F484776

General Info

Members Datasets Scaffolds Average Seq Length
888 282 1776 148

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_634821_c1|nmdc:mga0a205_634821_c1_86_583
Length 165
Sequence MAKSRQQRLEGFSKEVHMFGLTRWNSFDDVFNFQREVDRLFNQFWSDLPTRTAAGSSPSFQVNATEDGWRVDVPLPGIDPKDVSLEVAGNNLTIRAEVPSEDSDKNVSRYEQTFTVPQFLDIEKLSASHRHGMLRLTLPLKESVKPRRVQIETQMEDQKQLAGGR

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
200 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
201 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
204 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
205 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
206 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
207 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
208 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
214 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
215 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
216 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
217 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
218 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
219 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
222 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
223 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
224 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
225 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
226 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
227 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
240 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
241 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
259 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
260 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
265 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 2.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 1.46
Rhizosphere 96.85
Stem 0
Stem Tuber 0
Unclassified 40.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_634821_c1 3300050515 Bacteria 920
2 Ga0006778J45830_1017703 3300003162 Bacteria 571
3 JGI25406J46586_10012253 3300003203 Bacteria 3729
4 Ga0007416J51690_1013940 3300003577 Unclassified 560
5 Ga0007429J51699_1016628 3300003579 Unclassified 571
6 Ga0007429J51699_1043548 3300003579 Bacteria 549
7 Ga0007429J51699_1053477 3300003579 Unclassified 519
8 Ga0032354_1016397 3300003693 Unclassified 564
9 Ga0058859_10006525 3300004798 Unclassified 521
10 Ga0058861_11765244 3300004800 Bacteria 583
11 Ga0065714_10422736 3300005288 Unclassified 573
12 Ga0065712_10146184 3300005290 Unclassified 1376
13 Ga0065712_10267195 3300005290 Unclassified 924
14 Ga0065712_10350535 3300005290 Bacteria 788
15 Ga0065712_10368791 3300005290 Unclassified 766
16 Ga0065712_10661407 3300005290 Unclassified 563
17 Ga0065715_10302055 3300005293 Bacteria 1039
18 Ga0065715_10370492 3300005293 Unclassified 922
19 Ga0065715_10516618 3300005293 Unclassified 757
20 Ga0065715_10648943 3300005293 Unclassified 679
21 Ga0065707_10316627 3300005295 Bacteria 974
22 Ga0065707_10879651 3300005295 Bacteria 573
23 Ga0070676_10002230 3300005328 Bacteria 9890
24 Ga0070676_10185599 3300005328 Bacteria 1355
25 Ga0070676_10433300 3300005328 Bacteria 921
26 Ga0070676_10725690 3300005328 Unclassified 727
27 Ga0070683_100315717 3300005329 Bacteria 1487
28 Ga0070683_101171693 3300005329 Unclassified 738
29 Ga0070690_100263343 3300005330 Bacteria 1223
30 Ga0070690_100739923 3300005330 Unclassified 758
31 Ga0070690_100753108 3300005330 Bacteria 752
32 Ga0070690_100914636 3300005330 Unclassified 687
33 Ga0070670_100009882 3300005331 Bacteria 8149
34 Ga0070670_100012366 3300005331 Bacteria 7303
35 Ga0070670_100023240 3300005331 Bacteria 5336
36 Ga0070670_100091171 3300005331 Unclassified 2620
37 Ga0070670_100491221 3300005331 Unclassified 1091
38 Ga0070670_100884259 3300005331 Unclassified 809
39 Ga0070670_101079780 3300005331 Bacteria 731
40 Ga0070677_10048819 3300005333 Bacteria 1702
41 Ga0070677_10299453 3300005333 Unclassified 817
42 Ga0070677_10496221 3300005333 Bacteria 661
43 Ga0068869_100011193 3300005334 Bacteria 5878
44 Ga0068869_100063924 3300005334 Bacteria 2705
45 Ga0068869_100273834 3300005334 Unclassified 1355
46 Ga0068869_100484612 3300005334 Bacteria 1030
47 Ga0068869_100517190 3300005334 Unclassified 999
48 Ga0068869_101579248 3300005334 Bacteria 584
49 Ga0070666_10022525 3300005335 Bacteria 4090
50 Ga0070666_10094237 3300005335 Bacteria 2059
51 Ga0070666_11018169 3300005335 Unclassified 615
52 Ga0070680_100987300 3300005336 Bacteria 727
53 Ga0070680_101009344 3300005336 Unclassified 719
54 Ga0070682_101058830 3300005337 Unclassified 677
55 Ga0070682_101269624 3300005337 Unclassified 624
56 Ga0068868_100160056 3300005338 Unclassified 1859
57 Ga0068868_100987382 3300005338 Unclassified 770
58 Ga0068868_101059264 3300005338 Unclassified 744
59 Ga0070660_100260851 3300005339 Unclassified 1415
60 Ga0070660_100456362 3300005339 Bacteria 1061
61 Ga0070689_100067434 3300005340 Unclassified 2789
62 Ga0070689_100067598 3300005340 Bacteria 2786
63 Ga0070689_100615129 3300005340 Unclassified 942
64 Ga0070689_101075629 3300005340 Bacteria 718
65 Ga0070691_10030808 3300005341 Bacteria 2513
66 Ga0070691_10345639 3300005341 Bacteria 824
67 Ga0070661_100055148 3300005344 Bacteria 2911
68 Ga0070661_101241395 3300005344 Unclassified 624
69 Ga0070692_10223775 3300005345 Unclassified 1113
70 Ga0070692_10985122 3300005345 Unclassified 588
71 Ga0070668_100148290 3300005347 Unclassified 1895
72 Ga0070668_100866632 3300005347 Unclassified 806
73 Ga0070668_101170132 3300005347 Unclassified 696
74 Ga0070668_101520367 3300005347 Bacteria 612
75 Ga0070669_100028494 3300005353 Bacteria 4022
76 Ga0070669_100029852 3300005353 Bacteria 3933
77 Ga0070669_100056607 3300005353 Bacteria 2875
78 Ga0070669_100058378 3300005353 Bacteria 2831
79 Ga0070669_100088861 3300005353 Unclassified 2313
80 Ga0070669_100342584 3300005353 Bacteria 1212
81 Ga0070669_100589870 3300005353 Unclassified 930
82 Ga0070675_100001785 3300005354 Bacteria 15872
83 Ga0070675_100014267 3300005354 Bacteria 6264
84 Ga0070675_100026835 3300005354 Bacteria 4623
85 Ga0070675_100039503 3300005354 Bacteria 3851
86 Ga0070675_100047911 3300005354 Bacteria 3503
87 Ga0070675_100110904 3300005354 Bacteria 2321
88 Ga0070675_100412060 3300005354 Bacteria 1207
89 Ga0070675_100807166 3300005354 Unclassified 858
90 Ga0070675_101770312 3300005354 Unclassified 570
91 Ga0070671_100012557 3300005355 Bacteria 6821
92 Ga0070671_100035910 3300005355 Bacteria 4107
93 Ga0070671_100112371 3300005355 Bacteria 2288
94 Ga0070671_100188442 3300005355 Bacteria 1748
95 Ga0070674_100036007 3300005356 Unclassified 3319
96 Ga0070674_100419662 3300005356 Bacteria 1097
97 Ga0070674_100759167 3300005356 Bacteria 834
98 Ga0070674_101214121 3300005356 Unclassified 670
99 Ga0070673_100002679 3300005364 Bacteria 10902
100 Ga0070673_100052502 3300005364 Bacteria 3198
101 Ga0070673_100112963 3300005364 Unclassified 2255
102 Ga0070673_100577257 3300005364 Bacteria 1024
103 Ga0070673_100644427 3300005364 Bacteria 969
104 Ga0070673_100711790 3300005364 Bacteria 923
105 Ga0070688_100001312 3300005365 Bacteria 12406
106 Ga0070688_100135250 3300005365 Bacteria 1668
107 Ga0070659_100483797 3300005366 Bacteria 1053
108 Ga0070659_100686973 3300005366 Bacteria 884
109 Ga0070659_101056574 3300005366 Bacteria 714
110 Ga0070667_100038303 3300005367 Unclassified 4019
111 Ga0070667_100097379 3300005367 Unclassified 2538
112 Ga0070667_100345697 3300005367 Unclassified 1346
113 Ga0070667_100966572 3300005367 Unclassified 794
114 Ga0070667_101025663 3300005367 Unclassified 770
115 Ga0070667_102086292 3300005367 Unclassified 534
116 Ga0070709_10019831 3300005434 Bacteria 3894
117 Ga0070713_100183430 3300005436 Unclassified 1882
118 Ga0070701_10192974 3300005438 Bacteria 1199
119 Ga0070705_100001307 3300005440 Bacteria 13359
120 Ga0070705_100025543 3300005440 Bacteria 3204
121 Ga0070700_100112297 3300005441 Bacteria 1814
122 Ga0070700_100496881 3300005441 Bacteria 937
123 Ga0070700_100576181 3300005441 Bacteria 878
124 Ga0070694_100000796 3300005444 Bacteria 17667
125 Ga0070694_100361273 3300005444 Bacteria 1128
126 Ga0070694_100545218 3300005444 Bacteria 928
127 Ga0070663_100023564 3300005455 Bacteria 4128
128 Ga0070663_100026133 3300005455 Bacteria 3950
129 Ga0070663_101082909 3300005455 Bacteria 700
130 Ga0070663_101102013 3300005455 Unclassified 694
131 Ga0070678_100012427 3300005456 Bacteria 5292
132 Ga0070678_100038026 3300005456 Bacteria 3385
133 Ga0070678_100293305 3300005456 Bacteria 1380
134 Ga0070678_100748776 3300005456 Unclassified 884
135 Ga0070678_100878018 3300005456 Unclassified 818
136 Ga0070678_100995615 3300005456 Unclassified 770
