:mga00v17_66060_c1_200_886 228
139 3300050492 nmdc:mga0yw44_132762_c1 nmdc:mga0yw44_132762_c1_114_800 228
140 3300050493 nmdc:mga0k408_13316_c1 nmdc:mga0k408_13316_c1_3420_4106 228
141 3300050494 nmdc:mga06z11_51310_c1 nmdc:mga06z11_51310_c1_1394_2080 228
142 3300050496 nmdc:mga07m45_31196_c1 nmdc:mga07m45_31196_c1_95_781 228
143 3300050507 nmdc:mga05p37_17645_c1 nmdc:mga05p37_17645_c1_260_949 228
144 3300050512 nmdc:mga0n895_567231_c1 nmdc:mga0n895_567231_c1_76_762 228
145 3300050515 nmdc:mga0a205_147733_c1 nmdc:mga0a205_147733_c1_1273_1959 228
146 3300053085 Ga0495619_0302189 Ga0495619_0302189_84_770 228
147 3300059421 Ga0590071_000026 Ga0590071_000026_31280_31972 228
148 3300059424 Ga0590075_000183 Ga0590075_000183_5705_6397 228
149 3300059426 Ga0590077_000467 Ga0590077_000467_1441_2133 228
150 3300061734 Ga0530510_0432236 Ga0530510_0432236_108_803 228
151 3300004799 Ga0058863_11372655 Ga0058863_113726551 229
152 3300005290 Ga0065712_10141289 Ga0065712_101412892 229
153 3300005293 Ga0065715_10399287 Ga0065715_103992872 229
154 3300005293 Ga0065715_10439296 Ga0065715_104392961 229
155 3300005331 Ga0070670_100029005 Ga0070670_1000290053 229
156 3300005331 Ga0070670_100104607 Ga0070670_1001046072 229
157 3300005334 Ga0068869_100512305 Ga0068869_1005123052 229
158 3300005335 Ga0070666_10047548 Ga0070666_100475482 229
159 3300005340 Ga0070689_100020431 Ga0070689_1000204311 229
160 3300005356 Ga0070674_100314870 Ga0070674_1003148701 229
161 3300005434 Ga0070709_10185749 Ga0070709_101857492 229
162 3300005436 Ga0070713_100005536 Ga0070713_1000055364 229
163 3300005467 Ga0070706_100275725 Ga0070706_1002757252 229
164 3300005530 Ga0070679_100276835 Ga0070679_1002768352 229
165 3300005530 Ga0070679_100411424 Ga0070679_1004114242 229
166 3300005543 Ga0070672_100050952 Ga0070672_1000509523 229
167 3300005549 Ga0070704_100237233 Ga0070704_1002372331 229
168 3300005563 Ga0068855_100080579 Ga0068855_1000805792 229
169 3300005564 Ga0070664_100129074 Ga0070664_1001290742 229
170 3300005578 Ga0068854_100142525 Ga0068854_1001425252 229
171 3300005614 Ga0068856_100481988 Ga0068856_1004819882 229
172 3300005618 Ga0068864_100259513 Ga0068864_1002595132 229
173 3300005841 Ga0068863_100119807 Ga0068863_1001198072 229
174 3300005843 Ga0068860_100159922 Ga0068860_1001599222 229
175 3300005844 Ga0068862_100122790 Ga0068862_1001227902 229
176 3300006028 Ga0070717_10049452 Ga0070717_100494523 229
177 3300006038 Ga0075365_10046799 Ga0075365_100467992 229
178 3300006871 Ga0075434_100115686 Ga0075434_1001156862 229
179 3300007076 Ga0075435_100003529 Ga0075435_1000035296 229
180 3300009094 Ga0111539_10108298 Ga0111539_101082982 229
181 3300009094 Ga0111539_10321933 Ga0111539_103219332 229
182 3300009098 Ga0105245_10167129 Ga0105245_101671292 229
183 3300009147 Ga0114129_10005936 Ga0114129_100059368 229
184 3300009174 Ga0105241_10092922 Ga0105241_100929223 229
185 3300009176 Ga0105242_10096956 Ga0105242_100969563 229
186 3300009551 Ga0105238_10386033 Ga0105238_103860331 229
187 3300009553 Ga0105249_10167198 Ga0105249_101671983 229
188 3300013104 Ga0157370_10450483 Ga0157370_104504831 229
189 3300013306 Ga0163162_10289786 Ga0163162_102897862 229
190 3300013307 Ga0157372_10331013 Ga0157372_103310132 229
191 3300014326 Ga0157380_10417305 Ga0157380_104173052 229
192 3300025315 Ga0207697_10054229 Ga0207697_100542293 229
193 3300025907 Ga0207645_10012713 Ga0207645_100127133 229
194 3300025911 Ga0207654_10182794 Ga0207654_101827942 229
195 3300025912 Ga0207707_10375601 Ga0207707_103756012 229
196 3300025913 Ga0207695_10323025 Ga0207695_103230251 229
197 3300025917 Ga0207660_10323607 Ga0207660_103236071 229
198 3300025918 Ga0207662_10030434 Ga0207662_100304343 229
199 3300025921 Ga0207652_10395690 Ga0207652_103956902 229
200 3300025921 Ga0207652_10858722 Ga0207652_108587221 229
201 3300025923 Ga0207681_10022922 Ga0207681_100229223 229
202 3300025925 Ga0207650_10262410 Ga0207650_102624101 229
203 3300025926 Ga0207659_10415188 Ga0207659_104151882 229
204 3300025933 Ga0207706_10414114 Ga0207706_104141141 229
205 3300025937 Ga0207669_10440284 Ga0207669_104402842 229
206 3300025940 Ga0207691_10058645 Ga0207691_100586453 229
207 3300025941 Ga0207711_10059923 Ga0207711_100599232 229
208 3300025942 Ga0207689_10053462 Ga0207689_100534623 229
209 3300025942 Ga0207689_10507555 Ga0207689_105075552 229
210 3300025945 Ga0207679_10414307 Ga0207679_104143072 229
211 3300025949 Ga0207667_10263672 Ga0207667_102636722 229
212 3300025960 Ga0207651_10004078 Ga0207651_100040787 229
213 3300025961 Ga0207712_10208920 Ga0207712_102089201 229
214 3300025981 Ga0207640_10397743 Ga0207640_103977432 229
215 3300026075 Ga0207708_10011422 Ga0207708_100114222 229
216 3300026075 Ga0207708_10266817 Ga0207708_102668171 229
217 3300026078 Ga0207702_10240774 Ga0207702_102407742 229
218 3300026095 Ga0207676_10107700 Ga0207676_101077002 229
219 3300031901 Ga0307406_10609972 Ga0307406_106099721 229
220 3300031995 Ga0307409_101080386 Ga0307409_1010803861 229
221 3300034957 Ga0373938_0061598 Ga0373938_0061598_13_702 229
222 3300035114 Ga0373939_0103554 Ga0373939_0103554_188_877 229
223 3300035121 Ga0373960_0075443 Ga0373960_0075443_305_994 229
224 3300035171 Ga0373946_0061675 Ga0373946_0061675_672_1361 229
225 3300035241 Ga0373961_0009027 Ga0373961_0009027_1510_2199 229
226 3300035410 Ga0373924_0171337 Ga0373924_0171337_123_812 229
227 3300035691 Ga0373931_0071850 Ga0373931_0071850_1140_1829 229
228 3300035692 Ga0373935_0186047 Ga0373935_0186047_626_1315 229
229 3300035724 Ga0373933_0055618 Ga0373933_0055618_153_842 229
230 3300035725 Ga0373947_0069335 Ga0373947_0069335_176_865 229
231 3300036401 Ga0373937_0001133 Ga0373937_0001133_13090_13779 229
232 3300037068 Ga0373925_0003703 Ga0373925_0003703_8790_9479 229
233 3300037471 Ga0395905_0793217 Ga0395905_0793217_27_716 229
234 3300041404 Ga0439436_0082972 Ga0439436_0082972_36_725 229
235 3300041406 Ga0439439_0013816 Ga0439439_0013816_1020_1709 229
236 3300041999 Ga0439433_0011412 Ga0439433_0011412_536_1225 229
237 3300042156 Ga0439446_0019965 Ga0439446_0019965_1155_1844 229
238 3300048903 Ga0496100_0255931 Ga0496100_0255931_23_712 229
239 3300048910 Ga0496107_0386571 Ga0496107_0386571_31_720 229
240 3300048913 Ga0496110_0171715 Ga0496110_0171715_154_843 229
241 3300048915 Ga0496112_0130428 Ga0496112_0130428_1026_1715 229
242 3300049582 Ga0501048_0573170 Ga0501048_0573170_55_744 229
243 3300049583 Ga0501067_0127915 Ga0501067_0127915_46_735 229
244 3300049585 Ga0501069_0061543 Ga0501069_0061543_936_1625 229
245 3300050492 nmdc:mga0yw44_72645_c1 nmdc:mga0yw44_72645_c1_1124_1813 229
246 3300050507 nmdc:mga05p37_32706_c1 nmdc:mga05p37_32706_c1_3708_4397 229
