F484809
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 889 | 343 | 889 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300049768|Ga0501271_007320|Ga0501271_007320_20_793 |
| Length | 257 |
| Sequence | LAGYLLPLRLRRSCPSVLRTNGDELIALFDRKDQSEDELVSGSDAATRALSVAAVENDFVEGVYDKLAKVYDLIFGPTLHPGRLRAIERMDIQPGERVLEVGVGTGINLSLYPTHCHVTGIDFSSSMLEKARERVARKDIHSVRLLQMDAADLKFSTDSFDIVYAPYLISVVPDPVRVAQEMRRVCRPGGRIVFLNHFLSPNPILSRAERMISPMTIHIGFKSDLDLPAFLAQADLKPISIEKVNIPKIWSLVTSVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 191 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 192 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 194 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 220 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 221 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 223 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 224 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 225 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 226 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 227 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 228 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 229 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 230 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 231 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 232 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 274 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 309 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 310 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 324 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 325 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 326 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 333 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 334 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 335 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 336 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.43 |
| Metatranscriptomes | 1.57 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.3 |
| Nodule | 0 |
| Rhizoplane | 4.95 |
| Rhizosphere | 88.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10021937 | 3300001991 | Bacteria | 1222 |
| 2 | JGI24744J21845_10009333 | 3300002077 | Bacteria | 2012 |
| 3 | Ga0007416J51690_1062403 | 3300003577 | Bacteria | 854 |
| 4 | Ga0032354_1051467 | 3300003693 | Unclassified | 975 |
| 5 | Ga0058863_11348119 | 3300004799 | Bacteria | 776 |
| 6 | Ga0058863_11372655 | 3300004799 | Bacteria | 984 |
| 7 | Ga0058861_11984245 | 3300004800 | Bacteria | 948 |
| 8 | Ga0058860_11794914 | 3300004801 | Bacteria | 867 |
| 9 | Ga0065714_10136143 | 3300005288 | Bacteria | 1208 |
| 10 | Ga0065712_10000477 | 3300005290 | Bacteria | 12101 |
| 11 | Ga0065712_10003522 | 3300005290 | Bacteria | 6689 |
| 12 | Ga0065712_10076567 | 3300005290 | Bacteria | 3638 |
| 13 | Ga0065712_10102239 | 3300005290 | Bacteria | 2014 |
| 14 | Ga0065712_10141289 | 3300005290 | Bacteria | 1448 |
| 15 | Ga0065712_10200589 | 3300005290 | Bacteria | 1110 |
| 16 | Ga0065715_10019037 | 3300005293 | Archaea | 2903 |
| 17 | Ga0065715_10026217 | 3300005293 | Unclassified | 1919 |
| 18 | Ga0065715_10090283 | 3300005293 | Bacteria | 7300 |
| 19 | Ga0065715_10092283 | 3300005293 | Bacteria | 5203 |
| 20 | Ga0065715_10094975 | 3300005293 | Bacteria | 4176 |
| 21 | Ga0065715_10101127 | 3300005293 | Bacteria | 3234 |
| 22 | Ga0065715_10114217 | 3300005293 | Bacteria | 2459 |
| 23 | Ga0065715_10175914 | 3300005293 | Bacteria | 1512 |
| 24 | Ga0065715_10204893 | 3300005293 | Unclassified | 1342 |
| 25 | Ga0065715_10222887 | 3300005293 | Bacteria | 1264 |
| 26 | Ga0065715_10311319 | 3300005293 | Bacteria | 1020 |
| 27 | Ga0065715_10326582 | 3300005293 | Bacteria | 991 |
| 28 | Ga0065715_10399287 | 3300005293 | Bacteria | 883 |
| 29 | Ga0065715_10439296 | 3300005293 | Bacteria | 838 |
| 30 | Ga0065707_10106216 | 3300005295 | Bacteria | 2606 |
| 31 | Ga0065707_10118059 | 3300005295 | Bacteria | 2195 |
| 32 | Ga0065707_10148463 | 3300005295 | Bacteria | 1670 |
| 33 | Ga0065707_10202475 | 3300005295 | Bacteria | 1304 |
| 34 | Ga0065707_10463193 | 3300005295 | Bacteria | 789 |
| 35 | Ga0070683_100001987 | 3300005329 | Bacteria | 16026 |
| 36 | Ga0070683_100056388 | 3300005329 | Bacteria | 3649 |
| 37 | Ga0070683_100086019 | 3300005329 | Bacteria | 2948 |
| 38 | Ga0070683_100375192 | 3300005329 | Bacteria | 1355 |
| 39 | Ga0070690_100106953 | 3300005330 | Bacteria | 1861 |
| 40 | Ga0070690_100177091 | 3300005330 | Unclassified | 1472 |
| 41 | Ga0070670_100008366 | 3300005331 | Bacteria | 8819 |
| 42 | Ga0070670_100020564 | 3300005331 | Bacteria | 5676 |
| 43 | Ga0070670_100029005 | 3300005331 | Bacteria | 4763 |
| 44 | Ga0070670_100045833 | 3300005331 | Bacteria | 3759 |
| 45 | Ga0070670_100104607 | 3300005331 | Bacteria | 2438 |
| 46 | Ga0070670_100147463 | 3300005331 | Bacteria | 2036 |
| 47 | Ga0070677_10029454 | 3300005333 | Bacteria | 2082 |
| 48 | Ga0070677_10166242 | 3300005333 | Bacteria | 1039 |
| 49 | Ga0070677_10174544 | 3300005333 | Bacteria | 1019 |
| 50 | Ga0068869_100156595 | 3300005334 | Bacteria | 1771 |
| 51 | Ga0068869_100512305 | 3300005334 | Bacteria | 1003 |
| 52 | Ga0070666_10047548 | 3300005335 | Bacteria | 2880 |
| 53 | Ga0070666_10146555 | 3300005335 | Bacteria | 1646 |
| 54 | Ga0070666_10269532 | 3300005335 | Unclassified | 1208 |
| 55 | Ga0070680_100153809 | 3300005336 | Unclassified | 1932 |
| 56 | Ga0070682_100150697 | 3300005337 | Bacteria | 1595 |
| 57 | Ga0068868_100077209 | 3300005338 | Bacteria | 2664 |
| 58 | Ga0068868_100080478 | 3300005338 | Unclassified | 2611 |
| 59 | Ga0070689_100020431 | 3300005340 | Bacteria | 4913 |
| 60 | Ga0070691_10054188 | 3300005341 | Unclassified | 1920 |
| 61 | Ga0070687_100067214 | 3300005343 | Bacteria | 1912 |
| 62 | Ga0070687_100091944 | 3300005343 | Unclassified | 1680 |
| 63 | Ga0070661_100002279 | 3300005344 | Bacteria | 13174 |
| 64 | Ga0070661_100091577 | 3300005344 | Unclassified | 2252 |
| 65 | Ga0070661_100157775 | 3300005344 | Bacteria | 1717 |
| 66 | Ga0070661_100286701 | 3300005344 | Bacteria | 1279 |
| 67 | Ga0070661_100297700 | 3300005344 | Bacteria | 1255 |
| 68 | Ga0070692_10106275 | 3300005345 | Unclassified | 1546 |
| 69 | Ga0070669_100005348 | 3300005353 | Bacteria | 9267 |
| 70 | Ga0070669_100517555 | 3300005353 | Bacteria | 991 |
| 71 | Ga0070675_100044442 | 3300005354 | Bacteria | 3633 |
| 72 | Ga0070675_100115369 | 3300005354 | Unclassified | 2277 |
| 73 | Ga0070675_100128235 | 3300005354 | Bacteria | 2160 |
| 74 | Ga0070671_100008914 | 3300005355 | Bacteria | 8048 |
| 75 | Ga0070671_100036708 | 3300005355 | Bacteria | 4064 |
| 76 | Ga0070671_100049389 | 3300005355 | Bacteria | 3501 |
| 77 | Ga0070671_100193937 | 3300005355 | Unclassified | 1722 |
| 78 | Ga0070671_100281269 | 3300005355 | Unclassified | 1415 |
| 79 | Ga0070671_100874014 | 3300005355 | Bacteria | 785 |
| 80 | Ga0070674_100086763 | 3300005356 | Bacteria | 2249 |
| 81 | Ga0070674_100165719 | 3300005356 | Bacteria | 1680 |
| 82 | Ga0070674_100307388 | 3300005356 | Archaea | 1266 |
| 83 | Ga0070674_100314870 | 3300005356 | Bacteria | 1252 |
| 84 | Ga0070674_100503535 | 3300005356 | Unclassified | 1009 |
| 85 | Ga0070673_100003223 | 3300005364 | Bacteria | 10120 |
| 86 | Ga0070673_100016706 | 3300005364 | Bacteria | 5200 |
| 87 | Ga0070673_100784806 | 3300005364 | Unclassified | 879 |
| 88 | Ga0070688_100017161 | 3300005365 | Bacteria | 4154 |
| 89 | Ga0070659_100246438 | 3300005366 | Unclassified | 1480 |
| 90 | Ga0070667_100255150 | 3300005367 | Bacteria | 1569 |
| 91 | Ga0070667_100370374 | 3300005367 | Bacteria | 1300 |
| 92 | Ga0070709_10154525 | 3300005434 | Bacteria | 1589 |
| 93 | Ga0070709_10185749 | 3300005434 | Bacteria | 1463 |
| 94 | Ga0070713_100005536 | 3300005436 | Bacteria | 8652 |
| 95 | Ga0070710_10363301 | 3300005437 | Bacteria | 961 |
| 96 | Ga0070710_10406993 | 3300005437 | Bacteria | 913 |
| 97 | Ga0070701_10036952 | 3300005438 | Bacteria | 2463 |
| 98 | Ga0070711_100092535 | 3300005439 | Bacteria | 2182 |
| 99 | Ga0070711_100310796 | 3300005439 | Unclassified | 1256 |
| 100 | Ga0070705_100258142 | 3300005440 | Bacteria | 1227 |
| 101 | Ga0070705_100279163 | 3300005440 | Bacteria | 1187 |
| 102 | Ga0070700_100115987 | 3300005441 | Bacteria | 1787 |
| 103 | Ga0070700_100293652 | 3300005441 | Bacteria | 1183 |
| 104 | Ga0070700_100524330 | 3300005441 | Bacteria | 916 |
| 105 | Ga0070694_100015345 | 3300005444 | Bacteria | 4810 |
| 106 | Ga0070694_100276075 | 3300005444 | Bacteria | 1280 |
| 107 | Ga0070663_100133932 | 3300005455 | Bacteria | 1885 |
| 108 | Ga0070663_100293534 | 3300005455 | Bacteria | 1299 |
| 109 | Ga0070663_100366603 | 3300005455 | Bacteria | 1170 |
| 110 | Ga0070678_100046570 | 3300005456 | Bacteria | 3110 |
| 111 | Ga0070678_100121707 | 3300005456 | Bacteria | 2059 |
| 112 | Ga0070678_100208935 | 3300005456 | Bacteria | 1616 |
| 113 | Ga0070678_100446703 | 3300005456 | Bacteria | 1132 |
| 114 | Ga0070662_100045226 | 3300005457 | Bacteria | 3157 |
| 115 | Ga0070662_100154485 | 3300005457 | Bacteria | 1790 |
| 116 | Ga0070662_100224390 | 3300005457 | Bacteria | 1501 |
| 117 | Ga0070681_10024457 | 3300005458 | Bacteria | 6081 |
| 118 | Ga0068867_100056868 | 3300005459 | Bacteria | 2895 |
| 119 | Ga0070685_10038720 | 3300005466 | Bacteria | 2705 |
| 120 | Ga0070685_10144521 | 3300005466 | Bacteria | 1501 |
| 121 | Ga0070706_100275725 | 3300005467 | Bacteria | 1569 |
| 122 | Ga0070707_100102722 | 3300005468 | Bacteria | 2770 |
| 123 | Ga0070698_100069706 | 3300005471 | Bacteria | 3529 |
| 124 | Ga0070698_100535601 | 3300005471 | Bacteria | 1110 |
| 125 | Ga0070698_100849368 | 3300005471 | Bacteria | 858 |
| 126 | Ga0070699_100006964 | 3300005518 | Bacteria | 9828 |
| 127 | Ga0070699_100045871 | 3300005518 | Bacteria | 3782 |
| 128 | Ga0070679_100020355 | 3300005530 | Bacteria | 6467 |
| 129 | Ga0070679_100276835 | 3300005530 | Bacteria | 1631 |
| 130 | Ga0070679_100411424 | 3300005530 | Bacteria | 1298 |
| 131 | Ga0070684_100001908 | 3300005535 | Bacteria | 15287 |
| 132 | Ga0070684_100148274 | 3300005535 | Bacteria | 2124 |
| 133 | Ga0070697_100212294 | 3300005536 | Bacteria | 1648 |
| 134 | Ga0070672_100007337 | 3300005543 | Bacteria | 7476 |
| 135 | Ga0070672_100050952 | 3300005543 | Bacteria | 3227 |
| 136 | Ga0070672_100051514 | 3300005543 | Bacteria | 3211 |
| 137 | Ga0070672_100092368 | 3300005543 | Bacteria | 2443 |
| 138 | Ga0070672_100137211 | 3300005543 | Bacteria | 2015 |
| 139 | Ga0070672_100448753 | 3300005543 | Bacteria | 1111 |
| 140 | Ga0070686_100005561 | 3300005544 | Bacteria | 6974 |
| 141 | Ga0070686_100029678 | 3300005544 | Bacteria | 3329 |
| 142 | Ga0070686_100056865 | 3300005544 | Bacteria | 2511 |
| 143 | Ga0070686_100269276 | 3300005544 | Bacteria | 1252 |
| 144 | Ga0070686_100298513 | 3300005544 | Bacteria | 1194 |
| 145 | Ga0070693_100052330 | 3300005547 | Unclassified | 2340 |
| 146 | Ga0070665_100246070 | 3300005548 | Bacteria | 1789 |
| 147 | Ga0070665_100279617 | 3300005548 | Bacteria | 1671 |
| 148 | Ga0070665_100475268 | 3300005548 | Bacteria | 1260 |
| 149 | Ga0070665_100649983 | 3300005548 | Bacteria | 1067 |
| 150 | Ga0070665_100832596 | 3300005548 | Bacteria | 936 |
| 151 | Ga0070704_100237233 | 3300005549 | Bacteria | 1491 |
| 152 | Ga0070704_100615141 | 3300005549 | Bacteria | 956 |
| 153 | Ga0068855_100080579 | 3300005563 | Bacteria | 3775 |
| 154 | Ga0068855_100221347 | 3300005563 | Bacteria | 2122 |
| 155 | Ga0068855_100625399 | 3300005563 | Bacteria | 1159 |
| 156 | Ga0070664_100001311 | 3300005564 | Bacteria | 19875 |
| 157 | Ga0070664_100039698 | 3300005564 | Bacteria | 3967 |
| 158 | Ga0070664_100066848 | 3300005564 | Bacteria | 3070 |
| 159 | Ga0070664_100129074 | 3300005564 | Bacteria | 2220 |
| 160 | Ga0068857_100244031 | 3300005577 | Bacteria | 1645 |
| 161 | Ga0068854_100007928 | 3300005578 | Bacteria | 6798 |
| 162 | Ga0068854_100142525 | 3300005578 | Unclassified | 1840 |
| 163 | Ga0068856_100074414 | 3300005614 | Bacteria | 3363 |
| 164 | Ga0068856_100481988 | 3300005614 | Bacteria | 1261 |
| 165 | Ga0070702_100076737 | 3300005615 | Bacteria | 1989 |
| 166 | Ga0068852_100108436 | 3300005616 | Bacteria | 2520 |
| 167 | Ga0068852_100330431 | 3300005616 | Bacteria | 1483 |
| 168 | Ga0068852_100848307 | 3300005616 | Unclassified | 929 |
| 169 | Ga0068859_100429179 | 3300005617 | Bacteria | 1418 |
| 170 | Ga0068859_100563900 | 3300005617 | Bacteria | 1233 |
| 171 | Ga0068864_100042976 | 3300005618 | Bacteria | 3868 |
| 172 | Ga0068864_100105772 | 3300005618 | Unclassified | 2501 |
| 173 | Ga0068864_100259513 | 3300005618 | Bacteria | 1616 |
| 174 | Ga0068861_100242043 | 3300005719 | Bacteria | 1535 |
| 175 | Ga0068861_100278751 | 3300005719 | Bacteria | 1439 |
| 176 | Ga0068861_100293311 | 3300005719 | Unclassified | 1405 |
| 177 | Ga0068870_10064703 | 3300005840 | Bacteria | 1976 |
| 178 | Ga0068863_100004415 | 3300005841 | Bacteria | 13870 |
| 179 | Ga0068863_100088210 | 3300005841 | Bacteria | 2940 |
| 180 | Ga0068863_100119807 | 3300005841 | Unclassified | 2509 |
| 181 | Ga0068863_100815521 | 3300005841 | Bacteria | 931 |
| 182 | Ga0068860_100077343 | 3300005843 | Bacteria | 3164 |
| 183 | Ga0068860_100159922 | 3300005843 | Unclassified | 2171 |
| 184 | Ga0068860_100341714 | 3300005843 | Bacteria | 1472 |
| 185 | Ga0068860_100658006 | 3300005843 | Bacteria | 1056 |
| 186 | Ga0068862_100122790 | 3300005844 | Bacteria | 2291 |
| 187 | Ga0068862_100413101 | 3300005844 | Bacteria | 1265 |
| 188 | Ga0068862_100637461 | 3300005844 | Bacteria | 1027 |
| 189 | Ga0081539_10047867 | 3300005985 | Unclassified | 2437 |
| 190 | Ga0070717_10049452 | 3300006028 | Bacteria | 3451 |
| 191 | Ga0070717_10369932 | 3300006028 | Bacteria | 1284 |
| 192 | Ga0075365_10046799 | 3300006038 | Bacteria | 2842 |
| 193 | Ga0075365_10140043 | 3300006038 | Bacteria | 1679 |
| 194 | Ga0075365_10148327 | 3300006038 | Unclassified | 1631 |
| 195 | Ga0075368_10079634 | 3300006042 | Bacteria | 1332 |
| 196 | Ga0075368_10109320 | 3300006042 | Bacteria | 1139 |
| 197 | Ga0075363_100105179 | 3300006048 | Bacteria | 1565 |
| 198 | Ga0075364_10001527 | 3300006051 | Bacteria | 12608 |
| 199 | Ga0075364_10027904 | 3300006051 | Bacteria | 3609 |
| 200 | Ga0075364_10057320 | 3300006051 | Bacteria | 2551 |
| 201 | Ga0075364_10098488 | 3300006051 | Bacteria | 1945 |
| 202 | Ga0070716_100098595 | 3300006173 | Bacteria | 1786 |
| 203 | Ga0070716_100107250 | 3300006173 | Bacteria | 1724 |
| 204 | Ga0075362_10036132 | 3300006177 | Bacteria | 2160 |
| 205 | Ga0075362_10068370 | 3300006177 | Unclassified | 1618 |
| 206 | Ga0075367_10007468 | 3300006178 | Bacteria | 5598 |
| 207 | Ga0075367_10019063 | 3300006178 | Bacteria | 3798 |
| 208 | Ga0075367_10026547 | 3300006178 | Bacteria | 3286 |
| 209 | Ga0075367_10406317 | 3300006178 | Bacteria | 861 |
| 210 | Ga0075369_10017347 | 3300006186 | Bacteria | 2917 |
| 211 | Ga0075369_10127423 | 3300006186 | Bacteria | 1155 |
| 212 | Ga0075366_10012901 | 3300006195 | Bacteria | 4749 |
| 213 | Ga0075366_10020773 | 3300006195 | Unclassified | 3811 |
| 214 | Ga0075366_10077657 | 3300006195 | Bacteria | 1981 |
| 215 | Ga0075366_10113346 | 3300006195 | Bacteria | 1632 |
| 216 | Ga0075366_10360145 | 3300006195 | Bacteria | 893 |
| 217 | Ga0097621_100024680 | 3300006237 | Bacteria | 4697 |
| 218 | Ga0097621_100682212 | 3300006237 | Bacteria | 945 |
| 219 | Ga0075370_10009908 | 3300006353 | Bacteria | 4965 |