137 Ga0070678_101510741 3300005456 Unclassified 629
138 Ga0070662_100171688 3300005457 Bacteria 1703
139 Ga0070662_100251047 3300005457 Bacteria 1422
140 Ga0070662_100270582 3300005457 Unclassified 1372
141 Ga0070662_100372051 3300005457 Bacteria 1174
142 Ga0070662_100391961 3300005457 Unclassified 1145
143 Ga0070662_100396252 3300005457 Bacteria 1139
144 Ga0070662_100947277 3300005457 Unclassified 736
145 Ga0070662_101015978 3300005457 Unclassified 710
146 Ga0070681_10893212 3300005458 Bacteria 807
147 Ga0068867_101505077 3300005459 Unclassified 627
148 Ga0070685_10074408 3300005466 Bacteria 2021
149 Ga0070685_10162327 3300005466 Bacteria 1425
150 Ga0070685_10201188 3300005466 Bacteria 1295
151 Ga0070685_10403930 3300005466 Unclassified 947
152 Ga0070707_101118271 3300005468 Bacteria 754
153 Ga0070698_101332699 3300005471 Unclassified 668
154 Ga0070679_100450896 3300005530 Unclassified 1231
155 Ga0070697_100026290 3300005536 Bacteria 4648
156 Ga0070697_100449902 3300005536 Bacteria 1122
157 Ga0070697_101268774 3300005536 Unclassified 657
158 Ga0068853_100145427 3300005539 Bacteria 2130
159 Ga0068853_101110248 3300005539 Unclassified 763
160 Ga0070672_100074927 3300005543 Bacteria 2700
161 Ga0070672_100158357 3300005543 Bacteria 1877
162 Ga0070672_100343750 3300005543 Bacteria 1271
163 Ga0070672_100660468 3300005543 Bacteria 913
164 Ga0070672_100737453 3300005543 Bacteria 864
165 Ga0070672_100909117 3300005543 Unclassified 778
166 Ga0070686_100010720 3300005544 Bacteria 5180
167 Ga0070686_100516964 3300005544 Unclassified 929
168 Ga0070686_100860696 3300005544 Unclassified 735
169 Ga0070695_100000075 3300005545 Bacteria 40319
170 Ga0070695_100438082 3300005545 Bacteria 999
171 Ga0070696_100000235 3300005546 Bacteria 33523
172 Ga0070696_100008939 3300005546 Bacteria 6703
173 Ga0070696_100814420 3300005546 Bacteria 769
174 Ga0070693_100489305 3300005547 Unclassified 870
175 Ga0070693_100974340 3300005547 Bacteria 640
176 Ga0070665_100038027 3300005548 Unclassified 4837
177 Ga0070665_100186367 3300005548 Unclassified 2076
178 Ga0070665_100403772 3300005548 Bacteria 1374
179 Ga0070665_100575391 3300005548 Bacteria 1139
180 Ga0070665_102580761 3300005548 Unclassified 509
181 Ga0070704_100023420 3300005549 Bacteria 4033
182 Ga0070704_100024599 3300005549 Bacteria 3953
183 Ga0070704_100163501 3300005549 Unclassified 1763
184 Ga0070704_100832628 3300005549 Bacteria 826
185 Ga0068855_100310175 3300005563 Bacteria 1746
186 Ga0068855_101190182 3300005563 Bacteria 793
187 Ga0070664_100064272 3300005564 Bacteria 3129
188 Ga0070664_100086397 3300005564 Bacteria 2710
189 Ga0070664_100351994 3300005564 Bacteria 1340
190 Ga0068857_100415463 3300005577 Bacteria 1254
191 Ga0068857_100491332 3300005577 Bacteria 1151
192 Ga0068857_101195157 3300005577 Unclassified 736
193 Ga0068854_100027796 3300005578 Unclassified 3902
194 Ga0068854_100077075 3300005578 Unclassified 2452
195 Ga0068854_100180256 3300005578 Bacteria 1650
196 Ga0068854_100576735 3300005578 Bacteria 957
197 Ga0068856_100438146 3300005614 Unclassified 1327
198 Ga0070702_100047167 3300005615 Bacteria 2446
199 Ga0068852_100678311 3300005616 Bacteria 1040
200 Ga0068859_100050824 3300005617 Bacteria 4165
201 Ga0068859_100118202 3300005617 Bacteria 2717
202 Ga0068859_100267643 3300005617 Unclassified 1801
203 Ga0068859_101030466 3300005617 Unclassified 904
204 Ga0068859_101359248 3300005617 Unclassified 783
205 Ga0068864_100082069 3300005618 Unclassified 2828
206 Ga0068864_100307331 3300005618 Bacteria 1486
207 Ga0068864_100634982 3300005618 Unclassified 1039
208 Ga0068864_100918977 3300005618 Unclassified 865
209 Ga0068866_10316876 3300005718 Bacteria 980
210 Ga0068861_100025217 3300005719 Unclassified 4309
211 Ga0068861_100039832 3300005719 Unclassified 3510
212 Ga0068861_100093567 3300005719 Bacteria 2377
213 Ga0068861_100261556 3300005719 Bacteria 1481
214 Ga0068861_100390962 3300005719 Bacteria 1232
215 Ga0068861_100420343 3300005719 Bacteria 1191
216 Ga0068861_100704850 3300005719 Unclassified 938
217 Ga0068861_101026502 3300005719 Unclassified 789
218 Ga0068851_10059726 3300005834 Bacteria 1951
219 Ga0068870_10036909 3300005840 Bacteria 2516
220 Ga0068870_10062629 3300005840 Bacteria 2004
221 Ga0068870_10101259 3300005840 Bacteria 1628
222 Ga0068870_10131861 3300005840 Bacteria 1452
223 Ga0068870_10172994 3300005840 Unclassified 1290
224 Ga0068870_10277672 3300005840 Bacteria 1049
225 Ga0068870_10425335 3300005840 Bacteria 870
226 Ga0068863_100003789 3300005841 Bacteria 14952
227 Ga0068863_100034414 3300005841 Unclassified 4826
228 Ga0068863_100053630 3300005841 Bacteria 3822
229 Ga0068863_100217070 3300005841 Bacteria 1842
230 Ga0068863_100794406 3300005841 Unclassified 944
231 Ga0068863_101244518 3300005841 Unclassified 750
232 Ga0068858_100104511 3300005842 Bacteria 2642
233 Ga0068858_100127026 3300005842 Unclassified 2389
234 Ga0068858_100142201 3300005842 Bacteria 2253
235 Ga0068860_100327515 3300005843 Bacteria 1504
236 Ga0068860_100355672 3300005843 Bacteria 1442
237 Ga0068860_100805267 3300005843 Bacteria 953
238 Ga0068860_100978072 3300005843 Bacteria 864
239 Ga0068860_100995491 3300005843 Bacteria 856
240 Ga0068860_101011732 3300005843 Bacteria 849
241 Ga0068860_101161887 3300005843 Bacteria 792
242 Ga0068860_101476061 3300005843 Unclassified 701
243 Ga0068862_100100200 3300005844 Bacteria 2533
244 Ga0068862_100473082 3300005844 Unclassified 1185
245 Ga0068862_100558887 3300005844 Bacteria 1094
246 Ga0068862_101025408 3300005844 Unclassified 817
247 Ga0068862_101670725 3300005844 Unclassified 645
248 Ga0068862_101858852 3300005844 Bacteria 612
249 Ga0081455_10442717 3300005937 Bacteria 890
250 Ga0081539_10000373 3300005985 Bacteria 98166
251 Ga0081539_10012107 3300005985 Bacteria 6702
252 Ga0081539_10275247 3300005985 Unclassified 735
253 Ga0070717_10183861 3300006028 Bacteria 1823
254 Ga0070717_10852036 3300006028 Unclassified 829
255 Ga0075364_10025553 3300006051 Bacteria 3759
256 Ga0075432_10055509 3300006058 Bacteria 1403
257 Ga0075367_10022741 3300006178 Bacteria 3519
258 Ga0075366_10005206 3300006195 Bacteria 7039
259 Ga0075366_10019149 3300006195 Bacteria 3956
260 Ga0075366_10307490 3300006195 Bacteria 970
261 Ga0075366_10422928 3300006195 Unclassified 821
262 Ga0097621_100016237 3300006237 Bacteria 5623
263 Ga0097621_100122561 3300006237 Bacteria 2207
264 Ga0097621_100335340 3300006237 Unclassified 1342
265 Ga0097621_100341755 3300006237 Bacteria 1329
266 Ga0097621_100418122 3300006237 Bacteria 1203
267 Ga0097621_100555575 3300006237 Unclassified 1045
268 Ga0068871_100006820 3300006358 Bacteria 8122
269 Ga0068871_100286163 3300006358 Unclassified 1443
270 Ga0068871_100353974 3300006358 Bacteria 1299
271 Ga0068871_100396142 3300006358 Unclassified 1229
272 Ga0068871_100614951 3300006358 Bacteria 989
273 Ga0068871_101990784 3300006358 Unclassified 553
274 Ga0075428_100003772 3300006844 Bacteria 16610
275 Ga0075428_100018149 3300006844 Bacteria 7773
276 Ga0075428_100023802 3300006844 Bacteria 6776
277 Ga0075428_100061804 3300006844 Bacteria 4102
278 Ga0075428_100136989 3300006844 Bacteria 2662
279 Ga0075428_100237481 3300006844 Bacteria 1967
280 Ga0075428_100423997 3300006844 Unclassified 1425
281 Ga0075428_100983754 3300006844 Unclassified 893
282 Ga0075428_101167974 3300006844 Unclassified 812
283 Ga0075428_101173727 3300006844 Unclassified 810
284 Ga0075428_101682443 3300006844 Unclassified 662
285 Ga0075428_101845120 3300006844 Unclassified 629
286 Ga0075430_100004525 3300006846 Bacteria 11713
287 Ga0075430_100008082 3300006846 Bacteria 8891
288 Ga0075430_100027065 3300006846 Bacteria 4875
289 Ga0075430_100095023 3300006846 Bacteria 2492
290 Ga0075430_100166064 3300006846 Bacteria 1837
291 Ga0075430_100205465 3300006846 Bacteria 1635
292 Ga0075430_100394728 3300006846 Unclassified 1142
293 Ga0075430_100470146 3300006846 Unclassified 1038
294 Ga0075430_100639788 3300006846 Unclassified 877
295 Ga0075430_100786340 3300006846 Unclassified 784
296 Ga0075431_100004199 3300006847 Bacteria 14103
297 Ga0075431_100007630 3300006847 Bacteria 10774
298 Ga0075431_100010675 3300006847 Bacteria 9229
299 Ga0075431_100043199 3300006847 Bacteria 4652
300 Ga0075431_100048410 3300006847 Bacteria 4385
301 Ga0075431_100175110 3300006847 Bacteria 2204
302 Ga0075431_100244677 3300006847 Bacteria 1823
303 Ga0075431_100259770 3300006847 Unclassified 1762
304 Ga0075431_100448158 3300006847 Unclassified 1287
305 Ga0075431_101070385 3300006847 Bacteria 772
306 Ga0075433_10005921 3300006852 Bacteria 9625
307 Ga0075433_10006561 3300006852 Bacteria 9209
308 Ga0075433_10009448 3300006852 Bacteria 7793
309 Ga0075433_10070452 3300006852 Unclassified 3073