247 3300050511 nmdc:mga08y16_286616_c1 nmdc:mga08y16_286616_c1_46_735 229
248 3300050512 nmdc:mga0n895_361484_c1 nmdc:mga0n895_361484_c1_664_1353 229
249 3300050513 nmdc:mga0rr50_103323_c1 nmdc:mga0rr50_103323_c1_195_884 229
250 3300050513 nmdc:mga0rr50_159586_c1 nmdc:mga0rr50_159586_c1_54_743 229
251 3300050513 nmdc:mga0rr50_709628_c1 nmdc:mga0rr50_709628_c1_13_702 229
252 3300059511 Ga0587091_027257 Ga0587091_027257_124_813 229
253 3300059626 Ga0587115_023167 Ga0587115_023167_114_803 229
254 3300059642 Ga0587069_025428 Ga0587069_025428_11_700 229
255 3300060344 Ga0587071_027528 Ga0587071_027528_276_965 229
256 3300060353 Ga0501082_0301322 Ga0501082_0301322_129_818 229
257 3300061734 Ga0530510_0099621 Ga0530510_0099621_377_1066 229
258 3300003577 Ga0007416J51690_1062403 Ga0007416J51690_10624031 230
259 3300003693 Ga0032354_1051467 Ga0032354_10514671 230
260 3300005290 Ga0065712_10000477 Ga0065712_100004773 230
261 3300005293 Ga0065715_10019037 Ga0065715_100190373 230
262 3300005293 Ga0065715_10090283 Ga0065715_100902832 230
263 3300005293 Ga0065715_10204893 Ga0065715_102048932 230
264 3300005329 Ga0070683_100001987 Ga0070683_1000019876 230
265 3300005331 Ga0070670_100045833 Ga0070670_1000458331 230
266 3300005333 Ga0070677_10166242 Ga0070677_101662421 230
267 3300005344 Ga0070661_100002279 Ga0070661_1000022796 230
268 3300005355 Ga0070671_100049389 Ga0070671_1000493892 230
269 3300005366 Ga0070659_100246438 Ga0070659_1002464381 230
270 3300005439 Ga0070711_100310796 Ga0070711_1003107961 230
271 3300005440 Ga0070705_100279163 Ga0070705_1002791631 230
272 3300005455 Ga0070663_100366603 Ga0070663_1003666031 230
273 3300005466 Ga0070685_10144521 Ga0070685_101445212 230
274 3300005471 Ga0070698_100535601 Ga0070698_1005356011 230
275 3300005518 Ga0070699_100045871 Ga0070699_1000458712 230
276 3300005535 Ga0070684_100001908 Ga0070684_1000019089 230
277 3300005543 Ga0070672_100137211 Ga0070672_1001372112 230
278 3300005544 Ga0070686_100269276 Ga0070686_1002692762 230
279 3300005547 Ga0070693_100052330 Ga0070693_1000523302 230
280 3300005564 Ga0070664_100001311 Ga0070664_1000013111 230
281 3300005844 Ga0068862_100413101 Ga0068862_1004131012 230
282 3300006844 Ga0075428_100010827 Ga0075428_1000108272 230
283 3300006847 Ga0075431_100385364 Ga0075431_1003853642 230
284 3300006852 Ga0075433_10121539 Ga0075433_101215392 230
285 3300006871 Ga0075434_100708638 Ga0075434_1007086382 230
286 3300006880 Ga0075429_100106911 Ga0075429_1001069112 230
287 3300007076 Ga0075435_100144823 Ga0075435_1001448232 230
288 3300007076 Ga0075435_100307123 Ga0075435_1003071231 230
289 3300009094 Ga0111539_10524650 Ga0111539_105246502 230
290 3300009148 Ga0105243_10488889 Ga0105243_104888892 230
291 3300009177 Ga0105248_10196066 Ga0105248_101960662 230
292 3300011119 Ga0105246_10063426 Ga0105246_100634263 230
293 3300014968 Ga0157379_10202064 Ga0157379_102020641 230
294 3300025916 Ga0207663_10275514 Ga0207663_102755141 230
295 3300025926 Ga0207659_10296959 Ga0207659_102969591 230
296 3300025932 Ga0207690_10021122 Ga0207690_100211222 230
297 3300025932 Ga0207690_10279631 Ga0207690_102796311 230
298 3300025940 Ga0207691_10257260 Ga0207691_102572602 230
299 3300025941 Ga0207711_10347361 Ga0207711_103473612 230
300 3300025944 Ga0207661_10045422 Ga0207661_100454223 230
301 3300025945 Ga0207679_10002292 Ga0207679_100022925 230
302 3300026067 Ga0207678_10156509 Ga0207678_101565092 230
303 3300026075 Ga0207708_10282220 Ga0207708_102822202 230
304 3300026095 Ga0207676_10046378 Ga0207676_100463781 230
305 3300027907 Ga0207428_10021461 Ga0207428_100214616 230
306 3300031995 Ga0307409_100217530 Ga0307409_1002175302 230
307 3300037068 Ga0373925_0739910 Ga0373925_0739910_100_798 230
308 3300042435 Ga0439434_0088557 Ga0439434_0088557_183_881 230
309 3300046681 Ga0495647_0240858 Ga0495647_0240858_23_718 230
310 3300048907 Ga0496104_0017991 Ga0496104_0017991_1596_2294 230
311 3300048908 Ga0496105_0073215 Ga0496105_0073215_771_1469 230
312 3300048911 Ga0496108_0072827 Ga0496108_0072827_1376_2074 230
313 3300048912 Ga0496109_0008449 Ga0496109_0008449_5855_6553 230
314 3300048913 Ga0496110_0001028 Ga0496110_0001028_18630_19328 230
315 3300048914 Ga0496111_0002876 Ga0496111_0002876_9396_10094 230
316 3300048915 Ga0496112_0012055 Ga0496112_0012055_79_777 230
317 3300050508 nmdc:mga09592_150062_c1 nmdc:mga09592_150062_c1_746_1444 230
318 3300050510 nmdc:mga06r32_652058_c1 nmdc:mga06r32_652058_c1_176_874 230
319 3300050511 nmdc:mga08y16_76858_c1 nmdc:mga08y16_76858_c1_2661_3359 230
320 3300050512 nmdc:mga0n895_219225_c1 nmdc:mga0n895_219225_c1_447_1145 230
321 3300050512 nmdc:mga0n895_427657_c1 nmdc:mga0n895_427657_c1_453_1151 230
322 3300050513 nmdc:mga0rr50_250679_c1 nmdc:mga0rr50_250679_c1_493_1191 230
323 3300050513 nmdc:mga0rr50_45565_c1 nmdc:mga0rr50_45565_c1_406_1104 230
324 3300050513 nmdc:mga0rr50_602822_c1 nmdc:mga0rr50_602822_c1_117_815 230
325 3300050515 nmdc:mga0a205_138828_c1 nmdc:mga0a205_138828_c1_1387_2085 230
326 3300050515 nmdc:mga0a205_257708_c1 nmdc:mga0a205_257708_c1_818_1516 230
327 3300059477 Ga0587084_035243 Ga0587084_035243_81_779 230
328 3300004800 Ga0058861_11984245 Ga0058861_119842451 231
329 3300005293 Ga0065715_10092283 Ga0065715_100922832 231
330 3300005331 Ga0070670_100020564 Ga0070670_1000205644 231
331 3300005344 Ga0070661_100286701 Ga0070661_1002867011 231
332 3300005354 Ga0070675_100044442 Ga0070675_1000444423 231
333 3300005355 Ga0070671_100036708 Ga0070671_1000367082 231
334 3300005355 Ga0070671_100281269 Ga0070671_1002812691 231
335 3300005356 Ga0070674_100165719 Ga0070674_1001657192 231
336 3300005437 Ga0070710_10363301 Ga0070710_103633011 231
337 3300005439 Ga0070711_100092535 Ga0070711_1000925352 231
338 3300005440 Ga0070705_100258142 Ga0070705_1002581421 231
339 3300005455 Ga0070663_100133932 Ga0070663_1001339322 231
340 3300005456 Ga0070678_100046570 Ga0070678_1000465702 231
341 3300005458 Ga0070681_10024457 Ga0070681_100244573 231
342 3300005468 Ga0070707_100102722 Ga0070707_1001027221 231
343 3300005471 Ga0070698_100069706 Ga0070698_1000697062 231
344 3300005471 Ga0070698_100849368 Ga0070698_1008493681 231
345 3300005530 Ga0070679_100020355 Ga0070679_1000203552 231
346 3300005535 Ga0070684_100148274 Ga0070684_1001482742 231
347 3300005536 Ga0070697_100212294 Ga0070697_1002122942 231
348 3300005543 Ga0070672_100092368 Ga0070672_1000923682 231
349 3300005544 Ga0070686_100056865 Ga0070686_1000568652 231
350 3300005548 Ga0070665_100649983 Ga0070665_1006499832 231
351 3300005548 Ga0070665_100832596 Ga0070665_1008325961 231
352 3300005564 Ga0070664_100066848 Ga0070664_1000668482 231
353 3300005577 Ga0068857_100244031 Ga0068857_1002440312 231