| 220 | Ga0075370_10156368 | 3300006353 | Bacteria | 1337 |
| 221 | Ga0075370_10375382 | 3300006353 | Unclassified | 851 |
| 222 | Ga0075428_100000815 | 3300006844 | Bacteria | 32626 |
| 223 | Ga0075428_100004986 | 3300006844 | Bacteria | 14743 |
| 224 | Ga0075428_100010827 | 3300006844 | Bacteria | 10138 |
| 225 | Ga0075428_100043003 | 3300006844 | Bacteria | 4967 |
| 226 | Ga0075428_100075808 | 3300006844 | Bacteria | 3672 |
| 227 | Ga0075428_100465421 | 3300006844 | Bacteria | 1354 |
| 228 | Ga0075428_100724724 | 3300006844 | Bacteria | 1059 |
| 229 | Ga0075430_100000790 | 3300006846 | Bacteria | 24524 |
| 230 | Ga0075430_100049111 | 3300006846 | Bacteria | 3562 |
| 231 | Ga0075430_100181980 | 3300006846 | Unclassified | 1748 |
| 232 | Ga0075430_100363129 | 3300006846 | Bacteria | 1196 |
| 233 | Ga0075430_100635419 | 3300006846 | Unclassified | 880 |
| 234 | Ga0075431_100014813 | 3300006847 | Bacteria | 7894 |
| 235 | Ga0075431_100017202 | 3300006847 | Bacteria | 7347 |
| 236 | Ga0075431_100030446 | 3300006847 | Bacteria | 5559 |
| 237 | Ga0075431_100095960 | 3300006847 | Bacteria | 3061 |
| 238 | Ga0075431_100144689 | 3300006847 | Bacteria | 2450 |
| 239 | Ga0075431_100385364 | 3300006847 | Bacteria | 1405 |
| 240 | Ga0075431_100602075 | 3300006847 | Bacteria | 1083 |
| 241 | Ga0075431_100849846 | 3300006847 | Bacteria | 884 |
| 242 | Ga0075433_10002477 | 3300006852 | Bacteria | 14047 |
| 243 | Ga0075433_10065014 | 3300006852 | Bacteria | 3199 |
| 244 | Ga0075433_10070272 | 3300006852 | Bacteria | 3077 |
| 245 | Ga0075433_10121539 | 3300006852 | Bacteria | 2319 |
| 246 | Ga0075433_10128598 | 3300006852 | Bacteria | 2250 |
| 247 | Ga0075433_10148937 | 3300006852 | Bacteria | 2081 |
| 248 | Ga0075434_100000298 | 3300006871 | Bacteria | 35329 |
| 249 | Ga0075434_100006405 | 3300006871 | Bacteria | 10788 |
| 250 | Ga0075434_100067873 | 3300006871 | Bacteria | 3552 |
| 251 | Ga0075434_100115686 | 3300006871 | Bacteria | 2695 |
| 252 | Ga0075434_100189802 | 3300006871 | Unclassified | 2075 |
| 253 | Ga0075434_100447375 | 3300006871 | Bacteria | 1313 |
| 254 | Ga0075434_100509532 | 3300006871 | Bacteria | 1224 |
| 255 | Ga0075434_100708638 | 3300006871 | Unclassified | 1024 |
| 256 | Ga0075429_100010093 | 3300006880 | Bacteria | 8182 |
| 257 | Ga0075429_100066198 | 3300006880 | Bacteria | 3145 |
| 258 | Ga0075429_100106911 | 3300006880 | Bacteria | 2445 |
| 259 | Ga0075429_100386693 | 3300006880 | Bacteria | 1225 |
| 260 | Ga0068865_100010738 | 3300006881 | Bacteria | 5708 |
| 261 | Ga0075436_100006302 | 3300006914 | Bacteria | 8128 |
| 262 | Ga0075436_100016213 | 3300006914 | Bacteria | 5101 |
| 263 | Ga0075436_100081620 | 3300006914 | Bacteria | 2242 |
| 264 | Ga0075436_100482047 | 3300006914 | Bacteria | 906 |
| 265 | Ga0097620_100429119 | 3300006931 | Bacteria | 1418 |
| 266 | Ga0097620_100563901 | 3300006931 | Bacteria | 1233 |
| 267 | Ga0075435_100001342 | 3300007076 | Bacteria | 15839 |
| 268 | Ga0075435_100003529 | 3300007076 | Bacteria | 10616 |
| 269 | Ga0075435_100020505 | 3300007076 | Bacteria | 5066 |
| 270 | Ga0075435_100022425 | 3300007076 | Bacteria | 4872 |
| 271 | Ga0075435_100048138 | 3300007076 | Bacteria | 3424 |
| 272 | Ga0075435_100144823 | 3300007076 | Bacteria | 1995 |
| 273 | Ga0075435_100307123 | 3300007076 | Bacteria | 1357 |
| 274 | Ga0105240_10119156 | 3300009093 | Bacteria | 3180 |
| 275 | Ga0105240_10181718 | 3300009093 | Bacteria | 2481 |
| 276 | Ga0105240_10249664 | 3300009093 | Bacteria | 2053 |
| 277 | Ga0105240_11062314 | 3300009093 | Bacteria | 863 |
| 278 | Ga0111539_10000159 | 3300009094 | Bacteria | 76817 |
| 279 | Ga0111539_10001132 | 3300009094 | Bacteria | 35254 |
| 280 | Ga0111539_10005818 | 3300009094 | Bacteria | 15942 |
| 281 | Ga0111539_10091748 | 3300009094 | Bacteria | 3569 |
| 282 | Ga0111539_10108298 | 3300009094 | Bacteria | 3261 |
| 283 | Ga0111539_10142013 | 3300009094 | Bacteria | 2811 |
| 284 | Ga0111539_10150068 | 3300009094 | Bacteria | 2728 |
| 285 | Ga0111539_10321933 | 3300009094 | Bacteria | 1799 |
| 286 | Ga0111539_10495438 | 3300009094 | Bacteria | 1423 |
| 287 | Ga0111539_10524650 | 3300009094 | Bacteria | 1380 |
| 288 | Ga0111539_10555551 | 3300009094 | Bacteria | 1337 |
| 289 | Ga0105245_10167129 | 3300009098 | Bacteria | 2092 |
| 290 | Ga0105245_10205491 | 3300009098 | Bacteria | 1893 |
| 291 | Ga0105245_11067305 | 3300009098 | Unclassified | 853 |
| 292 | Ga0114129_10003080 | 3300009147 | Bacteria | 23394 |
| 293 | Ga0114129_10004686 | 3300009147 | Bacteria | 19320 |
| 294 | Ga0114129_10005936 | 3300009147 | Bacteria | 17285 |
| 295 | Ga0114129_10005947 | 3300009147 | Bacteria | 17271 |
| 296 | Ga0114129_10014940 | 3300009147 | Bacteria | 11062 |
| 297 | Ga0114129_10015136 | 3300009147 | Bacteria | 10979 |
| 298 | Ga0114129_10015339 | 3300009147 | Bacteria | 10902 |
| 299 | Ga0114129_10018206 | 3300009147 | Bacteria | 10001 |
| 300 | Ga0114129_10020092 | 3300009147 | Bacteria | 9506 |
| 301 | Ga0114129_10020475 | 3300009147 | Bacteria | 9409 |
| 302 | Ga0114129_10166577 | 3300009147 | Bacteria | 3007 |
| 303 | Ga0114129_10349182 | 3300009147 | Bacteria | 1960 |
| 304 | Ga0114129_10479429 | 3300009147 | Bacteria | 1628 |
| 305 | Ga0114129_11105235 | 3300009147 | Bacteria | 992 |
| 306 | Ga0105243_10059416 | 3300009148 | Bacteria | 3051 |
| 307 | Ga0105243_10488889 | 3300009148 | Bacteria | 1163 |
| 308 | Ga0105243_10616293 | 3300009148 | Bacteria | 1047 |
| 309 | Ga0105241_10092922 | 3300009174 | Bacteria | 2383 |
| 310 | Ga0105241_10170541 | 3300009174 | Bacteria | 1797 |
| 311 | Ga0105241_10413795 | 3300009174 | Bacteria | 1185 |
| 312 | Ga0105242_10075189 | 3300009176 | Bacteria | 2812 |
| 313 | Ga0105242_10096956 | 3300009176 | Bacteria | 2492 |
| 314 | Ga0105242_10191186 | 3300009176 | Bacteria | 1812 |
| 315 | Ga0105242_10199882 | 3300009176 | Bacteria | 1775 |
| 316 | Ga0105248_10008294 | 3300009177 | Bacteria | 11413 |
| 317 | Ga0105248_10167534 | 3300009177 | Bacteria | 2476 |
| 318 | Ga0105248_10173918 | 3300009177 | Bacteria | 2427 |
| 319 | Ga0105248_10196066 | 3300009177 | Unclassified | 2275 |
| 320 | Ga0105248_10281996 | 3300009177 | Bacteria | 1870 |
| 321 | Ga0105248_10653983 | 3300009177 | Bacteria | 1186 |
| 322 | Ga0105248_10856437 | 3300009177 | Bacteria | 1026 |
| 323 | Ga0105237_10837143 | 3300009545 | Bacteria | 927 |
| 324 | Ga0105238_10353014 | 3300009551 | Bacteria | 1460 |
| 325 | Ga0105238_10386033 | 3300009551 | Bacteria | 1392 |
| 326 | Ga0105249_10060895 | 3300009553 | Bacteria | 3463 |
| 327 | Ga0105249_10167198 | 3300009553 | Unclassified | 2130 |
| 328 | Ga0105249_10235170 | 3300009553 | Bacteria | 1809 |
| 329 | Ga0105249_10514252 | 3300009553 | Bacteria | 1244 |
| 330 | Ga0105249_10687924 | 3300009553 | Unclassified | 1082 |
| 331 | Ga0105239_11002943 | 3300010375 | Bacteria | 960 |
| 332 | Ga0105246_10063426 | 3300011119 | Bacteria | 2577 |
| 333 | Ga0157370_10450483 | 3300013104 | Bacteria | 1183 |
| 334 | Ga0157369_10290850 | 3300013105 | Bacteria | 1701 |
| 335 | Ga0157374_10208906 | 3300013296 | Bacteria | 1914 |
| 336 | Ga0157374_10432775 | 3300013296 | Bacteria | 1315 |
| 337 | Ga0157374_10488361 | 3300013296 | Bacteria | 1235 |
| 338 | Ga0163162_10049950 | 3300013306 | Unclassified | 4194 |
| 339 | Ga0163162_10289786 | 3300013306 | Bacteria | 1769 |
| 340 | Ga0157372_10253205 | 3300013307 | Bacteria | 2044 |
| 341 | Ga0157372_10331013 | 3300013307 | Unclassified | 1774 |
| 342 | Ga0157372_10341479 | 3300013307 | Bacteria | 1744 |
| 343 | Ga0157372_11385527 | 3300013307 | Unclassified | 811 |
| 344 | Ga0157375_10028868 | 3300013308 | Bacteria | 5208 |
| 345 | Ga0157375_11009335 | 3300013308 | Bacteria | 972 |
| 346 | Ga0157375_11029739 | 3300013308 | Bacteria | 962 |
| 347 | Ga0157375_11031597 | 3300013308 | Bacteria | 961 |
| 348 | Ga0163163_10083729 | 3300014325 | Bacteria | 3195 |
| 349 | Ga0163163_10113490 | 3300014325 | Bacteria | 2740 |
| 350 | Ga0163163_10117285 | 3300014325 | Bacteria | 2694 |
| 351 | Ga0163163_10133092 | 3300014325 | Bacteria | 2527 |
| 352 | Ga0163163_10742363 | 3300014325 | Bacteria | 1045 |
| 353 | Ga0157380_10007670 | 3300014326 | Bacteria | 7678 |
| 354 | Ga0157380_10020788 | 3300014326 | Bacteria | 4913 |
| 355 | Ga0157380_10092269 | 3300014326 | Bacteria | 2502 |
| 356 | Ga0157380_10211859 | 3300014326 | Bacteria | 1727 |
| 357 | Ga0157380_10417305 | 3300014326 | Bacteria | 1279 |
| 358 | Ga0157380_11082613 | 3300014326 | Bacteria | 840 |
| 359 | Ga0157379_10020355 | 3300014968 | Bacteria | 5866 |
| 360 | Ga0157379_10140554 | 3300014968 | Bacteria | 2177 |
| 361 | Ga0157379_10202064 | 3300014968 | Bacteria | 1797 |
| 362 | Ga0157376_10047766 | 3300014969 | Bacteria | 3536 |
| 363 | Ga0157376_10179769 | 3300014969 | Bacteria | 1933 |
| 364 | Ga0157376_10279250 | 3300014969 | Unclassified | 1572 |
| 365 | Ga0157376_10924861 | 3300014969 | Bacteria | 891 |
| 366 | Ga0163161_10079418 | 3300017792 | Bacteria | 2413 |
| 367 | Ga0207673_1003453 | 3300025290 | Bacteria | 1850 |
| 368 | Ga0207697_10001568 | 3300025315 | Bacteria | 12343 |
| 369 | Ga0207697_10054229 | 3300025315 | Bacteria | 1661 |
| 370 | Ga0207697_10184009 | 3300025315 | Unclassified | 916 |
| 371 | Ga0207682_10067805 | 3300025893 | Bacteria | 1506 |
| 372 | Ga0207688_10004015 | 3300025901 | Bacteria | 8014 |
| 373 | Ga0207688_10053367 | 3300025901 | Bacteria | 2267 |
| 374 | Ga0207688_10195398 | 3300025901 | Bacteria | 1212 |
| 375 | Ga0207688_10296179 | 3300025901 | Unclassified | 988 |
| 376 | Ga0207688_10305952 | 3300025901 | Bacteria | 973 |
| 377 | Ga0207680_10110387 | 3300025903 | Bacteria | 1783 |
| 378 | Ga0207685_10116977 | 3300025905 | Bacteria | 1164 |
| 379 | Ga0207699_10124627 | 3300025906 | Bacteria | 1671 |
| 380 | Ga0207699_10179719 | 3300025906 | Bacteria | 1421 |
| 381 | Ga0207645_10012713 | 3300025907 | Bacteria | 5707 |
| 382 | Ga0207645_10313286 | 3300025907 | Bacteria | 1046 |
| 383 | Ga0207643_10147725 | 3300025908 | Bacteria | 1407 |
| 384 | Ga0207654_10182794 | 3300025911 | Bacteria | 1369 |
| 385 | Ga0207654_10302017 | 3300025911 | Bacteria | 1089 |
| 386 | Ga0207707_10375601 | 3300025912 | Bacteria | 1222 |
| 387 | Ga0207695_10323025 | 3300025913 | Bacteria | 1433 |
| 388 | Ga0207663_10034360 | 3300025916 | Bacteria | 3031 |
| 389 | Ga0207663_10275514 | 3300025916 | Unclassified | 1248 |
| 390 | Ga0207660_10214060 | 3300025917 | Bacteria | 1510 |
| 391 | Ga0207660_10323607 | 3300025917 | Bacteria | 1232 |
| 392 | Ga0207662_10030434 | 3300025918 | Bacteria | 3132 |
| 393 | Ga0207649_10276376 | 3300025920 | Bacteria | 1219 |
| 394 | Ga0207649_10687926 | 3300025920 | Bacteria | 792 |
| 395 | Ga0207652_10087310 | 3300025921 | Bacteria | 2735 |
| 396 | Ga0207652_10395690 | 3300025921 | Bacteria | 1247 |
| 397 | Ga0207652_10858722 | 3300025921 | Bacteria | 803 |
| 398 | Ga0207646_10523838 | 3300025922 | Unclassified | 1067 |
| 399 | Ga0207681_10022922 | 3300025923 | Bacteria | 3987 |
| 400 | Ga0207681_10028318 | 3300025923 | Bacteria | 3628 |
| 401 | Ga0207681_10630557 | 3300025923 | Unclassified | 888 |
| 402 | Ga0207650_10053739 | 3300025925 | Bacteria | 2986 |
| 403 | Ga0207650_10262410 | 3300025925 | Bacteria | 1401 |
| 404 | Ga0207659_10083887 | 3300025926 | Bacteria | 2363 |
| 405 | Ga0207659_10296959 | 3300025926 | Bacteria | 1325 |
| 406 | Ga0207659_10341509 | 3300025926 | Bacteria | 1240 |
| 407 | Ga0207659_10415188 | 3300025926 | Bacteria | 1128 |
| 408 | Ga0207659_10739620 | 3300025926 | Unclassified | 843 |
| 409 | Ga0207644_10031400 | 3300025931 | Bacteria | 3700 |
| 410 | Ga0207644_10040068 | 3300025931 | Bacteria | 3310 |
| 411 | Ga0207644_10384004 | 3300025931 | Bacteria | 1146 |
| 412 | Ga0207690_10021122 | 3300025932 | Bacteria | 4032 |
| 413 | Ga0207690_10279631 | 3300025932 | Bacteria | 1299 |
| 414 | Ga0207706_10220706 | 3300025933 | Bacteria | 1660 |
| 415 | Ga0207706_10313831 | 3300025933 | Unclassified | 1365 |
| 416 | Ga0207706_10316390 | 3300025933 | Bacteria | 1359 |
| 417 | Ga0207706_10352660 | 3300025933 | Bacteria | 1279 |
| 418 | Ga0207706_10414114 | 3300025933 | Bacteria | 1168 |
| 419 | Ga0207706_10499052 | 3300025933 | Bacteria | 1050 |
| 420 | Ga0207686_10150383 | 3300025934 | Bacteria | 1620 |
| 421 | Ga0207686_10301651 | 3300025934 | Bacteria | 1190 |
| 422 | Ga0207709_10131390 | 3300025935 | Bacteria | 1707 |
| 423 | Ga0207669_10012024 | 3300025937 | Bacteria | 4239 |
| 424 | Ga0207669_10027751 | 3300025937 | Bacteria | 3105 |
| 425 | Ga0207669_10120945 | 3300025937 | Bacteria | 1777 |
| 426 | Ga0207669_10440284 | 3300025937 | Bacteria | 1030 |
| 427 | Ga0207704_10116046 | 3300025938 | Bacteria | 1821 |
| 428 | Ga0207665_10095209 | 3300025939 | Bacteria | 2069 |
| 429 | Ga0207691_10012110 | 3300025940 | Bacteria | 8267 |
| 430 | Ga0207691_10053824 | 3300025940 | Bacteria | 3673 |
| 431 | Ga0207691_10053870 | 3300025940 | Bacteria | 3671 |
| 432 | Ga0207691_10058645 | 3300025940 | Bacteria | 3501 |
| 433 | Ga0207691_10079921 | 3300025940 | Bacteria | 2942 |
| 434 | Ga0207691_10257260 | 3300025940 | Unclassified | 1505 |
| 435 | Ga0207711_10050180 | 3300025941 | Bacteria | 3572 |
| 436 | Ga0207711_10059923 | 3300025941 | Bacteria | 3278 |
| 437 | Ga0207711_10189605 | 3300025941 | Bacteria | 1873 |
| 438 | Ga0207711_10303301 | 3300025941 | Bacteria | 1473 |
| 439 | Ga0207711_10347361 | 3300025941 | Bacteria | 1373 |
| 440 | Ga0207711_10636473 | 3300025941 | Bacteria | 995 |
| 441 | Ga0207689_10053462 | 3300025942 | Bacteria | 3327 |
| 442 | Ga0207689_10507555 | 3300025942 | Bacteria | 1011 |
| 443 | Ga0207661_10026010 | 3300025944 | Bacteria | 4455 |
| 444 | Ga0207661_10045422 | 3300025944 | Bacteria | 3477 |
| 445 | Ga0207661_10162472 | 3300025944 | Bacteria | 1939 |
| 446 | Ga0207661_10165018 | 3300025944 | Bacteria | 1924 |
| 447 | Ga0207679_10002292 | 3300025945 | Bacteria | 11801 |
| 448 | Ga0207679_10076051 | 3300025945 | Bacteria | 2550 |
| 449 | Ga0207679_10313861 | 3300025945 | Bacteria | 1355 |
| 450 | Ga0207679_10321934 | 3300025945 | Bacteria | 1339 |
| 451 | Ga0207679_10414307 | 3300025945 | Bacteria | 1188 |
| 452 | Ga0207667_10263672 | 3300025949 | Unclassified | 1762 |
| 453 | Ga0207667_10304950 | 3300025949 | Bacteria | 1627 |
| 454 | Ga0207651_10004078 | 3300025960 | Bacteria | 7281 |
| 455 | Ga0207651_10321873 | 3300025960 | Bacteria | 1293 |
| 456 | Ga0207651_10387428 | 3300025960 | Bacteria | 1186 |
| 457 | Ga0207712_10208920 | 3300025961 | Bacteria | 1553 |
| 458 | Ga0207712_10219097 | 3300025961 | Bacteria | 1520 |
| 459 | Ga0207712_10720588 | 3300025961 | Bacteria | 872 |
| 460 | Ga0207668_10181457 | 3300025972 | Bacteria | 1661 |
| 461 | Ga0207668_10493406 | 3300025972 | Bacteria | 1052 |
| 462 | Ga0207640_10011327 | 3300025981 | Bacteria | 5047 |
| 463 | Ga0207640_10397743 | 3300025981 | Bacteria | 1121 |
| 464 | Ga0207658_10023108 | 3300025986 | Bacteria | 4337 |
| 465 | Ga0207658_10478428 | 3300025986 | Bacteria | 1106 |
| 466 | Ga0207678_10049029 | 3300026067 | Bacteria | 3649 |
| 467 | Ga0207678_10076647 | 3300026067 | Bacteria | 2864 |
| 468 | Ga0207678_10156509 | 3300026067 | Bacteria | 1946 |
| 469 | Ga0207678_10250266 | 3300026067 | Bacteria | 1517 |
| 470 | Ga0207678_10300597 | 3300026067 | Archaea | 1379 |
| 471 | Ga0207708_10011422 | 3300026075 | Bacteria | 6613 |
| 472 | Ga0207708_10148869 | 3300026075 | Bacteria | 1841 |
| 473 | Ga0207708_10257132 | 3300026075 | Bacteria | 1409 |