310 Ga0075433_10086120 3300006852 Unclassified 2774
311 Ga0075433_10678812 3300006852 Bacteria 903
312 Ga0075434_100035361 3300006871 Unclassified 4939
313 Ga0075434_100162690 3300006871 Unclassified 2251
314 Ga0075434_100204571 3300006871 Bacteria 1994
315 Ga0075434_100267535 3300006871 Bacteria 1729
316 Ga0075434_100426244 3300006871 Unclassified 1348
317 Ga0075434_100590498 3300006871 Bacteria 1130
318 Ga0075434_100758298 3300006871 Unclassified 987
319 Ga0075434_100955802 3300006871 Unclassified 871
320 Ga0075429_100047548 3300006880 Bacteria 3732
321 Ga0075429_100082606 3300006880 Bacteria 2800
322 Ga0075429_100092227 3300006880 Bacteria 2642
323 Ga0075429_100135335 3300006880 Bacteria 2157
324 Ga0075429_100202564 3300006880 Bacteria 1739
325 Ga0075429_100220726 3300006880 Bacteria 1660
326 Ga0075429_100410163 3300006880 Bacteria 1186
327 Ga0075429_100503225 3300006880 Bacteria 1062
328 Ga0075429_100655450 3300006880 Unclassified 920
329 Ga0075429_101742845 3300006880 Bacteria 541
330 Ga0068865_100085562 3300006881 Bacteria 2275
331 Ga0068865_100105913 3300006881 Bacteria 2066
332 Ga0068865_100164232 3300006881 Bacteria 1696
333 Ga0068865_100186656 3300006881 Unclassified 1600
334 Ga0068865_100292931 3300006881 Bacteria 1300
335 Ga0068865_100991779 3300006881 Bacteria 735
336 Ga0097620_100050824 3300006931 Bacteria 4165
337 Ga0097620_100118195 3300006931 Bacteria 2717
338 Ga0097620_100267625 3300006931 Unclassified 1801
339 Ga0097620_101030386 3300006931 Unclassified 904
340 Ga0097620_101359684 3300006931 Unclassified 783
341 Ga0075435_100004217 3300007076 Bacteria 9869
342 Ga0075435_100539076 3300007076 Unclassified 1010
343 Ga0075435_101002959 3300007076 Unclassified 729
344 Ga0075435_101277209 3300007076 Unclassified 643
345 Ga0099794_10114123 3300007265 Bacteria 1355
346 Ga0105251_10116116 3300009011 Bacteria 1217
347 Ga0105240_10716159 3300009093 Unclassified 1091
348 Ga0111539_10006468 3300009094 Bacteria 15090
349 Ga0111539_10011219 3300009094 Bacteria 11259
350 Ga0111539_10025433 3300009094 Bacteria 7258
351 Ga0111539_10096760 3300009094 Bacteria 3468
352 Ga0111539_10323096 3300009094 Bacteria 1796
353 Ga0111539_10467455 3300009094 Bacteria 1469
354 Ga0111539_10787569 3300009094 Bacteria 1107
355 Ga0111539_10824482 3300009094 Bacteria 1079
356 Ga0111539_11097025 3300009094 Bacteria 925
357 Ga0111539_11192333 3300009094 Bacteria 884
358 Ga0111539_11220470 3300009094 Bacteria 873
359 Ga0111539_11430552 3300009094 Bacteria 802
360 Ga0111539_12091466 3300009094 Unclassified 657
361 Ga0105245_10277065 3300009098 Bacteria 1638
362 Ga0105245_10560426 3300009098 Unclassified 1165
363 Ga0105245_10574698 3300009098 Bacteria 1151
364 Ga0105247_10084508 3300009101 Bacteria 2005
365 Ga0105247_10132900 3300009101 Bacteria 1623
366 Ga0105247_11220210 3300009101 Bacteria 600
367 Ga0105247_11235573 3300009101 Unclassified 597
368 Ga0105247_11742715 3300009101 Unclassified 516
369 Ga0114129_10002152 3300009147 Bacteria 27153
370 Ga0114129_10036840 3300009147 Bacteria 6907
371 Ga0114129_10082182 3300009147 Bacteria 4477
372 Ga0114129_10103190 3300009147 Bacteria 3943
373 Ga0114129_10474553 3300009147 Bacteria 1638
374 Ga0114129_11297051 3300009147 Bacteria 903
375 Ga0114129_11392441 3300009147 Bacteria 866
376 Ga0114129_11780899 3300009147 Bacteria 749
377 Ga0105243_10014810 3300009148 Bacteria 5901
378 Ga0105243_10742001 3300009148 Unclassified 962
379 Ga0105241_10841317 3300009174 Bacteria 848
380 Ga0105242_10240343 3300009176 Bacteria 1628
381 Ga0105242_10366056 3300009176 Bacteria 1336
382 Ga0105242_10466721 3300009176 Bacteria 1193
383 Ga0105242_10503086 3300009176 Bacteria 1153
384 Ga0105242_11648276 3300009176 Unclassified 676
385 Ga0105248_10017198 3300009177 Bacteria 7966
386 Ga0105248_10057320 3300009177 Bacteria 4372
387 Ga0105248_10113257 3300009177 Bacteria 3059
388 Ga0105248_10210006 3300009177 Bacteria 2193
389 Ga0105248_10309660 3300009177 Unclassified 1778
390 Ga0105248_10480910 3300009177 Unclassified 1400
391 Ga0105248_11274640 3300009177 Unclassified 831
392 Ga0105237_10596056 3300009545 Unclassified 1112
393 Ga0105237_10829171 3300009545 Bacteria 932
394 Ga0105238_10009458 3300009551 Bacteria 9755
395 Ga0105238_10105108 3300009551 Bacteria 2805
396 Ga0105238_10522351 3300009551 Bacteria 1190
397 Ga0105238_10576358 3300009551 Bacteria 1131
398 Ga0105249_10174294 3300009553 Unclassified 2088
399 Ga0105249_10774581 3300009553 Bacteria 1022
400 Ga0105249_12121964 3300009553 Bacteria 635
401 Ga0105239_10533769 3300010375 Unclassified 1335
402 Ga0105246_10063095 3300011119 Unclassified 2583
403 Ga0105246_10074764 3300011119 Bacteria 2396
404 Ga0105246_10110037 3300011119 Bacteria 2022
405 Ga0105246_10156753 3300011119 Bacteria 1730
406 Ga0105246_10859209 3300011119 Unclassified 810
407 Ga0157371_10265363 3300013102 Bacteria 1238
408 Ga0157374_10017724 3300013296 Bacteria 6276
409 Ga0157374_10383021 3300013296 Unclassified 1401
410 Ga0157374_10404929 3300013296 Unclassified 1361
411 Ga0157374_10452360 3300013296 Bacteria 1286
412 Ga0157378_10052780 3300013297 Unclassified 3617
413 Ga0157378_10717744 3300013297 Unclassified 1020
414 Ga0157378_10751888 3300013297 Unclassified 998
415 Ga0157378_11267357 3300013297 Unclassified 778
416 Ga0163162_10055440 3300013306 Bacteria 3990
417 Ga0163162_10128512 3300013306 Unclassified 2642
418 Ga0163162_10258836 3300013306 Bacteria 1872
419 Ga0163162_10520109 3300013306 Unclassified 1319
420 Ga0163162_10642089 3300013306 Bacteria 1185
421 Ga0163162_10657904 3300013306 Bacteria 1171
422 Ga0163162_11251782 3300013306 Bacteria 843
423 Ga0163162_12996603 3300013306 Unclassified 543
424 Ga0157375_10020113 3300013308 Bacteria 6092
425 Ga0157375_10037405 3300013308 Bacteria 4650
426 Ga0157375_10347845 3300013308 Bacteria 1648
427 Ga0157375_10388092 3300013308 Unclassified 1563
428 Ga0157375_11491102 3300013308 Unclassified 798
429 Ga0163163_10014203 3300014325 Bacteria 7315
430 Ga0163163_10024554 3300014325 Bacteria 5737
431 Ga0163163_10030190 3300014325 Bacteria 5220
432 Ga0163163_10033208 3300014325 Unclassified 4990
433 Ga0163163_10039601 3300014325 Bacteria 4600
434 Ga0163163_10104247 3300014325 Bacteria 2861
435 Ga0163163_10106901 3300014325 Bacteria 2824
436 Ga0163163_10402054 3300014325 Bacteria 1428
437 Ga0163163_10416607 3300014325 Unclassified 1402
438 Ga0163163_10688556 3300014325 Bacteria 1086
439 Ga0157380_10110936 3300014326 Bacteria 2305
440 Ga0157380_10167865 3300014326 Unclassified 1914
441 Ga0157380_10179041 3300014326 Unclassified 1861
442 Ga0157380_10225385 3300014326 Bacteria 1680
443 Ga0157380_10278166 3300014326 Unclassified 1530
444 Ga0157380_10305985 3300014326 Unclassified 1466
445 Ga0157380_10414136 3300014326 Bacteria 1283
446 Ga0157380_10486193 3300014326 Bacteria 1195
447 Ga0157380_10938668 3300014326 Unclassified 894
448 Ga0157380_11316618 3300014326 Bacteria 770
449 Ga0157380_12234933 3300014326 Bacteria 611
450 Ga0157380_12447746 3300014326 Unclassified 587
451 Ga0157377_10035737 3300014745 Bacteria 2728
452 Ga0157377_10122572 3300014745 Bacteria 1577
453 Ga0157377_10201621 3300014745 Bacteria 1263
454 Ga0157377_10410726 3300014745 Bacteria 924
455 Ga0157377_10575087 3300014745 Bacteria 800
456 Ga0157377_10642068 3300014745 Unclassified 763
457 Ga0157379_10011606 3300014968 Bacteria 7694
458 Ga0157379_10027784 3300014968 Bacteria 5036
459 Ga0157379_10689811 3300014968 Bacteria 958
460 Ga0157376_10056177 3300014969 Unclassified 3288
461 Ga0157376_10258067 3300014969 Bacteria 1631
462 Ga0157376_10558313 3300014969 Bacteria 1134
463 Ga0157376_11826769 3300014969 Unclassified 644
464 Ga0163161_10219378 3300017792 Bacteria 1472
465 Ga0163161_10454701 3300017792 Bacteria 1036
466 Ga0163161_11059384 3300017792 Unclassified 695
467 Ga0163161_12042594 3300017792 Unclassified 510
468 Ga0206356_10622013 3300020070 Unclassified 539
469 Ga0206351_10091398 3300020077 Unclassified 529
470 Ga0206351_10099706 3300020077 Unclassified 653
471 Ga0206351_10376092 3300020077 Unclassified 712
472 Ga0206351_10571302 3300020077 Bacteria 561
473 Ga0206350_10478025 3300020080 Unclassified 563
474 Ga0206350_10550396 3300020080 Unclassified 647
475 Ga0154015_1114267 3300020610 Unclassified 568
476 Ga0154015_1661591 3300020610 Unclassified 541
477 Ga0224712_10389838 3300022467 Unclassified 663
478 Ga0224712_10634373 3300022467 Bacteria 523
479 Ga0207697_10074635 3300025315 Bacteria 1424
480 Ga0207656_10044598 3300025321 Bacteria 1894
481 Ga0207656_10251409 3300025321 Unclassified 866
482 Ga0207653_10072804 3300025885 Unclassified 1177
483 Ga0207682_10094111 3300025893 Bacteria 1303
484 Ga0207688_10041356 3300025901 Bacteria 2564
485 Ga0207680_10083394 3300025903 Unclassified 2014