354 3300005615 Ga0070702_100076737 Ga0070702_1000767372 231
355 3300005616 Ga0068852_100330431 Ga0068852_1003304312 231
356 3300005617 Ga0068859_100563900 Ga0068859_1005639002 231
357 3300005618 Ga0068864_100042976 Ga0068864_1000429763 231
358 3300005719 Ga0068861_100278751 Ga0068861_1002787511 231
359 3300005840 Ga0068870_10064703 Ga0068870_100647032 231
360 3300005841 Ga0068863_100088210 Ga0068863_1000882102 231
361 3300005843 Ga0068860_100658006 Ga0068860_1006580061 231
362 3300006051 Ga0075364_10098488 Ga0075364_100984882 231
363 3300006173 Ga0070716_100107250 Ga0070716_1001072502 231
364 3300006195 Ga0075366_10360145 Ga0075366_103601452 231
365 3300006237 Ga0097621_100682212 Ga0097621_1006822122 231
366 3300006353 Ga0075370_10375382 Ga0075370_103753821 231
367 3300006847 Ga0075431_100144689 Ga0075431_1001446892 231
368 3300006871 Ga0075434_100189802 Ga0075434_1001898021 231
369 3300006880 Ga0075429_100386693 Ga0075429_1003866931 231
370 3300006931 Ga0097620_100563901 Ga0097620_1005639011 231
371 3300009148 Ga0105243_10616293 Ga0105243_106162931 231
372 3300009174 Ga0105241_10413795 Ga0105241_104137951 231
373 3300009176 Ga0105242_10191186 Ga0105242_101911862 231
374 3300009176 Ga0105242_10199882 Ga0105242_101998821 231
375 3300009177 Ga0105248_10281996 Ga0105248_102819962 231
376 3300009551 Ga0105238_10353014 Ga0105238_103530142 231
377 3300009553 Ga0105249_10514252 Ga0105249_105142522 231
378 3300013307 Ga0157372_10253205 Ga0157372_102532052 231
379 3300014325 Ga0163163_10117285 Ga0163163_101172853 231
380 3300014326 Ga0157380_11082613 Ga0157380_110826131 231
381 3300025901 Ga0207688_10053367 Ga0207688_100533672 231
382 3300025905 Ga0207685_10116977 Ga0207685_101169771 231
383 3300025908 Ga0207643_10147725 Ga0207643_101477252 231
384 3300025921 Ga0207652_10087310 Ga0207652_100873102 231
385 3300025923 Ga0207681_10630557 Ga0207681_106305571 231
386 3300025926 Ga0207659_10341509 Ga0207659_103415092 231
387 3300025926 Ga0207659_10739620 Ga0207659_107396201 231
388 3300025931 Ga0207644_10031400 Ga0207644_100314002 231
389 3300025937 Ga0207669_10120945 Ga0207669_101209452 231
390 3300025940 Ga0207691_10012110 Ga0207691_100121108 231
391 3300025941 Ga0207711_10050180 Ga0207711_100501802 231
392 3300025945 Ga0207679_10321934 Ga0207679_103219342 231
393 3300025960 Ga0207651_10387428 Ga0207651_103874281 231
394 3300025961 Ga0207712_10720588 Ga0207712_107205881 231
395 3300026067 Ga0207678_10049029 Ga0207678_100490292 231
396 3300026067 Ga0207678_10250266 Ga0207678_102502661 231
397 3300026075 Ga0207708_10257132 Ga0207708_102571322 231
398 3300026078 Ga0207702_10369360 Ga0207702_103693602 231
399 3300026089 Ga0207648_10119632 Ga0207648_101196322 231
400 3300026095 Ga0207676_10095408 Ga0207676_100954082 231
401 3300026121 Ga0207683_10024772 Ga0207683_100247722 231
402 3300028379 Ga0268266_10249785 Ga0268266_102497852 231
403 3300028380 Ga0268265_10467261 Ga0268265_104672612 231
404 3300028381 Ga0268264_10325045 Ga0268264_103250452 231
405 3300031901 Ga0307406_10356004 Ga0307406_103560042 231
406 3300032126 Ga0307415_100750888 Ga0307415_1007508881 231
407 3300035171 Ga0373946_0037118 Ga0373946_0037118_65_763 231
408 3300035172 Ga0373955_0254619 Ga0373955_0254619_56_754 231
409 3300035410 Ga0373924_0087859 Ga0373924_0087859_190_888 231
410 3300036401 Ga0373937_0036918 Ga0373937_0036918_3053_3751 231
411 3300042122 Ga0450920_005476 Ga0450920_005476_1454_2155 231
412 3300042135 Ga0450899_018353 Ga0450899_018353_59_760 231
413 3300044712 Ga0453684_0400144 Ga0453684_0400144_709_1407 231
414 3300048903 Ga0496100_0036166 Ga0496100_0036166_1416_2114 231
415 3300048904 Ga0496101_0001396 Ga0496101_0001396_851_1549 231
416 3300048905 Ga0496102_0190663 Ga0496102_0190663_504_1202 231
417 3300048907 Ga0496104_0404124 Ga0496104_0404124_328_1026 231
418 3300048908 Ga0496105_0079560 Ga0496105_0079560_393_1091 231
419 3300048911 Ga0496108_0469910 Ga0496108_0469910_268_972 231
420 3300048917 Ga0496114_0016205 Ga0496114_0016205_3314_4012 231
421 3300048918 Ga0496115_0160647 Ga0496115_0160647_786_1484 231
422 3300049571 Ga0501034_0083559 Ga0501034_0083559_1783_2481 231
423 3300049579 Ga0501043_0097525 Ga0501043_0097525_399_1097 231
424 3300049581 Ga0501047_0048474 Ga0501047_0048474_1112_1810 231
425 3300049823 Ga0501044_0004662 Ga0501044_0004662_7994_8692 231
426 3300050491 nmdc:mga00v17_57772_c1 nmdc:mga00v17_57772_c1_1090_1794 231
427 3300050492 nmdc:mga0yw44_146583_c1 nmdc:mga0yw44_146583_c1_474_1178 231
428 3300050494 nmdc:mga06z11_17107_c1 nmdc:mga06z11_17107_c1_1974_2678 231
429 3300050508 nmdc:mga09592_378024_c1 nmdc:mga09592_378024_c1_421_1119 231
430 3300053077 Ga0495601_0264364 Ga0495601_0264364_50_748 231
431 3300053085 Ga0495619_0044076 Ga0495619_0044076_2042_2740 231
432 3300054114 Ga0501084_0257956 Ga0501084_0257956_715_1413 231
433 3300004801 Ga0058860_11794914 Ga0058860_117949141 232
434 3300005290 Ga0065712_10102239 Ga0065712_101022392 232
435 3300005293 Ga0065715_10094975 Ga0065715_100949754 232
436 3300005293 Ga0065715_10175914 Ga0065715_101759142 232
437 3300005293 Ga0065715_10311319 Ga0065715_103113192 232
438 3300005295 Ga0065707_10118059 Ga0065707_101180592 232
439 3300005295 Ga0065707_10148463 Ga0065707_101484632 232
440 3300005295 Ga0065707_10463193 Ga0065707_104631931 232
441 3300005329 Ga0070683_100086019 Ga0070683_1000860192 232
442 3300005329 Ga0070683_100375192 Ga0070683_1003751922 232
443 3300005330 Ga0070690_100177091 Ga0070690_1001770912 232
444 3300005331 Ga0070670_100147463 Ga0070670_1001474631 232
445 3300005333 Ga0070677_10029454 Ga0070677_100294542 232
446 3300005333 Ga0070677_10174544 Ga0070677_101745442 232
447 3300005335 Ga0070666_10146555 Ga0070666_101465551 232
448 3300005335 Ga0070666_10269532 Ga0070666_102695321 232
449 3300005338 Ga0068868_100080478 Ga0068868_1000804782 232
450 3300005343 Ga0070687_100067214 Ga0070687_1000672142 232
451 3300005344 Ga0070661_100157775 Ga0070661_1001577752 232
452 3300005344 Ga0070661_100297700 Ga0070661_1002977002 232
453 3300005353 Ga0070669_100005348 Ga0070669_1000053487 232
454 3300005354 Ga0070675_100128235 Ga0070675_1001282352 232
455 3300005355 Ga0070671_100008914 Ga0070671_1000089142 232
456 3300005355 Ga0070671_100874014 Ga0070671_1008740141 232
457 3300005356 Ga0070674_100307388 Ga0070674_1003073881 232
458 3300005356 Ga0070674_100503535 Ga0070674_1005035352 232
459 3300005364 Ga0070673_100016706 Ga0070673_1000167065 232
460 3300005367 Ga0070667_100255150 Ga0070667_1002551502 232
461 3300005367 Ga0070667_100370374 Ga0070667_1003703742 232
462 3300005441 Ga0070700_100524330 Ga0070700_1005243302 232
463 3300005455 Ga0070663_100293534 Ga0070663_1002935342 232