| 474 | Ga0207708_10266817 | 3300026075 | Bacteria | 1383 |
| 475 | Ga0207708_10282220 | 3300026075 | Bacteria | 1346 |
| 476 | Ga0207702_10133137 | 3300026078 | Bacteria | 2239 |
| 477 | Ga0207702_10240774 | 3300026078 | Bacteria | 1695 |
| 478 | Ga0207702_10369360 | 3300026078 | Bacteria | 1377 |
| 479 | Ga0207641_10000667 | 3300026088 | Bacteria | 37425 |
| 480 | Ga0207641_10733992 | 3300026088 | Bacteria | 974 |
| 481 | Ga0207648_10039115 | 3300026089 | Bacteria | 4170 |
| 482 | Ga0207648_10119632 | 3300026089 | Bacteria | 2315 |
| 483 | Ga0207676_10046378 | 3300026095 | Bacteria | 3363 |
| 484 | Ga0207676_10095408 | 3300026095 | Bacteria | 2453 |
| 485 | Ga0207676_10107700 | 3300026095 | Bacteria | 2325 |
| 486 | Ga0207675_100119993 | 3300026118 | Bacteria | 2487 |
| 487 | Ga0207675_100487984 | 3300026118 | Bacteria | 1225 |
| 488 | Ga0207675_100552154 | 3300026118 | Unclassified | 1151 |
| 489 | Ga0207683_10024772 | 3300026121 | Bacteria | 5170 |
| 490 | Ga0207683_10266084 | 3300026121 | Unclassified | 1566 |
| 491 | Ga0207683_10377008 | 3300026121 | Bacteria | 1304 |
| 492 | Ga0207683_10545856 | 3300026121 | Bacteria | 1071 |
| 493 | Ga0207698_10927288 | 3300026142 | Unclassified | 879 |
| 494 | Ga0209971_1028914 | 3300027682 | Bacteria | 1327 |
| 495 | Ga0209813_10008064 | 3300027866 | Bacteria | 2649 |
| 496 | Ga0207428_10001075 | 3300027907 | Bacteria | 29809 |
| 497 | Ga0207428_10002569 | 3300027907 | Bacteria | 18144 |
| 498 | Ga0207428_10009844 | 3300027907 | Bacteria | 8562 |
| 499 | Ga0207428_10021461 | 3300027907 | Bacteria | 5468 |
| 500 | Ga0207428_10073487 | 3300027907 | Bacteria | 2682 |
| 501 | Ga0207428_10097373 | 3300027907 | Unclassified | 2277 |
| 502 | Ga0207428_10183348 | 3300027907 | Unclassified | 1581 |
| 503 | Ga0268266_10090768 | 3300028379 | Bacteria | 2678 |
| 504 | Ga0268266_10249785 | 3300028379 | Bacteria | 1640 |
| 505 | Ga0268266_10254068 | 3300028379 | Bacteria | 1627 |
| 506 | Ga0268266_10548745 | 3300028379 | Bacteria | 1107 |
| 507 | Ga0268265_10271588 | 3300028380 | Bacteria | 1513 |
| 508 | Ga0268265_10350986 | 3300028380 | Bacteria | 1347 |
| 509 | Ga0268265_10407880 | 3300028380 | Bacteria | 1258 |
| 510 | Ga0268265_10467261 | 3300028380 | Bacteria | 1182 |
| 511 | Ga0268264_10316667 | 3300028381 | Bacteria | 1474 |
| 512 | Ga0268264_10325045 | 3300028381 | Bacteria | 1456 |
| 513 | Ga0307408_100083765 | 3300031548 | Bacteria | 2390 |
| 514 | Ga0307408_100121996 | 3300031548 | Unclassified | 2020 |
| 515 | Ga0265314_10061270 | 3300031711 | Unclassified | 2563 |
| 516 | Ga0307405_10108849 | 3300031731 | Bacteria | 1873 |
| 517 | Ga0307405_10112770 | 3300031731 | Bacteria | 1845 |
| 518 | Ga0307405_10123446 | 3300031731 | Bacteria | 1776 |
| 519 | Ga0307413_10339984 | 3300031824 | Bacteria | 1154 |
| 520 | Ga0307410_10124228 | 3300031852 | Bacteria | 1887 |
| 521 | Ga0307406_10356004 | 3300031901 | Bacteria | 1146 |
| 522 | Ga0307406_10609972 | 3300031901 | Bacteria | 901 |
| 523 | Ga0307407_10094231 | 3300031903 | Bacteria | 1843 |
| 524 | Ga0307412_10567391 | 3300031911 | Bacteria | 956 |
| 525 | Ga0307409_100048523 | 3300031995 | Bacteria | 3232 |
| 526 | Ga0307409_100159718 | 3300031995 | Bacteria | 1969 |
| 527 | Ga0307409_100165738 | 3300031995 | Bacteria | 1939 |
| 528 | Ga0307409_100190286 | 3300031995 | Unclassified | 1826 |
| 529 | Ga0307409_100217530 | 3300031995 | Bacteria | 1722 |
| 530 | Ga0307409_100435609 | 3300031995 | Unclassified | 1261 |
| 531 | Ga0307409_101080386 | 3300031995 | Bacteria | 823 |
| 532 | Ga0307416_100029805 | 3300032002 | Bacteria | 4083 |
| 533 | Ga0307416_100045644 | 3300032002 | Bacteria | 3452 |
| 534 | Ga0307416_100100825 | 3300032002 | Bacteria | 2512 |
| 535 | Ga0307416_100110060 | 3300032002 | Unclassified | 2425 |
| 536 | Ga0307416_100164543 | 3300032002 | Unclassified | 2056 |
| 537 | Ga0307416_100174027 | 3300032002 | Bacteria | 2008 |
| 538 | Ga0307416_100267712 | 3300032002 | Unclassified | 1675 |
| 539 | Ga0307416_100292462 | 3300032002 | Unclassified | 1613 |
| 540 | Ga0307414_10210073 | 3300032004 | Bacteria | 1590 |
| 541 | Ga0307414_10292082 | 3300032004 | Bacteria | 1375 |
| 542 | Ga0307414_10661173 | 3300032004 | Bacteria | 943 |
| 543 | Ga0307411_10101415 | 3300032005 | Bacteria | 2037 |
| 544 | Ga0307411_10223112 | 3300032005 | Bacteria | 1463 |
| 545 | Ga0307415_100157787 | 3300032126 | Bacteria | 1754 |
| 546 | Ga0307415_100308104 | 3300032126 | Unclassified | 1315 |
| 547 | Ga0307415_100750888 | 3300032126 | Bacteria | 886 |
| 548 | Ga0307415_100876209 | 3300032126 | Bacteria | 826 |
| 549 | Ga0373948_0001350 | 3300034817 | Bacteria | 3370 |
| 550 | Ga0373958_0044725 | 3300034819 | Bacteria | 917 |
| 551 | Ga0373959_0028671 | 3300034820 | Bacteria | 1112 |
| 552 | Ga0373938_0003342 | 3300034957 | Bacteria | 2625 |
| 553 | Ga0373938_0061598 | 3300034957 | Bacteria | 879 |
| 554 | Ga0373929_0000830 | 3300035085 | Bacteria | 6021 |
| 555 | Ga0373940_0007532 | 3300035088 | Bacteria | 2461 |
| 556 | Ga0373949_0002959 | 3300035090 | Bacteria | 4181 |
| 557 | Ga0373951_0000480 | 3300035091 | Bacteria | 11448 |
| 558 | Ga0373951_0025185 | 3300035091 | Bacteria | 1381 |
| 559 | Ga0373952_0000212 | 3300035092 | Bacteria | 9165 |
| 560 | Ga0373923_0069114 | 3300035111 | Bacteria | 1514 |
| 561 | Ga0373923_0117452 | 3300035111 | Unclassified | 1186 |
| 562 | Ga0373932_0000133 | 3300035112 | Bacteria | 21018 |
| 563 | Ga0373939_0000812 | 3300035114 | Bacteria | 7708 |
| 564 | Ga0373939_0039327 | 3300035114 | Bacteria | 1415 |
| 565 | Ga0373939_0103554 | 3300035114 | Bacteria | 981 |
| 566 | Ga0373941_0002759 | 3300035115 | Bacteria | 3899 |
| 567 | Ga0373953_0033591 | 3300035117 | Bacteria | 2008 |
| 568 | Ga0373960_0018506 | 3300035121 | Bacteria | 1817 |
| 569 | Ga0373960_0075443 | 3300035121 | Bacteria | 1051 |
| 570 | Ga0373943_0003044 | 3300035170 | Bacteria | 7617 |
| 571 | Ga0373946_0004691 | 3300035171 | Bacteria | 4909 |
| 572 | Ga0373946_0037118 | 3300035171 | Bacteria | 1979 |
| 573 | Ga0373946_0061675 | 3300035171 | Bacteria | 1597 |
| 574 | Ga0373955_0254619 | 3300035172 | Unclassified | 1053 |
| 575 | Ga0373942_0005700 | 3300035207 | Bacteria | 2885 |
| 576 | Ga0373961_0000926 | 3300035241 | Bacteria | 9781 |
| 577 | Ga0373961_0009027 | 3300035241 | Bacteria | 2434 |
| 578 | Ga0373961_0014747 | 3300035241 | Unclassified | 1989 |
| 579 | Ga0373962_0000594 | 3300035242 | Bacteria | 8175 |
| 580 | Ga0373962_0047046 | 3300035242 | Unclassified | 1233 |
| 581 | Ga0373924_0035310 | 3300035410 | Unclassified | 2027 |
| 582 | Ga0373924_0087859 | 3300035410 | Bacteria | 1328 |
| 583 | Ga0373924_0171337 | 3300035410 | Bacteria | 954 |
| 584 | Ga0373931_0001600 | 3300035691 | Bacteria | 9790 |
| 585 | Ga0373931_0071850 | 3300035691 | Bacteria | 1891 |
| 586 | Ga0373931_0158454 | 3300035691 | Bacteria | 1325 |
| 587 | Ga0373935_0012031 | 3300035692 | Bacteria | 5201 |
| 588 | Ga0373935_0186047 | 3300035692 | Bacteria | 1428 |
| 589 | Ga0373933_0055618 | 3300035724 | Bacteria | 2374 |
| 590 | Ga0373947_0069335 | 3300035725 | Bacteria | 2158 |
| 591 | Ga0373937_0001133 | 3300036401 | Bacteria | 22430 |
| 592 | Ga0373937_0036918 | 3300036401 | Bacteria | 4453 |
| 593 | Ga0373937_0275752 | 3300036401 | Bacteria | 1588 |
| 594 | Ga0373925_0003703 | 3300037068 | Bacteria | 11742 |
| 595 | Ga0373925_0015321 | 3300037068 | Bacteria | 5545 |
| 596 | Ga0373925_0739910 | 3300037068 | Unclassified | 811 |
| 597 | Ga0395905_0793217 | 3300037471 | Bacteria | 850 |
| 598 | Ga0395901_0728084 | 3300038443 | Bacteria | 987 |
| 599 | Ga0439436_0082332 | 3300041404 | Bacteria | 896 |
| 600 | Ga0439436_0082972 | 3300041404 | Bacteria | 892 |
| 601 | Ga0439439_0013816 | 3300041406 | Bacteria | 1960 |
| 602 | Ga0451795_0441604 | 3300041456 | Bacteria | 970 |
| 603 | Ga0451849_1405725 | 3300041505 | Unclassified | 884 |
| 604 | Ga0439433_0011412 | 3300041999 | Bacteria | 1946 |
| 605 | Ga0439451_041683 | 3300042009 | Bacteria | 921 |
| 606 | Ga0450920_005476 | 3300042122 | Bacteria | 2257 |
| 607 | Ga0450896_001975 | 3300042133 | Bacteria | 2606 |
| 608 | Ga0450898_007257 | 3300042134 | Bacteria | 1722 |
| 609 | Ga0450899_018353 | 3300042135 | Bacteria | 809 |
| 610 | Ga0439446_0019965 | 3300042156 | Bacteria | 1885 |
| 611 | Ga0439434_0088557 | 3300042435 | Unclassified | 988 |
| 612 | Ga0439435_0000936 | 3300042436 | Bacteria | 5068 |
| 613 | Ga0439435_0010222 | 3300042436 | Bacteria | 2221 |
| 614 | Ga0439435_0058046 | 3300042436 | Unclassified | 1122 |
| 615 | Ga0439435_0116821 | 3300042436 | Unclassified | 832 |
| 616 | Ga0439460_0011420 | 3300042461 | Bacteria | 2289 |
| 617 | Ga0451577_0151231 | 3300042876 | Bacteria | 2088 |
| 618 | Ga0453684_0400144 | 3300044712 | Bacteria | 1538 |
| 619 | Ga0451576_0003826 | 3300045051 | Bacteria | 20230 |
| 620 | Ga0451576_0302997 | 3300045051 | Unclassified | 1672 |
| 621 | Ga0451576_1103677 | 3300045051 | Unclassified | 830 |
| 622 | Ga0495603_0057471 | 3300046455 | Bacteria | 2302 |
| 623 | Ga0495603_0102714 | 3300046455 | Bacteria | 1669 |
| 624 | Ga0495629_0285534 | 3300046459 | Bacteria | 1132 |
| 625 | Ga0495638_0003705 | 3300046460 | Bacteria | 11892 |
| 626 | Ga0495580_0330700 | 3300046472 | Bacteria | 1035 |
| 627 | Ga0495639_0100086 | 3300046475 | Bacteria | 1368 |
| 628 | Ga0495594_0110689 | 3300046499 | Bacteria | 1549 |
| 629 | Ga0495608_0140252 | 3300046511 | Bacteria | 1543 |
| 630 | Ga0495630_0485819 | 3300046517 | Bacteria | 947 |
| 631 | Ga0495652_0170262 | 3300046529 | Unclassified | 1682 |
| 632 | Ga0495586_0188589 | 3300046535 | Bacteria | 1168 |
| 633 | Ga0495587_0038631 | 3300046536 | Bacteria | 2861 |
| 634 | Ga0495667_0097822 | 3300046559 | Unclassified | 1900 |
| 635 | Ga0495667_0229425 | 3300046559 | Bacteria | 1184 |
| 636 | Ga0495634_0216819 | 3300046642 | Bacteria | 1183 |
| 637 | Ga0495635_0497936 | 3300046663 | Bacteria | 802 |
| 638 | Ga0495599_0326441 | 3300046678 | Unclassified | 923 |
| 639 | Ga0495647_0240858 | 3300046681 | Bacteria | 803 |
| 640 | Ga0495658_0060984 | 3300046683 | Unclassified | 2165 |
| 641 | Ga0495658_0481972 | 3300046683 | Bacteria | 793 |
| 642 | Ga0495613_0006752 | 3300046689 | Bacteria | 8570 |
| 643 | Ga0495600_0215870 | 3300046809 | Bacteria | 1228 |
| 644 | Ga0495674_0011154 | 3300047319 | Bacteria | 8484 |
| 645 | Ga0495672_0066901 | 3300047320 | Bacteria | 2048 |
| 646 | Ga0495684_0000226 | 3300047471 | Bacteria | 44097 |
| 647 | Ga0495684_0517052 | 3300047471 | Bacteria | 818 |
| 648 | Ga0496100_0036166 | 3300048903 | Bacteria | 3112 |
| 649 | Ga0496100_0255931 | 3300048903 | Bacteria | 1297 |
| 650 | Ga0496100_0428151 | 3300048903 | Bacteria | 1012 |
| 651 | Ga0496101_0001396 | 3300048904 | Bacteria | 14449 |
| 652 | Ga0496101_0047743 | 3300048904 | Bacteria | 3075 |
| 653 | Ga0496101_0125721 | 3300048904 | Bacteria | 1943 |
| 654 | Ga0496102_0064346 | 3300048905 | Bacteria | 3359 |
| 655 | Ga0496102_0190663 | 3300048905 | Unclassified | 1931 |
| 656 | Ga0496102_0278369 | 3300048905 | Bacteria | 1577 |
| 657 | Ga0496103_0161951 | 3300048906 | Bacteria | 1435 |
| 658 | Ga0496104_0008772 | 3300048907 | Bacteria | 8990 |
| 659 | Ga0496104_0017991 | 3300048907 | Bacteria | 6443 |
| 660 | Ga0496104_0404124 | 3300048907 | Bacteria | 1278 |
| 661 | Ga0496104_0544745 | 3300048907 | Bacteria | 1071 |
| 662 | Ga0496105_0073215 | 3300048908 | Unclassified | 2831 |
| 663 | Ga0496105_0079560 | 3300048908 | Bacteria | 2707 |
| 664 | Ga0496105_0523944 | 3300048908 | Bacteria | 928 |
| 665 | Ga0496106_0031956 | 3300048909 | Bacteria | 3923 |
| 666 | Ga0496106_0349207 | 3300048909 | Unclassified | 1188 |
| 667 | Ga0496106_0580931 | 3300048909 | Bacteria | 898 |
| 668 | Ga0496106_0786111 | 3300048909 | Bacteria | 755 |
| 669 | Ga0496107_0386571 | 3300048910 | Bacteria | 1041 |
| 670 | Ga0496108_0072827 | 3300048911 | Unclassified | 2901 |
| 671 | Ga0496108_0105953 | 3300048911 | Bacteria | 2401 |
| 672 | Ga0496108_0295716 | 3300048911 | Unclassified | 1410 |
| 673 | Ga0496108_0343433 | 3300048911 | Bacteria | 1302 |
| 674 | Ga0496108_0469910 | 3300048911 | Bacteria | 1099 |
| 675 | Ga0496109_0008449 | 3300048912 | Bacteria | 8755 |
| 676 | Ga0496109_0423920 | 3300048912 | Bacteria | 1257 |
| 677 | Ga0496110_0001028 | 3300048913 | Bacteria | 19617 |
| 678 | Ga0496110_0047039 | 3300048913 | Bacteria | 3776 |
| 679 | Ga0496110_0171715 | 3300048913 | Bacteria | 1967 |
| 680 | Ga0496110_0282315 | 3300048913 | Bacteria | 1512 |
| 681 | Ga0496111_0002876 | 3300048914 | Bacteria | 10513 |
| 682 | Ga0496112_0012055 | 3300048915 | Bacteria | 7930 |
| 683 | Ga0496112_0130428 | 3300048915 | Bacteria | 2485 |
| 684 | Ga0496112_0474870 | 3300048915 | Bacteria | 1187 |
| 685 | Ga0496114_0003318 | 3300048917 | Bacteria | 12366 |
| 686 | Ga0496114_0016205 | 3300048917 | Bacteria | 6001 |
| 687 | Ga0496114_0198069 | 3300048917 | Bacteria | 1758 |
| 688 | Ga0496114_0773237 | 3300048917 | Unclassified | 838 |
| 689 | Ga0496115_0052754 | 3300048918 | Bacteria | 3263 |
| 690 | Ga0496115_0160647 | 3300048918 | Bacteria | 1857 |
| 691 | Ga0501292_012949 | 3300049515 | Bacteria | 1278 |
| 692 | Ga0501292_023063 | 3300049515 | Unclassified | 1016 |
| 693 | Ga0501031_0430097 | 3300049568 | Unclassified | 853 |
| 694 | Ga0501032_0371644 | 3300049569 | Unclassified | 920 |
| 695 | Ga0501034_0028871 | 3300049571 | Bacteria | 5642 |
| 696 | Ga0501034_0083559 | 3300049571 | Bacteria | 3195 |
| 697 | Ga0501036_0121886 | 3300049572 | Bacteria | 2202 |
| 698 | Ga0501036_0384228 | 3300049572 | Unclassified | 1171 |
| 699 | Ga0501036_0424489 | 3300049572 | Unclassified | 1108 |
| 700 | Ga0501039_0105191 | 3300049575 | Bacteria | 2204 |
| 701 | Ga0501039_0198160 | 3300049575 | Bacteria | 1579 |
| 702 | Ga0501039_0276605 | 3300049575 | Unclassified | 1320 |
| 703 | Ga0501039_0627805 | 3300049575 | Bacteria | 842 |
| 704 | Ga0501040_0118695 | 3300049576 | Bacteria | 1855 |
| 705 | Ga0501040_0125178 | 3300049576 | Bacteria | 1805 |
| 706 | Ga0501041_0442327 | 3300049577 | Unclassified | 825 |
| 707 | Ga0501042_0101822 | 3300049578 | Bacteria | 2066 |
| 708 | Ga0501042_0292817 | 3300049578 | Unclassified | 1176 |
| 709 | Ga0501043_0097525 | 3300049579 | Unclassified | 2311 |
| 710 | Ga0501046_0236032 | 3300049580 | Unclassified | 1350 |
| 711 | Ga0501047_0048474 | 3300049581 | Bacteria | 4102 |
| 712 | Ga0501048_0247109 | 3300049582 | Unclassified | 1266 |
| 713 | Ga0501048_0573170 | 3300049582 | Bacteria | 810 |
| 714 | Ga0501067_0127915 | 3300049583 | Bacteria | 1413 |
| 715 | Ga0501069_0061543 | 3300049585 | Bacteria | 2096 |
| 716 | Ga0501069_0154185 | 3300049585 | Unclassified | 1321 |
| 717 | Ga0501071_0061541 | 3300049587 | Bacteria | 2719 |
| 718 | Ga0501071_0161634 | 3300049587 | Unclassified | 1674 |
| 719 | Ga0501071_0236836 | 3300049587 | Bacteria | 1376 |
| 720 | Ga0501071_0461530 | 3300049587 | Unclassified | 973 |
| 721 | Ga0501072_0012676 | 3300049588 | Bacteria | 6446 |
| 722 | Ga0501072_0076812 | 3300049588 | Bacteria | 2643 |
| 723 | Ga0501072_0151136 | 3300049588 | Unclassified | 1851 |
| 724 | Ga0501072_0451560 | 3300049588 | Bacteria | 1018 |
| 725 | Ga0501073_0000430 | 3300049589 | Bacteria | 28781 |
| 726 | Ga0501073_0258642 | 3300049589 | Bacteria | 1201 |
| 727 | Ga0501074_0059878 | 3300049590 | Bacteria | 2743 |
| 728 | Ga0501074_0139387 | 3300049590 | Bacteria | 1735 |
| 729 | Ga0501075_0025723 | 3300049591 | Bacteria | 4325 |
| 730 | Ga0501075_0055996 | 3300049591 | Bacteria | 2968 |