486 Ga0207680_10172123 3300025903 Unclassified 1459
487 Ga0207680_10379673 3300025903 Unclassified 996
488 Ga0207680_10543153 3300025903 Bacteria 829
489 Ga0207645_10054847 3300025907 Unclassified 2546
490 Ga0207645_10100422 3300025907 Bacteria 1866
491 Ga0207645_10258672 3300025907 Bacteria 1153
492 Ga0207645_10378687 3300025907 Unclassified 950
493 Ga0207645_10713891 3300025907 Bacteria 681
494 Ga0207643_10045143 3300025908 Bacteria 2488
495 Ga0207643_10055704 3300025908 Unclassified 2249
496 Ga0207643_10075529 3300025908 Bacteria 1945
497 Ga0207643_10140425 3300025908 Bacteria 1443
498 Ga0207684_11237684 3300025910 Unclassified 617
499 Ga0207695_10520460 3300025913 Unclassified 1071
500 Ga0207671_10901936 3300025914 Bacteria 699
501 Ga0207660_10730926 3300025917 Bacteria 808
502 Ga0207660_11341276 3300025917 Bacteria 580
503 Ga0207662_10072663 3300025918 Unclassified 2085
504 Ga0207657_10331857 3300025919 Bacteria 1201
505 Ga0207649_10020122 3300025920 Unclassified 3822
506 Ga0207649_10211480 3300025920 Bacteria 1376
507 Ga0207649_10627274 3300025920 Bacteria 829
508 Ga0207649_11106595 3300025920 Unclassified 625
509 Ga0207652_10105781 3300025921 Bacteria 2490
510 Ga0207646_10897957 3300025922 Unclassified 786
511 Ga0207681_10031248 3300025923 Bacteria 3477
512 Ga0207681_10045108 3300025923 Unclassified 2958
513 Ga0207681_10075506 3300025923 Bacteria 2364
514 Ga0207681_10169138 3300025923 Unclassified 1655
515 Ga0207694_10043001 3300025924 Unclassified 3486
516 Ga0207694_10950056 3300025924 Unclassified 727
517 Ga0207650_10043082 3300025925 Bacteria 3312
518 Ga0207650_10102463 3300025925 Unclassified 2206
519 Ga0207650_10563592 3300025925 Bacteria 956
520 Ga0207650_10916776 3300025925 Unclassified 744
521 Ga0207650_11035486 3300025925 Unclassified 698
522 Ga0207659_10003157 3300025926 Bacteria 9850
523 Ga0207659_10011789 3300025926 Bacteria 5533
524 Ga0207659_10043022 3300025926 Unclassified 3170
525 Ga0207659_10072400 3300025926 Bacteria 2519
526 Ga0207659_10096640 3300025926 Bacteria 2217
527 Ga0207659_10167047 3300025926 Bacteria 1733
528 Ga0207659_10524784 3300025926 Bacteria 1004
529 Ga0207659_10833111 3300025926 Unclassified 793
530 Ga0207659_10900956 3300025926 Unclassified 760
531 Ga0207644_10025276 3300025931 Bacteria 4083
532 Ga0207644_10273040 3300025931 Bacteria 1355
533 Ga0207644_11123382 3300025931 Bacteria 660
534 Ga0207706_10045530 3300025933 Unclassified 3887
535 Ga0207706_10050405 3300025933 Bacteria 3679
536 Ga0207706_10101606 3300025933 Bacteria 2530
537 Ga0207706_10574479 3300025933 Bacteria 969
538 Ga0207706_10695925 3300025933 Unclassified 869
539 Ga0207706_10921367 3300025933 Unclassified 737
540 Ga0207706_11040634 3300025933 Unclassified 686
541 Ga0207709_10013577 3300025935 Bacteria 4493
542 Ga0207709_10361651 3300025935 Bacteria 1099
543 Ga0207709_11702401 3300025935 Unclassified 524
544 Ga0207670_10043036 3300025936 Unclassified 2980
545 Ga0207670_10200848 3300025936 Bacteria 1515
546 Ga0207669_10189103 3300025937 Unclassified 1483
547 Ga0207669_10392168 3300025937 Bacteria 1085
548 Ga0207669_11145021 3300025937 Unclassified 658
549 Ga0207704_10082305 3300025938 Unclassified 2085
550 Ga0207704_10572995 3300025938 Bacteria 920
551 Ga0207704_10793373 3300025938 Unclassified 790
552 Ga0207691_10007003 3300025940 Bacteria 10879
553 Ga0207691_10051092 3300025940 Unclassified 3781
554 Ga0207691_10109740 3300025940 Bacteria 2455
555 Ga0207691_10236765 3300025940 Bacteria 1579
556 Ga0207691_10417442 3300025940 Bacteria 1144
557 Ga0207691_11105754 3300025940 Unclassified 659
558 Ga0207691_11116148 3300025940 Unclassified 656
559 Ga0207711_10136923 3300025941 Unclassified 2200
560 Ga0207711_10607083 3300025941 Unclassified 1021
561 Ga0207711_11040260 3300025941 Unclassified 759
562 Ga0207689_10147198 3300025942 Bacteria 1940
563 Ga0207689_10227784 3300025942 Bacteria 1540
564 Ga0207689_10266747 3300025942 Unclassified 1417
565 Ga0207689_10284378 3300025942 Bacteria 1369
566 Ga0207689_10310173 3300025942 Bacteria 1308
567 Ga0207661_10334004 3300025944 Bacteria 1365
568 Ga0207661_10514180 3300025944 Bacteria 1095
569 Ga0207679_10011150 3300025945 Bacteria 5806
570 Ga0207679_10112886 3300025945 Unclassified 2149
571 Ga0207679_10840131 3300025945 Bacteria 838
572 Ga0207679_10855244 3300025945 Bacteria 831
573 Ga0207667_10852383 3300025949 Unclassified 905
574 Ga0207651_10002425 3300025960 Bacteria 8911
575 Ga0207651_10032440 3300025960 Bacteria 3355
576 Ga0207651_10049698 3300025960 Unclassified 2842
577 Ga0207651_10680617 3300025960 Unclassified 905
578 Ga0207651_10956145 3300025960 Bacteria 764
579 Ga0207712_11519041 3300025961 Unclassified 600
580 Ga0207668_10354311 3300025972 Bacteria 1228
581 Ga0207640_10039626 3300025981 Unclassified 2983
582 Ga0207640_11593120 3300025981 Unclassified 588
583 Ga0207640_11631856 3300025981 Unclassified 581
584 Ga0207658_10049293 3300025986 Unclassified 3094
585 Ga0207658_10076350 3300025986 Unclassified 2552
586 Ga0207658_11101514 3300025986 Bacteria 725
587 Ga0207658_11377097 3300025986 Bacteria 645
588 Ga0207677_10208961 3300026023 Unclassified 1557
589 Ga0207677_10242737 3300026023 Unclassified 1458
590 Ga0207677_10754555 3300026023 Unclassified 868
591 Ga0207703_10016127 3300026035 Bacteria 5825
592 Ga0207703_10041728 3300026035 Unclassified 3678
593 Ga0207703_10232400 3300026035 Unclassified 1654
594 Ga0207703_11767321 3300026035 Unclassified 594
595 Ga0207678_10155829 3300026067 Bacteria 1950
596 Ga0207678_10274752 3300026067 Bacteria 1445
597 Ga0207678_10555857 3300026067 Bacteria 1004
598 Ga0207708_10122381 3300026075 Bacteria 2028
599 Ga0207708_10174955 3300026075 Bacteria 1702
600 Ga0207708_10633851 3300026075 Unclassified 908
601 Ga0207641_10057623 3300026088 Unclassified 3304
602 Ga0207641_10059731 3300026088 Bacteria 3248
603 Ga0207641_10100606 3300026088 Bacteria 2546
604 Ga0207641_10143933 3300026088 Unclassified 2154
605 Ga0207641_10252678 3300026088 Bacteria 1647
606 Ga0207641_11970299 3300026088 Unclassified 585
607 Ga0207648_10006480 3300026089 Bacteria 11628
608 Ga0207648_10669511 3300026089 Unclassified 960
609 Ga0207676_10012910 3300026095 Bacteria 6000
610 Ga0207676_10028481 3300026095 Bacteria 4173
611 Ga0207676_10127726 3300026095 Bacteria 2156
612 Ga0207676_10183144 3300026095 Bacteria 1836
613 Ga0207676_10188600 3300026095 Bacteria 1812
614 Ga0207676_11078636 3300026095 Unclassified 793
615 Ga0207676_11723306 3300026095 Bacteria 625
616 Ga0207676_12036974 3300026095 Unclassified 573
617 Ga0207674_10065647 3300026116 Bacteria 3657
618 Ga0207674_10302660 3300026116 Bacteria 1548
619 Ga0207674_10732506 3300026116 Bacteria 954
620 Ga0207675_100030403 3300026118 Bacteria 5030
621 Ga0207675_100054061 3300026118 Bacteria 3746
622 Ga0207675_100054562 3300026118 Bacteria 3728
623 Ga0207675_100058220 3300026118 Bacteria 3606
624 Ga0207675_100110628 3300026118 Unclassified 2592
625 Ga0207675_100180898 3300026118 Bacteria 2019
626 Ga0207675_100266816 3300026118 Bacteria 1660
627 Ga0207675_101463420 3300026118 Unclassified 704
628 Ga0207683_10008490 3300026121 Bacteria 8791
629 Ga0207683_10019849 3300026121 Bacteria 5742
630 Ga0207683_10024447 3300026121 Bacteria 5204
631 Ga0207683_10028929 3300026121 Bacteria 4795
632 Ga0207683_10633874 3300026121 Bacteria 990
633 Ga0207683_10671336 3300026121 Bacteria 960
634 Ga0207698_10352310 3300026142 Bacteria 1391
635 Ga0207698_10571127 3300026142 Unclassified 1111
636 Ga0207698_10648908 3300026142 Unclassified 1045
637 Ga0207698_12060341 3300026142 Unclassified 584
638 Ga0209968_1081988 3300027526 Unclassified 581
639 Ga0209982_1030302 3300027552 Unclassified 850
640 Ga0210002_1040766 3300027617 Unclassified 788
641 Ga0209971_1030607 3300027682 Bacteria 1289
642 Ga0209998_10060509 3300027717 Unclassified 891
643 Ga0209813_10036928 3300027866 Bacteria 1470
644 Ga0209974_10106519 3300027876 Bacteria 984
645 Ga0207428_10039483 3300027907 Bacteria 3833
646 Ga0207428_10144084 3300027907 Bacteria 1817
647 Ga0268266_10009033 3300028379 Bacteria 8811
648 Ga0268266_10133966 3300028379 Unclassified 2218
649 Ga0268266_10417534 3300028379 Bacteria 1271
650 Ga0268266_10445215 3300028379 Bacteria 1231
651 Ga0268265_10022688 3300028380 Bacteria 4414
652 Ga0268265_10084842 3300028380 Bacteria 2511
653 Ga0268265_10258474 3300028380 Bacteria 1547
654 Ga0268265_10314676 3300028380 Bacteria 1415
655 Ga0268265_10483877 3300028380 Bacteria 1163
656 Ga0268265_10500173 3300028380 Unclassified 1145
657 Ga0268265_11268694 3300028380 Unclassified 736
658 Ga0268265_12100673 3300028380 Unclassified 572
659 Ga0268264_10217550 3300028381 Bacteria 1757
660 Ga0268264_10222626 3300028381 Unclassified 1738