464 3300005456 Ga0070678_100208935 Ga0070678_1002089352 232
465 3300005457 Ga0070662_100224390 Ga0070662_1002243901 232
466 3300005466 Ga0070685_10038720 Ga0070685_100387202 232
467 3300005518 Ga0070699_100006964 Ga0070699_1000069647 232
468 3300005543 Ga0070672_100007337 Ga0070672_1000073373 232
469 3300005544 Ga0070686_100005561 Ga0070686_1000055612 232
470 3300005548 Ga0070665_100279617 Ga0070665_1002796172 232
471 3300005549 Ga0070704_100615141 Ga0070704_1006151412 232
472 3300005563 Ga0068855_100221347 Ga0068855_1002213472 232
473 3300005578 Ga0068854_100007928 Ga0068854_1000079283 232
474 3300005614 Ga0068856_100074414 Ga0068856_1000744142 232
475 3300005616 Ga0068852_100108436 Ga0068852_1001084362 232
476 3300005719 Ga0068861_100242043 Ga0068861_1002420431 232
477 3300005841 Ga0068863_100004415 Ga0068863_10000441513 232
478 3300005843 Ga0068860_100077343 Ga0068860_1000773432 232
479 3300005843 Ga0068860_100341714 Ga0068860_1003417141 232
480 3300005844 Ga0068862_100637461 Ga0068862_1006374612 232
481 3300006028 Ga0070717_10369932 Ga0070717_103699322 232
482 3300006237 Ga0097621_100024680 Ga0097621_1000246805 232
483 3300006844 Ga0075428_100004986 Ga0075428_1000049865 232
484 3300006846 Ga0075430_100363129 Ga0075430_1003631292 232
485 3300006847 Ga0075431_100095960 Ga0075431_1000959602 232
486 3300006847 Ga0075431_100849846 Ga0075431_1008498462 232
487 3300006852 Ga0075433_10065014 Ga0075433_100650142 232
488 3300006852 Ga0075433_10070272 Ga0075433_100702722 232
489 3300006852 Ga0075433_10148937 Ga0075433_101489372 232
490 3300006871 Ga0075434_100000298 Ga0075434_10000029824 232
491 3300006871 Ga0075434_100006405 Ga0075434_1000064052 232
492 3300006871 Ga0075434_100067873 Ga0075434_1000678732 232
493 3300006871 Ga0075434_100509532 Ga0075434_1005095321 232
494 3300006881 Ga0068865_100010738 Ga0068865_1000107384 232
495 3300006914 Ga0075436_100006302 Ga0075436_1000063024 232
496 3300006914 Ga0075436_100016213 Ga0075436_1000162132 232
497 3300006914 Ga0075436_100081620 Ga0075436_1000816202 232
498 3300007076 Ga0075435_100001342 Ga0075435_1000013427 232
499 3300007076 Ga0075435_100020505 Ga0075435_1000205054 232
500 3300007076 Ga0075435_100022425 Ga0075435_1000224255 232
501 3300007076 Ga0075435_100048138 Ga0075435_1000481383 232
502 3300009093 Ga0105240_10181718 Ga0105240_101817182 232
503 3300009093 Ga0105240_10249664 Ga0105240_102496642 232
504 3300009093 Ga0105240_11062314 Ga0105240_110623141 232
505 3300009094 Ga0111539_10150068 Ga0111539_101500682 232
506 3300009094 Ga0111539_10555551 Ga0111539_105555512 232
507 3300009098 Ga0105245_10205491 Ga0105245_102054911 232
508 3300009098 Ga0105245_11067305 Ga0105245_110673051 232
509 3300009147 Ga0114129_10005947 Ga0114129_100059472 232
510 3300009147 Ga0114129_10015136 Ga0114129_1001513610 232
511 3300009147 Ga0114129_10018206 Ga0114129_100182066 232
512 3300009147 Ga0114129_10020475 Ga0114129_100204758 232
513 3300009147 Ga0114129_10349182 Ga0114129_103491822 232
514 3300009148 Ga0105243_10059416 Ga0105243_100594162 232
515 3300009176 Ga0105242_10075189 Ga0105242_100751892 232
516 3300009177 Ga0105248_10008294 Ga0105248_100082946 232
517 3300009177 Ga0105248_10167534 Ga0105248_101675342 232
518 3300009177 Ga0105248_10173918 Ga0105248_101739182 232
519 3300009177 Ga0105248_10653983 Ga0105248_106539832 232
520 3300009545 Ga0105237_10837143 Ga0105237_108371431 232
521 3300009553 Ga0105249_10060895 Ga0105249_100608953 232
522 3300009553 Ga0105249_10235170 Ga0105249_102351702 232
523 3300010375 Ga0105239_11002943 Ga0105239_110029431 232
524 3300013105 Ga0157369_10290850 Ga0157369_102908502 232
525 3300013296 Ga0157374_10432775 Ga0157374_104327752 232
526 3300013296 Ga0157374_10488361 Ga0157374_104883612 232
527 3300013306 Ga0163162_10049950 Ga0163162_100499502 232
528 3300013307 Ga0157372_10341479 Ga0157372_103414792 232
529 3300013308 Ga0157375_10028868 Ga0157375_100288682 232
530 3300013308 Ga0157375_11029739 Ga0157375_110297391 232
531 3300013308 Ga0157375_11031597 Ga0157375_110315971 232
532 3300014325 Ga0163163_10133092 Ga0163163_101330922 232
533 3300014326 Ga0157380_10092269 Ga0157380_100922692 232
534 3300014968 Ga0157379_10020355 Ga0157379_100203553 232
535 3300014968 Ga0157379_10140554 Ga0157379_101405542 232
536 3300014969 Ga0157376_10047766 Ga0157376_100477663 232
537 3300014969 Ga0157376_10279250 Ga0157376_102792502 232
538 3300017792 Ga0163161_10079418 Ga0163161_100794182 232
539 3300025893 Ga0207682_10067805 Ga0207682_100678052 232
540 3300025901 Ga0207688_10195398 Ga0207688_101953982 232
541 3300025901 Ga0207688_10296179 Ga0207688_102961791 232
542 3300025906 Ga0207699_10179719 Ga0207699_101797192 232
543 3300025907 Ga0207645_10313286 Ga0207645_103132862 232
544 3300025916 Ga0207663_10034360 Ga0207663_100343603 232
545 3300025920 Ga0207649_10276376 Ga0207649_102763762 232
546 3300025923 Ga0207681_10028318 Ga0207681_100283182 232
547 3300025933 Ga0207706_10220706 Ga0207706_102207061 232
548 3300025933 Ga0207706_10316390 Ga0207706_103163902 232
549 3300025933 Ga0207706_10499052 Ga0207706_104990522 232
550 3300025934 Ga0207686_10150383 Ga0207686_101503832 232
551 3300025934 Ga0207686_10301651 Ga0207686_103016511 232
552 3300025935 Ga0207709_10131390 Ga0207709_101313902 232
553 3300025938 Ga0207704_10116046 Ga0207704_101160462 232
554 3300025940 Ga0207691_10079921 Ga0207691_100799213 232
555 3300025941 Ga0207711_10189605 Ga0207711_101896051 232
556 3300025941 Ga0207711_10303301 Ga0207711_103033012 232
557 3300025944 Ga0207661_10162472 Ga0207661_101624721 232
558 3300025944 Ga0207661_10165018 Ga0207661_101650182 232
559 3300025949 Ga0207667_10304950 Ga0207667_103049502 232
560 3300025960 Ga0207651_10321873 Ga0207651_103218731 232
561 3300025961 Ga0207712_10219097 Ga0207712_102190972 232
562 3300025972 Ga0207668_10493406 Ga0207668_104934062 232
563 3300025981 Ga0207640_10011327 Ga0207640_100113275 232
564 3300025986 Ga0207658_10478428 Ga0207658_104784282 232
565 3300026078 Ga0207702_10133137 Ga0207702_101331372 232
566 3300026088 Ga0207641_10000667 Ga0207641_1000066716 232
567 3300026088 Ga0207641_10733992 Ga0207641_107339921 232
568 3300026089 Ga0207648_10039115 Ga0207648_100391154 232
569 3300026118 Ga0207675_100119993 Ga0207675_1001199932 232
570 3300026118 Ga0207675_100487984 Ga0207675_1004879841 232
571 3300026121 Ga0207683_10377008 Ga0207683_103770082 232
572 3300027682 Ga0209971_1028914 Ga0209971_10289142 232
573 3300027907 Ga0207428_10073487 Ga0207428_100734872 232
574 3300028379 Ga0268266_10090768 Ga0268266_100907683 232
575 3300028380 Ga0268265_10350986 Ga0268265_103509862 232
576 3300028381 Ga0268264_10316667 Ga0268264_103166672 232
577 3300031548 Ga0307408_100121996 Ga0307408_1001219962 232