| 731 | Ga0501075_0065169 | 3300049591 | Bacteria | 2748 |
| 732 | Ga0501075_0326697 | 3300049591 | Bacteria | 1169 |
| 733 | Ga0501076_0029968 | 3300049592 | Bacteria | 4236 |
| 734 | Ga0501076_0128736 | 3300049592 | Bacteria | 2052 |
| 735 | Ga0501076_0344214 | 3300049592 | Bacteria | 1224 |
| 736 | Ga0501076_0485570 | 3300049592 | Unclassified | 1018 |
| 737 | Ga0501076_0639980 | 3300049592 | Unclassified | 877 |
| 738 | Ga0501077_0230533 | 3300049593 | Bacteria | 1177 |
| 739 | Ga0501235_009852 | 3300049669 | Bacteria | 2090 |
| 740 | Ga0501239_011728 | 3300049672 | Unclassified | 983 |
| 741 | Ga0501225_0068745 | 3300049705 | Bacteria | 1005 |
| 742 | Ga0501079_0043341 | 3300049741 | Bacteria | 3473 |
| 743 | Ga0501079_0061678 | 3300049741 | Bacteria | 2892 |
| 744 | Ga0501079_0331616 | 3300049741 | Bacteria | 1192 |
| 745 | Ga0501079_0361626 | 3300049741 | Unclassified | 1137 |
| 746 | Ga0501080_0102502 | 3300049742 | Bacteria | 2655 |
| 747 | Ga0501080_0225902 | 3300049742 | Bacteria | 1712 |
| 748 | Ga0501080_0309341 | 3300049742 | Unclassified | 1432 |
| 749 | Ga0501081_0063095 | 3300049743 | Bacteria | 2571 |
| 750 | Ga0501081_0198816 | 3300049743 | Unclassified | 1453 |
| 751 | Ga0501271_007320 | 3300049768 | Unclassified | 1110 |
| 752 | Ga0501044_0004662 | 3300049823 | Bacteria | 15342 |
| 753 | Ga0501045_0146040 | 3300049824 | Unclassified | 1759 |
| 754 | Ga0501045_0371839 | 3300049824 | Bacteria | 1064 |
| 755 | Ga0501045_0378093 | 3300049824 | Bacteria | 1054 |
| 756 | nmdc:mga03683_30439_c1 | 3300050489 | Bacteria | 2160 |
| 757 | nmdc:mga03683_63536_c1 | 3300050489 | Unclassified | 1565 |
| 758 | nmdc:mga00v17_23849_c1 | 3300050491 | Bacteria | 3543 |
| 759 | nmdc:mga00v17_321748_c1 | 3300050491 | Bacteria | 1005 |
| 760 | nmdc:mga00v17_445680_c1 | 3300050491 | Bacteria | 841 |
| 761 | nmdc:mga00v17_57772_c1 | 3300050491 | Bacteria | 2374 |
| 762 | nmdc:mga00v17_66060_c1 | 3300050491 | Bacteria | 2233 |
| 763 | nmdc:mga0yw44_132762_c1 | 3300050492 | Bacteria | 1613 |
| 764 | nmdc:mga0yw44_146583_c1 | 3300050492 | Bacteria | 1537 |
| 765 | nmdc:mga0yw44_72645_c1 | 3300050492 | Unclassified | 2139 |
| 766 | nmdc:mga0k408_13316_c1 | 3300050493 | Bacteria | 4508 |
| 767 | nmdc:mga0k408_202559_c1 | 3300050493 | Unclassified | 1185 |
| 768 | nmdc:mga0k408_25762_c1 | 3300050493 | Bacteria | 3332 |
| 769 | nmdc:mga0k408_35378_c1 | 3300050493 | Bacteria | 2864 |
| 770 | nmdc:mga06z11_11222_c1 | 3300050494 | Unclassified | 3854 |
| 771 | nmdc:mga06z11_17107_c1 | 3300050494 | Bacteria | 3283 |
| 772 | nmdc:mga06z11_51310_c1 | 3300050494 | Bacteria | 2112 |
| 773 | nmdc:mga06z11_66634_c1 | 3300050494 | Bacteria | 1894 |
| 774 | nmdc:mga04h51_8770_c1 | 3300050495 | Bacteria | 2715 |
| 775 | nmdc:mga07m45_168497_c1 | 3300050496 | Bacteria | 1272 |
| 776 | nmdc:mga07m45_31196_c1 | 3300050496 | Bacteria | 2953 |
| 777 | nmdc:mga05p37_1011882_c1 | 3300050507 | Bacteria | 881 |
| 778 | nmdc:mga05p37_12570_c1 | 3300050507 | Bacteria | 10109 |
| 779 | nmdc:mga05p37_1500_c2 | 3300050507 | Bacteria | 23791 |
| 780 | nmdc:mga05p37_17645_c1 | 3300050507 | Bacteria | 8612 |
| 781 | nmdc:mga05p37_221081_c1 | 3300050507 | Bacteria | 1771 |
| 782 | nmdc:mga05p37_257111_c1 | 3300050507 | Bacteria | 2092 |
| 783 | nmdc:mga05p37_27903_c2 | 3300050507 | Bacteria | 6521 |
| 784 | nmdc:mga05p37_32706_c1 | 3300050507 | Bacteria | 6363 |
| 785 | nmdc:mga05p37_5123_c1 | 3300050507 | Bacteria | 15369 |
| 786 | nmdc:mga05p37_5835_c2 | 3300050507 | Bacteria | 10997 |
| 787 | nmdc:mga05p37_65145_c1 | 3300050507 | Bacteria | 4484 |
| 788 | nmdc:mga05p37_71086_c1 | 3300050507 | Bacteria | 4281 |
| 789 | nmdc:mga09592_150062_c1 | 3300050508 | Bacteria | 2011 |
| 790 | nmdc:mga09592_165039_c1 | 3300050508 | Bacteria | 1914 |
| 791 | nmdc:mga09592_27688_c1 | 3300050508 | Bacteria | 4705 |
| 792 | nmdc:mga09592_378024_c1 | 3300050508 | Bacteria | 1225 |
| 793 | nmdc:mga09592_405460_c1 | 3300050508 | Bacteria | 1178 |
| 794 | nmdc:mga09592_585007_c1 | 3300050508 | Unclassified | 957 |
| 795 | nmdc:mga09592_9342_c1 | 3300050508 | Bacteria | 7973 |
| 796 | nmdc:mga0qj67_124572_c1 | 3300050509 | Bacteria | 2085 |
| 797 | nmdc:mga0qj67_188403_c1 | 3300050509 | Bacteria | 1677 |
| 798 | nmdc:mga0qj67_202563_c1 | 3300050509 | Unclassified | 1612 |
| 799 | nmdc:mga0qj67_31764_c1 | 3300050509 | Unclassified | 4115 |
| 800 | nmdc:mga0qj67_4023_c1 | 3300050509 | Bacteria | 10645 |
| 801 | nmdc:mga0qj67_88363_c1 | 3300050509 | Bacteria | 2488 |
| 802 | nmdc:mga0qj67_96447_c1 | 3300050509 | Bacteria | 2381 |
| 803 | nmdc:mga06r32_154420_c1 | 3300050510 | Bacteria | 2276 |
| 804 | nmdc:mga06r32_176978_c1 | 3300050510 | Bacteria | 2118 |
| 805 | nmdc:mga06r32_188657_c1 | 3300050510 | Unclassified | 2049 |
| 806 | nmdc:mga06r32_53035_c1 | 3300050510 | Bacteria | 3885 |
| 807 | nmdc:mga06r32_6030_c1 | 3300050510 | Bacteria | 10903 |
| 808 | nmdc:mga06r32_652058_c1 | 3300050510 | Bacteria | 1021 |
| 809 | nmdc:mga08y16_207016_c1 | 3300050511 | Bacteria | 2032 |
| 810 | nmdc:mga08y16_254922_c1 | 3300050511 | Bacteria | 1813 |
| 811 | nmdc:mga08y16_286616_c1 | 3300050511 | Bacteria | 1698 |
| 812 | nmdc:mga08y16_506030_c1 | 3300050511 | Bacteria | 1227 |
| 813 | nmdc:mga08y16_53398_c1 | 3300050511 | Bacteria | 4226 |
| 814 | nmdc:mga08y16_61798_c1 | 3300050511 | Bacteria | 3911 |
| 815 | nmdc:mga08y16_76858_c1 | 3300050511 | Bacteria | 3480 |
| 816 | nmdc:mga08y16_89520_c1 | 3300050511 | Bacteria | 3207 |
| 817 | nmdc:mga08y16_95715_c1 | 3300050511 | Bacteria | 3093 |
| 818 | nmdc:mga08y16_99921_c1 | 3300050511 | Bacteria | 3021 |
| 819 | nmdc:mga0n895_20034_c1 | 3300050512 | Bacteria | 6229 |
| 820 | nmdc:mga0n895_219225_c1 | 3300050512 | Bacteria | 1932 |
| 821 | nmdc:mga0n895_229_c1 | 3300050512 | Bacteria | 35421 |
| 822 | nmdc:mga0n895_361484_c1 | 3300050512 | Bacteria | 1470 |
| 823 | nmdc:mga0n895_427657_c1 | 3300050512 | Unclassified | 1338 |
| 824 | nmdc:mga0n895_567231_c1 | 3300050512 | Bacteria | 1140 |
| 825 | nmdc:mga0n895_71478_c1 | 3300050512 | Bacteria | 3441 |
| 826 | nmdc:mga0rr50_103323_c1 | 3300050513 | Unclassified | 2243 |
| 827 | nmdc:mga0rr50_14_c1 | 3300050513 | Bacteria | 196574 |
| 828 | nmdc:mga0rr50_159586_c1 | 3300050513 | Bacteria | 1829 |
| 829 | nmdc:mga0rr50_219879_c1 | 3300050513 | Bacteria | 1568 |
| 830 | nmdc:mga0rr50_22513_c1 | 3300050513 | Bacteria | 4327 |
| 831 | nmdc:mga0rr50_250679_c1 | 3300050513 | Bacteria | 1470 |
| 832 | nmdc:mga0rr50_3194_c1 | 3300050513 | Bacteria | 9370 |
| 833 | nmdc:mga0rr50_45565_c1 | 3300050513 | Bacteria | 3224 |
| 834 | nmdc:mga0rr50_602822_c1 | 3300050513 | Unclassified | 936 |
| 835 | nmdc:mga0rr50_709628_c1 | 3300050513 | Bacteria | 858 |
| 836 | nmdc:mga08x19_12392_c1 | 3300050514 | Bacteria | 5136 |
| 837 | nmdc:mga08x19_72724_c1 | 3300050514 | Bacteria | 2243 |
| 838 | nmdc:mga0a205_104477_c1 | 3300050515 | Bacteria | 2732 |
| 839 | nmdc:mga0a205_138828_c1 | 3300050515 | Bacteria | 2331 |
| 840 | nmdc:mga0a205_147733_c1 | 3300050515 | Bacteria | 2251 |
| 841 | nmdc:mga0a205_18545_c1 | 3300050515 | Bacteria | 6544 |
| 842 | nmdc:mga0a205_203041_c1 | 3300050515 | Bacteria | 1872 |
| 843 | nmdc:mga0a205_257708_c1 | 3300050515 | Bacteria | 1622 |
| 844 | nmdc:mga0a205_8071_c1 | 3300050515 | Bacteria | 9572 |
| 845 | Ga0495601_0027119 | 3300053077 | Bacteria | 3541 |
| 846 | Ga0495601_0264364 | 3300053077 | Unclassified | 1123 |
| 847 | Ga0495601_0278148 | 3300053077 | Bacteria | 1091 |
| 848 | Ga0495595_0018713 | 3300053084 | Bacteria | 2996 |
| 849 | Ga0495619_0003775 | 3300053085 | Bacteria | 9743 |
| 850 | Ga0495619_0012315 | 3300053085 | Bacteria | 5383 |
| 851 | Ga0495619_0044076 | 3300053085 | Bacteria | 2927 |
| 852 | Ga0495619_0067617 | 3300053085 | Archaea | 2386 |
| 853 | Ga0495619_0302189 | 3300053085 | Bacteria | 1108 |
| 854 | Ga0500641_0009818 | 3300053096 | Bacteria | 3447 |
| 855 | Ga0500555_007562 | 3300053103 | Bacteria | 3087 |
| 856 | Ga0500592_003976 | 3300053116 | Bacteria | 2361 |
| 857 | Ga0500568_0004866 | 3300053139 | Bacteria | 7092 |
| 858 | Ga0500616_0000567 | 3300053153 | Bacteria | 45260 |
| 859 | Ga0500627_0221183 | 3300053158 | Unclassified | 845 |
| 860 | Ga0500645_000402 | 3300053730 | Bacteria | 30326 |
| 861 | Ga0500599_012921 | 3300053736 | Bacteria | 1125 |
| 862 | Ga0501084_0028086 | 3300054114 | Bacteria | 4702 |
| 863 | Ga0501084_0235088 | 3300054114 | Bacteria | 1547 |
| 864 | Ga0501084_0257956 | 3300054114 | Bacteria | 1472 |
| 865 | Ga0501084_0318615 | 3300054114 | Bacteria | 1313 |
| 866 | Ga0590071_000026 | 3300059421 | Bacteria | 37861 |
| 867 | Ga0590071_000236 | 3300059421 | Bacteria | 16159 |
| 868 | Ga0590074_002005 | 3300059423 | Bacteria | 3332 |
| 869 | Ga0590075_000068 | 3300059424 | Bacteria | 25784 |
| 870 | Ga0590075_000183 | 3300059424 | Bacteria | 17452 |
| 871 | Ga0590075_010098 | 3300059424 | Bacteria | 2270 |
| 872 | Ga0590077_000212 | 3300059426 | Bacteria | 16714 |
| 873 | Ga0590077_000467 | 3300059426 | Bacteria | 11366 |
| 874 | Ga0587084_035243 | 3300059477 | Unclassified | 825 |
| 875 | Ga0587091_027257 | 3300059511 | Bacteria | 1047 |
| 876 | Ga0587091_057831 | 3300059511 | Bacteria | 815 |
| 877 | Ga0587115_023167 | 3300059626 | Bacteria | 879 |
| 878 | Ga0587062_031957 | 3300059639 | Bacteria | 811 |
| 879 | Ga0587069_025428 | 3300059642 | Bacteria | 921 |
| 880 | Ga0587071_027528 | 3300060344 | Bacteria | 1078 |
| 881 | Ga0587071_046805 | 3300060344 | Bacteria | 884 |
| 882 | Ga0501082_0171402 | 3300060353 | Bacteria | 1887 |
| 883 | Ga0501082_0239270 | 3300060353 | Unclassified | 1580 |
| 884 | Ga0501082_0301322 | 3300060353 | Unclassified | 1396 |
| 885 | Ga0501082_0344687 | 3300060353 | Bacteria | 1298 |
| 886 | Ga0530510_0060229 | 3300061734 | Bacteria | 2747 |
| 887 | Ga0530510_0071377 | 3300061734 | Bacteria | 2521 |
| 888 | Ga0530510_0099621 | 3300061734 | Bacteria | 2125 |
| 889 | Ga0530510_0432236 | 3300061734 | Unclassified | 994 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006178 | Ga0075367_10406317 | Ga0075367_104063172 | 204 |
| 2 | 3300048915 | Ga0496112_0474870 | Ga0496112_0474870_552_1172 | 206 |
| 3 | 3300049588 | Ga0501072_0151136 | Ga0501072_0151136_1181_1801 | 206 |
| 4 | 3300046663 | Ga0495635_0497936 | Ga0495635_0497936_163_786 | 207 |
| 5 | 3300005336 | Ga0070680_100153809 | Ga0070680_1001538093 | 210 |
| 6 | 3300009094 | Ga0111539_10142013 | Ga0111539_101420133 | 210 |
| 7 | 3300028380 | Ga0268265_10407880 | Ga0268265_104078801 | 210 |
| 8 | 3300050511 | nmdc:mga08y16_61798_c1 | nmdc:mga08y16_61798_c1_2433_3116 | 210 |
| 9 | 3300025972 | Ga0207668_10181457 | Ga0207668_101814571 | 214 |
| 10 | 3300005293 | Ga0065715_10101127 | Ga0065715_101011273 | 217 |
| 11 | 3300005293 | Ga0065715_10326582 | Ga0065715_103265821 | 217 |
| 12 | 3300005295 | Ga0065707_10106216 | Ga0065707_101062162 | 217 |
| 13 | 3300005330 | Ga0070690_100106953 | Ga0070690_1001069533 | 217 |
| 14 | 3300005334 | Ga0068869_100156595 | Ga0068869_1001565953 | 217 |
| 15 | 3300005337 | Ga0070682_100150697 | Ga0070682_1001506972 | 217 |
| 16 | 3300005341 | Ga0070691_10054188 | Ga0070691_100541882 | 217 |
| 17 | 3300005343 | Ga0070687_100091944 | Ga0070687_1000919442 | 217 |
| 18 | 3300005353 | Ga0070669_100517555 | Ga0070669_1005175551 | 217 |
| 19 | 3300005354 | Ga0070675_100115369 | Ga0070675_1001153693 | 217 |
| 20 | 3300005364 | Ga0070673_100003223 | Ga0070673_10000322312 | 217 |
| 21 | 3300005365 | Ga0070688_100017161 | Ga0070688_1000171613 | 217 |
| 22 | 3300005438 | Ga0070701_10036952 | Ga0070701_100369523 | 217 |
| 23 | 3300005444 | Ga0070694_100015345 | Ga0070694_1000153454 | 217 |
| 24 | 3300005457 | Ga0070662_100154485 | Ga0070662_1001544853 | 217 |
| 25 | 3300005459 | Ga0068867_100056868 | Ga0068867_1000568682 | 217 |
| 26 | 3300005544 | Ga0070686_100029678 | Ga0070686_1000296783 | 217 |
| 27 | 3300049569 | Ga0501032_0371644 | Ga0501032_0371644_10_672 | 220 |
| 28 | 3300031711 | Ga0265314_10061270 | Ga0265314_100612702 | 222 |
| 29 | 3300005719 | Ga0068861_100293311 | Ga0068861_1002933112 | 223 |
| 30 | 3300006042 | Ga0075368_10079634 | Ga0075368_100796342 | 223 |
| 31 | 3300006178 | Ga0075367_10019063 | Ga0075367_100190633 | 223 |
| 32 | 3300006195 | Ga0075366_10012901 | Ga0075366_100129013 | 223 |
| 33 | 3300006353 | Ga0075370_10156368 | Ga0075370_101563681 | 223 |
| 34 | 3300026118 | Ga0207675_100552154 | Ga0207675_1005521542 | 223 |
| 35 | 3300027866 | Ga0209813_10008064 | Ga0209813_100080642 | 223 |
| 36 | 3300049592 | Ga0501076_0485570 | Ga0501076_0485570_86_760 | 223 |
| 37 | 3300050493 | nmdc:mga0k408_25762_c1 | nmdc:mga0k408_25762_c1_877_1551 | 223 |
| 38 | 3300050494 | nmdc:mga06z11_66634_c1 | nmdc:mga06z11_66634_c1_865_1539 | 223 |
| 39 | 3300050495 | nmdc:mga04h51_8770_c1 | nmdc:mga04h51_8770_c1_258_932 | 223 |
| 40 | 3300050496 | nmdc:mga07m45_168497_c1 | nmdc:mga07m45_168497_c1_477_1151 | 223 |
| 41 | 3300053158 | Ga0500627_0221183 | Ga0500627_0221183_54_728 | 223 |
| 42 | 3300006914 | Ga0075436_100482047 | Ga0075436_1004820471 | 226 |
| 43 | 3300041505 | Ga0451849_1405725 | Ga0451849_1405725_63_743 | 226 |
| 44 | 3300004799 | Ga0058863_11348119 | Ga0058863_113481191 | 227 |
| 45 | 3300005288 | Ga0065714_10136143 | Ga0065714_101361432 | 227 |
| 46 | 3300005290 | Ga0065712_10003522 | Ga0065712_100035222 | 227 |
| 47 | 3300005331 | Ga0070670_100008366 | Ga0070670_10000836610 | 227 |
| 48 | 3300005344 | Ga0070661_100091577 | Ga0070661_1000915772 | 227 |
| 49 | 3300005441 | Ga0070700_100115987 | Ga0070700_1001159872 | 227 |
| 50 | 3300005444 | Ga0070694_100276075 | Ga0070694_1002760752 | 227 |
| 51 | 3300005564 | Ga0070664_100039698 | Ga0070664_1000396984 | 227 |
| 52 | 3300005617 | Ga0068859_100429179 | Ga0068859_1004291793 | 227 |
| 53 | 3300005618 | Ga0068864_100105772 | Ga0068864_1001057723 | 227 |
| 54 | 3300005985 | Ga0081539_10047867 | Ga0081539_100478672 | 227 |
| 55 | 3300006844 | Ga0075428_100465421 | Ga0075428_1004654211 | 227 |
| 56 | 3300006844 | Ga0075428_100724724 | Ga0075428_1007247242 | 227 |
| 57 | 3300006846 | Ga0075430_100181980 | Ga0075430_1001819802 | 227 |
| 58 | 3300006931 | Ga0097620_100429119 | Ga0097620_1004291193 | 227 |
| 59 | 3300009094 | Ga0111539_10005818 | Ga0111539_1000581811 | 227 |
| 60 | 3300009553 | Ga0105249_10687924 | Ga0105249_106879241 | 227 |
| 61 | 3300014325 | Ga0163163_10113490 | Ga0163163_101134904 | 227 |
| 62 | 3300014326 | Ga0157380_10007670 | Ga0157380_100076707 | 227 |
| 63 | 3300014326 | Ga0157380_10020788 | Ga0157380_100207886 | 227 |
| 64 | 3300025917 | Ga0207660_10214060 | Ga0207660_102140603 | 227 |
| 65 | 3300025925 | Ga0207650_10053739 | Ga0207650_100537391 | 227 |
| 66 | 3300025945 | Ga0207679_10313861 | Ga0207679_103138612 | 227 |
| 67 | 3300026075 | Ga0207708_10148869 | Ga0207708_101488692 | 227 |
| 68 | 3300027907 | Ga0207428_10001075 | Ga0207428_1000107522 | 227 |
| 69 | 3300027907 | Ga0207428_10183348 | Ga0207428_101833483 | 227 |
| 70 | 3300028380 | Ga0268265_10271588 | Ga0268265_102715882 | 227 |
| 71 | 3300031995 | Ga0307409_100435609 | Ga0307409_1004356092 | 227 |
| 72 | 3300032002 | Ga0307416_100292462 | Ga0307416_1002924623 | 227 |
| 73 | 3300032004 | Ga0307414_10292082 | Ga0307414_102920821 | 227 |
| 74 | 3300032005 | Ga0307411_10101415 | Ga0307411_101014152 | 227 |
| 75 | 3300049587 | Ga0501071_0236836 | Ga0501071_0236836_243_926 | 227 |
| 76 | 3300049589 | Ga0501073_0000430 | Ga0501073_0000430_21870_22553 | 227 |