661 Ga0268264_10430485 3300028381 Unclassified 1274
662 Ga0268264_10915227 3300028381 Bacteria 881
663 Ga0268264_11096193 3300028381 Bacteria 804
664 Ga0268264_11351482 3300028381 Unclassified 723
665 Ga0316183_1167839 3300030742 Bacteria 710
666 Ga0307408_100217831 3300031548 Bacteria 1556
667 Ga0307408_100299680 3300031548 Bacteria 1346
668 Ga0307408_100981643 3300031548 Unclassified 777
669 Ga0307405_10348562 3300031731 Bacteria 1141
670 Ga0307413_11218568 3300031824 Unclassified 655
671 Ga0307406_10478962 3300031901 Bacteria 1005
672 Ga0307412_10335218 3300031911 Unclassified 1209
673 Ga0307412_10923601 3300031911 Unclassified 766
674 Ga0307412_11567416 3300031911 Bacteria 601
675 Ga0307412_11907593 3300031911 Unclassified 548
676 Ga0307409_101540649 3300031995 Unclassified 692
677 Ga0307416_100092434 3300032002 Unclassified 2602
678 Ga0307416_101056186 3300032002 Bacteria 916
679 Ga0307416_101640038 3300032002 Unclassified 748
680 Ga0307416_101786948 3300032002 Unclassified 719
681 Ga0307411_10113611 3300032005 Bacteria 1944
682 Ga0307411_10132187 3300032005 Bacteria 1826
683 Ga0307411_10886644 3300032005 Unclassified 792
684 Ga0307411_11056433 3300032005 Unclassified 730
685 Ga0307411_12165377 3300032005 Unclassified 521
686 Ga0307415_100417859 3300032126 Bacteria 1150
687 Ga0307415_100430588 3300032126 Unclassified 1135
688 Ga0307415_101738315 3300032126 Unclassified 602
689 Ga0395900_0216303 3300037418 Bacteria 1933
690 Ga0242420_029970 3300038996 Bacteria 1006
691 Ga0439453_0036693 3300041408 Unclassified 948
692 Ga0439453_0057756 3300041408 Bacteria 797
693 Ga0439453_0113610 3300041408 Unclassified 615
694 Ga0451797_0227462 3300041453 Bacteria 987
695 Ga0451807_0169482 3300041486 Unclassified 1114
696 Ga0451851_1338608 3300041507 Bacteria 845
697 Ga0439431_0076869 3300041997 Bacteria 896
698 Ga0439433_0076928 3300041999 Unclassified 808
699 Ga0439433_0083569 3300041999 Unclassified 779
700 Ga0439437_014207 3300042000 Bacteria 930
701 Ga0439441_018026 3300042001 Unclassified 1274
702 Ga0439441_040607 3300042001 Unclassified 931
703 Ga0439441_083448 3300042001 Unclassified 699
704 Ga0439443_052384 3300042003 Unclassified 717
705 Ga0439448_0323271 3300042005 Unclassified 549
706 Ga0439449_0262458 3300042007 Unclassified 650
707 Ga0439450_012483 3300042008 Unclassified 1687
708 Ga0439450_023553 3300042008 Unclassified 1337
709 Ga0439450_114216 3300042008 Unclassified 692
710 Ga0439455_0086171 3300042012 Bacteria 858
711 Ga0450919_021822 3300042121 Unclassified 723
712 Ga0450920_046900 3300042122 Unclassified 864
713 Ga0450923_131117 3300042125 Unclassified 597
714 Ga0450896_069372 3300042133 Unclassified 582
715 Ga0450898_035364 3300042134 Unclassified 931
716 Ga0450905_055983 3300042142 Bacteria 651
717 Ga0450908_000260 3300042184 Bacteria 10440
718 Ga0439434_0159132 3300042435 Unclassified 750
719 Ga0439434_0231219 3300042435 Unclassified 629
720 Ga0439435_0021005 3300042436 Bacteria 1690
721 Ga0439435_0031260 3300042436 Bacteria 1446
722 Ga0439435_0050731 3300042436 Bacteria 1187
723 Ga0439435_0053168 3300042436 Bacteria 1164
724 Ga0439435_0088958 3300042436 Unclassified 936
725 Ga0439435_0245465 3300042436 Bacteria 602
726 Ga0439444_0013531 3300042437 Unclassified 1352
727 Ga0439444_0018270 3300042437 Unclassified 1212
728 Ga0439444_0126602 3300042437 Unclassified 601
729 Ga0439459_0018211 3300042438 Unclassified 1318
730 Ga0439464_0051481 3300042439 Bacteria 1192
731 Ga0439464_0069486 3300042439 Bacteria 1040
732 Ga0439464_0321341 3300042439 Unclassified 508
733 Ga0439460_0032560 3300042461 Bacteria 1493
734 Ga0439460_0057408 3300042461 Bacteria 1181
735 Ga0439460_0067822 3300042461 Bacteria 1100
736 Ga0439460_0070321 3300042461 Bacteria 1083
737 Ga0439460_0161985 3300042461 Bacteria 750
738 Ga0439460_0172893 3300042461 Unclassified 728
739 Ga0450916_003608 3300042530 Bacteria 1707
740 Ga0450916_012513 3300042530 Bacteria 1084
741 Ga0450893_0019526 3300042532 Bacteria 1160
742 Ga0450893_0035523 3300042532 Unclassified 900
743 Ga0451576_0406991 3300045051 Unclassified 1427
744 Ga0451576_2231087 3300045051 Bacteria 562
745 Ga0495643_0017123 3300046522 Unclassified 4244
746 Ga0496100_0561555 3300048903 Unclassified 884
747 Ga0496101_0577730 3300048904 Unclassified 889
748 Ga0496104_0163743 3300048907 Unclassified 2133
749 Ga0496104_0349604 3300048907 Unclassified 1391
750 Ga0496107_0353713 3300048910 Bacteria 1093
751 Ga0496109_0179350 3300048912 Bacteria 1989
752 Ga0496109_0773964 3300048912 Unclassified 898
753 Ga0496110_0289468 3300048913 Bacteria 1492
754 Ga0496110_0594619 3300048913 Unclassified 1004
755 Ga0496112_0670700 3300048915 Bacteria 966
756 Ga0496113_0995018 3300048916 Unclassified 661
757 Ga0501306_080735 3300049127 Bacteria 561
758 Ga0501297_018376 3300049520 Unclassified 857
759 Ga0501300_036149 3300049523 Bacteria 736
760 Ga0501321_078367 3300049537 Unclassified 524
761 Ga0501033_0825905 3300049570 Unclassified 626
762 Ga0501036_0127222 3300049572 Bacteria 2152
763 Ga0501038_0786213 3300049574 Bacteria 708
764 Ga0501039_1258110 3300049575 Unclassified 571
765 Ga0501040_0150760 3300049576 Bacteria 1640
766 Ga0501040_1052552 3300049576 Unclassified 590
767 Ga0501041_0050131 3300049577 Bacteria 2544
768 Ga0501041_0497676 3300049577 Unclassified 775
769 Ga0501041_0695944 3300049577 Bacteria 650
770 Ga0501042_1006692 3300049578 Unclassified 607
771 Ga0501046_0236083 3300049580 Unclassified 1350
772 Ga0501046_0348761 3300049580 Bacteria 1075
773 Ga0501048_0030488 3300049582 Bacteria 3903
774 Ga0501048_0061629 3300049582 Unclassified 2656
775 Ga0501048_0429898 3300049582 Unclassified 945
776 Ga0501048_0503104 3300049582 Bacteria 869
777 Ga0501068_0512831 3300049584 Unclassified 778
778 Ga0501069_0490820 3300049585 Unclassified 732
779 Ga0501071_0057281 3300049587 Unclassified 2816
780 Ga0501071_1267057 3300049587 Bacteria 570
781 Ga0501072_0024195 3300049588 Unclassified 4723
782 Ga0501072_0770335 3300049588 Unclassified 754
783 Ga0501072_0811959 3300049588 Unclassified 732
784 Ga0501072_1235128 3300049588 Unclassified 580
785 Ga0501074_0676846 3300049590 Unclassified 728
786 Ga0501074_1076309 3300049590 Unclassified 565
787 Ga0501075_0107703 3300049591 Bacteria 2118
788 Ga0501075_0423061 3300049591 Unclassified 1016
789 Ga0501075_0492233 3300049591 Unclassified 935
790 Ga0501075_0631408 3300049591 Bacteria 817
791 Ga0501075_0904590 3300049591 Bacteria 671
792 Ga0501076_0031653 3300049592 Unclassified 4127
793 Ga0501076_0437433 3300049592 Bacteria 1077
794 Ga0501076_0687870 3300049592 Unclassified 844
795 Ga0501206_011775 3300049653 Bacteria 1184
796 Ga0501209_076838 3300049656 Unclassified 958
797 Ga0501225_0188006 3300049705 Unclassified 649
798 Ga0501079_0796062 3300049741 Unclassified 744
799 Ga0501080_1261489 3300049742 Unclassified 634
800 Ga0501081_0069126 3300049743 Bacteria 2460
801 Ga0501273_011913 3300049770 Bacteria 1089
802 Ga0501276_013445 3300049773 Unclassified 717
803 Ga0501044_0969321 3300049823 Unclassified 723
804 Ga0501045_0022691 3300049824 Unclassified 4495
805 Ga0501045_0037370 3300049824 Bacteria 3529
806 Ga0501045_0231872 3300049824 Bacteria 1374
807 nmdc:mga00v17_67307_c1 3300050491 Bacteria 2213
808 nmdc:mga0k408_222766_c1 3300050493 Bacteria 1126
809 nmdc:mga0k408_30033_c1 3300050493 Bacteria 3097
810 nmdc:mga0k408_327789_c1 3300050493 Bacteria 913
811 nmdc:mga0k408_36044_c1 3300050493 Bacteria 2838
812 nmdc:mga07m45_636409_c1 3300050496 Bacteria 615
813 nmdc:mga05p37_13720_c1 3300050507 Bacteria 9711
814 nmdc:mga05p37_14441_c1 3300050507 Bacteria 9480
815 nmdc:mga05p37_1642261_c1 3300050507 Bacteria 630
816 nmdc:mga05p37_226029_c2 3300050507 Unclassified 1719
817 nmdc:mga05p37_24527_c1 3300050507 Bacteria 7331
818 nmdc:mga05p37_285523_c1 3300050507 Bacteria 1966
819 nmdc:mga05p37_320337_c1 3300050507 Bacteria 1835
820 nmdc:mga05p37_498404_c1 3300050507 Bacteria 1398
821 nmdc:mga09592_115844_c1 3300050508 Bacteria 1191
822 nmdc:mga09592_22830_c1 3300050508 Bacteria 5162
823 nmdc:mga09592_275663_c1 3300050508 Bacteria 1459
824 nmdc:mga09592_312317_c1 3300050508 Bacteria 1362
825 nmdc:mga09592_337393_c1 3300050508 Bacteria 1305
826 nmdc:mga09592_435958_c1 3300050508 Bacteria 1131
827 nmdc:mga09592_484104_c1 3300050508 Bacteria 1066
828 nmdc:mga09592_65688_c1 3300050508 Unclassified 3074
829 nmdc:mga0qj67_1094261_c1 3300050509 Unclassified 623
830 nmdc:mga0qj67_149181_c1 3300050509 Bacteria 1897
831 nmdc:mga0qj67_152841_c1 3300050509 Bacteria 1872
832 nmdc:mga0qj67_2057_c1 3300050509 Bacteria 14348
833 nmdc:mga0qj67_359275_c1 3300050509 Bacteria 1177
834 nmdc:mga0qj67_3894_c1 3300050509 Bacteria 10782
835 nmdc:mga0qj67_630338_c1 3300050509 Unclassified 856