578 3300032002 Ga0307416_100045644 Ga0307416_1000456442 232
579 3300032002 Ga0307416_100164543 Ga0307416_1001645432 232
580 3300032002 Ga0307416_100174027 Ga0307416_1001740272 232
581 3300032004 Ga0307414_10661173 Ga0307414_106611731 232
582 3300032126 Ga0307415_100308104 Ga0307415_1003081041 232
583 3300034817 Ga0373948_0001350 Ga0373948_0001350_527_1228 232
584 3300034819 Ga0373958_0044725 Ga0373958_0044725_99_800 232
585 3300034820 Ga0373959_0028671 Ga0373959_0028671_171_872 232
586 3300034957 Ga0373938_0003342 Ga0373938_0003342_1161_1862 232
587 3300035085 Ga0373929_0000830 Ga0373929_0000830_26_727 232
588 3300035088 Ga0373940_0007532 Ga0373940_0007532_923_1624 232
589 3300035090 Ga0373949_0002959 Ga0373949_0002959_841_1542 232
590 3300035091 Ga0373951_0000480 Ga0373951_0000480_10536_11237 232
591 3300035091 Ga0373951_0025185 Ga0373951_0025185_55_756 232
592 3300035092 Ga0373952_0000212 Ga0373952_0000212_3974_4675 232
593 3300035111 Ga0373923_0117452 Ga0373923_0117452_208_909 232
594 3300035112 Ga0373932_0000133 Ga0373932_0000133_7338_8039 232
595 3300035114 Ga0373939_0000812 Ga0373939_0000812_92_793 232
596 3300035114 Ga0373939_0039327 Ga0373939_0039327_470_1171 232
597 3300035115 Ga0373941_0002759 Ga0373941_0002759_762_1463 232
598 3300035117 Ga0373953_0033591 Ga0373953_0033591_1228_1929 232
599 3300035121 Ga0373960_0018506 Ga0373960_0018506_82_783 232
600 3300035170 Ga0373943_0003044 Ga0373943_0003044_4654_5355 232
601 3300035171 Ga0373946_0004691 Ga0373946_0004691_1305_2006 232
602 3300035207 Ga0373942_0005700 Ga0373942_0005700_28_729 232
603 3300035241 Ga0373961_0000926 Ga0373961_0000926_4629_5330 232
604 3300035241 Ga0373961_0014747 Ga0373961_0014747_372_1073 232
605 3300035242 Ga0373962_0000594 Ga0373962_0000594_6599_7300 232
606 3300035242 Ga0373962_0047046 Ga0373962_0047046_167_868 232
607 3300035410 Ga0373924_0035310 Ga0373924_0035310_964_1665 232
608 3300035691 Ga0373931_0001600 Ga0373931_0001600_880_1581 232
609 3300035691 Ga0373931_0158454 Ga0373931_0158454_559_1260 232
610 3300035692 Ga0373935_0012031 Ga0373935_0012031_1245_1946 232
611 3300036401 Ga0373937_0275752 Ga0373937_0275752_683_1384 232
612 3300037068 Ga0373925_0015321 Ga0373925_0015321_1332_2033 232
613 3300042876 Ga0451577_0151231 Ga0451577_0151231_419_1120 232
614 3300045051 Ga0451576_0003826 Ga0451576_0003826_1951_2652 232
615 3300046459 Ga0495629_0285534 Ga0495629_0285534_142_843 232
616 3300046472 Ga0495580_0330700 Ga0495580_0330700_86_787 232
617 3300046475 Ga0495639_0100086 Ga0495639_0100086_248_949 232
618 3300046511 Ga0495608_0140252 Ga0495608_0140252_596_1297 232
619 3300046517 Ga0495630_0485819 Ga0495630_0485819_133_834 232
620 3300046529 Ga0495652_0170262 Ga0495652_0170262_218_919 232
621 3300046535 Ga0495586_0188589 Ga0495586_0188589_72_773 232
622 3300046536 Ga0495587_0038631 Ga0495587_0038631_95_796 232
623 3300046559 Ga0495667_0097822 Ga0495667_0097822_632_1333 232
624 3300046678 Ga0495599_0326441 Ga0495599_0326441_82_783 232
625 3300046683 Ga0495658_0060984 Ga0495658_0060984_82_783 232
626 3300046683 Ga0495658_0481972 Ga0495658_0481972_36_737 232
627 3300046689 Ga0495613_0006752 Ga0495613_0006752_7155_7856 232
628 3300046809 Ga0495600_0215870 Ga0495600_0215870_413_1114 232
629 3300047319 Ga0495674_0011154 Ga0495674_0011154_913_1614 232
630 3300047471 Ga0495684_0000226 Ga0495684_0000226_22141_22842 232
631 3300047471 Ga0495684_0517052 Ga0495684_0517052_39_740 232
632 3300048903 Ga0496100_0428151 Ga0496100_0428151_203_901 232
633 3300048904 Ga0496101_0047743 Ga0496101_0047743_2258_2956 232
634 3300048904 Ga0496101_0125721 Ga0496101_0125721_1181_1882 232
635 3300048905 Ga0496102_0064346 Ga0496102_0064346_116_814 232
636 3300048905 Ga0496102_0278369 Ga0496102_0278369_98_799 232
637 3300048906 Ga0496103_0161951 Ga0496103_0161951_50_751 232
638 3300048907 Ga0496104_0008772 Ga0496104_0008772_5912_6613 232
639 3300048908 Ga0496105_0523944 Ga0496105_0523944_135_836 232
640 3300048909 Ga0496106_0349207 Ga0496106_0349207_263_961 232
641 3300048909 Ga0496106_0580931 Ga0496106_0580931_49_750 232
642 3300048909 Ga0496106_0786111 Ga0496106_0786111_15_716 232
643 3300048911 Ga0496108_0295716 Ga0496108_0295716_202_900 232
644 3300048911 Ga0496108_0343433 Ga0496108_0343433_549_1250 232
645 3300048912 Ga0496109_0423920 Ga0496109_0423920_268_969 232
646 3300048913 Ga0496110_0282315 Ga0496110_0282315_694_1395 232
647 3300048917 Ga0496114_0003318 Ga0496114_0003318_2254_2955 232
648 3300048917 Ga0496114_0198069 Ga0496114_0198069_135_836 232
649 3300048918 Ga0496115_0052754 Ga0496115_0052754_2524_3225 232
650 3300049515 Ga0501292_023063 Ga0501292_023063_53_751 232
651 3300049568 Ga0501031_0430097 Ga0501031_0430097_54_752 232
652 3300049572 Ga0501036_0121886 Ga0501036_0121886_70_774 232
653 3300049572 Ga0501036_0424489 Ga0501036_0424489_50_748 232
654 3300049575 Ga0501039_0105191 Ga0501039_0105191_134_838 232
655 3300049575 Ga0501039_0198160 Ga0501039_0198160_824_1522 232
656 3300049575 Ga0501039_0276605 Ga0501039_0276605_303_1004 232
657 3300049576 Ga0501040_0118695 Ga0501040_0118695_920_1618 232
658 3300049578 Ga0501042_0101822 Ga0501042_0101822_1309_2016 232
659 3300049578 Ga0501042_0292817 Ga0501042_0292817_331_1029 232
660 3300049580 Ga0501046_0236032 Ga0501046_0236032_420_1118 232
661 3300049587 Ga0501071_0061541 Ga0501071_0061541_1761_2462 232
662 3300049587 Ga0501071_0161634 Ga0501071_0161634_365_1063 232
663 3300049588 Ga0501072_0076812 Ga0501072_0076812_158_865 232
664 3300049588 Ga0501072_0451560 Ga0501072_0451560_254_967 232
665 3300049589 Ga0501073_0258642 Ga0501073_0258642_309_1022 232
666 3300049590 Ga0501074_0139387 Ga0501074_0139387_330_1067 232
667 3300049591 Ga0501075_0055996 Ga0501075_0055996_1910_2608 232
668 3300049591 Ga0501075_0065169 Ga0501075_0065169_823_1524 232
669 3300049591 Ga0501075_0326697 Ga0501075_0326697_303_1016 232
670 3300049592 Ga0501076_0128736 Ga0501076_0128736_562_1299 232
671 3300049592 Ga0501076_0639980 Ga0501076_0639980_50_775 232
672 3300049593 Ga0501077_0230533 Ga0501077_0230533_190_915 232
673 3300049741 Ga0501079_0061678 Ga0501079_0061678_1603_2316 232
674 3300049741 Ga0501079_0331616 Ga0501079_0331616_82_786 232
675 3300049742 Ga0501080_0225902 Ga0501080_0225902_177_890 232
676 3300049743 Ga0501081_0198816 Ga0501081_0198816_549_1250 232
677 3300049768 Ga0501271_007320 Ga0501271_007320_20_793 232
678 3300049824 Ga0501045_0371839 Ga0501045_0371839_217_942 232
679 3300049824 Ga0501045_0378093 Ga0501045_0378093_284_1021 232
680 3300050507 nmdc:mga05p37_1500_c2 nmdc:mga05p37_1500_c2_17743_18444 232
681 3300050507 nmdc:mga05p37_257111_c1 nmdc:mga05p37_257111_c1_79_780 232