| 77 | 3300049590 | Ga0501074_0059878 | Ga0501074_0059878_2008_2691 | 227 |
| 78 | 3300049669 | Ga0501235_009852 | Ga0501235_009852_206_889 | 227 |
| 79 | 3300050509 | nmdc:mga0qj67_202563_c1 | nmdc:mga0qj67_202563_c1_461_1144 | 227 |
| 80 | 3300050511 | nmdc:mga08y16_53398_c1 | nmdc:mga08y16_53398_c1_624_1307 | 227 |
| 81 | 3300005290 | Ga0065712_10200589 | Ga0065712_102005892 | 228 |
| 82 | 3300005293 | Ga0065715_10114217 | Ga0065715_101142172 | 228 |
| 83 | 3300005293 | Ga0065715_10222887 | Ga0065715_102228872 | 228 |
| 84 | 3300005329 | Ga0070683_100056388 | Ga0070683_1000563881 | 228 |
| 85 | 3300005434 | Ga0070709_10154525 | Ga0070709_101545252 | 228 |
| 86 | 3300005437 | Ga0070710_10406993 | Ga0070710_104069932 | 228 |
| 87 | 3300005543 | Ga0070672_100051514 | Ga0070672_1000515143 | 228 |
| 88 | 3300005563 | Ga0068855_100625399 | Ga0068855_1006253991 | 228 |
| 89 | 3300005616 | Ga0068852_100848307 | Ga0068852_1008483071 | 228 |
| 90 | 3300006038 | Ga0075365_10140043 | Ga0075365_101400432 | 228 |
| 91 | 3300006048 | Ga0075363_100105179 | Ga0075363_1001051793 | 228 |
| 92 | 3300006051 | Ga0075364_10001527 | Ga0075364_100015278 | 228 |
| 93 | 3300006051 | Ga0075364_10027904 | Ga0075364_100279045 | 228 |
| 94 | 3300006051 | Ga0075364_10057320 | Ga0075364_100573202 | 228 |
| 95 | 3300006173 | Ga0070716_100098595 | Ga0070716_1000985952 | 228 |
| 96 | 3300006177 | Ga0075362_10036132 | Ga0075362_100361324 | 228 |
| 97 | 3300006178 | Ga0075367_10026547 | Ga0075367_100265474 | 228 |
| 98 | 3300006186 | Ga0075369_10017347 | Ga0075369_100173472 | 228 |
| 99 | 3300006186 | Ga0075369_10127423 | Ga0075369_101274231 | 228 |
| 100 | 3300006195 | Ga0075366_10077657 | Ga0075366_100776573 | 228 |
| 101 | 3300006195 | Ga0075366_10113346 | Ga0075366_101133462 | 228 |
| 102 | 3300006353 | Ga0075370_10009908 | Ga0075370_100099085 | 228 |
| 103 | 3300006852 | Ga0075433_10128598 | Ga0075433_101285982 | 228 |
| 104 | 3300006871 | Ga0075434_100447375 | Ga0075434_1004473752 | 228 |
| 105 | 3300009093 | Ga0105240_10119156 | Ga0105240_101191561 | 228 |
| 106 | 3300009147 | Ga0114129_10003080 | Ga0114129_100030805 | 228 |
| 107 | 3300009177 | Ga0105248_10856437 | Ga0105248_108564372 | 228 |
| 108 | 3300013296 | Ga0157374_10208906 | Ga0157374_102089062 | 228 |
| 109 | 3300013307 | Ga0157372_11385527 | Ga0157372_113855271 | 228 |
| 110 | 3300014969 | Ga0157376_10179769 | Ga0157376_101797692 | 228 |
| 111 | 3300025906 | Ga0207699_10124627 | Ga0207699_101246272 | 228 |
| 112 | 3300025922 | Ga0207646_10523838 | Ga0207646_105238382 | 228 |
| 113 | 3300025939 | Ga0207665_10095209 | Ga0207665_100952092 | 228 |
| 114 | 3300025940 | Ga0207691_10053824 | Ga0207691_100538243 | 228 |
| 115 | 3300025941 | Ga0207711_10636473 | Ga0207711_106364732 | 228 |
| 116 | 3300025944 | Ga0207661_10026010 | Ga0207661_100260102 | 228 |
| 117 | 3300025945 | Ga0207679_10076051 | Ga0207679_100760512 | 228 |
| 118 | 3300026142 | Ga0207698_10927288 | Ga0207698_109272882 | 228 |
| 119 | 3300035111 | Ga0373923_0069114 | Ga0373923_0069114_58_744 | 228 |
| 120 | 3300042436 | Ga0439435_0010222 | Ga0439435_0010222_947_1648 | 228 |
| 121 | 3300042461 | Ga0439460_0011420 | Ga0439460_0011420_1457_2158 | 228 |
| 122 | 3300046455 | Ga0495603_0102714 | Ga0495603_0102714_340_1026 | 228 |
| 123 | 3300046559 | Ga0495667_0229425 | Ga0495667_0229425_274_960 | 228 |
| 124 | 3300046642 | Ga0495634_0216819 | Ga0495634_0216819_379_1068 | 228 |
| 125 | 3300048907 | Ga0496104_0544745 | Ga0496104_0544745_260_946 | 228 |
| 126 | 3300049571 | Ga0501034_0028871 | Ga0501034_0028871_3234_3920 | 228 |
| 127 | 3300049575 | Ga0501039_0627805 | Ga0501039_0627805_91_786 | 228 |
| 128 | 3300049577 | Ga0501041_0442327 | Ga0501041_0442327_90_785 | 228 |
| 129 | 3300049587 | Ga0501071_0461530 | Ga0501071_0461530_21_716 | 228 |
| 130 | 3300049588 | Ga0501072_0012676 | Ga0501072_0012676_2247_2942 | 228 |
| 131 | 3300049741 | Ga0501079_0043341 | Ga0501079_0043341_934_1629 | 228 |
| 132 | 3300049742 | Ga0501080_0102502 | Ga0501080_0102502_1874_2560 | 228 |
| 133 | 3300049743 | Ga0501081_0063095 | Ga0501081_0063095_1793_2488 | 228 |
| 134 | 3300050489 | nmdc:mga03683_30439_c1 | nmdc:mga03683_30439_c1_1416_2102 | 228 |
| 135 | 3300050491 | nmdc:mga00v17_23849_c1 | nmdc:mga00v17_23849_c1_2404_3090 | 228 |
| 136 | 3300050491 | nmdc:mga00v17_321748_c1 | nmdc:mga00v17_321748_c1_12_698 | 228 |
| 137 | 3300050491 | nmdc:mga00v17_445680_c1 | nmdc:mga00v17_445680_c1_126_812 | 228 |
| 138 | 3300050491 | nmdc:mga00v17_66060_c1 | nmdc:mga00v17_66060_c1_200_886 | 228 |
| 139 | 3300050492 | nmdc:mga0yw44_132762_c1 | nmdc:mga0yw44_132762_c1_114_800 | 228 |
| 140 | 3300050493 | nmdc:mga0k408_13316_c1 | nmdc:mga0k408_13316_c1_3420_4106 | 228 |
| 141 | 3300050494 | nmdc:mga06z11_51310_c1 | nmdc:mga06z11_51310_c1_1394_2080 | 228 |
| 142 | 3300050496 | nmdc:mga07m45_31196_c1 | nmdc:mga07m45_31196_c1_95_781 | 228 |
| 143 | 3300050507 | nmdc:mga05p37_17645_c1 | nmdc:mga05p37_17645_c1_260_949 | 228 |
| 144 | 3300050512 | nmdc:mga0n895_567231_c1 | nmdc:mga0n895_567231_c1_76_762 | 228 |
| 145 | 3300050515 | nmdc:mga0a205_147733_c1 | nmdc:mga0a205_147733_c1_1273_1959 | 228 |
| 146 | 3300053085 | Ga0495619_0302189 | Ga0495619_0302189_84_770 | 228 |
| 147 | 3300059421 | Ga0590071_000026 | Ga0590071_000026_31280_31972 | 228 |
| 148 | 3300059424 | Ga0590075_000183 | Ga0590075_000183_5705_6397 | 228 |
| 149 | 3300059426 | Ga0590077_000467 | Ga0590077_000467_1441_2133 | 228 |
| 150 | 3300061734 | Ga0530510_0432236 | Ga0530510_0432236_108_803 | 228 |
| 151 | 3300004799 | Ga0058863_11372655 | Ga0058863_113726551 | 229 |
| 152 | 3300005290 | Ga0065712_10141289 | Ga0065712_101412892 | 229 |
| 153 | 3300005293 | Ga0065715_10399287 | Ga0065715_103992872 | 229 |
| 154 | 3300005293 | Ga0065715_10439296 | Ga0065715_104392961 | 229 |
| 155 | 3300005331 | Ga0070670_100029005 | Ga0070670_1000290053 | 229 |
| 156 | 3300005331 | Ga0070670_100104607 | Ga0070670_1001046072 | 229 |
| 157 | 3300005334 | Ga0068869_100512305 | Ga0068869_1005123052 | 229 |
| 158 | 3300005335 | Ga0070666_10047548 | Ga0070666_100475482 | 229 |
| 159 | 3300005340 | Ga0070689_100020431 | Ga0070689_1000204311 | 229 |
| 160 | 3300005356 | Ga0070674_100314870 | Ga0070674_1003148701 | 229 |
| 161 | 3300005434 | Ga0070709_10185749 | Ga0070709_101857492 | 229 |
| 162 | 3300005436 | Ga0070713_100005536 | Ga0070713_1000055364 | 229 |
| 163 | 3300005467 | Ga0070706_100275725 | Ga0070706_1002757252 | 229 |
| 164 | 3300005530 | Ga0070679_100276835 | Ga0070679_1002768352 | 229 |
| 165 | 3300005530 | Ga0070679_100411424 | Ga0070679_1004114242 | 229 |
| 166 | 3300005543 | Ga0070672_100050952 | Ga0070672_1000509523 | 229 |
| 167 | 3300005549 | Ga0070704_100237233 | Ga0070704_1002372331 | 229 |
| 168 | 3300005563 | Ga0068855_100080579 | Ga0068855_1000805792 | 229 |
| 169 | 3300005564 | Ga0070664_100129074 | Ga0070664_1001290742 | 229 |
| 170 | 3300005578 | Ga0068854_100142525 | Ga0068854_1001425252 | 229 |
| 171 | 3300005614 | Ga0068856_100481988 | Ga0068856_1004819882 | 229 |
| 172 | 3300005618 | Ga0068864_100259513 | Ga0068864_1002595132 | 229 |
| 173 | 3300005841 | Ga0068863_100119807 | Ga0068863_1001198072 | 229 |
| 174 | 3300005843 | Ga0068860_100159922 | Ga0068860_1001599222 | 229 |
| 175 | 3300005844 | Ga0068862_100122790 | Ga0068862_1001227902 | 229 |
| 176 | 3300006028 | Ga0070717_10049452 | Ga0070717_100494523 | 229 |
| 177 | 3300006038 | Ga0075365_10046799 | Ga0075365_100467992 | 229 |
| 178 | 3300006871 | Ga0075434_100115686 | Ga0075434_1001156862 | 229 |
| 179 | 3300007076 | Ga0075435_100003529 | Ga0075435_1000035296 | 229 |
| 180 | 3300009094 | Ga0111539_10108298 | Ga0111539_101082982 | 229 |
| 181 | 3300009094 | Ga0111539_10321933 | Ga0111539_103219332 | 229 |
| 182 | 3300009098 | Ga0105245_10167129 | Ga0105245_101671292 | 229 |
| 183 | 3300009147 | Ga0114129_10005936 | Ga0114129_100059368 | 229 |
| 184 | 3300009174 | Ga0105241_10092922 | Ga0105241_100929223 | 229 |
| 185 | 3300009176 | Ga0105242_10096956 | Ga0105242_100969563 | 229 |
| 186 | 3300009551 | Ga0105238_10386033 | Ga0105238_103860331 | 229 |
| 187 | 3300009553 | Ga0105249_10167198 | Ga0105249_101671983 | 229 |
| 188 | 3300013104 | Ga0157370_10450483 | Ga0157370_104504831 | 229 |
| 189 | 3300013306 | Ga0163162_10289786 | Ga0163162_102897862 | 229 |
| 190 | 3300013307 | Ga0157372_10331013 | Ga0157372_103310132 | 229 |
| 191 | 3300014326 | Ga0157380_10417305 | Ga0157380_104173052 | 229 |
| 192 | 3300025315 | Ga0207697_10054229 | Ga0207697_100542293 | 229 |
| 193 | 3300025907 | Ga0207645_10012713 | Ga0207645_100127133 | 229 |
| 194 | 3300025911 | Ga0207654_10182794 | Ga0207654_101827942 | 229 |
| 195 | 3300025912 | Ga0207707_10375601 | Ga0207707_103756012 | 229 |
| 196 | 3300025913 | Ga0207695_10323025 | Ga0207695_103230251 | 229 |
| 197 | 3300025917 | Ga0207660_10323607 | Ga0207660_103236071 | 229 |
| 198 | 3300025918 | Ga0207662_10030434 | Ga0207662_100304343 | 229 |
| 199 | 3300025921 | Ga0207652_10395690 | Ga0207652_103956902 | 229 |
| 200 | 3300025921 | Ga0207652_10858722 | Ga0207652_108587221 | 229 |
| 201 | 3300025923 | Ga0207681_10022922 | Ga0207681_100229223 | 229 |
| 202 | 3300025925 | Ga0207650_10262410 | Ga0207650_102624101 | 229 |
| 203 | 3300025926 | Ga0207659_10415188 | Ga0207659_104151882 | 229 |
| 204 | 3300025933 | Ga0207706_10414114 | Ga0207706_104141141 | 229 |
| 205 | 3300025937 | Ga0207669_10440284 | Ga0207669_104402842 | 229 |
| 206 | 3300025940 | Ga0207691_10058645 | Ga0207691_100586453 | 229 |
| 207 | 3300025941 | Ga0207711_10059923 | Ga0207711_100599232 | 229 |
| 208 | 3300025942 | Ga0207689_10053462 | Ga0207689_100534623 | 229 |
| 209 | 3300025942 | Ga0207689_10507555 | Ga0207689_105075552 | 229 |
| 210 | 3300025945 | Ga0207679_10414307 | Ga0207679_104143072 | 229 |
| 211 | 3300025949 | Ga0207667_10263672 | Ga0207667_102636722 | 229 |
| 212 | 3300025960 | Ga0207651_10004078 | Ga0207651_100040787 | 229 |
| 213 | 3300025961 | Ga0207712_10208920 | Ga0207712_102089201 | 229 |
| 214 | 3300025981 | Ga0207640_10397743 | Ga0207640_103977432 | 229 |
| 215 | 3300026075 | Ga0207708_10011422 | Ga0207708_100114222 | 229 |
| 216 | 3300026075 | Ga0207708_10266817 | Ga0207708_102668171 | 229 |
| 217 | 3300026078 | Ga0207702_10240774 | Ga0207702_102407742 | 229 |
| 218 | 3300026095 | Ga0207676_10107700 | Ga0207676_101077002 | 229 |
| 219 | 3300031901 | Ga0307406_10609972 | Ga0307406_106099721 | 229 |
| 220 | 3300031995 | Ga0307409_101080386 | Ga0307409_1010803861 | 229 |
| 221 | 3300034957 | Ga0373938_0061598 | Ga0373938_0061598_13_702 | 229 |
| 222 | 3300035114 | Ga0373939_0103554 | Ga0373939_0103554_188_877 | 229 |
| 223 | 3300035121 | Ga0373960_0075443 | Ga0373960_0075443_305_994 | 229 |
| 224 | 3300035171 | Ga0373946_0061675 | Ga0373946_0061675_672_1361 | 229 |
| 225 | 3300035241 | Ga0373961_0009027 | Ga0373961_0009027_1510_2199 | 229 |
| 226 | 3300035410 | Ga0373924_0171337 | Ga0373924_0171337_123_812 | 229 |
| 227 | 3300035691 | Ga0373931_0071850 | Ga0373931_0071850_1140_1829 | 229 |
| 228 | 3300035692 | Ga0373935_0186047 | Ga0373935_0186047_626_1315 | 229 |
| 229 | 3300035724 | Ga0373933_0055618 | Ga0373933_0055618_153_842 | 229 |
| 230 | 3300035725 | Ga0373947_0069335 | Ga0373947_0069335_176_865 | 229 |
| 231 | 3300036401 | Ga0373937_0001133 | Ga0373937_0001133_13090_13779 | 229 |
| 232 | 3300037068 | Ga0373925_0003703 | Ga0373925_0003703_8790_9479 | 229 |
| 233 | 3300037471 | Ga0395905_0793217 | Ga0395905_0793217_27_716 | 229 |
| 234 | 3300041404 | Ga0439436_0082972 | Ga0439436_0082972_36_725 | 229 |
| 235 | 3300041406 | Ga0439439_0013816 | Ga0439439_0013816_1020_1709 | 229 |
| 236 | 3300041999 | Ga0439433_0011412 | Ga0439433_0011412_536_1225 | 229 |
| 237 | 3300042156 | Ga0439446_0019965 | Ga0439446_0019965_1155_1844 | 229 |
| 238 | 3300048903 | Ga0496100_0255931 | Ga0496100_0255931_23_712 | 229 |
| 239 | 3300048910 | Ga0496107_0386571 | Ga0496107_0386571_31_720 | 229 |
| 240 | 3300048913 | Ga0496110_0171715 | Ga0496110_0171715_154_843 | 229 |
| 241 | 3300048915 | Ga0496112_0130428 | Ga0496112_0130428_1026_1715 | 229 |
| 242 | 3300049582 | Ga0501048_0573170 | Ga0501048_0573170_55_744 | 229 |
| 243 | 3300049583 | Ga0501067_0127915 | Ga0501067_0127915_46_735 | 229 |
| 244 | 3300049585 | Ga0501069_0061543 | Ga0501069_0061543_936_1625 | 229 |
| 245 | 3300050492 | nmdc:mga0yw44_72645_c1 | nmdc:mga0yw44_72645_c1_1124_1813 | 229 |
| 246 | 3300050507 | nmdc:mga05p37_32706_c1 | nmdc:mga05p37_32706_c1_3708_4397 | 229 |
| 247 | 3300050511 | nmdc:mga08y16_286616_c1 | nmdc:mga08y16_286616_c1_46_735 | 229 |
| 248 | 3300050512 | nmdc:mga0n895_361484_c1 | nmdc:mga0n895_361484_c1_664_1353 | 229 |
| 249 | 3300050513 | nmdc:mga0rr50_103323_c1 | nmdc:mga0rr50_103323_c1_195_884 | 229 |
| 250 | 3300050513 | nmdc:mga0rr50_159586_c1 | nmdc:mga0rr50_159586_c1_54_743 | 229 |
| 251 | 3300050513 | nmdc:mga0rr50_709628_c1 | nmdc:mga0rr50_709628_c1_13_702 | 229 |
| 252 | 3300059511 | Ga0587091_027257 | Ga0587091_027257_124_813 | 229 |
| 253 | 3300059626 | Ga0587115_023167 | Ga0587115_023167_114_803 | 229 |
| 254 | 3300059642 | Ga0587069_025428 | Ga0587069_025428_11_700 | 229 |
| 255 | 3300060344 | Ga0587071_027528 | Ga0587071_027528_276_965 | 229 |
| 256 | 3300060353 | Ga0501082_0301322 | Ga0501082_0301322_129_818 | 229 |
| 257 | 3300061734 | Ga0530510_0099621 | Ga0530510_0099621_377_1066 | 229 |
| 258 | 3300003577 | Ga0007416J51690_1062403 | Ga0007416J51690_10624031 | 230 |
| 259 | 3300003693 | Ga0032354_1051467 | Ga0032354_10514671 | 230 |
| 260 | 3300005290 | Ga0065712_10000477 | Ga0065712_100004773 | 230 |
| 261 | 3300005293 | Ga0065715_10019037 | Ga0065715_100190373 | 230 |
| 262 | 3300005293 | Ga0065715_10090283 | Ga0065715_100902832 | 230 |
| 263 | 3300005293 | Ga0065715_10204893 | Ga0065715_102048932 | 230 |
| 264 | 3300005329 | Ga0070683_100001987 | Ga0070683_1000019876 | 230 |
| 265 | 3300005331 | Ga0070670_100045833 | Ga0070670_1000458331 | 230 |
| 266 | 3300005333 | Ga0070677_10166242 | Ga0070677_101662421 | 230 |
| 267 | 3300005344 | Ga0070661_100002279 | Ga0070661_1000022796 | 230 |
| 268 | 3300005355 | Ga0070671_100049389 | Ga0070671_1000493892 | 230 |
| 269 | 3300005366 | Ga0070659_100246438 | Ga0070659_1002464381 | 230 |
| 270 | 3300005439 | Ga0070711_100310796 | Ga0070711_1003107961 | 230 |
| 271 | 3300005440 | Ga0070705_100279163 | Ga0070705_1002791631 | 230 |
| 272 | 3300005455 | Ga0070663_100366603 | Ga0070663_1003666031 | 230 |
| 273 | 3300005466 | Ga0070685_10144521 | Ga0070685_101445212 | 230 |
| 274 | 3300005471 | Ga0070698_100535601 | Ga0070698_1005356011 | 230 |
| 275 | 3300005518 | Ga0070699_100045871 | Ga0070699_1000458712 | 230 |
| 276 | 3300005535 | Ga0070684_100001908 | Ga0070684_1000019089 | 230 |
| 277 | 3300005543 | Ga0070672_100137211 | Ga0070672_1001372112 | 230 |
| 278 | 3300005544 | Ga0070686_100269276 | Ga0070686_1002692762 | 230 |
| 279 | 3300005547 | Ga0070693_100052330 | Ga0070693_1000523302 | 230 |
| 280 | 3300005564 | Ga0070664_100001311 | Ga0070664_1000013111 | 230 |
| 281 | 3300005844 | Ga0068862_100413101 | Ga0068862_1004131012 | 230 |
| 282 | 3300006844 | Ga0075428_100010827 | Ga0075428_1000108272 | 230 |
| 283 | 3300006847 | Ga0075431_100385364 | Ga0075431_1003853642 | 230 |
| 284 | 3300006852 | Ga0075433_10121539 | Ga0075433_101215392 | 230 |
| 285 | 3300006871 | Ga0075434_100708638 | Ga0075434_1007086382 | 230 |
| 286 | 3300006880 | Ga0075429_100106911 | Ga0075429_1001069112 | 230 |
| 287 | 3300007076 | Ga0075435_100144823 | Ga0075435_1001448232 | 230 |