836 nmdc:mga06r32_123802_c2 3300050510 Bacteria 1817
837 nmdc:mga06r32_1261798_c1 3300050510 Unclassified 684
838 nmdc:mga06r32_1302927_c1 3300050510 Bacteria 670
839 nmdc:mga06r32_15167_c1 3300050510 Bacteria 6998
840 nmdc:mga06r32_193316_c1 3300050510 Bacteria 2022
841 nmdc:mga06r32_22403_c1 3300050510 Bacteria 5840
842 nmdc:mga06r32_37394_c1 3300050510 Bacteria 4591
843 nmdc:mga06r32_3839_c1 3300050510 Bacteria 13446
844 nmdc:mga06r32_460413_c1 3300050510 Unclassified 1251
845 nmdc:mga08y16_1219568_c1 3300050511 Bacteria 722
846 nmdc:mga08y16_1280765_c1 3300050511 Unclassified 700
847 nmdc:mga08y16_1979_c1 3300050511 Bacteria 20895
848 nmdc:mga08y16_272502_c1 3300050511 Bacteria 1747
849 nmdc:mga08y16_37280_c1 3300050511 Bacteria 5107
850 nmdc:mga08y16_385062_c1 3300050511 Bacteria 1437
851 nmdc:mga08y16_50670_c1 3300050511 Bacteria 4345
852 nmdc:mga08y16_58941_c1 3300050511 Unclassified 4012
853 nmdc:mga08y16_71416_c1 3300050511 Bacteria 3618
854 nmdc:mga08y16_781924_c1 3300050511 Unclassified 949
855 nmdc:mga08y16_916209_c1 3300050511 Unclassified 862
856 nmdc:mga08y16_925308_c1 3300050511 Unclassified 856
857 nmdc:mga08y16_980758_c1 3300050511 Bacteria 826
858 nmdc:mga0n895_219398_c1 3300050512 Bacteria 1931
859 nmdc:mga0n895_341151_c1 3300050512 Bacteria 1517
860 nmdc:mga0n895_45203_c1 3300050512 Bacteria 4296
861 nmdc:mga0n895_505724_c1 3300050512 Bacteria 1217
862 nmdc:mga0n895_525932_c1 3300050512 Bacteria 1190
863 nmdc:mga0n895_59270_c1 3300050512 Bacteria 3777
864 nmdc:mga0n895_904248_c1 3300050512 Unclassified 868
865 nmdc:mga0n895_999058_c1 3300050512 Unclassified 818
866 nmdc:mga0rr50_2072_c1 3300050513 Bacteria 11195
867 nmdc:mga0rr50_306365_c1 3300050513 Unclassified 1330
868 nmdc:mga0rr50_428971_c1 3300050513 Bacteria 1119
869 nmdc:mga0rr50_498635_c1 3300050513 Unclassified 1035
870 nmdc:mga0rr50_551891_c1 3300050513 Bacteria 981
871 nmdc:mga08x19_35407_c1 3300050514 Bacteria 3159
872 nmdc:mga0a205_153448_c1 3300050515 Unclassified 2202
873 nmdc:mga0a205_15978_c1 3300050515 Bacteria 7023
874 nmdc:mga0a205_275736_c1 3300050515 Bacteria 1558
875 nmdc:mga0a205_3460_c1 3300050515 Bacteria 14101
876 nmdc:mga0a205_402958_c1 3300050515 Bacteria 1232
877 nmdc:mga0a205_494179_c1 3300050515 Bacteria 1081
878 nmdc:mga0a205_89971_c1 3300050515 Unclassified 2966
879 Ga0501084_0167234 3300054114 Bacteria 1856
880 Ga0501084_0437658 3300054114 Bacteria 1105
881 Ga0501084_0765068 3300054114 Unclassified 814
882 Ga0501084_0853221 3300054114 Bacteria 766
883 Ga0501084_0858113 3300054114 Bacteria 764
884 Ga0590071_019105 3300059421 Bacteria 1613
885 Ga0587070_173155 3300059491 Unclassified 557
886 Ga0501082_0051829 3300060353 Bacteria 3537
887 Ga0501082_0885813 3300060353 Bacteria 781
888 Ga0501082_1637701 3300060353 Unclassified 562
889 nmdc:mga0a205_634821_c1
890 Ga0006778J45830_1017703
891 JGI25406J46586_10012253
892 Ga0007416J51690_1013940
893 Ga0007429J51699_1016628
894 Ga0007429J51699_1043548
895 Ga0007429J51699_1053477
896 Ga0032354_1016397
897 Ga0058859_10006525
898 Ga0058861_11765244
899 Ga0065714_10422736
900 Ga0065712_10146184
901 Ga0065712_10267195
902 Ga0065712_10350535
903 Ga0065712_10368791
904 Ga0065712_10661407
905 Ga0065715_10302055
906 Ga0065715_10370492
907 Ga0065715_10516618
908 Ga0065715_10648943
909 Ga0065707_10316627
910 Ga0065707_10879651
911 Ga0070676_10002230
912 Ga0070676_10185599
913 Ga0070676_10433300
914 Ga0070676_10725690
915 Ga0070683_100315717
916 Ga0070683_101171693
917 Ga0070690_100263343
918 Ga0070690_100739923
919 Ga0070690_100753108
920 Ga0070690_100914636
921 Ga0070670_100009882
922 Ga0070670_100012366
923 Ga0070670_100023240
924 Ga0070670_100091171
925 Ga0070670_100491221
926 Ga0070670_100884259
927 Ga0070670_101079780
928 Ga0070677_10048819
929 Ga0070677_10299453
930 Ga0070677_10496221
931 Ga0068869_100011193
932 Ga0068869_100063924
933 Ga0068869_100273834
934 Ga0068869_100484612
935 Ga0068869_100517190
936 Ga0068869_101579248
937 Ga0070666_10022525
938 Ga0070666_10094237
939 Ga0070666_11018169
940 Ga0070680_100987300
941 Ga0070680_101009344
942 Ga0070682_101058830
943 Ga0070682_101269624
944 Ga0068868_100160056
945 Ga0068868_100987382
946 Ga0068868_101059264
947 Ga0070660_100260851
948 Ga0070660_100456362
949 Ga0070689_100067434
950 Ga0070689_100067598
951 Ga0070689_100615129
952 Ga0070689_101075629
953 Ga0070691_10030808
954 Ga0070691_10345639
955 Ga0070661_100055148
956 Ga0070661_101241395
957 Ga0070692_10223775
958 Ga0070692_10985122
959 Ga0070668_100148290
960 Ga0070668_100866632
961 Ga0070668_101170132
962 Ga0070668_101520367
963 Ga0070669_100028494
964 Ga0070669_100029852
965 Ga0070669_100056607
966 Ga0070669_100058378
967 Ga0070669_100088861
968 Ga0070669_100342584
969 Ga0070669_100589870
970 Ga0070675_100001785
971 Ga0070675_100014267
972 Ga0070675_100026835
973 Ga0070675_100039503
974 Ga0070675_100047911
975 Ga0070675_100110904
976 Ga0070675_100412060
977 Ga0070675_100807166
978 Ga0070675_101770312
979 Ga0070671_100012557
980 Ga0070671_100035910
981 Ga0070671_100112371
982 Ga0070671_100188442
983 Ga0070674_100036007
984 Ga0070674_100419662
985 Ga0070674_100759167
986 Ga0070674_101214121
987 Ga0070673_100002679
988 Ga0070673_100052502
989 Ga0070673_100112963
990 Ga0070673_100577257
991 Ga0070673_100644427
992 Ga0070673_100711790
993 Ga0070688_100001312
994 Ga0070688_100135250
995 Ga0070659_100483797
996 Ga0070659_100686973
997 Ga0070659_101056574
998 Ga0070667_100038303
999 Ga0070667_100097379
1000 Ga0070667_100345697
1001 Ga0070667_100966572
1002 Ga0070667_101025663
1003 Ga0070667_102086292
1004 Ga0070709_10019831
1005 Ga0070713_100183430
1006 Ga0070701_10192974
1007 Ga0070705_100001307
1008 Ga0070705_100025543
1009 Ga0070700_100112297
1010 Ga0070700_100496881
1011 Ga0070700_100576181
1012 Ga0070694_100000796
1013 Ga0070694_100361273
1014 Ga0070694_100545218
1015 Ga0070663_100023564
1016 Ga0070663_100026133
1017 Ga0070663_101082909
1018 Ga0070663_101102013
1019 Ga0070678_100012427
1020 Ga0070678_100038026
1021 Ga0070678_100293305
1022 Ga0070678_100748776
1023 Ga0070678_100878018
1024 Ga0070678_100995615
1025 Ga0070678_101510741
1026 Ga0070662_100171688
1027 Ga0070662_100251047
1028 Ga0070662_100270582
1029 Ga0070662_100372051
1030 Ga0070662_100391961
1031 Ga0070662_100396252
1032 Ga0070662_100947277
1033 Ga0070662_101015978
1034 Ga0070681_10893212
1035 Ga0068867_101505077
1036 Ga0070685_10074408
1037 Ga0070685_10162327
1038 Ga0070685_10201188
1039 Ga0070685_10403930
1040 Ga0070707_101118271
1041 Ga0070698_101332699
1042 Ga0070679_100450896
1043 Ga0070697_100026290
1044 Ga0070697_100449902
1045 Ga0070697_101268774
1046 Ga0068853_100145427
1047 Ga0068853_101110248
1048 Ga0070672_100074927
1049 Ga0070672_100158357
1050 Ga0070672_100343750
1051 Ga0070672_100660468
1052 Ga0070672_100737453
1053 Ga0070672_100909117
1054 Ga0070686_100010720
1055 Ga0070686_100516964
1056 Ga0070686_100860696
1057 Ga0070695_100000075
1058 Ga0070695_100438082
1059 Ga0070696_100000235
1060 Ga0070696_100008939
1061 Ga0070696_100814420
1062 Ga0070693_100489305
1063 Ga0070693_100974340
1064 Ga0070665_100038027
1065 Ga0070665_100186367
1066 Ga0070665_100403772
1067 Ga0070665_100575391
1068 Ga0070665_102580761
1069 Ga0070704_100023420
1070 Ga0070704_100024599
1071 Ga0070704_100163501
1072 Ga0070704_100832628
1073 Ga0068855_100310175
1074 Ga0068855_101190182
1075 Ga0070664_100064272
1076 Ga0070664_100086397
1077 Ga0070664_100351994
1078 Ga0068857_100415463
1079 Ga0068857_100491332
1080 Ga0068857_101195157
1081 Ga0068854_100027796
1082 Ga0068854_100077075
1083 Ga0068854_100180256
1084 Ga0068854_100576735
1085 Ga0068856_100438146
1086 Ga0070702_100047167
1087 Ga0068852_100678311
1088 Ga0068859_100050824
1089 Ga0068859_100118202
1090 Ga0068859_100267643
1091 Ga0068859_101030466
1092 Ga0068859_101359248
1093 Ga0068864_100082069
1094 Ga0068864_100307331
1095 Ga0068864_100634982
1096 Ga0068864_100918977
1097 Ga0068866_10316876
1098 Ga0068861_100025217
1099 Ga0068861_100039832
1100 Ga0068861_100093567
1101 Ga0068861_100261556
1102 Ga0068861_100390962
1103 Ga0068861_100420343
1104 Ga0068861_100704850
1105 Ga0068861_101026502
1106 Ga0068851_10059726
1107 Ga0068870_10036909
1108 Ga0068870_10062629
1109 Ga0068870_10101259
1110 Ga0068870_10131861
1111 Ga0068870_10172994
1112 Ga0068870_10277672
1113 Ga0068870_10425335
1114 Ga0068863_100003789
1115 Ga0068863_100034414
1116 Ga0068863_100053630
1117 Ga0068863_100217070
1118 Ga0068863_100794406
1119 Ga0068863_101244518
1120 Ga0068858_100104511
1121 Ga0068858_100127026
1122 Ga0068858_100142201
1123 Ga0068860_100327515
1124 Ga0068860_100355672
1125 Ga0068860_100805267
1126 Ga0068860_100978072
1127 Ga0068860_100995491
1128 Ga0068860_101011732