682 3300050507 nmdc:mga05p37_5835_c2 nmdc:mga05p37_5835_c2_6027_6731 232
683 3300050507 nmdc:mga05p37_65145_c1 nmdc:mga05p37_65145_c1_12_713 232
684 3300050508 nmdc:mga09592_27688_c1 nmdc:mga09592_27688_c1_3513_4217 232
685 3300050508 nmdc:mga09592_405460_c1 nmdc:mga09592_405460_c1_237_935 232
686 3300050509 nmdc:mga0qj67_188403_c1 nmdc:mga0qj67_188403_c1_780_1484 232
687 3300050509 nmdc:mga0qj67_88363_c1 nmdc:mga0qj67_88363_c1_262_966 232
688 3300050510 nmdc:mga06r32_176978_c1 nmdc:mga06r32_176978_c1_601_1329 232
689 3300050510 nmdc:mga06r32_53035_c1 nmdc:mga06r32_53035_c1_2128_2832 232
690 3300050511 nmdc:mga08y16_95715_c1 nmdc:mga08y16_95715_c1_1654_2355 232
691 3300050512 nmdc:mga0n895_20034_c1 nmdc:mga0n895_20034_c1_5468_6166 232
692 3300050512 nmdc:mga0n895_229_c1 nmdc:mga0n895_229_c1_29517_30218 232
693 3300050512 nmdc:mga0n895_71478_c1 nmdc:mga0n895_71478_c1_2550_3251 232
694 3300050513 nmdc:mga0rr50_14_c1 nmdc:mga0rr50_14_c1_42095_42796 232
695 3300050513 nmdc:mga0rr50_219879_c1 nmdc:mga0rr50_219879_c1_697_1398 232
696 3300050513 nmdc:mga0rr50_22513_c1 nmdc:mga0rr50_22513_c1_3488_4189 232
697 3300050513 nmdc:mga0rr50_3194_c1 nmdc:mga0rr50_3194_c1_5468_6169 232
698 3300050514 nmdc:mga08x19_12392_c1 nmdc:mga08x19_12392_c1_2527_3228 232
699 3300050514 nmdc:mga08x19_72724_c1 nmdc:mga08x19_72724_c1_1436_2137 232
700 3300050515 nmdc:mga0a205_104477_c1 nmdc:mga0a205_104477_c1_1389_2090 232
701 3300050515 nmdc:mga0a205_18545_c1 nmdc:mga0a205_18545_c1_4361_5059 232
702 3300050515 nmdc:mga0a205_203041_c1 nmdc:mga0a205_203041_c1_901_1602 232
703 3300053077 Ga0495601_0027119 Ga0495601_0027119_1392_2093 232
704 3300053077 Ga0495601_0278148 Ga0495601_0278148_215_916 232
705 3300053084 Ga0495595_0018713 Ga0495595_0018713_2122_2823 232
706 3300053085 Ga0495619_0003775 Ga0495619_0003775_1654_2355 232
707 3300053085 Ga0495619_0012315 Ga0495619_0012315_2878_3579 232
708 3300053085 Ga0495619_0067617 Ga0495619_0067617_669_1370 232
709 3300054114 Ga0501084_0028086 Ga0501084_0028086_1610_2347 232
710 3300054114 Ga0501084_0235088 Ga0501084_0235088_407_1111 232
711 3300054114 Ga0501084_0318615 Ga0501084_0318615_347_1060 232
712 3300059421 Ga0590071_000236 Ga0590071_000236_6175_6876 232
713 3300059423 Ga0590074_002005 Ga0590074_002005_1232_1933 232
714 3300059424 Ga0590075_000068 Ga0590075_000068_7951_8652 232
715 3300059424 Ga0590075_010098 Ga0590075_010098_916_1614 232
716 3300059426 Ga0590077_000212 Ga0590077_000212_7290_7991 232
717 3300059511 Ga0587091_057831 Ga0587091_057831_61_762 232
718 3300059639 Ga0587062_031957 Ga0587062_031957_45_746 232
719 3300060344 Ga0587071_046805 Ga0587071_046805_151_852 232
720 3300060353 Ga0501082_0171402 Ga0501082_0171402_1150_1875 232
721 3300060353 Ga0501082_0239270 Ga0501082_0239270_813_1514 232
722 3300060353 Ga0501082_0344687 Ga0501082_0344687_489_1202 232
723 3300061734 Ga0530510_0071377 Ga0530510_0071377_134_847 232
724 3300005295 Ga0065707_10202475 Ga0065707_102024752 233
725 3300005364 Ga0070673_100784806 Ga0070673_1007848061 233
726 3300005456 Ga0070678_100446703 Ga0070678_1004467032 233
727 3300005457 Ga0070662_100045226 Ga0070662_1000452262 233
728 3300005543 Ga0070672_100448753 Ga0070672_1004487531 233
729 3300005841 Ga0068863_100815521 Ga0068863_1008155211 233
730 3300006038 Ga0075365_10148327 Ga0075365_101483272 233
731 3300006042 Ga0075368_10109320 Ga0075368_101093201 233
732 3300006177 Ga0075362_10068370 Ga0075362_100683702 233
733 3300006178 Ga0075367_10007468 Ga0075367_100074685 233
734 3300006195 Ga0075366_10020773 Ga0075366_100207732 233
735 3300006844 Ga0075428_100043003 Ga0075428_1000430032 233
736 3300006846 Ga0075430_100635419 Ga0075430_1006354192 233
737 3300006847 Ga0075431_100017202 Ga0075431_1000172026 233
738 3300006847 Ga0075431_100602075 Ga0075431_1006020752 233
739 3300009094 Ga0111539_10001132 Ga0111539_100011329 233
740 3300009147 Ga0114129_10015339 Ga0114129_100153395 233
741 3300009147 Ga0114129_10020092 Ga0114129_100200928 233
742 3300009147 Ga0114129_10479429 Ga0114129_104794292 233
743 3300009147 Ga0114129_11105235 Ga0114129_111052351 233
744 3300009174 Ga0105241_10170541 Ga0105241_101705412 233
745 3300014325 Ga0163163_10742363 Ga0163163_107423632 233
746 3300025903 Ga0207680_10110387 Ga0207680_101103871 233
747 3300025911 Ga0207654_10302017 Ga0207654_103020172 233
748 3300025931 Ga0207644_10384004 Ga0207644_103840041 233
749 3300025933 Ga0207706_10352660 Ga0207706_103526601 233
750 3300025937 Ga0207669_10012024 Ga0207669_100120243 233
751 3300026067 Ga0207678_10300597 Ga0207678_103005972 233
752 3300026121 Ga0207683_10545856 Ga0207683_105458561 233
753 3300027907 Ga0207428_10009844 Ga0207428_100098449 233
754 3300028379 Ga0268266_10254068 Ga0268266_102540681 233
755 3300031548 Ga0307408_100083765 Ga0307408_1000837652 233
756 3300031731 Ga0307405_10112770 Ga0307405_101127701 233
757 3300031731 Ga0307405_10123446 Ga0307405_101234462 233
758 3300031824 Ga0307413_10339984 Ga0307413_103399842 233
759 3300031852 Ga0307410_10124228 Ga0307410_101242281 233
760 3300031995 Ga0307409_100159718 Ga0307409_1001597182 233
761 3300031995 Ga0307409_100190286 Ga0307409_1001902862 233
762 3300032002 Ga0307416_100029805 Ga0307416_1000298052 233
763 3300032002 Ga0307416_100100825 Ga0307416_1001008252 233
764 3300032002 Ga0307416_100110060 Ga0307416_1001100602 233
765 3300032004 Ga0307414_10210073 Ga0307414_102100732 233
766 3300032005 Ga0307411_10223112 Ga0307411_102231122 233
767 3300032126 Ga0307415_100157787 Ga0307415_1001577872 233
768 3300032126 Ga0307415_100876209 Ga0307415_1008762091 233
769 3300038443 Ga0395901_0728084 Ga0395901_0728084_207_917 233
770 3300041404 Ga0439436_0082332 Ga0439436_0082332_72_785 233
771 3300041456 Ga0451795_0441604 Ga0451795_0441604_195_896 233
772 3300042009 Ga0439451_041683 Ga0439451_041683_117_818 233
773 3300042133 Ga0450896_001975 Ga0450896_001975_896_1600 233
774 3300042134 Ga0450898_007257 Ga0450898_007257_252_956 233
775 3300042436 Ga0439435_0058046 Ga0439435_0058046_380_1084 233
776 3300045051 Ga0451576_0302997 Ga0451576_0302997_474_1175 233
777 3300045051 Ga0451576_1103677 Ga0451576_1103677_31_732 233
778 3300046455 Ga0495603_0057471 Ga0495603_0057471_126_827 233
779 3300046460 Ga0495638_0003705 Ga0495638_0003705_6283_6987 233
780 3300046499 Ga0495594_0110689 Ga0495594_0110689_114_815 233
781 3300047320 Ga0495672_0066901 Ga0495672_0066901_313_1023 233
782 3300048909 Ga0496106_0031956 Ga0496106_0031956_3133_3834 233
783 3300048917 Ga0496114_0773237 Ga0496114_0773237_21_722 233
784 3300049572 Ga0501036_0384228 Ga0501036_0384228_418_1119 233
785 3300049576 Ga0501040_0125178 Ga0501040_0125178_248_949 233
786 3300049582 Ga0501048_0247109 Ga0501048_0247109_470_1171 233