| 288 | 3300007076 | Ga0075435_100307123 | Ga0075435_1003071231 | 230 |
| 289 | 3300009094 | Ga0111539_10524650 | Ga0111539_105246502 | 230 |
| 290 | 3300009148 | Ga0105243_10488889 | Ga0105243_104888892 | 230 |
| 291 | 3300009177 | Ga0105248_10196066 | Ga0105248_101960662 | 230 |
| 292 | 3300011119 | Ga0105246_10063426 | Ga0105246_100634263 | 230 |
| 293 | 3300014968 | Ga0157379_10202064 | Ga0157379_102020641 | 230 |
| 294 | 3300025916 | Ga0207663_10275514 | Ga0207663_102755141 | 230 |
| 295 | 3300025926 | Ga0207659_10296959 | Ga0207659_102969591 | 230 |
| 296 | 3300025932 | Ga0207690_10021122 | Ga0207690_100211222 | 230 |
| 297 | 3300025932 | Ga0207690_10279631 | Ga0207690_102796311 | 230 |
| 298 | 3300025940 | Ga0207691_10257260 | Ga0207691_102572602 | 230 |
| 299 | 3300025941 | Ga0207711_10347361 | Ga0207711_103473612 | 230 |
| 300 | 3300025944 | Ga0207661_10045422 | Ga0207661_100454223 | 230 |
| 301 | 3300025945 | Ga0207679_10002292 | Ga0207679_100022925 | 230 |
| 302 | 3300026067 | Ga0207678_10156509 | Ga0207678_101565092 | 230 |
| 303 | 3300026075 | Ga0207708_10282220 | Ga0207708_102822202 | 230 |
| 304 | 3300026095 | Ga0207676_10046378 | Ga0207676_100463781 | 230 |
| 305 | 3300027907 | Ga0207428_10021461 | Ga0207428_100214616 | 230 |
| 306 | 3300031995 | Ga0307409_100217530 | Ga0307409_1002175302 | 230 |
| 307 | 3300037068 | Ga0373925_0739910 | Ga0373925_0739910_100_798 | 230 |
| 308 | 3300042435 | Ga0439434_0088557 | Ga0439434_0088557_183_881 | 230 |
| 309 | 3300046681 | Ga0495647_0240858 | Ga0495647_0240858_23_718 | 230 |
| 310 | 3300048907 | Ga0496104_0017991 | Ga0496104_0017991_1596_2294 | 230 |
| 311 | 3300048908 | Ga0496105_0073215 | Ga0496105_0073215_771_1469 | 230 |
| 312 | 3300048911 | Ga0496108_0072827 | Ga0496108_0072827_1376_2074 | 230 |
| 313 | 3300048912 | Ga0496109_0008449 | Ga0496109_0008449_5855_6553 | 230 |
| 314 | 3300048913 | Ga0496110_0001028 | Ga0496110_0001028_18630_19328 | 230 |
| 315 | 3300048914 | Ga0496111_0002876 | Ga0496111_0002876_9396_10094 | 230 |
| 316 | 3300048915 | Ga0496112_0012055 | Ga0496112_0012055_79_777 | 230 |
| 317 | 3300050508 | nmdc:mga09592_150062_c1 | nmdc:mga09592_150062_c1_746_1444 | 230 |
| 318 | 3300050510 | nmdc:mga06r32_652058_c1 | nmdc:mga06r32_652058_c1_176_874 | 230 |
| 319 | 3300050511 | nmdc:mga08y16_76858_c1 | nmdc:mga08y16_76858_c1_2661_3359 | 230 |
| 320 | 3300050512 | nmdc:mga0n895_219225_c1 | nmdc:mga0n895_219225_c1_447_1145 | 230 |
| 321 | 3300050512 | nmdc:mga0n895_427657_c1 | nmdc:mga0n895_427657_c1_453_1151 | 230 |
| 322 | 3300050513 | nmdc:mga0rr50_250679_c1 | nmdc:mga0rr50_250679_c1_493_1191 | 230 |
| 323 | 3300050513 | nmdc:mga0rr50_45565_c1 | nmdc:mga0rr50_45565_c1_406_1104 | 230 |
| 324 | 3300050513 | nmdc:mga0rr50_602822_c1 | nmdc:mga0rr50_602822_c1_117_815 | 230 |
| 325 | 3300050515 | nmdc:mga0a205_138828_c1 | nmdc:mga0a205_138828_c1_1387_2085 | 230 |
| 326 | 3300050515 | nmdc:mga0a205_257708_c1 | nmdc:mga0a205_257708_c1_818_1516 | 230 |
| 327 | 3300059477 | Ga0587084_035243 | Ga0587084_035243_81_779 | 230 |
| 328 | 3300004800 | Ga0058861_11984245 | Ga0058861_119842451 | 231 |
| 329 | 3300005293 | Ga0065715_10092283 | Ga0065715_100922832 | 231 |
| 330 | 3300005331 | Ga0070670_100020564 | Ga0070670_1000205644 | 231 |
| 331 | 3300005344 | Ga0070661_100286701 | Ga0070661_1002867011 | 231 |
| 332 | 3300005354 | Ga0070675_100044442 | Ga0070675_1000444423 | 231 |
| 333 | 3300005355 | Ga0070671_100036708 | Ga0070671_1000367082 | 231 |
| 334 | 3300005355 | Ga0070671_100281269 | Ga0070671_1002812691 | 231 |
| 335 | 3300005356 | Ga0070674_100165719 | Ga0070674_1001657192 | 231 |
| 336 | 3300005437 | Ga0070710_10363301 | Ga0070710_103633011 | 231 |
| 337 | 3300005439 | Ga0070711_100092535 | Ga0070711_1000925352 | 231 |
| 338 | 3300005440 | Ga0070705_100258142 | Ga0070705_1002581421 | 231 |
| 339 | 3300005455 | Ga0070663_100133932 | Ga0070663_1001339322 | 231 |
| 340 | 3300005456 | Ga0070678_100046570 | Ga0070678_1000465702 | 231 |
| 341 | 3300005458 | Ga0070681_10024457 | Ga0070681_100244573 | 231 |
| 342 | 3300005468 | Ga0070707_100102722 | Ga0070707_1001027221 | 231 |
| 343 | 3300005471 | Ga0070698_100069706 | Ga0070698_1000697062 | 231 |
| 344 | 3300005471 | Ga0070698_100849368 | Ga0070698_1008493681 | 231 |
| 345 | 3300005530 | Ga0070679_100020355 | Ga0070679_1000203552 | 231 |
| 346 | 3300005535 | Ga0070684_100148274 | Ga0070684_1001482742 | 231 |
| 347 | 3300005536 | Ga0070697_100212294 | Ga0070697_1002122942 | 231 |
| 348 | 3300005543 | Ga0070672_100092368 | Ga0070672_1000923682 | 231 |
| 349 | 3300005544 | Ga0070686_100056865 | Ga0070686_1000568652 | 231 |
| 350 | 3300005548 | Ga0070665_100649983 | Ga0070665_1006499832 | 231 |
| 351 | 3300005548 | Ga0070665_100832596 | Ga0070665_1008325961 | 231 |
| 352 | 3300005564 | Ga0070664_100066848 | Ga0070664_1000668482 | 231 |
| 353 | 3300005577 | Ga0068857_100244031 | Ga0068857_1002440312 | 231 |
| 354 | 3300005615 | Ga0070702_100076737 | Ga0070702_1000767372 | 231 |
| 355 | 3300005616 | Ga0068852_100330431 | Ga0068852_1003304312 | 231 |
| 356 | 3300005617 | Ga0068859_100563900 | Ga0068859_1005639002 | 231 |
| 357 | 3300005618 | Ga0068864_100042976 | Ga0068864_1000429763 | 231 |
| 358 | 3300005719 | Ga0068861_100278751 | Ga0068861_1002787511 | 231 |
| 359 | 3300005840 | Ga0068870_10064703 | Ga0068870_100647032 | 231 |
| 360 | 3300005841 | Ga0068863_100088210 | Ga0068863_1000882102 | 231 |
| 361 | 3300005843 | Ga0068860_100658006 | Ga0068860_1006580061 | 231 |
| 362 | 3300006051 | Ga0075364_10098488 | Ga0075364_100984882 | 231 |
| 363 | 3300006173 | Ga0070716_100107250 | Ga0070716_1001072502 | 231 |
| 364 | 3300006195 | Ga0075366_10360145 | Ga0075366_103601452 | 231 |
| 365 | 3300006237 | Ga0097621_100682212 | Ga0097621_1006822122 | 231 |
| 366 | 3300006353 | Ga0075370_10375382 | Ga0075370_103753821 | 231 |
| 367 | 3300006847 | Ga0075431_100144689 | Ga0075431_1001446892 | 231 |
| 368 | 3300006871 | Ga0075434_100189802 | Ga0075434_1001898021 | 231 |
| 369 | 3300006880 | Ga0075429_100386693 | Ga0075429_1003866931 | 231 |
| 370 | 3300006931 | Ga0097620_100563901 | Ga0097620_1005639011 | 231 |
| 371 | 3300009148 | Ga0105243_10616293 | Ga0105243_106162931 | 231 |
| 372 | 3300009174 | Ga0105241_10413795 | Ga0105241_104137951 | 231 |
| 373 | 3300009176 | Ga0105242_10191186 | Ga0105242_101911862 | 231 |
| 374 | 3300009176 | Ga0105242_10199882 | Ga0105242_101998821 | 231 |
| 375 | 3300009177 | Ga0105248_10281996 | Ga0105248_102819962 | 231 |
| 376 | 3300009551 | Ga0105238_10353014 | Ga0105238_103530142 | 231 |
| 377 | 3300009553 | Ga0105249_10514252 | Ga0105249_105142522 | 231 |
| 378 | 3300013307 | Ga0157372_10253205 | Ga0157372_102532052 | 231 |
| 379 | 3300014325 | Ga0163163_10117285 | Ga0163163_101172853 | 231 |
| 380 | 3300014326 | Ga0157380_11082613 | Ga0157380_110826131 | 231 |
| 381 | 3300025901 | Ga0207688_10053367 | Ga0207688_100533672 | 231 |
| 382 | 3300025905 | Ga0207685_10116977 | Ga0207685_101169771 | 231 |
| 383 | 3300025908 | Ga0207643_10147725 | Ga0207643_101477252 | 231 |
| 384 | 3300025921 | Ga0207652_10087310 | Ga0207652_100873102 | 231 |
| 385 | 3300025923 | Ga0207681_10630557 | Ga0207681_106305571 | 231 |
| 386 | 3300025926 | Ga0207659_10341509 | Ga0207659_103415092 | 231 |
| 387 | 3300025926 | Ga0207659_10739620 | Ga0207659_107396201 | 231 |
| 388 | 3300025931 | Ga0207644_10031400 | Ga0207644_100314002 | 231 |
| 389 | 3300025937 | Ga0207669_10120945 | Ga0207669_101209452 | 231 |
| 390 | 3300025940 | Ga0207691_10012110 | Ga0207691_100121108 | 231 |
| 391 | 3300025941 | Ga0207711_10050180 | Ga0207711_100501802 | 231 |
| 392 | 3300025945 | Ga0207679_10321934 | Ga0207679_103219342 | 231 |
| 393 | 3300025960 | Ga0207651_10387428 | Ga0207651_103874281 | 231 |
| 394 | 3300025961 | Ga0207712_10720588 | Ga0207712_107205881 | 231 |
| 395 | 3300026067 | Ga0207678_10049029 | Ga0207678_100490292 | 231 |
| 396 | 3300026067 | Ga0207678_10250266 | Ga0207678_102502661 | 231 |
| 397 | 3300026075 | Ga0207708_10257132 | Ga0207708_102571322 | 231 |
| 398 | 3300026078 | Ga0207702_10369360 | Ga0207702_103693602 | 231 |
| 399 | 3300026089 | Ga0207648_10119632 | Ga0207648_101196322 | 231 |
| 400 | 3300026095 | Ga0207676_10095408 | Ga0207676_100954082 | 231 |
| 401 | 3300026121 | Ga0207683_10024772 | Ga0207683_100247722 | 231 |
| 402 | 3300028379 | Ga0268266_10249785 | Ga0268266_102497852 | 231 |
| 403 | 3300028380 | Ga0268265_10467261 | Ga0268265_104672612 | 231 |
| 404 | 3300028381 | Ga0268264_10325045 | Ga0268264_103250452 | 231 |
| 405 | 3300031901 | Ga0307406_10356004 | Ga0307406_103560042 | 231 |
| 406 | 3300032126 | Ga0307415_100750888 | Ga0307415_1007508881 | 231 |
| 407 | 3300035171 | Ga0373946_0037118 | Ga0373946_0037118_65_763 | 231 |
| 408 | 3300035172 | Ga0373955_0254619 | Ga0373955_0254619_56_754 | 231 |
| 409 | 3300035410 | Ga0373924_0087859 | Ga0373924_0087859_190_888 | 231 |
| 410 | 3300036401 | Ga0373937_0036918 | Ga0373937_0036918_3053_3751 | 231 |
| 411 | 3300042122 | Ga0450920_005476 | Ga0450920_005476_1454_2155 | 231 |
| 412 | 3300042135 | Ga0450899_018353 | Ga0450899_018353_59_760 | 231 |
| 413 | 3300044712 | Ga0453684_0400144 | Ga0453684_0400144_709_1407 | 231 |
| 414 | 3300048903 | Ga0496100_0036166 | Ga0496100_0036166_1416_2114 | 231 |
| 415 | 3300048904 | Ga0496101_0001396 | Ga0496101_0001396_851_1549 | 231 |
| 416 | 3300048905 | Ga0496102_0190663 | Ga0496102_0190663_504_1202 | 231 |
| 417 | 3300048907 | Ga0496104_0404124 | Ga0496104_0404124_328_1026 | 231 |
| 418 | 3300048908 | Ga0496105_0079560 | Ga0496105_0079560_393_1091 | 231 |
| 419 | 3300048911 | Ga0496108_0469910 | Ga0496108_0469910_268_972 | 231 |
| 420 | 3300048917 | Ga0496114_0016205 | Ga0496114_0016205_3314_4012 | 231 |
| 421 | 3300048918 | Ga0496115_0160647 | Ga0496115_0160647_786_1484 | 231 |
| 422 | 3300049571 | Ga0501034_0083559 | Ga0501034_0083559_1783_2481 | 231 |
| 423 | 3300049579 | Ga0501043_0097525 | Ga0501043_0097525_399_1097 | 231 |
| 424 | 3300049581 | Ga0501047_0048474 | Ga0501047_0048474_1112_1810 | 231 |
| 425 | 3300049823 | Ga0501044_0004662 | Ga0501044_0004662_7994_8692 | 231 |
| 426 | 3300050491 | nmdc:mga00v17_57772_c1 | nmdc:mga00v17_57772_c1_1090_1794 | 231 |
| 427 | 3300050492 | nmdc:mga0yw44_146583_c1 | nmdc:mga0yw44_146583_c1_474_1178 | 231 |
| 428 | 3300050494 | nmdc:mga06z11_17107_c1 | nmdc:mga06z11_17107_c1_1974_2678 | 231 |
| 429 | 3300050508 | nmdc:mga09592_378024_c1 | nmdc:mga09592_378024_c1_421_1119 | 231 |
| 430 | 3300053077 | Ga0495601_0264364 | Ga0495601_0264364_50_748 | 231 |
| 431 | 3300053085 | Ga0495619_0044076 | Ga0495619_0044076_2042_2740 | 231 |
| 432 | 3300054114 | Ga0501084_0257956 | Ga0501084_0257956_715_1413 | 231 |
| 433 | 3300004801 | Ga0058860_11794914 | Ga0058860_117949141 | 232 |
| 434 | 3300005290 | Ga0065712_10102239 | Ga0065712_101022392 | 232 |
| 435 | 3300005293 | Ga0065715_10094975 | Ga0065715_100949754 | 232 |
| 436 | 3300005293 | Ga0065715_10175914 | Ga0065715_101759142 | 232 |
| 437 | 3300005293 | Ga0065715_10311319 | Ga0065715_103113192 | 232 |
| 438 | 3300005295 | Ga0065707_10118059 | Ga0065707_101180592 | 232 |
| 439 | 3300005295 | Ga0065707_10148463 | Ga0065707_101484632 | 232 |
| 440 | 3300005295 | Ga0065707_10463193 | Ga0065707_104631931 | 232 |
| 441 | 3300005329 | Ga0070683_100086019 | Ga0070683_1000860192 | 232 |
| 442 | 3300005329 | Ga0070683_100375192 | Ga0070683_1003751922 | 232 |
| 443 | 3300005330 | Ga0070690_100177091 | Ga0070690_1001770912 | 232 |
| 444 | 3300005331 | Ga0070670_100147463 | Ga0070670_1001474631 | 232 |
| 445 | 3300005333 | Ga0070677_10029454 | Ga0070677_100294542 | 232 |
| 446 | 3300005333 | Ga0070677_10174544 | Ga0070677_101745442 | 232 |
| 447 | 3300005335 | Ga0070666_10146555 | Ga0070666_101465551 | 232 |
| 448 | 3300005335 | Ga0070666_10269532 | Ga0070666_102695321 | 232 |
| 449 | 3300005338 | Ga0068868_100080478 | Ga0068868_1000804782 | 232 |
| 450 | 3300005343 | Ga0070687_100067214 | Ga0070687_1000672142 | 232 |
| 451 | 3300005344 | Ga0070661_100157775 | Ga0070661_1001577752 | 232 |
| 452 | 3300005344 | Ga0070661_100297700 | Ga0070661_1002977002 | 232 |
| 453 | 3300005353 | Ga0070669_100005348 | Ga0070669_1000053487 | 232 |
| 454 | 3300005354 | Ga0070675_100128235 | Ga0070675_1001282352 | 232 |
| 455 | 3300005355 | Ga0070671_100008914 | Ga0070671_1000089142 | 232 |
| 456 | 3300005355 | Ga0070671_100874014 | Ga0070671_1008740141 | 232 |
| 457 | 3300005356 | Ga0070674_100307388 | Ga0070674_1003073881 | 232 |
| 458 | 3300005356 | Ga0070674_100503535 | Ga0070674_1005035352 | 232 |
| 459 | 3300005364 | Ga0070673_100016706 | Ga0070673_1000167065 | 232 |
| 460 | 3300005367 | Ga0070667_100255150 | Ga0070667_1002551502 | 232 |
| 461 | 3300005367 | Ga0070667_100370374 | Ga0070667_1003703742 | 232 |
| 462 | 3300005441 | Ga0070700_100524330 | Ga0070700_1005243302 | 232 |
| 463 | 3300005455 | Ga0070663_100293534 | Ga0070663_1002935342 | 232 |
| 464 | 3300005456 | Ga0070678_100208935 | Ga0070678_1002089352 | 232 |
| 465 | 3300005457 | Ga0070662_100224390 | Ga0070662_1002243901 | 232 |
| 466 | 3300005466 | Ga0070685_10038720 | Ga0070685_100387202 | 232 |
| 467 | 3300005518 | Ga0070699_100006964 | Ga0070699_1000069647 | 232 |
| 468 | 3300005543 | Ga0070672_100007337 | Ga0070672_1000073373 | 232 |
| 469 | 3300005544 | Ga0070686_100005561 | Ga0070686_1000055612 | 232 |
| 470 | 3300005548 | Ga0070665_100279617 | Ga0070665_1002796172 | 232 |
| 471 | 3300005549 | Ga0070704_100615141 | Ga0070704_1006151412 | 232 |
| 472 | 3300005563 | Ga0068855_100221347 | Ga0068855_1002213472 | 232 |
| 473 | 3300005578 | Ga0068854_100007928 | Ga0068854_1000079283 | 232 |
| 474 | 3300005614 | Ga0068856_100074414 | Ga0068856_1000744142 | 232 |
| 475 | 3300005616 | Ga0068852_100108436 | Ga0068852_1001084362 | 232 |
| 476 | 3300005719 | Ga0068861_100242043 | Ga0068861_1002420431 | 232 |
| 477 | 3300005841 | Ga0068863_100004415 | Ga0068863_10000441513 | 232 |
| 478 | 3300005843 | Ga0068860_100077343 | Ga0068860_1000773432 | 232 |
| 479 | 3300005843 | Ga0068860_100341714 | Ga0068860_1003417141 | 232 |
| 480 | 3300005844 | Ga0068862_100637461 | Ga0068862_1006374612 | 232 |
| 481 | 3300006028 | Ga0070717_10369932 | Ga0070717_103699322 | 232 |
| 482 | 3300006237 | Ga0097621_100024680 | Ga0097621_1000246805 | 232 |
| 483 | 3300006844 | Ga0075428_100004986 | Ga0075428_1000049865 | 232 |
| 484 | 3300006846 | Ga0075430_100363129 | Ga0075430_1003631292 | 232 |
| 485 | 3300006847 | Ga0075431_100095960 | Ga0075431_1000959602 | 232 |
| 486 | 3300006847 | Ga0075431_100849846 | Ga0075431_1008498462 | 232 |
| 487 | 3300006852 | Ga0075433_10065014 | Ga0075433_100650142 | 232 |
| 488 | 3300006852 | Ga0075433_10070272 | Ga0075433_100702722 | 232 |
| 489 | 3300006852 | Ga0075433_10148937 | Ga0075433_101489372 | 232 |
| 490 | 3300006871 | Ga0075434_100000298 | Ga0075434_10000029824 | 232 |
| 491 | 3300006871 | Ga0075434_100006405 | Ga0075434_1000064052 | 232 |
| 492 | 3300006871 | Ga0075434_100067873 | Ga0075434_1000678732 | 232 |
| 493 | 3300006871 | Ga0075434_100509532 | Ga0075434_1005095321 | 232 |
| 494 | 3300006881 | Ga0068865_100010738 | Ga0068865_1000107384 | 232 |
| 495 | 3300006914 | Ga0075436_100006302 | Ga0075436_1000063024 | 232 |
| 496 | 3300006914 | Ga0075436_100016213 | Ga0075436_1000162132 | 232 |
| 497 | 3300006914 | Ga0075436_100081620 | Ga0075436_1000816202 | 232 |
| 498 | 3300007076 | Ga0075435_100001342 | Ga0075435_1000013427 | 232 |