1129 Ga0068860_101161887
1130 Ga0068860_101476061
1131 Ga0068862_100100200
1132 Ga0068862_100473082
1133 Ga0068862_100558887
1134 Ga0068862_101025408
1135 Ga0068862_101670725
1136 Ga0068862_101858852
1137 Ga0081455_10442717
1138 Ga0081539_10000373
1139 Ga0081539_10012107
1140 Ga0081539_10275247
1141 Ga0070717_10183861
1142 Ga0070717_10852036
1143 Ga0075364_10025553
1144 Ga0075432_10055509
1145 Ga0075367_10022741
1146 Ga0075366_10005206
1147 Ga0075366_10019149
1148 Ga0075366_10307490
1149 Ga0075366_10422928
1150 Ga0097621_100016237
1151 Ga0097621_100122561
1152 Ga0097621_100335340
1153 Ga0097621_100341755
1154 Ga0097621_100418122
1155 Ga0097621_100555575
1156 Ga0068871_100006820
1157 Ga0068871_100286163
1158 Ga0068871_100353974
1159 Ga0068871_100396142
1160 Ga0068871_100614951
1161 Ga0068871_101990784
1162 Ga0075428_100003772
1163 Ga0075428_100018149
1164 Ga0075428_100023802
1165 Ga0075428_100061804
1166 Ga0075428_100136989
1167 Ga0075428_100237481
1168 Ga0075428_100423997
1169 Ga0075428_100983754
1170 Ga0075428_101167974
1171 Ga0075428_101173727
1172 Ga0075428_101682443
1173 Ga0075428_101845120
1174 Ga0075430_100004525
1175 Ga0075430_100008082
1176 Ga0075430_100027065
1177 Ga0075430_100095023
1178 Ga0075430_100166064
1179 Ga0075430_100205465
1180 Ga0075430_100394728
1181 Ga0075430_100470146
1182 Ga0075430_100639788
1183 Ga0075430_100786340
1184 Ga0075431_100004199
1185 Ga0075431_100007630
1186 Ga0075431_100010675
1187 Ga0075431_100043199
1188 Ga0075431_100048410
1189 Ga0075431_100175110
1190 Ga0075431_100244677
1191 Ga0075431_100259770
1192 Ga0075431_100448158
1193 Ga0075431_101070385
1194 Ga0075433_10005921
1195 Ga0075433_10006561
1196 Ga0075433_10009448
1197 Ga0075433_10070452
1198 Ga0075433_10086120
1199 Ga0075433_10678812
1200 Ga0075434_100035361
1201 Ga0075434_100162690
1202 Ga0075434_100204571
1203 Ga0075434_100267535
1204 Ga0075434_100426244
1205 Ga0075434_100590498
1206 Ga0075434_100758298
1207 Ga0075434_100955802
1208 Ga0075429_100047548
1209 Ga0075429_100082606
1210 Ga0075429_100092227
1211 Ga0075429_100135335
1212 Ga0075429_100202564
1213 Ga0075429_100220726
1214 Ga0075429_100410163
1215 Ga0075429_100503225
1216 Ga0075429_100655450
1217 Ga0075429_101742845
1218 Ga0068865_100085562
1219 Ga0068865_100105913
1220 Ga0068865_100164232
1221 Ga0068865_100186656
1222 Ga0068865_100292931
1223 Ga0068865_100991779
1224 Ga0097620_100050824
1225 Ga0097620_100118195
1226 Ga0097620_100267625
1227 Ga0097620_101030386
1228 Ga0097620_101359684
1229 Ga0075435_100004217
1230 Ga0075435_100539076
1231 Ga0075435_101002959
1232 Ga0075435_101277209
1233 Ga0099794_10114123
1234 Ga0105251_10116116
1235 Ga0105240_10716159
1236 Ga0111539_10006468
1237 Ga0111539_10011219
1238 Ga0111539_10025433
1239 Ga0111539_10096760
1240 Ga0111539_10323096
1241 Ga0111539_10467455
1242 Ga0111539_10787569
1243 Ga0111539_10824482
1244 Ga0111539_11097025
1245 Ga0111539_11192333
1246 Ga0111539_11220470
1247 Ga0111539_11430552
1248 Ga0111539_12091466
1249 Ga0105245_10277065
1250 Ga0105245_10560426
1251 Ga0105245_10574698
1252 Ga0105247_10084508
1253 Ga0105247_10132900
1254 Ga0105247_11220210
1255 Ga0105247_11235573
1256 Ga0105247_11742715
1257 Ga0114129_10002152
1258 Ga0114129_10036840
1259 Ga0114129_10082182
1260 Ga0114129_10103190
1261 Ga0114129_10474553
1262 Ga0114129_11297051
1263 Ga0114129_11392441
1264 Ga0114129_11780899
1265 Ga0105243_10014810
1266 Ga0105243_10742001
1267 Ga0105241_10841317
1268 Ga0105242_10240343
1269 Ga0105242_10366056
1270 Ga0105242_10466721
1271 Ga0105242_10503086
1272 Ga0105242_11648276
1273 Ga0105248_10017198
1274 Ga0105248_10057320
1275 Ga0105248_10113257
1276 Ga0105248_10210006
1277 Ga0105248_10309660
1278 Ga0105248_10480910
1279 Ga0105248_11274640
1280 Ga0105237_10596056
1281 Ga0105237_10829171
1282 Ga0105238_10009458
1283 Ga0105238_10105108
1284 Ga0105238_10522351
1285 Ga0105238_10576358
1286 Ga0105249_10174294
1287 Ga0105249_10774581
1288 Ga0105249_12121964
1289 Ga0105239_10533769
1290 Ga0105246_10063095
1291 Ga0105246_10074764
1292 Ga0105246_10110037
1293 Ga0105246_10156753
1294 Ga0105246_10859209
1295 Ga0157371_10265363
1296 Ga0157374_10017724
1297 Ga0157374_10383021
1298 Ga0157374_10404929
1299 Ga0157374_10452360
1300 Ga0157378_10052780
1301 Ga0157378_10717744
1302 Ga0157378_10751888
1303 Ga0157378_11267357
1304 Ga0163162_10055440
1305 Ga0163162_10128512
1306 Ga0163162_10258836
1307 Ga0163162_10520109
1308 Ga0163162_10642089
1309 Ga0163162_10657904
1310 Ga0163162_11251782
1311 Ga0163162_12996603
1312 Ga0157375_10020113
1313 Ga0157375_10037405
1314 Ga0157375_10347845
1315 Ga0157375_10388092
1316 Ga0157375_11491102
1317 Ga0163163_10014203
1318 Ga0163163_10024554
1319 Ga0163163_10030190
1320 Ga0163163_10033208
1321 Ga0163163_10039601
1322 Ga0163163_10104247
1323 Ga0163163_10106901
1324 Ga0163163_10402054
1325 Ga0163163_10416607
1326 Ga0163163_10688556
1327 Ga0157380_10110936
1328 Ga0157380_10167865
1329 Ga0157380_10179041
1330 Ga0157380_10225385
1331 Ga0157380_10278166
1332 Ga0157380_10305985
1333 Ga0157380_10414136
1334 Ga0157380_10486193
1335 Ga0157380_10938668
1336 Ga0157380_11316618
1337 Ga0157380_12234933
1338 Ga0157380_12447746
1339 Ga0157377_10035737
1340 Ga0157377_10122572
1341 Ga0157377_10201621
1342 Ga0157377_10410726
1343 Ga0157377_10575087
1344 Ga0157377_10642068
1345 Ga0157379_10011606
1346 Ga0157379_10027784
1347 Ga0157379_10689811
1348 Ga0157376_10056177
1349 Ga0157376_10258067
1350 Ga0157376_10558313
1351 Ga0157376_11826769
1352 Ga0163161_10219378
1353 Ga0163161_10454701
1354 Ga0163161_11059384
1355 Ga0163161_12042594
1356 Ga0206356_10622013
1357 Ga0206351_10091398
1358 Ga0206351_10099706
1359 Ga0206351_10376092
1360 Ga0206351_10571302
1361 Ga0206350_10478025
1362 Ga0206350_10550396
1363 Ga0154015_1114267
1364 Ga0154015_1661591
1365 Ga0224712_10389838
1366 Ga0224712_10634373
1367 Ga0207697_10074635
1368 Ga0207656_10044598
1369 Ga0207656_10251409
1370 Ga0207653_10072804
1371 Ga0207682_10094111
1372 Ga0207688_10041356
1373 Ga0207680_10083394
1374 Ga0207680_10172123
1375 Ga0207680_10379673
1376 Ga0207680_10543153
1377 Ga0207645_10054847
1378 Ga0207645_10100422
1379 Ga0207645_10258672
1380 Ga0207645_10378687
1381 Ga0207645_10713891
1382 Ga0207643_10045143
1383 Ga0207643_10055704
1384 Ga0207643_10075529
1385 Ga0207643_10140425
1386 Ga0207684_11237684
1387 Ga0207695_10520460
1388 Ga0207671_10901936
1389 Ga0207660_10730926
1390 Ga0207660_11341276
1391 Ga0207662_10072663
1392 Ga0207657_10331857
1393 Ga0207649_10020122
1394 Ga0207649_10211480
1395 Ga0207649_10627274
1396 Ga0207649_11106595
1397 Ga0207652_10105781
1398 Ga0207646_10897957
1399 Ga0207681_10031248
1400 Ga0207681_10045108
1401 Ga0207681_10075506
1402 Ga0207681_10169138
1403 Ga0207694_10043001
1404 Ga0207694_10950056
1405 Ga0207650_10043082
1406 Ga0207650_10102463
1407 Ga0207650_10563592
1408 Ga0207650_10916776
1409 Ga0207650_11035486
1410 Ga0207659_10003157
1411 Ga0207659_10011789
1412 Ga0207659_10043022
1413 Ga0207659_10072400
1414 Ga0207659_10096640
1415 Ga0207659_10167047
1416 Ga0207659_10524784
1417 Ga0207659_10833111
1418 Ga0207659_10900956
1419 Ga0207644_10025276
1420 Ga0207644_10273040
1421 Ga0207644_11123382
1422 Ga0207706_10045530
1423 Ga0207706_10050405
1424 Ga0207706_10101606
1425 Ga0207706_10574479
1426 Ga0207706_10695925
1427 Ga0207706_10921367
1428 Ga0207706_11040634
1429 Ga0207709_10013577
1430 Ga0207709_10361651
1431 Ga0207709_11702401
1432 Ga0207670_10043036
1433 Ga0207670_10200848
1434 Ga0207669_10189103
1435 Ga0207669_10392168
1436 Ga0207669_11145021
1437 Ga0207704_10082305
1438 Ga0207704_10572995
1439 Ga0207704_10793373
1440 Ga0207691_10007003
1441 Ga0207691_10051092
1442 Ga0207691_10109740
1443 Ga0207691_10236765
1444 Ga0207691_10417442
1445 Ga0207691_11105754
1446 Ga0207691_11116148
1447 Ga0207711_10136923
1448 Ga0207711_10607083
1449 Ga0207711_11040260
1450 Ga0207689_10147198
1451 Ga0207689_10227784
1452 Ga0207689_10266747
1453 Ga0207689_10284378
1454 Ga0207689_10310173
1455 Ga0207661_10334004
1456 Ga0207661_10514180
1457 Ga0207679_10011150
1458 Ga0207679_10112886
1459 Ga0207679_10840131
1460 Ga0207679_10855244
1461 Ga0207667_10852383
1462 Ga0207651_10002425
1463 Ga0207651_10032440
1464 Ga0207651_10049698
1465 Ga0207651_10680617
1466 Ga0207651_10956145
1467 Ga0207712_11519041
1468 Ga0207668_10354311
1469 Ga0207640_10039626
1470 Ga0207640_11593120
1471 Ga0207640_11631856
1472 Ga0207658_10049293
1473 Ga0207658_10076350
1474 Ga0207658_11101514
1475 Ga0207658_11377097
1476 Ga0207677_10208961
1477 Ga0207677_10242737
1478 Ga0207677_10754555
1479 Ga0207703_10016127
1480 Ga0207703_10041728
1481 Ga0207703_10232400
1482 Ga0207703_11767321
1483 Ga0207678_10155829
1484 Ga0207678_10274752
1485 Ga0207678_10555857
1486 Ga0207708_10122381