787 3300049585 Ga0501069_0154185 Ga0501069_0154185_464_1165 233
788 3300049591 Ga0501075_0025723 Ga0501075_0025723_3517_4218 233
789 3300049592 Ga0501076_0029968 Ga0501076_0029968_1891_2592 233
790 3300049592 Ga0501076_0344214 Ga0501076_0344214_23_727 233
791 3300049705 Ga0501225_0068745 Ga0501225_0068745_98_799 233
792 3300049741 Ga0501079_0361626 Ga0501079_0361626_95_796 233
793 3300049742 Ga0501080_0309341 Ga0501080_0309341_523_1224 233
794 3300049824 Ga0501045_0146040 Ga0501045_0146040_113_814 233
795 3300050489 nmdc:mga03683_63536_c1 nmdc:mga03683_63536_c1_722_1432 233
796 3300050493 nmdc:mga0k408_202559_c1 nmdc:mga0k408_202559_c1_384_1094 233
797 3300050493 nmdc:mga0k408_35378_c1 nmdc:mga0k408_35378_c1_470_1180 233
798 3300050494 nmdc:mga06z11_11222_c1 nmdc:mga06z11_11222_c1_628_1338 233
799 3300050507 nmdc:mga05p37_1011882_c1 nmdc:mga05p37_1011882_c1_84_788 233
800 3300050507 nmdc:mga05p37_12570_c1 nmdc:mga05p37_12570_c1_6124_6825 233
801 3300050507 nmdc:mga05p37_221081_c1 nmdc:mga05p37_221081_c1_1023_1724 233
802 3300050507 nmdc:mga05p37_27903_c2 nmdc:mga05p37_27903_c2_1642_2343 233
803 3300050508 nmdc:mga09592_585007_c1 nmdc:mga09592_585007_c1_128_829 233
804 3300050509 nmdc:mga0qj67_31764_c1 nmdc:mga0qj67_31764_c1_3064_3765 233
805 3300050510 nmdc:mga06r32_188657_c1 nmdc:mga06r32_188657_c1_436_1137 233
806 3300050511 nmdc:mga08y16_207016_c1 nmdc:mga08y16_207016_c1_250_954 233
807 3300050511 nmdc:mga08y16_506030_c1 nmdc:mga08y16_506030_c1_229_930 233
808 3300053096 Ga0500641_0009818 Ga0500641_0009818_231_935 233
809 3300053103 Ga0500555_007562 Ga0500555_007562_1381_2085 233
810 3300053116 Ga0500592_003976 Ga0500592_003976_953_1657 233
811 3300053139 Ga0500568_0004866 Ga0500568_0004866_1748_2458 233
812 3300053153 Ga0500616_0000567 Ga0500616_0000567_43234_43938 233
813 3300053730 Ga0500645_000402 Ga0500645_000402_4576_5280 233
814 3300053736 Ga0500599_012921 Ga0500599_012921_198_902 233
815 3300061734 Ga0530510_0060229 Ga0530510_0060229_344_1045 233
816 3300005293 Ga0065715_10026217 Ga0065715_100262172 234
817 3300005345 Ga0070692_10106275 Ga0070692_101062752 234
818 3300005441 Ga0070700_100293652 Ga0070700_1002936522 234
819 3300006844 Ga0075428_100000815 Ga0075428_10000081524 234
820 3300006844 Ga0075428_100075808 Ga0075428_1000758082 234
821 3300006846 Ga0075430_100000790 Ga0075430_1000007903 234
822 3300006846 Ga0075430_100049111 Ga0075430_1000491112 234
823 3300006847 Ga0075431_100014813 Ga0075431_1000148136 234
824 3300006847 Ga0075431_100030446 Ga0075431_1000304465 234
825 3300006852 Ga0075433_10002477 Ga0075433_1000247713 234
826 3300006880 Ga0075429_100010093 Ga0075429_1000100934 234
827 3300006880 Ga0075429_100066198 Ga0075429_1000661983 234
828 3300009094 Ga0111539_10000159 Ga0111539_1000015936 234
829 3300009094 Ga0111539_10091748 Ga0111539_100917482 234
830 3300009094 Ga0111539_10495438 Ga0111539_104954382 234
831 3300009147 Ga0114129_10004686 Ga0114129_1000468610 234
832 3300009147 Ga0114129_10014940 Ga0114129_100149409 234
833 3300009147 Ga0114129_10166577 Ga0114129_101665773 234
834 3300014326 Ga0157380_10211859 Ga0157380_102118592 234
835 3300025315 Ga0207697_10184009 Ga0207697_101840091 234
836 3300025901 Ga0207688_10305952 Ga0207688_103059522 234
837 3300025933 Ga0207706_10313831 Ga0207706_103138313 234
838 3300027907 Ga0207428_10002569 Ga0207428_100025694 234
839 3300027907 Ga0207428_10097373 Ga0207428_100973732 234
840 3300031731 Ga0307405_10108849 Ga0307405_101088491 234
841 3300031903 Ga0307407_10094231 Ga0307407_100942312 234
842 3300031911 Ga0307412_10567391 Ga0307412_105673912 234
843 3300031995 Ga0307409_100048523 Ga0307409_1000485232 234
844 3300031995 Ga0307409_100165738 Ga0307409_1001657381 234
845 3300032002 Ga0307416_100267712 Ga0307416_1002677122 234
846 3300042436 Ga0439435_0000936 Ga0439435_0000936_235_942 234
847 3300042436 Ga0439435_0116821 Ga0439435_0116821_61_768 234
848 3300049515 Ga0501292_012949 Ga0501292_012949_382_1089 234
849 3300049672 Ga0501239_011728 Ga0501239_011728_217_924 234
850 3300050507 nmdc:mga05p37_5123_c1 nmdc:mga05p37_5123_c1_8041_8748 234
851 3300050507 nmdc:mga05p37_71086_c1 nmdc:mga05p37_71086_c1_224_931 234
852 3300050508 nmdc:mga09592_165039_c1 nmdc:mga09592_165039_c1_718_1425 234
853 3300050508 nmdc:mga09592_9342_c1 nmdc:mga09592_9342_c1_2603_3310 234
854 3300050509 nmdc:mga0qj67_124572_c1 nmdc:mga0qj67_124572_c1_960_1667 234
855 3300050509 nmdc:mga0qj67_4023_c1 nmdc:mga0qj67_4023_c1_340_1047 234
856 3300050509 nmdc:mga0qj67_96447_c1 nmdc:mga0qj67_96447_c1_888_1595 234
857 3300050510 nmdc:mga06r32_154420_c1 nmdc:mga06r32_154420_c1_511_1218 234
858 3300050510 nmdc:mga06r32_6030_c1 nmdc:mga06r32_6030_c1_752_1459 234
859 3300050511 nmdc:mga08y16_254922_c1 nmdc:mga08y16_254922_c1_1029_1736 234
860 3300050511 nmdc:mga08y16_89520_c1 nmdc:mga08y16_89520_c1_576_1283 234
861 3300050511 nmdc:mga08y16_99921_c1 nmdc:mga08y16_99921_c1_752_1459 234
862 3300050515 nmdc:mga0a205_8071_c1 nmdc:mga0a205_8071_c1_3281_3988 234
863 3300001991 JGI24743J22301_10021937 JGI24743J22301_100219372 235
864 3300002077 JGI24744J21845_10009333 JGI24744J21845_100093332 235
865 3300005290 Ga0065712_10076567 Ga0065712_100765672 235
866 3300005338 Ga0068868_100077209 Ga0068868_1000772092 235
867 3300005355 Ga0070671_100193937 Ga0070671_1001939372 235
868 3300005356 Ga0070674_100086763 Ga0070674_1000867632 235
869 3300005456 Ga0070678_100121707 Ga0070678_1001217072 235
870 3300005544 Ga0070686_100298513 Ga0070686_1002985132 235
871 3300005548 Ga0070665_100246070 Ga0070665_1002460702 235
872 3300005548 Ga0070665_100475268 Ga0070665_1004752682 235
873 3300013308 Ga0157375_11009335 Ga0157375_110093352 235
874 3300014325 Ga0163163_10083729 Ga0163163_100837293 235
875 3300014969 Ga0157376_10924861 Ga0157376_109248611 235
876 3300025290 Ga0207673_1003453 Ga0207673_10034532 235
877 3300025315 Ga0207697_10001568 Ga0207697_100015684 235
878 3300025901 Ga0207688_10004015 Ga0207688_100040158 235
879 3300025920 Ga0207649_10687926 Ga0207649_106879261 235
880 3300025926 Ga0207659_10083887 Ga0207659_100838871 235
881 3300025931 Ga0207644_10040068 Ga0207644_100400682 235
882 3300025937 Ga0207669_10027751 Ga0207669_100277513 235
883 3300025940 Ga0207691_10053870 Ga0207691_100538703 235
884 3300025986 Ga0207658_10023108 Ga0207658_100231082 235
885 3300026067 Ga0207678_10076647 Ga0207678_100766473 235
886 3300026121 Ga0207683_10266084 Ga0207683_102660842 235
887 3300028379 Ga0268266_10548745 Ga0268266_105487451 235
888 3300048911 Ga0496108_0105953 Ga0496108_0105953_895_1602 235
889 3300048913 Ga0496110_0047039 Ga0496110_0047039_1746_2453 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

99

194

0.97

PF13649

Methyltransf_25

Methyltransferase domain

98

190

0.95

PF08242

Methyltransf_12

Methyltransferase domain

99

192

0.91

PF13847

Methyltransf_31

Methyltransferase domain

92

219

0.91

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

52

219

0.85

PF13489

Methyltransf_23

Methyltransferase domain

77

241

0.84

PF07021

MetW

Methionine biosynthesis protein MetW

83

198

0.81

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

55

194

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl5-assembly4.cif.gz_D crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution 0.8344 58 217
3bus-assembly2.cif.gz_B crystal structure of rebm 0.8325 59 234
3bus-assembly1.cif.gz_A crystal structure of rebm 0.827 59 234
5kok-assembly1.cif.gz_B pavine n-methyltransferase in complex with tetrahydropapaverine and s-adenosylhomocysteine ph 7.25 0.8259 57 176
6gkz-assembly1.cif.gz_A crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.821 57 172
ID Description Score Start End Superfamily
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8723 56 170 3.40.50.150
af_Q4DRI7_264_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8622 123 234 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8549 62 168 3.40.50.150
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8526 57 132 3.40.50.150
af_O13871_19_175_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8447 57 168 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3D5Y937-F1-model_v4 SAM-dependent methyltransferase 0.9111 33 170 GO:0008757
GO:0032259
AF-A0A4Q5L2Z0-F1-model_v4 deleted 0.9103 37 233
AF-A0A7Y2BKY5-F1-model_v4 Class I SAM-dependent methyltransferase 0.9091 36 233 GO:0008757
GO:0032259
AF-A0A534SAC5-F1-model_v4 Class I SAM-dependent methyltransferase 0.9065 38 234 GO:0008757
GO:0032259
AF-A0A1G3C466-F1-model_v4 Methyltransferase domain-containing protein 0.9049 66 233 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
76.88 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map