| 499 | 3300007076 | Ga0075435_100020505 | Ga0075435_1000205054 | 232 |
| 500 | 3300007076 | Ga0075435_100022425 | Ga0075435_1000224255 | 232 |
| 501 | 3300007076 | Ga0075435_100048138 | Ga0075435_1000481383 | 232 |
| 502 | 3300009093 | Ga0105240_10181718 | Ga0105240_101817182 | 232 |
| 503 | 3300009093 | Ga0105240_10249664 | Ga0105240_102496642 | 232 |
| 504 | 3300009093 | Ga0105240_11062314 | Ga0105240_110623141 | 232 |
| 505 | 3300009094 | Ga0111539_10150068 | Ga0111539_101500682 | 232 |
| 506 | 3300009094 | Ga0111539_10555551 | Ga0111539_105555512 | 232 |
| 507 | 3300009098 | Ga0105245_10205491 | Ga0105245_102054911 | 232 |
| 508 | 3300009098 | Ga0105245_11067305 | Ga0105245_110673051 | 232 |
| 509 | 3300009147 | Ga0114129_10005947 | Ga0114129_100059472 | 232 |
| 510 | 3300009147 | Ga0114129_10015136 | Ga0114129_1001513610 | 232 |
| 511 | 3300009147 | Ga0114129_10018206 | Ga0114129_100182066 | 232 |
| 512 | 3300009147 | Ga0114129_10020475 | Ga0114129_100204758 | 232 |
| 513 | 3300009147 | Ga0114129_10349182 | Ga0114129_103491822 | 232 |
| 514 | 3300009148 | Ga0105243_10059416 | Ga0105243_100594162 | 232 |
| 515 | 3300009176 | Ga0105242_10075189 | Ga0105242_100751892 | 232 |
| 516 | 3300009177 | Ga0105248_10008294 | Ga0105248_100082946 | 232 |
| 517 | 3300009177 | Ga0105248_10167534 | Ga0105248_101675342 | 232 |
| 518 | 3300009177 | Ga0105248_10173918 | Ga0105248_101739182 | 232 |
| 519 | 3300009177 | Ga0105248_10653983 | Ga0105248_106539832 | 232 |
| 520 | 3300009545 | Ga0105237_10837143 | Ga0105237_108371431 | 232 |
| 521 | 3300009553 | Ga0105249_10060895 | Ga0105249_100608953 | 232 |
| 522 | 3300009553 | Ga0105249_10235170 | Ga0105249_102351702 | 232 |
| 523 | 3300010375 | Ga0105239_11002943 | Ga0105239_110029431 | 232 |
| 524 | 3300013105 | Ga0157369_10290850 | Ga0157369_102908502 | 232 |
| 525 | 3300013296 | Ga0157374_10432775 | Ga0157374_104327752 | 232 |
| 526 | 3300013296 | Ga0157374_10488361 | Ga0157374_104883612 | 232 |
| 527 | 3300013306 | Ga0163162_10049950 | Ga0163162_100499502 | 232 |
| 528 | 3300013307 | Ga0157372_10341479 | Ga0157372_103414792 | 232 |
| 529 | 3300013308 | Ga0157375_10028868 | Ga0157375_100288682 | 232 |
| 530 | 3300013308 | Ga0157375_11029739 | Ga0157375_110297391 | 232 |
| 531 | 3300013308 | Ga0157375_11031597 | Ga0157375_110315971 | 232 |
| 532 | 3300014325 | Ga0163163_10133092 | Ga0163163_101330922 | 232 |
| 533 | 3300014326 | Ga0157380_10092269 | Ga0157380_100922692 | 232 |
| 534 | 3300014968 | Ga0157379_10020355 | Ga0157379_100203553 | 232 |
| 535 | 3300014968 | Ga0157379_10140554 | Ga0157379_101405542 | 232 |
| 536 | 3300014969 | Ga0157376_10047766 | Ga0157376_100477663 | 232 |
| 537 | 3300014969 | Ga0157376_10279250 | Ga0157376_102792502 | 232 |
| 538 | 3300017792 | Ga0163161_10079418 | Ga0163161_100794182 | 232 |
| 539 | 3300025893 | Ga0207682_10067805 | Ga0207682_100678052 | 232 |
| 540 | 3300025901 | Ga0207688_10195398 | Ga0207688_101953982 | 232 |
| 541 | 3300025901 | Ga0207688_10296179 | Ga0207688_102961791 | 232 |
| 542 | 3300025906 | Ga0207699_10179719 | Ga0207699_101797192 | 232 |
| 543 | 3300025907 | Ga0207645_10313286 | Ga0207645_103132862 | 232 |
| 544 | 3300025916 | Ga0207663_10034360 | Ga0207663_100343603 | 232 |
| 545 | 3300025920 | Ga0207649_10276376 | Ga0207649_102763762 | 232 |
| 546 | 3300025923 | Ga0207681_10028318 | Ga0207681_100283182 | 232 |
| 547 | 3300025933 | Ga0207706_10220706 | Ga0207706_102207061 | 232 |
| 548 | 3300025933 | Ga0207706_10316390 | Ga0207706_103163902 | 232 |
| 549 | 3300025933 | Ga0207706_10499052 | Ga0207706_104990522 | 232 |
| 550 | 3300025934 | Ga0207686_10150383 | Ga0207686_101503832 | 232 |
| 551 | 3300025934 | Ga0207686_10301651 | Ga0207686_103016511 | 232 |
| 552 | 3300025935 | Ga0207709_10131390 | Ga0207709_101313902 | 232 |
| 553 | 3300025938 | Ga0207704_10116046 | Ga0207704_101160462 | 232 |
| 554 | 3300025940 | Ga0207691_10079921 | Ga0207691_100799213 | 232 |
| 555 | 3300025941 | Ga0207711_10189605 | Ga0207711_101896051 | 232 |
| 556 | 3300025941 | Ga0207711_10303301 | Ga0207711_103033012 | 232 |
| 557 | 3300025944 | Ga0207661_10162472 | Ga0207661_101624721 | 232 |
| 558 | 3300025944 | Ga0207661_10165018 | Ga0207661_101650182 | 232 |
| 559 | 3300025949 | Ga0207667_10304950 | Ga0207667_103049502 | 232 |
| 560 | 3300025960 | Ga0207651_10321873 | Ga0207651_103218731 | 232 |
| 561 | 3300025961 | Ga0207712_10219097 | Ga0207712_102190972 | 232 |
| 562 | 3300025972 | Ga0207668_10493406 | Ga0207668_104934062 | 232 |
| 563 | 3300025981 | Ga0207640_10011327 | Ga0207640_100113275 | 232 |
| 564 | 3300025986 | Ga0207658_10478428 | Ga0207658_104784282 | 232 |
| 565 | 3300026078 | Ga0207702_10133137 | Ga0207702_101331372 | 232 |
| 566 | 3300026088 | Ga0207641_10000667 | Ga0207641_1000066716 | 232 |
| 567 | 3300026088 | Ga0207641_10733992 | Ga0207641_107339921 | 232 |
| 568 | 3300026089 | Ga0207648_10039115 | Ga0207648_100391154 | 232 |
| 569 | 3300026118 | Ga0207675_100119993 | Ga0207675_1001199932 | 232 |
| 570 | 3300026118 | Ga0207675_100487984 | Ga0207675_1004879841 | 232 |
| 571 | 3300026121 | Ga0207683_10377008 | Ga0207683_103770082 | 232 |
| 572 | 3300027682 | Ga0209971_1028914 | Ga0209971_10289142 | 232 |
| 573 | 3300027907 | Ga0207428_10073487 | Ga0207428_100734872 | 232 |
| 574 | 3300028379 | Ga0268266_10090768 | Ga0268266_100907683 | 232 |
| 575 | 3300028380 | Ga0268265_10350986 | Ga0268265_103509862 | 232 |
| 576 | 3300028381 | Ga0268264_10316667 | Ga0268264_103166672 | 232 |
| 577 | 3300031548 | Ga0307408_100121996 | Ga0307408_1001219962 | 232 |
| 578 | 3300032002 | Ga0307416_100045644 | Ga0307416_1000456442 | 232 |
| 579 | 3300032002 | Ga0307416_100164543 | Ga0307416_1001645432 | 232 |
| 580 | 3300032002 | Ga0307416_100174027 | Ga0307416_1001740272 | 232 |
| 581 | 3300032004 | Ga0307414_10661173 | Ga0307414_106611731 | 232 |
| 582 | 3300032126 | Ga0307415_100308104 | Ga0307415_1003081041 | 232 |
| 583 | 3300034817 | Ga0373948_0001350 | Ga0373948_0001350_527_1228 | 232 |
| 584 | 3300034819 | Ga0373958_0044725 | Ga0373958_0044725_99_800 | 232 |
| 585 | 3300034820 | Ga0373959_0028671 | Ga0373959_0028671_171_872 | 232 |
| 586 | 3300034957 | Ga0373938_0003342 | Ga0373938_0003342_1161_1862 | 232 |
| 587 | 3300035085 | Ga0373929_0000830 | Ga0373929_0000830_26_727 | 232 |
| 588 | 3300035088 | Ga0373940_0007532 | Ga0373940_0007532_923_1624 | 232 |
| 589 | 3300035090 | Ga0373949_0002959 | Ga0373949_0002959_841_1542 | 232 |
| 590 | 3300035091 | Ga0373951_0000480 | Ga0373951_0000480_10536_11237 | 232 |
| 591 | 3300035091 | Ga0373951_0025185 | Ga0373951_0025185_55_756 | 232 |
| 592 | 3300035092 | Ga0373952_0000212 | Ga0373952_0000212_3974_4675 | 232 |
| 593 | 3300035111 | Ga0373923_0117452 | Ga0373923_0117452_208_909 | 232 |
| 594 | 3300035112 | Ga0373932_0000133 | Ga0373932_0000133_7338_8039 | 232 |
| 595 | 3300035114 | Ga0373939_0000812 | Ga0373939_0000812_92_793 | 232 |
| 596 | 3300035114 | Ga0373939_0039327 | Ga0373939_0039327_470_1171 | 232 |
| 597 | 3300035115 | Ga0373941_0002759 | Ga0373941_0002759_762_1463 | 232 |
| 598 | 3300035117 | Ga0373953_0033591 | Ga0373953_0033591_1228_1929 | 232 |
| 599 | 3300035121 | Ga0373960_0018506 | Ga0373960_0018506_82_783 | 232 |
| 600 | 3300035170 | Ga0373943_0003044 | Ga0373943_0003044_4654_5355 | 232 |
| 601 | 3300035171 | Ga0373946_0004691 | Ga0373946_0004691_1305_2006 | 232 |
| 602 | 3300035207 | Ga0373942_0005700 | Ga0373942_0005700_28_729 | 232 |
| 603 | 3300035241 | Ga0373961_0000926 | Ga0373961_0000926_4629_5330 | 232 |
| 604 | 3300035241 | Ga0373961_0014747 | Ga0373961_0014747_372_1073 | 232 |
| 605 | 3300035242 | Ga0373962_0000594 | Ga0373962_0000594_6599_7300 | 232 |
| 606 | 3300035242 | Ga0373962_0047046 | Ga0373962_0047046_167_868 | 232 |
| 607 | 3300035410 | Ga0373924_0035310 | Ga0373924_0035310_964_1665 | 232 |
| 608 | 3300035691 | Ga0373931_0001600 | Ga0373931_0001600_880_1581 | 232 |
| 609 | 3300035691 | Ga0373931_0158454 | Ga0373931_0158454_559_1260 | 232 |
| 610 | 3300035692 | Ga0373935_0012031 | Ga0373935_0012031_1245_1946 | 232 |
| 611 | 3300036401 | Ga0373937_0275752 | Ga0373937_0275752_683_1384 | 232 |
| 612 | 3300037068 | Ga0373925_0015321 | Ga0373925_0015321_1332_2033 | 232 |
| 613 | 3300042876 | Ga0451577_0151231 | Ga0451577_0151231_419_1120 | 232 |
| 614 | 3300045051 | Ga0451576_0003826 | Ga0451576_0003826_1951_2652 | 232 |
| 615 | 3300046459 | Ga0495629_0285534 | Ga0495629_0285534_142_843 | 232 |
| 616 | 3300046472 | Ga0495580_0330700 | Ga0495580_0330700_86_787 | 232 |
| 617 | 3300046475 | Ga0495639_0100086 | Ga0495639_0100086_248_949 | 232 |
| 618 | 3300046511 | Ga0495608_0140252 | Ga0495608_0140252_596_1297 | 232 |
| 619 | 3300046517 | Ga0495630_0485819 | Ga0495630_0485819_133_834 | 232 |
| 620 | 3300046529 | Ga0495652_0170262 | Ga0495652_0170262_218_919 | 232 |
| 621 | 3300046535 | Ga0495586_0188589 | Ga0495586_0188589_72_773 | 232 |
| 622 | 3300046536 | Ga0495587_0038631 | Ga0495587_0038631_95_796 | 232 |
| 623 | 3300046559 | Ga0495667_0097822 | Ga0495667_0097822_632_1333 | 232 |
| 624 | 3300046678 | Ga0495599_0326441 | Ga0495599_0326441_82_783 | 232 |
| 625 | 3300046683 | Ga0495658_0060984 | Ga0495658_0060984_82_783 | 232 |
| 626 | 3300046683 | Ga0495658_0481972 | Ga0495658_0481972_36_737 | 232 |
| 627 | 3300046689 | Ga0495613_0006752 | Ga0495613_0006752_7155_7856 | 232 |
| 628 | 3300046809 | Ga0495600_0215870 | Ga0495600_0215870_413_1114 | 232 |
| 629 | 3300047319 | Ga0495674_0011154 | Ga0495674_0011154_913_1614 | 232 |
| 630 | 3300047471 | Ga0495684_0000226 | Ga0495684_0000226_22141_22842 | 232 |
| 631 | 3300047471 | Ga0495684_0517052 | Ga0495684_0517052_39_740 | 232 |
| 632 | 3300048903 | Ga0496100_0428151 | Ga0496100_0428151_203_901 | 232 |
| 633 | 3300048904 | Ga0496101_0047743 | Ga0496101_0047743_2258_2956 | 232 |
| 634 | 3300048904 | Ga0496101_0125721 | Ga0496101_0125721_1181_1882 | 232 |
| 635 | 3300048905 | Ga0496102_0064346 | Ga0496102_0064346_116_814 | 232 |
| 636 | 3300048905 | Ga0496102_0278369 | Ga0496102_0278369_98_799 | 232 |
| 637 | 3300048906 | Ga0496103_0161951 | Ga0496103_0161951_50_751 | 232 |
| 638 | 3300048907 | Ga0496104_0008772 | Ga0496104_0008772_5912_6613 | 232 |
| 639 | 3300048908 | Ga0496105_0523944 | Ga0496105_0523944_135_836 | 232 |
| 640 | 3300048909 | Ga0496106_0349207 | Ga0496106_0349207_263_961 | 232 |
| 641 | 3300048909 | Ga0496106_0580931 | Ga0496106_0580931_49_750 | 232 |
| 642 | 3300048909 | Ga0496106_0786111 | Ga0496106_0786111_15_716 | 232 |
| 643 | 3300048911 | Ga0496108_0295716 | Ga0496108_0295716_202_900 | 232 |
| 644 | 3300048911 | Ga0496108_0343433 | Ga0496108_0343433_549_1250 | 232 |
| 645 | 3300048912 | Ga0496109_0423920 | Ga0496109_0423920_268_969 | 232 |
| 646 | 3300048913 | Ga0496110_0282315 | Ga0496110_0282315_694_1395 | 232 |
| 647 | 3300048917 | Ga0496114_0003318 | Ga0496114_0003318_2254_2955 | 232 |
| 648 | 3300048917 | Ga0496114_0198069 | Ga0496114_0198069_135_836 | 232 |
| 649 | 3300048918 | Ga0496115_0052754 | Ga0496115_0052754_2524_3225 | 232 |
| 650 | 3300049515 | Ga0501292_023063 | Ga0501292_023063_53_751 | 232 |
| 651 | 3300049568 | Ga0501031_0430097 | Ga0501031_0430097_54_752 | 232 |
| 652 | 3300049572 | Ga0501036_0121886 | Ga0501036_0121886_70_774 | 232 |
| 653 | 3300049572 | Ga0501036_0424489 | Ga0501036_0424489_50_748 | 232 |
| 654 | 3300049575 | Ga0501039_0105191 | Ga0501039_0105191_134_838 | 232 |
| 655 | 3300049575 | Ga0501039_0198160 | Ga0501039_0198160_824_1522 | 232 |
| 656 | 3300049575 | Ga0501039_0276605 | Ga0501039_0276605_303_1004 | 232 |
| 657 | 3300049576 | Ga0501040_0118695 | Ga0501040_0118695_920_1618 | 232 |
| 658 | 3300049578 | Ga0501042_0101822 | Ga0501042_0101822_1309_2016 | 232 |
| 659 | 3300049578 | Ga0501042_0292817 | Ga0501042_0292817_331_1029 | 232 |
| 660 | 3300049580 | Ga0501046_0236032 | Ga0501046_0236032_420_1118 | 232 |
| 661 | 3300049587 | Ga0501071_0061541 | Ga0501071_0061541_1761_2462 | 232 |
| 662 | 3300049587 | Ga0501071_0161634 | Ga0501071_0161634_365_1063 | 232 |
| 663 | 3300049588 | Ga0501072_0076812 | Ga0501072_0076812_158_865 | 232 |
| 664 | 3300049588 | Ga0501072_0451560 | Ga0501072_0451560_254_967 | 232 |
| 665 | 3300049589 | Ga0501073_0258642 | Ga0501073_0258642_309_1022 | 232 |
| 666 | 3300049590 | Ga0501074_0139387 | Ga0501074_0139387_330_1067 | 232 |
| 667 | 3300049591 | Ga0501075_0055996 | Ga0501075_0055996_1910_2608 | 232 |
| 668 | 3300049591 | Ga0501075_0065169 | Ga0501075_0065169_823_1524 | 232 |
| 669 | 3300049591 | Ga0501075_0326697 | Ga0501075_0326697_303_1016 | 232 |
| 670 | 3300049592 | Ga0501076_0128736 | Ga0501076_0128736_562_1299 | 232 |
| 671 | 3300049592 | Ga0501076_0639980 | Ga0501076_0639980_50_775 | 232 |
| 672 | 3300049593 | Ga0501077_0230533 | Ga0501077_0230533_190_915 | 232 |
| 673 | 3300049741 | Ga0501079_0061678 | Ga0501079_0061678_1603_2316 | 232 |
| 674 | 3300049741 | Ga0501079_0331616 | Ga0501079_0331616_82_786 | 232 |
| 675 | 3300049742 | Ga0501080_0225902 | Ga0501080_0225902_177_890 | 232 |
| 676 | 3300049743 | Ga0501081_0198816 | Ga0501081_0198816_549_1250 | 232 |
| 677 | 3300049768 | Ga0501271_007320 | Ga0501271_007320_20_793 | 232 |
| 678 | 3300049824 | Ga0501045_0371839 | Ga0501045_0371839_217_942 | 232 |
| 679 | 3300049824 | Ga0501045_0378093 | Ga0501045_0378093_284_1021 | 232 |
| 680 | 3300050507 | nmdc:mga05p37_1500_c2 | nmdc:mga05p37_1500_c2_17743_18444 | 232 |
| 681 | 3300050507 | nmdc:mga05p37_257111_c1 | nmdc:mga05p37_257111_c1_79_780 | 232 |
| 682 | 3300050507 | nmdc:mga05p37_5835_c2 | nmdc:mga05p37_5835_c2_6027_6731 | 232 |
| 683 | 3300050507 | nmdc:mga05p37_65145_c1 | nmdc:mga05p37_65145_c1_12_713 | 232 |
| 684 | 3300050508 | nmdc:mga09592_27688_c1 | nmdc:mga09592_27688_c1_3513_4217 | 232 |
| 685 | 3300050508 | nmdc:mga09592_405460_c1 | nmdc:mga09592_405460_c1_237_935 | 232 |
| 686 | 3300050509 | nmdc:mga0qj67_188403_c1 | nmdc:mga0qj67_188403_c1_780_1484 | 232 |
| 687 | 3300050509 | nmdc:mga0qj67_88363_c1 | nmdc:mga0qj67_88363_c1_262_966 | 232 |
| 688 | 3300050510 | nmdc:mga06r32_176978_c1 | nmdc:mga06r32_176978_c1_601_1329 | 232 |
| 689 | 3300050510 | nmdc:mga06r32_53035_c1 | nmdc:mga06r32_53035_c1_2128_2832 | 232 |
| 690 | 3300050511 | nmdc:mga08y16_95715_c1 | nmdc:mga08y16_95715_c1_1654_2355 | 232 |
| 691 | 3300050512 | nmdc:mga0n895_20034_c1 | nmdc:mga0n895_20034_c1_5468_6166 | 232 |
| 692 | 3300050512 | nmdc:mga0n895_229_c1 | nmdc:mga0n895_229_c1_29517_30218 | 232 |
| 693 | 3300050512 | nmdc:mga0n895_71478_c1 | nmdc:mga0n895_71478_c1_2550_3251 | 232 |
| 694 | 3300050513 | nmdc:mga0rr50_14_c1 | nmdc:mga0rr50_14_c1_42095_42796 | 232 |
| 695 | 3300050513 | nmdc:mga0rr50_219879_c1 | nmdc:mga0rr50_219879_c1_697_1398 | 232 |
| 696 | 3300050513 | nmdc:mga0rr50_22513_c1 | nmdc:mga0rr50_22513_c1_3488_4189 | 232 |
| 697 | 3300050513 | nmdc:mga0rr50_3194_c1 | nmdc:mga0rr50_3194_c1_5468_6169 | 232 |
| 698 | 3300050514 | nmdc:mga08x19_12392_c1 | nmdc:mga08x19_12392_c1_2527_3228 | 232 |
| 699 | 3300050514 | nmdc:mga08x19_72724_c1 | nmdc:mga08x19_72724_c1_1436_2137 | 232 |
| 700 | 3300050515 | nmdc:mga0a205_104477_c1 | nmdc:mga0a205_104477_c1_1389_2090 | 232 |
| 701 | 3300050515 | nmdc:mga0a205_18545_c1 | nmdc:mga0a205_18545_c1_4361_5059 | 232 |
| 702 | 3300050515 | nmdc:mga0a205_203041_c1 | nmdc:mga0a205_203041_c1_901_1602 | 232 |
| 703 | 3300053077 | Ga0495601_0027119 | Ga0495601_0027119_1392_2093 | 232 |
| 704 | 3300053077 | Ga0495601_0278148 | Ga0495601_0278148_215_916 | 232 |
| 705 | 3300053084 | Ga0495595_0018713 | Ga0495595_0018713_2122_2823 | 232 |