1487 Ga0207708_10174955
1488 Ga0207708_10633851
1489 Ga0207641_10057623
1490 Ga0207641_10059731
1491 Ga0207641_10100606
1492 Ga0207641_10143933
1493 Ga0207641_10252678
1494 Ga0207641_11970299
1495 Ga0207648_10006480
1496 Ga0207648_10669511
1497 Ga0207676_10012910
1498 Ga0207676_10028481
1499 Ga0207676_10127726
1500 Ga0207676_10183144
1501 Ga0207676_10188600
1502 Ga0207676_11078636
1503 Ga0207676_11723306
1504 Ga0207676_12036974
1505 Ga0207674_10065647
1506 Ga0207674_10302660
1507 Ga0207674_10732506
1508 Ga0207675_100030403
1509 Ga0207675_100054061
1510 Ga0207675_100054562
1511 Ga0207675_100058220
1512 Ga0207675_100110628
1513 Ga0207675_100180898
1514 Ga0207675_100266816
1515 Ga0207675_101463420
1516 Ga0207683_10008490
1517 Ga0207683_10019849
1518 Ga0207683_10024447
1519 Ga0207683_10028929
1520 Ga0207683_10633874
1521 Ga0207683_10671336
1522 Ga0207698_10352310
1523 Ga0207698_10571127
1524 Ga0207698_10648908
1525 Ga0207698_12060341
1526 Ga0209968_1081988
1527 Ga0209982_1030302
1528 Ga0210002_1040766
1529 Ga0209971_1030607
1530 Ga0209998_10060509
1531 Ga0209813_10036928
1532 Ga0209974_10106519
1533 Ga0207428_10039483
1534 Ga0207428_10144084
1535 Ga0268266_10009033
1536 Ga0268266_10133966
1537 Ga0268266_10417534
1538 Ga0268266_10445215
1539 Ga0268265_10022688
1540 Ga0268265_10084842
1541 Ga0268265_10258474
1542 Ga0268265_10314676
1543 Ga0268265_10483877
1544 Ga0268265_10500173
1545 Ga0268265_11268694
1546 Ga0268265_12100673
1547 Ga0268264_10217550
1548 Ga0268264_10222626
1549 Ga0268264_10430485
1550 Ga0268264_10915227
1551 Ga0268264_11096193
1552 Ga0268264_11351482
1553 Ga0316183_1167839
1554 Ga0307408_100217831
1555 Ga0307408_100299680
1556 Ga0307408_100981643
1557 Ga0307405_10348562
1558 Ga0307413_11218568
1559 Ga0307406_10478962
1560 Ga0307412_10335218
1561 Ga0307412_10923601
1562 Ga0307412_11567416
1563 Ga0307412_11907593
1564 Ga0307409_101540649
1565 Ga0307416_100092434
1566 Ga0307416_101056186
1567 Ga0307416_101640038
1568 Ga0307416_101786948
1569 Ga0307411_10113611
1570 Ga0307411_10132187
1571 Ga0307411_10886644
1572 Ga0307411_11056433
1573 Ga0307411_12165377
1574 Ga0307415_100417859
1575 Ga0307415_100430588
1576 Ga0307415_101738315
1577 Ga0395900_0216303
1578 Ga0242420_029970
1579 Ga0439453_0036693
1580 Ga0439453_0057756
1581 Ga0439453_0113610
1582 Ga0451797_0227462
1583 Ga0451807_0169482
1584 Ga0451851_1338608
1585 Ga0439431_0076869
1586 Ga0439433_0076928
1587 Ga0439433_0083569
1588 Ga0439437_014207
1589 Ga0439441_018026
1590 Ga0439441_040607
1591 Ga0439441_083448
1592 Ga0439443_052384
1593 Ga0439448_0323271
1594 Ga0439449_0262458
1595 Ga0439450_012483
1596 Ga0439450_023553
1597 Ga0439450_114216
1598 Ga0439455_0086171
1599 Ga0450919_021822
1600 Ga0450920_046900
1601 Ga0450923_131117
1602 Ga0450896_069372
1603 Ga0450898_035364
1604 Ga0450905_055983
1605 Ga0450908_000260
1606 Ga0439434_0159132
1607 Ga0439434_0231219
1608 Ga0439435_0021005
1609 Ga0439435_0031260
1610 Ga0439435_0050731
1611 Ga0439435_0053168
1612 Ga0439435_0088958
1613 Ga0439435_0245465
1614 Ga0439444_0013531
1615 Ga0439444_0018270
1616 Ga0439444_0126602
1617 Ga0439459_0018211
1618 Ga0439464_0051481
1619 Ga0439464_0069486
1620 Ga0439464_0321341
1621 Ga0439460_0032560
1622 Ga0439460_0057408
1623 Ga0439460_0067822
1624 Ga0439460_0070321
1625 Ga0439460_0161985
1626 Ga0439460_0172893
1627 Ga0450916_003608
1628 Ga0450916_012513
1629 Ga0450893_0019526
1630 Ga0450893_0035523
1631 Ga0451576_0406991
1632 Ga0451576_2231087
1633 Ga0495643_0017123
1634 Ga0496100_0561555
1635 Ga0496101_0577730
1636 Ga0496104_0163743
1637 Ga0496104_0349604
1638 Ga0496107_0353713
1639 Ga0496109_0179350
1640 Ga0496109_0773964
1641 Ga0496110_0289468
1642 Ga0496110_0594619
1643 Ga0496112_0670700
1644 Ga0496113_0995018
1645 Ga0501306_080735
1646 Ga0501297_018376
1647 Ga0501300_036149
1648 Ga0501321_078367
1649 Ga0501033_0825905
1650 Ga0501036_0127222
1651 Ga0501038_0786213
1652 Ga0501039_1258110
1653 Ga0501040_0150760
1654 Ga0501040_1052552
1655 Ga0501041_0050131
1656 Ga0501041_0497676
1657 Ga0501041_0695944
1658 Ga0501042_1006692
1659 Ga0501046_0236083
1660 Ga0501046_0348761
1661 Ga0501048_0030488
1662 Ga0501048_0061629
1663 Ga0501048_0429898
1664 Ga0501048_0503104
1665 Ga0501068_0512831
1666 Ga0501069_0490820
1667 Ga0501071_0057281
1668 Ga0501071_1267057
1669 Ga0501072_0024195
1670 Ga0501072_0770335
1671 Ga0501072_0811959
1672 Ga0501072_1235128
1673 Ga0501074_0676846
1674 Ga0501074_1076309
1675 Ga0501075_0107703
1676 Ga0501075_0423061
1677 Ga0501075_0492233
1678 Ga0501075_0631408
1679 Ga0501075_0904590
1680 Ga0501076_0031653
1681 Ga0501076_0437433
1682 Ga0501076_0687870
1683 Ga0501206_011775
1684 Ga0501209_076838
1685 Ga0501225_0188006
1686 Ga0501079_0796062
1687 Ga0501080_1261489
1688 Ga0501081_0069126
1689 Ga0501273_011913
1690 Ga0501276_013445
1691 Ga0501044_0969321
1692 Ga0501045_0022691
1693 Ga0501045_0037370
1694 Ga0501045_0231872
1695 nmdc:mga00v17_67307_c1
1696 nmdc:mga0k408_222766_c1
1697 nmdc:mga0k408_30033_c1
1698 nmdc:mga0k408_327789_c1
1699 nmdc:mga0k408_36044_c1
1700 nmdc:mga07m45_636409_c1
1701 nmdc:mga05p37_13720_c1
1702 nmdc:mga05p37_14441_c1
1703 nmdc:mga05p37_1642261_c1
1704 nmdc:mga05p37_226029_c2
1705 nmdc:mga05p37_24527_c1
1706 nmdc:mga05p37_285523_c1
1707 nmdc:mga05p37_320337_c1
1708 nmdc:mga05p37_498404_c1
1709 nmdc:mga09592_115844_c1
1710 nmdc:mga09592_22830_c1
1711 nmdc:mga09592_275663_c1
1712 nmdc:mga09592_312317_c1
1713 nmdc:mga09592_337393_c1
1714 nmdc:mga09592_435958_c1
1715 nmdc:mga09592_484104_c1
1716 nmdc:mga09592_65688_c1
1717 nmdc:mga0qj67_1094261_c1
1718 nmdc:mga0qj67_149181_c1
1719 nmdc:mga0qj67_152841_c1
1720 nmdc:mga0qj67_2057_c1
1721 nmdc:mga0qj67_359275_c1
1722 nmdc:mga0qj67_3894_c1
1723 nmdc:mga0qj67_630338_c1
1724 nmdc:mga06r32_123802_c2
1725 nmdc:mga06r32_1261798_c1
1726 nmdc:mga06r32_1302927_c1
1727 nmdc:mga06r32_15167_c1
1728 nmdc:mga06r32_193316_c1
1729 nmdc:mga06r32_22403_c1
1730 nmdc:mga06r32_37394_c1
1731 nmdc:mga06r32_3839_c1
1732 nmdc:mga06r32_460413_c1
1733 nmdc:mga08y16_1219568_c1
1734 nmdc:mga08y16_1280765_c1
1735 nmdc:mga08y16_1979_c1
1736 nmdc:mga08y16_272502_c1
1737 nmdc:mga08y16_37280_c1
1738 nmdc:mga08y16_385062_c1
1739 nmdc:mga08y16_50670_c1
1740 nmdc:mga08y16_58941_c1
1741 nmdc:mga08y16_71416_c1
1742 nmdc:mga08y16_781924_c1
1743 nmdc:mga08y16_916209_c1
1744 nmdc:mga08y16_925308_c1
1745 nmdc:mga08y16_980758_c1
1746 nmdc:mga0n895_219398_c1
1747 nmdc:mga0n895_341151_c1
1748 nmdc:mga0n895_45203_c1
1749 nmdc:mga0n895_505724_c1
1750 nmdc:mga0n895_525932_c1
1751 nmdc:mga0n895_59270_c1
1752 nmdc:mga0n895_904248_c1
1753 nmdc:mga0n895_999058_c1
1754 nmdc:mga0rr50_2072_c1
1755 nmdc:mga0rr50_306365_c1
1756 nmdc:mga0rr50_428971_c1
1757 nmdc:mga0rr50_498635_c1
1758 nmdc:mga0rr50_551891_c1
1759 nmdc:mga08x19_35407_c1
1760 nmdc:mga0a205_153448_c1
1761 nmdc:mga0a205_15978_c1
1762 nmdc:mga0a205_275736_c1
1763 nmdc:mga0a205_3460_c1
1764 nmdc:mga0a205_402958_c1
1765 nmdc:mga0a205_494179_c1
1766 nmdc:mga0a205_89971_c1
1767 Ga0501084_0167234
1768 Ga0501084_0437658
1769 Ga0501084_0765068
1770 Ga0501084_0853221
1771 Ga0501084_0858113
1772 Ga0590071_019105
1773 Ga0587070_173155
1774 Ga0501082_0051829
1775 Ga0501082_0885813
1776 Ga0501082_1637701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

66

138

0.92

PF00011

HSP20

Hsp20/alpha crystallin family

61

152

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n3e-assembly1.cif.gz_B zebrafish alphaa crystallin 0.8438 41 123
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8435 41 121
4m5t-assembly3.cif.gz_A disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.8359 43 124
4m5t-assembly3.cif.gz_C disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.8324 43 124
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8296 39 121
ID Description Score Start End Superfamily
af_Q54AR9_158_227_3.10.20.370 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8865 65 100 3.10.20.370
af_K7MQU7_125_223_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8787 43 125 2.60.40.790
af_K7KJW2_40_126_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8487 40 121 2.60.40.790
af_A0A1D6GL72_7_81_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8463 59 127 2.60.40.790
af_A0A1D6KZ63_1_112_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8403 39 122 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A672GY16-F1-model_v4 SHSP domain-containing protein 0.8605 34 124
AF-A0A6J1SG53-F1-model_v4 deleted 0.8338 36 123
AF-A0A7L3L6I9-F1-model_v4 HSPB7 protein 0.8096 37 133 GO:0005634
GO:0005737
GO:0007507
AF-W5MQQ4-F1-model_v4 Heat shock protein beta-7-like 0.809 30 126
AF-A0A1J3INY7-F1-model_v4 Inactive protein RESTRICTED TEV MOVEMENT 2 0.7983 34 124 GO:0005886
GO:0006952
GO:0034605

Map