| 706 | 3300053085 | Ga0495619_0003775 | Ga0495619_0003775_1654_2355 | 232 |
| 707 | 3300053085 | Ga0495619_0012315 | Ga0495619_0012315_2878_3579 | 232 |
| 708 | 3300053085 | Ga0495619_0067617 | Ga0495619_0067617_669_1370 | 232 |
| 709 | 3300054114 | Ga0501084_0028086 | Ga0501084_0028086_1610_2347 | 232 |
| 710 | 3300054114 | Ga0501084_0235088 | Ga0501084_0235088_407_1111 | 232 |
| 711 | 3300054114 | Ga0501084_0318615 | Ga0501084_0318615_347_1060 | 232 |
| 712 | 3300059421 | Ga0590071_000236 | Ga0590071_000236_6175_6876 | 232 |
| 713 | 3300059423 | Ga0590074_002005 | Ga0590074_002005_1232_1933 | 232 |
| 714 | 3300059424 | Ga0590075_000068 | Ga0590075_000068_7951_8652 | 232 |
| 715 | 3300059424 | Ga0590075_010098 | Ga0590075_010098_916_1614 | 232 |
| 716 | 3300059426 | Ga0590077_000212 | Ga0590077_000212_7290_7991 | 232 |
| 717 | 3300059511 | Ga0587091_057831 | Ga0587091_057831_61_762 | 232 |
| 718 | 3300059639 | Ga0587062_031957 | Ga0587062_031957_45_746 | 232 |
| 719 | 3300060344 | Ga0587071_046805 | Ga0587071_046805_151_852 | 232 |
| 720 | 3300060353 | Ga0501082_0171402 | Ga0501082_0171402_1150_1875 | 232 |
| 721 | 3300060353 | Ga0501082_0239270 | Ga0501082_0239270_813_1514 | 232 |
| 722 | 3300060353 | Ga0501082_0344687 | Ga0501082_0344687_489_1202 | 232 |
| 723 | 3300061734 | Ga0530510_0071377 | Ga0530510_0071377_134_847 | 232 |
| 724 | 3300005295 | Ga0065707_10202475 | Ga0065707_102024752 | 233 |
| 725 | 3300005364 | Ga0070673_100784806 | Ga0070673_1007848061 | 233 |
| 726 | 3300005456 | Ga0070678_100446703 | Ga0070678_1004467032 | 233 |
| 727 | 3300005457 | Ga0070662_100045226 | Ga0070662_1000452262 | 233 |
| 728 | 3300005543 | Ga0070672_100448753 | Ga0070672_1004487531 | 233 |
| 729 | 3300005841 | Ga0068863_100815521 | Ga0068863_1008155211 | 233 |
| 730 | 3300006038 | Ga0075365_10148327 | Ga0075365_101483272 | 233 |
| 731 | 3300006042 | Ga0075368_10109320 | Ga0075368_101093201 | 233 |
| 732 | 3300006177 | Ga0075362_10068370 | Ga0075362_100683702 | 233 |
| 733 | 3300006178 | Ga0075367_10007468 | Ga0075367_100074685 | 233 |
| 734 | 3300006195 | Ga0075366_10020773 | Ga0075366_100207732 | 233 |
| 735 | 3300006844 | Ga0075428_100043003 | Ga0075428_1000430032 | 233 |
| 736 | 3300006846 | Ga0075430_100635419 | Ga0075430_1006354192 | 233 |
| 737 | 3300006847 | Ga0075431_100017202 | Ga0075431_1000172026 | 233 |
| 738 | 3300006847 | Ga0075431_100602075 | Ga0075431_1006020752 | 233 |
| 739 | 3300009094 | Ga0111539_10001132 | Ga0111539_100011329 | 233 |
| 740 | 3300009147 | Ga0114129_10015339 | Ga0114129_100153395 | 233 |
| 741 | 3300009147 | Ga0114129_10020092 | Ga0114129_100200928 | 233 |
| 742 | 3300009147 | Ga0114129_10479429 | Ga0114129_104794292 | 233 |
| 743 | 3300009147 | Ga0114129_11105235 | Ga0114129_111052351 | 233 |
| 744 | 3300009174 | Ga0105241_10170541 | Ga0105241_101705412 | 233 |
| 745 | 3300014325 | Ga0163163_10742363 | Ga0163163_107423632 | 233 |
| 746 | 3300025903 | Ga0207680_10110387 | Ga0207680_101103871 | 233 |
| 747 | 3300025911 | Ga0207654_10302017 | Ga0207654_103020172 | 233 |
| 748 | 3300025931 | Ga0207644_10384004 | Ga0207644_103840041 | 233 |
| 749 | 3300025933 | Ga0207706_10352660 | Ga0207706_103526601 | 233 |
| 750 | 3300025937 | Ga0207669_10012024 | Ga0207669_100120243 | 233 |
| 751 | 3300026067 | Ga0207678_10300597 | Ga0207678_103005972 | 233 |
| 752 | 3300026121 | Ga0207683_10545856 | Ga0207683_105458561 | 233 |
| 753 | 3300027907 | Ga0207428_10009844 | Ga0207428_100098449 | 233 |
| 754 | 3300028379 | Ga0268266_10254068 | Ga0268266_102540681 | 233 |
| 755 | 3300031548 | Ga0307408_100083765 | Ga0307408_1000837652 | 233 |
| 756 | 3300031731 | Ga0307405_10112770 | Ga0307405_101127701 | 233 |
| 757 | 3300031731 | Ga0307405_10123446 | Ga0307405_101234462 | 233 |
| 758 | 3300031824 | Ga0307413_10339984 | Ga0307413_103399842 | 233 |
| 759 | 3300031852 | Ga0307410_10124228 | Ga0307410_101242281 | 233 |
| 760 | 3300031995 | Ga0307409_100159718 | Ga0307409_1001597182 | 233 |
| 761 | 3300031995 | Ga0307409_100190286 | Ga0307409_1001902862 | 233 |
| 762 | 3300032002 | Ga0307416_100029805 | Ga0307416_1000298052 | 233 |
| 763 | 3300032002 | Ga0307416_100100825 | Ga0307416_1001008252 | 233 |
| 764 | 3300032002 | Ga0307416_100110060 | Ga0307416_1001100602 | 233 |
| 765 | 3300032004 | Ga0307414_10210073 | Ga0307414_102100732 | 233 |
| 766 | 3300032005 | Ga0307411_10223112 | Ga0307411_102231122 | 233 |
| 767 | 3300032126 | Ga0307415_100157787 | Ga0307415_1001577872 | 233 |
| 768 | 3300032126 | Ga0307415_100876209 | Ga0307415_1008762091 | 233 |
| 769 | 3300038443 | Ga0395901_0728084 | Ga0395901_0728084_207_917 | 233 |
| 770 | 3300041404 | Ga0439436_0082332 | Ga0439436_0082332_72_785 | 233 |
| 771 | 3300041456 | Ga0451795_0441604 | Ga0451795_0441604_195_896 | 233 |
| 772 | 3300042009 | Ga0439451_041683 | Ga0439451_041683_117_818 | 233 |
| 773 | 3300042133 | Ga0450896_001975 | Ga0450896_001975_896_1600 | 233 |
| 774 | 3300042134 | Ga0450898_007257 | Ga0450898_007257_252_956 | 233 |
| 775 | 3300042436 | Ga0439435_0058046 | Ga0439435_0058046_380_1084 | 233 |
| 776 | 3300045051 | Ga0451576_0302997 | Ga0451576_0302997_474_1175 | 233 |
| 777 | 3300045051 | Ga0451576_1103677 | Ga0451576_1103677_31_732 | 233 |
| 778 | 3300046455 | Ga0495603_0057471 | Ga0495603_0057471_126_827 | 233 |
| 779 | 3300046460 | Ga0495638_0003705 | Ga0495638_0003705_6283_6987 | 233 |
| 780 | 3300046499 | Ga0495594_0110689 | Ga0495594_0110689_114_815 | 233 |
| 781 | 3300047320 | Ga0495672_0066901 | Ga0495672_0066901_313_1023 | 233 |
| 782 | 3300048909 | Ga0496106_0031956 | Ga0496106_0031956_3133_3834 | 233 |
| 783 | 3300048917 | Ga0496114_0773237 | Ga0496114_0773237_21_722 | 233 |
| 784 | 3300049572 | Ga0501036_0384228 | Ga0501036_0384228_418_1119 | 233 |
| 785 | 3300049576 | Ga0501040_0125178 | Ga0501040_0125178_248_949 | 233 |
| 786 | 3300049582 | Ga0501048_0247109 | Ga0501048_0247109_470_1171 | 233 |
| 787 | 3300049585 | Ga0501069_0154185 | Ga0501069_0154185_464_1165 | 233 |
| 788 | 3300049591 | Ga0501075_0025723 | Ga0501075_0025723_3517_4218 | 233 |
| 789 | 3300049592 | Ga0501076_0029968 | Ga0501076_0029968_1891_2592 | 233 |
| 790 | 3300049592 | Ga0501076_0344214 | Ga0501076_0344214_23_727 | 233 |
| 791 | 3300049705 | Ga0501225_0068745 | Ga0501225_0068745_98_799 | 233 |
| 792 | 3300049741 | Ga0501079_0361626 | Ga0501079_0361626_95_796 | 233 |
| 793 | 3300049742 | Ga0501080_0309341 | Ga0501080_0309341_523_1224 | 233 |
| 794 | 3300049824 | Ga0501045_0146040 | Ga0501045_0146040_113_814 | 233 |
| 795 | 3300050489 | nmdc:mga03683_63536_c1 | nmdc:mga03683_63536_c1_722_1432 | 233 |
| 796 | 3300050493 | nmdc:mga0k408_202559_c1 | nmdc:mga0k408_202559_c1_384_1094 | 233 |
| 797 | 3300050493 | nmdc:mga0k408_35378_c1 | nmdc:mga0k408_35378_c1_470_1180 | 233 |
| 798 | 3300050494 | nmdc:mga06z11_11222_c1 | nmdc:mga06z11_11222_c1_628_1338 | 233 |
| 799 | 3300050507 | nmdc:mga05p37_1011882_c1 | nmdc:mga05p37_1011882_c1_84_788 | 233 |
| 800 | 3300050507 | nmdc:mga05p37_12570_c1 | nmdc:mga05p37_12570_c1_6124_6825 | 233 |
| 801 | 3300050507 | nmdc:mga05p37_221081_c1 | nmdc:mga05p37_221081_c1_1023_1724 | 233 |
| 802 | 3300050507 | nmdc:mga05p37_27903_c2 | nmdc:mga05p37_27903_c2_1642_2343 | 233 |
| 803 | 3300050508 | nmdc:mga09592_585007_c1 | nmdc:mga09592_585007_c1_128_829 | 233 |
| 804 | 3300050509 | nmdc:mga0qj67_31764_c1 | nmdc:mga0qj67_31764_c1_3064_3765 | 233 |
| 805 | 3300050510 | nmdc:mga06r32_188657_c1 | nmdc:mga06r32_188657_c1_436_1137 | 233 |
| 806 | 3300050511 | nmdc:mga08y16_207016_c1 | nmdc:mga08y16_207016_c1_250_954 | 233 |
| 807 | 3300050511 | nmdc:mga08y16_506030_c1 | nmdc:mga08y16_506030_c1_229_930 | 233 |
| 808 | 3300053096 | Ga0500641_0009818 | Ga0500641_0009818_231_935 | 233 |
| 809 | 3300053103 | Ga0500555_007562 | Ga0500555_007562_1381_2085 | 233 |
| 810 | 3300053116 | Ga0500592_003976 | Ga0500592_003976_953_1657 | 233 |
| 811 | 3300053139 | Ga0500568_0004866 | Ga0500568_0004866_1748_2458 | 233 |
| 812 | 3300053153 | Ga0500616_0000567 | Ga0500616_0000567_43234_43938 | 233 |
| 813 | 3300053730 | Ga0500645_000402 | Ga0500645_000402_4576_5280 | 233 |
| 814 | 3300053736 | Ga0500599_012921 | Ga0500599_012921_198_902 | 233 |
| 815 | 3300061734 | Ga0530510_0060229 | Ga0530510_0060229_344_1045 | 233 |
| 816 | 3300005293 | Ga0065715_10026217 | Ga0065715_100262172 | 234 |
| 817 | 3300005345 | Ga0070692_10106275 | Ga0070692_101062752 | 234 |
| 818 | 3300005441 | Ga0070700_100293652 | Ga0070700_1002936522 | 234 |
| 819 | 3300006844 | Ga0075428_100000815 | Ga0075428_10000081524 | 234 |
| 820 | 3300006844 | Ga0075428_100075808 | Ga0075428_1000758082 | 234 |
| 821 | 3300006846 | Ga0075430_100000790 | Ga0075430_1000007903 | 234 |
| 822 | 3300006846 | Ga0075430_100049111 | Ga0075430_1000491112 | 234 |
| 823 | 3300006847 | Ga0075431_100014813 | Ga0075431_1000148136 | 234 |
| 824 | 3300006847 | Ga0075431_100030446 | Ga0075431_1000304465 | 234 |
| 825 | 3300006852 | Ga0075433_10002477 | Ga0075433_1000247713 | 234 |
| 826 | 3300006880 | Ga0075429_100010093 | Ga0075429_1000100934 | 234 |
| 827 | 3300006880 | Ga0075429_100066198 | Ga0075429_1000661983 | 234 |
| 828 | 3300009094 | Ga0111539_10000159 | Ga0111539_1000015936 | 234 |
| 829 | 3300009094 | Ga0111539_10091748 | Ga0111539_100917482 | 234 |
| 830 | 3300009094 | Ga0111539_10495438 | Ga0111539_104954382 | 234 |
| 831 | 3300009147 | Ga0114129_10004686 | Ga0114129_1000468610 | 234 |
| 832 | 3300009147 | Ga0114129_10014940 | Ga0114129_100149409 | 234 |
| 833 | 3300009147 | Ga0114129_10166577 | Ga0114129_101665773 | 234 |
| 834 | 3300014326 | Ga0157380_10211859 | Ga0157380_102118592 | 234 |
| 835 | 3300025315 | Ga0207697_10184009 | Ga0207697_101840091 | 234 |
| 836 | 3300025901 | Ga0207688_10305952 | Ga0207688_103059522 | 234 |
| 837 | 3300025933 | Ga0207706_10313831 | Ga0207706_103138313 | 234 |
| 838 | 3300027907 | Ga0207428_10002569 | Ga0207428_100025694 | 234 |
| 839 | 3300027907 | Ga0207428_10097373 | Ga0207428_100973732 | 234 |
| 840 | 3300031731 | Ga0307405_10108849 | Ga0307405_101088491 | 234 |
| 841 | 3300031903 | Ga0307407_10094231 | Ga0307407_100942312 | 234 |
| 842 | 3300031911 | Ga0307412_10567391 | Ga0307412_105673912 | 234 |
| 843 | 3300031995 | Ga0307409_100048523 | Ga0307409_1000485232 | 234 |
| 844 | 3300031995 | Ga0307409_100165738 | Ga0307409_1001657381 | 234 |
| 845 | 3300032002 | Ga0307416_100267712 | Ga0307416_1002677122 | 234 |
| 846 | 3300042436 | Ga0439435_0000936 | Ga0439435_0000936_235_942 | 234 |
| 847 | 3300042436 | Ga0439435_0116821 | Ga0439435_0116821_61_768 | 234 |
| 848 | 3300049515 | Ga0501292_012949 | Ga0501292_012949_382_1089 | 234 |
| 849 | 3300049672 | Ga0501239_011728 | Ga0501239_011728_217_924 | 234 |
| 850 | 3300050507 | nmdc:mga05p37_5123_c1 | nmdc:mga05p37_5123_c1_8041_8748 | 234 |
| 851 | 3300050507 | nmdc:mga05p37_71086_c1 | nmdc:mga05p37_71086_c1_224_931 | 234 |
| 852 | 3300050508 | nmdc:mga09592_165039_c1 | nmdc:mga09592_165039_c1_718_1425 | 234 |
| 853 | 3300050508 | nmdc:mga09592_9342_c1 | nmdc:mga09592_9342_c1_2603_3310 | 234 |
| 854 | 3300050509 | nmdc:mga0qj67_124572_c1 | nmdc:mga0qj67_124572_c1_960_1667 | 234 |
| 855 | 3300050509 | nmdc:mga0qj67_4023_c1 | nmdc:mga0qj67_4023_c1_340_1047 | 234 |
| 856 | 3300050509 | nmdc:mga0qj67_96447_c1 | nmdc:mga0qj67_96447_c1_888_1595 | 234 |
| 857 | 3300050510 | nmdc:mga06r32_154420_c1 | nmdc:mga06r32_154420_c1_511_1218 | 234 |
| 858 | 3300050510 | nmdc:mga06r32_6030_c1 | nmdc:mga06r32_6030_c1_752_1459 | 234 |
| 859 | 3300050511 | nmdc:mga08y16_254922_c1 | nmdc:mga08y16_254922_c1_1029_1736 | 234 |
| 860 | 3300050511 | nmdc:mga08y16_89520_c1 | nmdc:mga08y16_89520_c1_576_1283 | 234 |
| 861 | 3300050511 | nmdc:mga08y16_99921_c1 | nmdc:mga08y16_99921_c1_752_1459 | 234 |
| 862 | 3300050515 | nmdc:mga0a205_8071_c1 | nmdc:mga0a205_8071_c1_3281_3988 | 234 |
| 863 | 3300001991 | JGI24743J22301_10021937 | JGI24743J22301_100219372 | 235 |
| 864 | 3300002077 | JGI24744J21845_10009333 | JGI24744J21845_100093332 | 235 |
| 865 | 3300005290 | Ga0065712_10076567 | Ga0065712_100765672 | 235 |
| 866 | 3300005338 | Ga0068868_100077209 | Ga0068868_1000772092 | 235 |
| 867 | 3300005355 | Ga0070671_100193937 | Ga0070671_1001939372 | 235 |
| 868 | 3300005356 | Ga0070674_100086763 | Ga0070674_1000867632 | 235 |
| 869 | 3300005456 | Ga0070678_100121707 | Ga0070678_1001217072 | 235 |
| 870 | 3300005544 | Ga0070686_100298513 | Ga0070686_1002985132 | 235 |
| 871 | 3300005548 | Ga0070665_100246070 | Ga0070665_1002460702 | 235 |
| 872 | 3300005548 | Ga0070665_100475268 | Ga0070665_1004752682 | 235 |
| 873 | 3300013308 | Ga0157375_11009335 | Ga0157375_110093352 | 235 |
| 874 | 3300014325 | Ga0163163_10083729 | Ga0163163_100837293 | 235 |
| 875 | 3300014969 | Ga0157376_10924861 | Ga0157376_109248611 | 235 |
| 876 | 3300025290 | Ga0207673_1003453 | Ga0207673_10034532 | 235 |
| 877 | 3300025315 | Ga0207697_10001568 | Ga0207697_100015684 | 235 |
| 878 | 3300025901 | Ga0207688_10004015 | Ga0207688_100040158 | 235 |
| 879 | 3300025920 | Ga0207649_10687926 | Ga0207649_106879261 | 235 |
| 880 | 3300025926 | Ga0207659_10083887 | Ga0207659_100838871 | 235 |
| 881 | 3300025931 | Ga0207644_10040068 | Ga0207644_100400682 | 235 |
| 882 | 3300025937 | Ga0207669_10027751 | Ga0207669_100277513 | 235 |
| 883 | 3300025940 | Ga0207691_10053870 | Ga0207691_100538703 | 235 |
| 884 | 3300025986 | Ga0207658_10023108 | Ga0207658_100231082 | 235 |
| 885 | 3300026067 | Ga0207678_10076647 | Ga0207678_100766473 | 235 |
| 886 | 3300026121 | Ga0207683_10266084 | Ga0207683_102660842 | 235 |
| 887 | 3300028379 | Ga0268266_10548745 | Ga0268266_105487451 | 235 |
| 888 | 3300048911 | Ga0496108_0105953 | Ga0496108_0105953_895_1602 | 235 |
| 889 | 3300048913 | Ga0496110_0047039 | Ga0496110_0047039_1746_2453 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vl5-assembly4.cif.gz_D | crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution | 0.8344 | 58 | 217 |
| 3bus-assembly2.cif.gz_B | crystal structure of rebm | 0.8325 | 59 | 234 |
| 3bus-assembly1.cif.gz_A | crystal structure of rebm | 0.827 | 59 | 234 |
| 5kok-assembly1.cif.gz_B | pavine n-methyltransferase in complex with tetrahydropapaverine and s-adenosylhomocysteine ph 7.25 | 0.8259 | 57 | 176 |
| 6gkz-assembly1.cif.gz_A | crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah | 0.821 | 57 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q80WQ4_26_187_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8723 | 56 | 170 | 3.40.50.150 |
| af_Q4DRI7_264_404_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8622 | 123 | 234 | 3.40.50.150 |
| af_Q9VBJ3_147_316_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8549 | 62 | 168 | 3.40.50.150 |
| af_Q55DF6_53_245_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8526 | 57 | 132 | 3.40.50.150 |
| af_O13871_19_175_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8447 | 57 | 168 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5Y937-F1-model_v4 | SAM-dependent methyltransferase | 0.9111 | 33 | 170 |
GO:0008757
GO:0032259 |
| AF-A0A4Q5L2Z0-F1-model_v4 | deleted | 0.9103 | 37 | 233 |
|
| AF-A0A7Y2BKY5-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9091 | 36 | 233 |
GO:0008757
GO:0032259 |
| AF-A0A534SAC5-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9065 | 38 | 234 |
GO:0008757
GO:0032259 |
| AF-A0A1G3C466-F1-model_v4 | Methyltransferase domain-containing protein | 0.9049 | 66 | 233 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar