F484756

General Info

Members Datasets Scaffolds Average Seq Length
888 327 887 110

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_12358853|Ga0105238_123588532
Length 117
Sequence MTATAETVQAPAKRRNEKVGNVVSTKMQKTIVVEVEMRKAHPKYKRIVKSAKKFYAHDEQNSARVGDVVRIRETRPLSKLKRWNLEEIVRRSSLGQIEELEAPQAAASSGMAKKGAR

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
148 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 3.27
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 4.73
Rhizosphere 91.67
Stem 0
Stem Tuber 0
Unclassified 2.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1013173 3300000531 Bacteria 521
2 LJNas_1000189 3300000546 Bacteria 10352
3 rootH2_10096173 3300003320 Bacteria 1883
4 rootH2_10177754 3300003320 Bacteria 1996
5 JGI25404J52841_10035318 3300003659 Bacteria 1064
6 Ga0058863_10003457 3300004799 Bacteria 3372
7 Ga0058863_11690845 3300004799 Bacteria 888
8 Ga0058861_11532275 3300004800 Bacteria 540
9 Ga0058861_11542957 3300004800 Bacteria 1002
10 Ga0058862_12327023 3300004803 Bacteria 1010
11 Ga0058862_12712161 3300004803 Bacteria 698
12 Ga0070658_10009410 3300005327 Bacteria 7850
13 Ga0070658_10070958 3300005327 Bacteria 2852
14 Ga0070658_10076190 3300005327 Bacteria 2751
15 Ga0070658_10161229 3300005327 Bacteria 1881
16 Ga0070658_10239808 3300005327 Bacteria 1537
17 Ga0070658_10253679 3300005327 Bacteria 1493
18 Ga0070658_10260242 3300005327 Bacteria 1473
19 Ga0070658_10376412 3300005327 Bacteria 1217
20 Ga0070658_11004857 3300005327 Bacteria 725
21 Ga0070658_11047070 3300005327 Bacteria 710
22 Ga0070683_100108530 3300005329 Bacteria 2617
23 Ga0070683_100186088 3300005329 Bacteria 1971
24 Ga0070683_100489624 3300005329 Bacteria 1174
25 Ga0070670_100968493 3300005331 Bacteria 773
26 Ga0070666_10235118 3300005335 Bacteria 1295
27 Ga0070680_100032458 3300005336 Bacteria 4203
28 Ga0070680_100075737 3300005336 Bacteria 2770
29 Ga0070680_100091294 3300005336 Bacteria 2521
30 Ga0070680_100231848 3300005336 Bacteria 1559
31 Ga0070680_100442051 3300005336 Bacteria 1110
32 Ga0070680_101255686 3300005336 Bacteria 641
33 Ga0070682_100524907 3300005337 Bacteria 922
34 Ga0068868_100038932 3300005338 Bacteria 3691
35 Ga0068868_100173056 3300005338 Bacteria 1788
36 Ga0070660_100006108 3300005339 Bacteria 8329
37 Ga0070660_100011289 3300005339 Bacteria 6341
38 Ga0070660_100061278 3300005339 Bacteria 2921
39 Ga0070660_100513948 3300005339 Bacteria 997
40 Ga0070660_101270735 3300005339 Bacteria 624
41 Ga0070691_10337695 3300005341 Bacteria 833
42 Ga0070661_100025903 3300005344 Bacteria 4215
43 Ga0070661_100162072 3300005344 Bacteria 1694
44 Ga0070661_100226031 3300005344 Bacteria 1437
45 Ga0070661_101217640 3300005344 Bacteria 630
46 Ga0070661_101218100 3300005344 Bacteria 630
47 Ga0070671_100001676 3300005355 Bacteria 16774
48 Ga0070674_100496041 3300005356 Bacteria 1016
49 Ga0070659_100001021 3300005366 Bacteria 20542
50 Ga0070659_100016590 3300005366 Bacteria 5530
51 Ga0070659_100445162 3300005366 Bacteria 1098
52 Ga0070667_100292165 3300005367 Bacteria 1466
53 Ga0070667_100326259 3300005367 Bacteria 1386
54 Ga0070709_10495921 3300005434 Bacteria 927
55 Ga0070714_100336931 3300005435 Bacteria 1414
56 Ga0070714_100863857 3300005435 Bacteria 878
57 Ga0070714_101762733 3300005435 Bacteria 605
58 Ga0070713_100015502 3300005436 Bacteria 5702
59 Ga0070713_100256803 3300005436 Bacteria 1596
60 Ga0070713_101554792 3300005436 Bacteria 642
61 Ga0070713_101809854 3300005436 Bacteria 593
62 Ga0070710_10327304 3300005437 Bacteria 1008
63 Ga0070711_100306354 3300005439 Bacteria 1265
64 Ga0070663_100010939 3300005455 Bacteria 5672
65 Ga0070663_100281825 3300005455 Bacteria 1325
66 Ga0070663_100434226 3300005455 Bacteria 1079
67 Ga0070663_100667965 3300005455 Bacteria 880
68 Ga0070663_101194012 3300005455 Bacteria 668
69 Ga0070663_101348258 3300005455 Bacteria 630
70 Ga0070663_101422324 3300005455 Bacteria 615
71 Ga0070678_100686922 3300005456 Bacteria 921
72 Ga0070662_101010675 3300005457 Bacteria 712
73 Ga0070681_10012933 3300005458 Bacteria 8287
74 Ga0070681_10171502 3300005458 Bacteria 2091
75 Ga0070681_10200046 3300005458 Bacteria 1916
76 Ga0070681_10769067 3300005458 Bacteria 880
77 Ga0070681_11194031 3300005458 Bacteria 683
78 Ga0068867_100270131 3300005459 Bacteria 1390
79 Ga0070707_101205634 3300005468 Bacteria 723
80 Ga0070699_100892826 3300005518 Unclassified 814
81 Ga0070679_100003562 3300005530 Bacteria 14258
82 Ga0070679_100015770 3300005530 Bacteria 7269
83 Ga0070679_100030999 3300005530 Bacteria 5282
84 Ga0070679_100067206 3300005530 Bacteria 3574
85 Ga0070679_100279165 3300005530 Bacteria 1623
86 Ga0070679_101411759 3300005530 Bacteria 642
87 Ga0070679_102066377 3300005530 Bacteria 519
88 Ga0070684_100006987 3300005535 Bacteria 8769
89 Ga0070684_100539430 3300005535 Bacteria 1082
90 Ga0070697_100007786 3300005536 Bacteria 8337
91 Ga0068853_100000054 3300005539 Bacteria 80837
92 Ga0068853_100181095 3300005539 Bacteria 1911
93 Ga0068853_100248542 3300005539 Bacteria 1631
94 Ga0070695_100110781 3300005545 Bacteria 1862
95 Ga0070665_100008632 3300005548 Bacteria 10311
96 Ga0070665_100046016 3300005548 Bacteria 4383
97 Ga0070665_100138605 3300005548 Bacteria 2436
98 Ga0070665_100853776 3300005548 Bacteria 923
99 Ga0070665_100881891 3300005548 Bacteria 907
100 Ga0070665_100984802 3300005548 Bacteria 855
101 Ga0068855_100000642 3300005563 Bacteria 42759
102 Ga0068855_100003825 3300005563 Bacteria 18405
103 Ga0068855_100006253 3300005563 Bacteria 14521
104 Ga0068855_100062458 3300005563 Bacteria 4348
105 Ga0068855_100140439 3300005563 Bacteria 2754
106 Ga0068855_100158606 3300005563 Bacteria 2569
107 Ga0068855_100231753 3300005563 Bacteria 2067
108 Ga0068855_100242058 3300005563 Bacteria 2015
109 Ga0068855_100510374 3300005563 Bacteria 1305
110 Ga0068855_100611063 3300005563 Bacteria 1175
111 Ga0068855_101177227 3300005563 Bacteria 798
112 Ga0070664_100163924 3300005564 Bacteria 1968
113 Ga0068857_100063745 3300005577 Bacteria 3276
114 Ga0068857_100171226 3300005577 Bacteria 1974
115 Ga0068857_100619698 3300005577 Bacteria 1024
116 Ga0068854_100000137 3300005578 Bacteria 50696
117 Ga0068854_100037277 3300005578 Bacteria 3412
118 Ga0068854_100357835 3300005578 Bacteria 1197
119 Ga0068854_100506959 3300005578 Bacteria 1017
120 Ga0068856_100026907 3300005614 Bacteria 5610
121 Ga0068856_100100182 3300005614 Bacteria 2889
122 Ga0068856_100173144 3300005614 Bacteria 2171
123 Ga0068856_100461662 3300005614 Bacteria 1291
124 Ga0068856_100569368 3300005614 Bacteria 1154
125 Ga0068856_100645530 3300005614 Bacteria 1079
126 Ga0068856_101846696 3300005614 Bacteria 616
127 Ga0068852_100888369 3300005616 Bacteria 908
128 Ga0068852_102632283 3300005616 Bacteria 522
129 Ga0068864_100008789 3300005618 Bacteria 8328
130 Ga0068851_10004509 3300005834 Bacteria 6282
131 Ga0068851_11005292 3300005834 Bacteria 526
132 Ga0068863_100042299 3300005841 Bacteria 4329
133 Ga0068863_100441707 3300005841 Bacteria 1276
134 Ga0068858_100188042 3300005842 Bacteria 1951
135 Ga0068858_100606443 3300005842 Bacteria 1062
136 Ga0068858_101327357 3300005842 Bacteria 708
137 Ga0081455_10401326 3300005937 Bacteria 951
138 Ga0081540_1027528 3300005983 Bacteria 3218
139 Ga0070717_10050783 3300006028 Bacteria 3410
140 Ga0070716_101013524 3300006173 Unclassified 657
141 Ga0070716_101594069 3300006173 Bacteria 536
142 Ga0070712_101145955 3300006175 Bacteria 676
143 Ga0070712_101349258 3300006175 Bacteria 622
144 Ga0070712_101640752 3300006175 Bacteria 563
145 Ga0097621_102135197 3300006237 Bacteria 536
146 Ga0068871_101611487 3300006358 Bacteria 615
147 Ga0099795_10347177 3300007788 Bacteria 663
148 Ga0105240_10000001 3300009093 Bacteria 2887840
149 Ga0105240_10007537 3300009093 Bacteria 15778
150 Ga0105240_10027101 3300009093 Bacteria 7509
151 Ga0105240_10045768 3300009093 Bacteria 5549
152 Ga0105240_10132535 3300009093 Bacteria 2988
153 Ga0105240_10263275 3300009093 Bacteria 1988
154 Ga0105240_10280570 3300009093 Bacteria 1914
155 Ga0105240_10313386 3300009093 Bacteria 1791
156 Ga0105240_11271638 3300009093 Bacteria 777
157 Ga0105240_12535415 3300009093 Bacteria 530
158 Ga0105245_10115478 3300009098 Bacteria 2501
159 Ga0105245_11108624 3300009098 Bacteria 838
160 Ga0105245_11891649 3300009098 Bacteria 650
161 Ga0105247_10101615 3300009101 Bacteria 1839
162 Ga0114129_10195930 3300009147 Bacteria 2740
163 Ga0105243_11064316 3300009148 Bacteria 815
164 Ga0105241_10083767 3300009174 Bacteria 2502
165 Ga0105241_10160507 3300009174 Bacteria 1847
166 Ga0105241_10232585 3300009174 Bacteria 1554
167 Ga0105241_10363434 3300009174 Bacteria 1260
168 Ga0105241_10912483 3300009174 Bacteria 816
169 Ga0105242_10477631 3300009176 Bacteria 1181
170 Ga0105248_10000094 3300009177 Bacteria 98558
171 Ga0105248_10003761 3300009177 Bacteria 16804
172 Ga0105248_10188672 3300009177 Bacteria 2323
173 Ga0105248_10384554 3300009177 Bacteria 1580
174 Ga0105248_10547026 3300009177 Bacteria 1306
175 Ga0105248_11518860 3300009177 Bacteria 758
176 Ga0105237_10161658 3300009545 Bacteria 2238
177 Ga0105237_10166637 3300009545 Bacteria 2202
178 Ga0105237_10391906 3300009545 Bacteria 1394
179 Ga0105237_10518019 3300009545 Bacteria 1199
180 Ga0105237_10609906 3300009545 Bacteria 1098
181 Ga0105237_10753391 3300009545 Bacteria 980
182 Ga0105237_11273966 3300009545 Bacteria 742
183 Ga0105237_11646534 3300009545 Bacteria 649
184 Ga0105238_10006787 3300009551 Bacteria 11431
185 Ga0105238_10150267 3300009551 Bacteria 2305
186 Ga0105238_10616892 3300009551 Bacteria 1093
187 Ga0105238_11172622 3300009551 Bacteria 792
188 Ga0105238_11498914 3300009551 Bacteria 703
189 Ga0105238_12358853 3300009551 Bacteria 567
190 Ga0105249_10016019 3300009553 Bacteria 6644
191 Ga0099796_10190101 3300010159 Bacteria 828
192 Ga0105239_10263000 3300010375 Bacteria 1939
193 Ga0105239_10517504 3300010375 Bacteria 1357
194 Ga0105239_10890865 3300010375 Bacteria 1021
195 Ga0105239_11900450 3300010375 Bacteria 690
196 Ga0105239_12046595 3300010375 Bacteria 665
197 Ga0105239_13623665 3300010375 Bacteria 502
198 Ga0157373_10196828 3300013100 Bacteria 1421
199 Ga0157373_10278775 3300013100 Bacteria 1184
200 Ga0157373_10327152 3300013100 Bacteria 1091
201 Ga0157373_11286363 3300013100 Bacteria 553
202 Ga0157371_10128407 3300013102 Bacteria 1803
203 Ga0157371_10149884 3300013102 Bacteria 1663
204 Ga0157371_10273346 3300013102 Bacteria 1220
205 Ga0157371_11031153 3300013102 Bacteria 629
206 Ga0157370_10007024 3300013104 Bacteria 12294
207 Ga0157370_10008035 3300013104 Bacteria 11427
208 Ga0157370_10049002 3300013104 Bacteria 4045
209 Ga0157370_10053290 3300013104 Bacteria 3858
210 Ga0157370_10062955 3300013104 Bacteria 3516
211 Ga0157370_10250542 3300013104 Bacteria 1638
212 Ga0157370_10414018 3300013104 Bacteria 1240
213 Ga0157370_10419687 3300013104 Bacteria 1231
214 Ga0157370_10432819 3300013104 Bacteria 1210
215 Ga0157370_10619041 3300013104 Bacteria 991
216 Ga0157370_10678274 3300013104 Bacteria 941
217 Ga0157370_10931090 3300013104 Bacteria 788
218 Ga0157369_10013194 3300013105 Bacteria 9351
219 Ga0157369_10026529 3300013105 Bacteria 6426
220 Ga0157369_10033381 3300013105 Bacteria 5656
221 Ga0157369_10056103 3300013105 Bacteria 4251
222 Ga0157369_10059538 3300013105 Bacteria 4118
223 Ga0157369_10118054 3300013105 Bacteria 2816
224 Ga0157369_10192055 3300013105 Bacteria 2145
225 Ga0157369_10265782 3300013105 Bacteria 1788
226 Ga0157369_10299684 3300013105 Bacteria 1672
227 Ga0157369_10364492 3300013105 Bacteria 1500
228 Ga0157369_10870738 3300013105 Bacteria 924
229 Ga0157369_10903016 3300013105 Bacteria 906
230 Ga0157369_10942606 3300013105 Bacteria 885
231 Ga0157369_11702911 3300013105 Bacteria 641
232 Ga0157369_11888698 3300013105 Bacteria 606
233 Ga0157369_12296453 3300013105 Bacteria 547
234 Ga0157374_10010090 3300013296 Bacteria 8111
235 Ga0157374_10034836 3300013296 Bacteria 4602
236 Ga0157374_10070986 3300013296 Bacteria 3283
237 Ga0157374_10191481 3300013296 Bacteria 2001
238 Ga0157374_10226508 3300013296 Bacteria 1836
239 Ga0157374_10330132 3300013296 Bacteria 1513
240 Ga0157374_10367640 3300013296 Bacteria 1431
241 Ga0157374_10389102 3300013296 Bacteria 1390
242 Ga0157374_10587134 3300013296 Bacteria 1123
243 Ga0157374_11071342 3300013296 Bacteria 826
244 Ga0157374_11161494 3300013296 Bacteria 793
245 Ga0157378_10020240 3300013297 Bacteria 5853
246 Ga0157378_10659345 3300013297 Bacteria 1063
247 Ga0157378_10695612 3300013297 Bacteria 1036
248 Ga0163162_10004959 3300013306 Bacteria 12820
249 Ga0157372_10003289 3300013307 Bacteria 17453
250 Ga0157372_10012293 3300013307 Bacteria 9121
251 Ga0157372_10047852 3300013307 Bacteria 4753
252 Ga0157372_10192270 3300013307 Bacteria 2364
253 Ga0157372_10233303 3300013307 Bacteria 2134
254 Ga0157372_10235497 3300013307 Bacteria 2123
255 Ga0157372_10375914 3300013307 Bacteria 1656
256 Ga0157372_10583983 3300013307 Bacteria 1302
257 Ga0157372_10764445 3300013307 Bacteria 1123
258 Ga0157372_10853250 3300013307 Bacteria 1057
259 Ga0157372_11125503 3300013307 Bacteria 908
260 Ga0157372_12134636 3300013307 Bacteria 644
261 Ga0157375_10263404 3300013308 Bacteria 1885
262 Ga0157375_11334027 3300013308 Bacteria 844
263 Ga0157375_13220794 3300013308 Bacteria 544
264 Ga0163163_10019000 3300014325 Bacteria 6447
265 Ga0163163_10111041 3300014325 Bacteria 2771
266 Ga0163163_10335438 3300014325 Bacteria 1567
267 Ga0182008_10258356 3300014497 Bacteria 900
268 Ga0157379_10169847 3300014968 Bacteria 1969
269 Ga0157379_10597111 3300014968 Bacteria 1030
270 Ga0157379_10637831 3300014968 Bacteria 997
271 Ga0157379_11383331 3300014968 Bacteria 682
272 Ga0157379_12446343 3300014968 Bacteria 522
273 Ga0157376_10028432 3300014969 Bacteria 4443
274 Ga0157376_10053211 3300014969 Bacteria 3369
275 Ga0157376_10173307 3300014969 Bacteria 1966
276 Ga0157376_10214467 3300014969 Bacteria 1779
277 Ga0157376_10277569 3300014969 Bacteria 1577
278 Ga0157376_10910835 3300014969 Bacteria 898
279 Ga0157376_11266178 3300014969 Bacteria 767
280 Ga0184598_113851 3300019182 Bacteria 794
281 Ga0197907_11454979 3300020069 Bacteria 551
282 Ga0206356_10233622 3300020070 Bacteria 655
283 Ga0206349_1064812 3300020075 Bacteria 838
284 Ga0206349_1580743 3300020075 Bacteria 591
285 Ga0206351_11002133 3300020077 Bacteria 1797
286 Ga0206352_10132864 3300020078 Bacteria 735
287 Ga0206353_10452776 3300020082 Bacteria 921
288 Ga0154015_1664317 3300020610 Bacteria 1351
289 Ga0213872_10005926 3300021361 Bacteria 6203
290 Ga0213872_10012057 3300021361 Bacteria 4077
291 Ga0213872_10015241 3300021361 Bacteria 3577
292 Ga0213872_10016045 3300021361 Bacteria 3478
293 Ga0213872_10242057 3300021361 Bacteria 762
294 Ga0213871_10002437 3300021441 Bacteria 3419
295 Ga0213871_10012856 3300021441 Bacteria 1955
296 Ga0213871_10214070 3300021441 Bacteria 604
297 Ga0224712_10451513 3300022467 Bacteria 617
298 Ga0224712_10465873 3300022467 Bacteria 608
299 Ga0224572_1040625 3300024225 Bacteria 877
300 Ga0209437_104260 3300025233 Bacteria 2536
301 Ga0209233_1002003 3300025261 Bacteria 7713
302 Ga0209233_1038436 3300025261 Bacteria 1056
303 Ga0207656_10007345 3300025321 Bacteria 4007
304 Ga0207656_10259307 3300025321 Bacteria 853
305 Ga0207656_10581264 3300025321 Bacteria 571
306 Ga0207680_10043011 3300025903 Bacteria 2646
307 Ga0207680_10245261 3300025903 Bacteria 1236
308 Ga0207647_10004892 3300025904 Bacteria 9886
309 Ga0207647_10022019 3300025904 Bacteria 4241
310 Ga0207647_10214128 3300025904 Bacteria 1112
311 Ga0207647_10274467 3300025904 Bacteria 963
312 Ga0207699_10312742 3300025906 Bacteria 1100
313 Ga0207699_10423402 3300025906 Bacteria 951
314 Ga0207705_10000048 3300025909 Bacteria 171848
315 Ga0207705_10010050 3300025909 Bacteria 6887
316 Ga0207705_10013784 3300025909 Bacteria 5828
317 Ga0207705_10026791 3300025909 Bacteria 4108
318 Ga0207705_10042512 3300025909 Bacteria 3262
319 Ga0207705_10042888 3300025909 Bacteria 3249
320 Ga0207705_10692718 3300025909 Bacteria 792
321 Ga0207654_10632971 3300025911 Bacteria 765
322 Ga0207654_10782746 3300025911 Bacteria 688
323 Ga0207707_10007751 3300025912 Bacteria 9347
324 Ga0207707_10223658 3300025912 Bacteria 1638
325 Ga0207707_10485341 3300025912 Bacteria 1055
326 Ga0207707_11492828 3300025912 Bacteria 536
327 Ga0207695_10000001 3300025913 Bacteria 2888630
328 Ga0207695_10003215 3300025913 Bacteria 23264
329 Ga0207695_10014395 3300025913 Bacteria 9378
330 Ga0207695_10021213 3300025913 Bacteria 7418
331 Ga0207695_10067170 3300025913 Bacteria 3679
332 Ga0207695_10146071 3300025913 Bacteria 2309
333 Ga0207695_10332441 3300025913 Bacteria 1408
334 Ga0207695_10486864 3300025913 Bacteria 1116
335 Ga0207695_11398501 3300025913 Bacteria 580
336 Ga0207695_11530822 3300025913 Bacteria 547
337 Ga0207695_11695789 3300025913 Bacteria 513
338 Ga0207671_10047104 3300025914 Bacteria 3190
339 Ga0207671_10409157 3300025914 Bacteria 1079
340 Ga0207671_10855990 3300025914 Bacteria 720
341 Ga0207671_10984782 3300025914 Bacteria 665
342 Ga0207671_11114049 3300025914 Bacteria 620
343 Ga0207671_11606787 3300025914 Bacteria 500
344 Ga0207693_10195081 3300025915 Bacteria 1593
345 Ga0207693_10993744 3300025915 Bacteria 641
346 Ga0207693_11059811 3300025915 Bacteria 617
347 Ga0207663_10017844 3300025916 Bacteria 3964
348 Ga0207663_10138731 3300025916 Bacteria 1691
349 Ga0207660_10033618 3300025917 Bacteria 3549
350 Ga0207660_10099104 3300025917 Bacteria 2174
351 Ga0207660_10201117 3300025917 Bacteria 1556
352 Ga0207660_10203919 3300025917 Bacteria 1546
353 Ga0207660_10695019 3300025917 Bacteria 830
354 Ga0207657_10003185 3300025919 Bacteria 17559
355 Ga0207657_10008913 3300025919 Bacteria 10142
356 Ga0207657_10012382 3300025919 Bacteria 8427
357 Ga0207657_10032755 3300025919 Bacteria 4691
358 Ga0207657_11395162 3300025919 Bacteria 526
359 Ga0207649_10019606 3300025920 Bacteria 3868
360 Ga0207649_10023049 3300025920 Bacteria 3601
361 Ga0207649_10283538 3300025920 Bacteria 1205
362 Ga0207649_10367667 3300025920 Bacteria 1069
363 Ga0207649_11394764 3300025920 Bacteria 554
364 Ga0207649_11429412 3300025920 Unclassified 547
365 Ga0207652_10021006 3300025921 Bacteria 5385
366 Ga0207652_10028452 3300025921 Bacteria 4663
367 Ga0207652_10049501 3300025921 Bacteria 3597
368 Ga0207652_10125219 3300025921 Bacteria 2289
369 Ga0207652_10396006 3300025921 Bacteria 1246
370 Ga0207652_10472137 3300025921 Bacteria 1130
371 Ga0207694_10011619 3300025924 Bacteria 6643
372 Ga0207694_10131015 3300025924 Bacteria 2010
373 Ga0207694_10139542 3300025924 Bacteria 1949
374 Ga0207694_10452964 3300025924 Bacteria 1071
375 Ga0207694_10487183 3300025924 Bacteria 1032
376 Ga0207694_10770405 3300025924 Bacteria 812
377 Ga0207650_10261081 3300025925 Bacteria 1405
378 Ga0207687_10320435 3300025927 Bacteria 1255
379 Ga0207700_10058148 3300025928 Bacteria 2919
380 Ga0207700_10181268 3300025928 Bacteria 1764
381 Ga0207700_10196726 3300025928 Bacteria 1697
382 Ga0207700_10303151 3300025928 Bacteria 1380
383 Ga0207700_11031631 3300025928 Bacteria 736
384 Ga0207700_11114510 3300025928 Bacteria 705
385 Ga0207664_10018040 3300025929 Bacteria 5185
386 Ga0207664_10292060 3300025929 Bacteria 1433
387 Ga0207664_10468553 3300025929 Bacteria 1126
388 Ga0207644_10018963 3300025931 Bacteria 4663
389 Ga0207690_10001487 3300025932 Bacteria 14647
390 Ga0207690_10332266 3300025932 Bacteria 1197
391 Ga0207690_11272767 3300025932 Bacteria 614
392 Ga0207686_10599710 3300025934 Bacteria 866
393 Ga0207669_11450103 3300025937 Bacteria 585
394 Ga0207665_10112861 3300025939 Bacteria 1911
395 Ga0207665_10462352 3300025939 Bacteria 975
396 Ga0207711_10000086 3300025941 Bacteria 99422
397 Ga0207711_10015612 3300025941 Bacteria 6301
398 Ga0207711_10188207 3300025941 Bacteria 1880
399 Ga0207711_10205564 3300025941 Bacteria 1798
400 Ga0207711_10607573 3300025941 Bacteria 1020
401 Ga0207661_10011175 3300025944 Bacteria 6494
402 Ga0207661_10013707 3300025944 Bacteria 5920
403 Ga0207661_10046339 3300025944 Bacteria 3448
404 Ga0207661_10274727 3300025944 Bacteria 1504
405 Ga0207679_10420146 3300025945 Bacteria 1180
406 Ga0207667_10004621 3300025949 Bacteria 16895
407 Ga0207667_10010059 3300025949 Bacteria 11087
408 Ga0207667_10014641 3300025949 Bacteria 8931
409 Ga0207667_10015592 3300025949 Bacteria 8622
410 Ga0207667_10053320 3300025949 Bacteria 4256
411 Ga0207667_10056317 3300025949 Bacteria 4130
412 Ga0207667_10528029 3300025949 Bacteria 1195
413 Ga0207667_10530167 3300025949 Bacteria 1192
414 Ga0207667_10819960 3300025949 Bacteria 926
415 Ga0207712_10006954 3300025961 Bacteria 7137
416 Ga0207640_10000023 3300025981 Bacteria 160979
417 Ga0207640_10075139 3300025981 Bacteria 2289
418 Ga0207640_10262866 3300025981 Bacteria 1346
419 Ga0207640_11111853 3300025981 Bacteria 699
420 Ga0207658_10391746 3300025986 Bacteria 1219
421 Ga0207677_10095968 3300026023 Bacteria 2168
422 Ga0207703_10248950 3300026035 Bacteria 1601
423 Ga0207639_10000034 3300026041 Bacteria 154355
424 Ga0207639_10035600 3300026041 Bacteria 3685
425 Ga0207639_10149778 3300026041 Bacteria 1953
426 Ga0207678_10009514 3300026067 Bacteria 8551
427 Ga0207678_10029842 3300026067 Bacteria 4761
428 Ga0207678_10035886 3300026067 Bacteria 4317
429 Ga0207678_10250236 3300026067 Bacteria 1517
430 Ga0207678_10399148 3300026067 Bacteria 1190
431 Ga0207678_10418017 3300026067 Bacteria 1162
432 Ga0207678_10957686 3300026067 Bacteria 757
433 Ga0207678_11019590 3300026067 Bacteria 733
434 Ga0207678_11438138 3300026067 Bacteria 609
435 Ga0207702_10119468 3300026078 Bacteria 2357
436 Ga0207702_10455360 3300026078 Bacteria 1242
437 Ga0207702_10511364 3300026078 Bacteria 1171
438 Ga0207702_10513881 3300026078 Bacteria 1169
439 Ga0207702_11499125 3300026078 Bacteria 668
440 Ga0207641_10035286 3300026088 Bacteria 4165
441 Ga0207641_10508350 3300026088 Bacteria 1171
442 Ga0207648_10333445 3300026089 Bacteria 1365
443 Ga0207648_10413253 3300026089 Bacteria 1224
444 Ga0207676_10154288 3300026095 Bacteria 1981
445 Ga0207674_10000532 3300026116 Bacteria 49916
446 Ga0207674_10052208 3300026116 Bacteria 4170
447 Ga0207674_10226479 3300026116 Bacteria 1818
448 Ga0207698_10008589 3300026142 Bacteria 6472
449 Ga0207698_10107780 3300026142 Bacteria 2327
450 Ga0207698_10361539 3300026142 Bacteria 1375
451 Ga0268266_10043642 3300028379 Bacteria 3832
452 Ga0268266_10096471 3300028379 Bacteria 2599
453 Ga0268266_10389723 3300028379 Bacteria 1315
454 Ga0268266_10907490 3300028379 Bacteria 852
455 Ga0268266_11631192 3300028379 Bacteria 620
456 Ga0265326_10114635 3300028558 Bacteria 766
457 Ga0265319_1274486 3300028563 Bacteria 513
458 Ga0265318_10024920 3300028577 Bacteria 2367
459 Ga0265336_10002166 3300028666 Bacteria 8298
460 Ga0265336_10055872 3300028666 Bacteria 1186
461 Ga0265336_10157622 3300028666 Bacteria 675
462 Ga0265338_10004125 3300028800 Bacteria 19883
463 Ga0265338_10006099 3300028800 Bacteria 15475
464 Ga0265338_10053598 3300028800 Bacteria 3606
465 Ga0265338_10055532 3300028800 Bacteria 3522
466 Ga0265338_10146685 3300028800 Bacteria 1840
467 Ga0265338_10352108 3300028800 Bacteria 1058
468 Ga0265338_10488535 3300028800 Bacteria 868
469 Ga0265338_10657614 3300028800 Bacteria 726
470 Ga0265324_10177768 3300029957 Bacteria 723
471 Ga0265766_1006890 3300030863 Bacteria 753
472 Ga0265777_104715 3300030877 Bacteria 880
473 Ga0265777_123604 3300030877 Bacteria 519
474 Ga0265770_1021345 3300030878 Bacteria 1029
475 Ga0265765_1015598 3300030879 Bacteria 885
476 Ga0265760_10038980 3300031090 Bacteria 1414
477 Ga0265760_10191784 3300031090 Bacteria 687
478 Ga0265330_10000477 3300031235 Bacteria 26910
479 Ga0265330_10001295 3300031235 Bacteria 14638
480 Ga0265330_10018950 3300031235 Bacteria 3158
481 Ga0265330_10026960 3300031235 Bacteria 2597
482 Ga0265330_10037542 3300031235 Bacteria 2156
483 Ga0265330_10319696 3300031235 Bacteria 655
484 Ga0265332_10007740 3300031238 Bacteria 4853
485 Ga0265328_10006319 3300031239 Bacteria 5027
486 Ga0265328_10055285 3300031239 Bacteria 1456
487 Ga0265328_10075251 3300031239 Bacteria 1242
488 Ga0265328_10117315 3300031239 Bacteria 991
489 Ga0265320_10033478 3300031240 Bacteria 2623
490 Ga0265320_10141861 3300031240 Bacteria 1088
491 Ga0265325_10000701 3300031241 Bacteria 24270
492 Ga0265325_10003065 3300031241 Bacteria 11039
493 Ga0265325_10034719 3300031241 Bacteria 2681
494 Ga0265325_10086886 3300031241 Bacteria 1546
495 Ga0265325_10113416 3300031241 Bacteria 1315
496 Ga0265325_10156559 3300031241 Bacteria 1074
497 Ga0265329_10012888 3300031242 Bacteria 2994
498 Ga0265329_10078833 3300031242 Bacteria 1043
499 Ga0265329_10092814 3300031242 Bacteria 958
500 Ga0265340_10001071 3300031247 Bacteria 15572
501 Ga0265340_10052890 3300031247 Bacteria 1962
502 Ga0265340_10113538 3300031247 Bacteria 1250
503 Ga0265340_10202476 3300031247 Bacteria 892
504 Ga0265340_10388081 3300031247 Bacteria 616
505 Ga0265339_10000029 3300031249 Bacteria 139089
506 Ga0265339_10000921 3300031249 Bacteria 22618
507 Ga0265339_10008463 3300031249 Bacteria 6547
508 Ga0265339_10021757 3300031249 Bacteria 3724
509 Ga0265339_10025776 3300031249 Bacteria 3371
510 Ga0265339_10045677 3300031249 Bacteria 2410
511 Ga0265339_10214568 3300031249 Bacteria 944
512 Ga0265331_10011314 3300031250 Bacteria 4891
513 Ga0265331_10137796 3300031250 Bacteria 1111
514 Ga0265331_10217935 3300031250 Bacteria 858
515 Ga0265316_10006934 3300031344 Bacteria 10744
516 Ga0265316_10007872 3300031344 Bacteria 9973
517 Ga0265316_10013957 3300031344 Bacteria 7104
518 Ga0265316_10030435 3300031344 Bacteria 4424
519 Ga0265316_10040636 3300031344 Bacteria 3727
520 Ga0265316_10073825 3300031344 Bacteria 2626
521 Ga0265316_10074456 3300031344 Bacteria 2613
522 Ga0265316_10187641 3300031344 Bacteria 1537
523 Ga0265316_10274545 3300031344 Bacteria 1233
524 Ga0265316_10328871 3300031344 Bacteria 1109
525 Ga0265316_10389958 3300031344 Bacteria 1004
526 Ga0265316_10565701 3300031344 Bacteria 808
527 Ga0265316_11049467 3300031344 Bacteria 566
528 Ga0265313_10001811 3300031595 Bacteria 19545
529 Ga0265313_10002067 3300031595 Bacteria 17973
530 Ga0265313_10163483 3300031595 Bacteria 944
531 Ga0265314_10001691 3300031711 Bacteria 24008
532 Ga0265314_10003098 3300031711 Bacteria 16368
533 Ga0265314_10009254 3300031711 Bacteria 8343
534 Ga0265314_10120206 3300031711 Bacteria 1655
535 Ga0265314_10130954 3300031711 Bacteria 1565
536 Ga0265342_10000307 3300031712 Bacteria 55504
537 Ga0265342_10003578 3300031712 Bacteria 12683
538 Ga0265342_10005760 3300031712 Bacteria 9367
539 Ga0265342_10008915 3300031712 Bacteria 7128
540 Ga0265342_10011411 3300031712 Bacteria 6084
541 Ga0265342_10023416 3300031712 Bacteria 3910
542 Ga0265342_10042608 3300031712 Bacteria 2741
543 Ga0265342_10212570 3300031712 Bacteria 1045
544 Ga0265342_10230440 3300031712 Bacteria 995
545 Ga0316583_10025716 3300032133 Bacteria 2102
546 Ga0316583_10049402 3300032133 Bacteria 1481
547 Ga0316583_10070914 3300032133 Bacteria 1219
548 Ga0307510_10021356 3300033180 Bacteria 7544
549 Ga0307510_10057933 3300033180 Bacteria 4015
550 Ga0307510_10113631 3300033180 Bacteria 2440
551 Ga0373936_0620030 3300035113 Bacteria 509
552 Ga0373954_0158309 3300035118 Bacteria 1108
553 Ga0373943_0283139 3300035170 Bacteria 938
554 Ga0373955_0044969 3300035172 Bacteria 2381
555 Ga0373935_0798760 3300035692 Bacteria 697
556 Ga0373933_0143009 3300035724 Bacteria 1511
557 Ga0373937_0193668 3300036401 Bacteria 1910
558 Ga0373937_0193913 3300036401 Bacteria 1909
559 Ga0373937_0390770 3300036401 Bacteria 1320
560 Ga0373937_0662167 3300036401 Bacteria 990
561 Ga0373937_0893831 3300036401 Bacteria 837
562 Ga0373937_1268394 3300036401 Bacteria 685
563 Ga0373937_1322130 3300036401 Bacteria 669
564 Ga0265778_000274 3300036457 Bacteria 3846
565 Ga0265778_042012 3300036457 Bacteria 611
566 Ga0372808_025990 3300036459 Bacteria 841
567 Ga0373925_0297434 3300037068 Bacteria 1303
568 Ga0395900_0872580 3300037418 Bacteria 824
569 Ga0395900_0975676 3300037418 Bacteria 768
570 Ga0395898_0874566 3300037466 Bacteria 837
571 Ga0436364_1102996 3300037853 Bacteria 744
572 Ga0395901_0258507 3300038443 Bacteria 1813
573 Ga0395901_0624604 3300038443 Bacteria 1084
574 Ga0436365_0942309 3300039437 Bacteria 1944
575 Ga0436360_0020830 3300039438 Bacteria 1273
576 Ga0436360_0228968 3300039438 Bacteria 6461
577 Ga0436360_0276944 3300039438 Bacteria 714
578 Ga0436360_0385320 3300039438 Bacteria 1428
579 Ga0436360_0686235 3300039438 Bacteria 739
580 Ga0436361_0270740 3300039447 Bacteria 8649
581 Ga0436361_0372633 3300039447 Bacteria 3166
582 Ga0436361_0486474 3300039447 Bacteria 9580
583 Ga0436361_0674593 3300039447 Bacteria 3692
584 Ga0436361_0750744 3300039447 Bacteria 1142
585 Ga0436361_0824839 3300039447 Bacteria 4602
586 Ga0436361_0950252 3300039447 Bacteria 868
587 Ga0436361_1077281 3300039447 Bacteria 751
588 Ga0436361_1086046 3300039447 Bacteria 694
589 Ga0436363_0704407 3300039450 Bacteria 3613
590 Ga0436362_0140245 3300039453 Bacteria 730
591 Ga0436362_0574597 3300039453 Bacteria 900
592 Ga0436362_0929367 3300039453 Bacteria 838
593 Ga0466969_0060890 3300044656 Bacteria 1835
594 Ga0466972_0383083 3300044658 Bacteria 659
595 Ga0466966_0153642 3300044684 Bacteria 1403
596 Ga0466961_0302188 3300044693 Bacteria 977
597 Ga0466961_0504271 3300044693 Bacteria 731
598 Ga0466970_0713229 3300044765 Bacteria 585
599 Ga0466959_0611243 3300045049 Bacteria 733
600 Ga0466958_0391635 3300045836 Bacteria 896
601 Ga0466958_0395944 3300045836 Bacteria 891
602 Ga0466958_0565165 3300045836 Bacteria 739
603 Ga0466958_0568065 3300045836 Bacteria 737
604 Ga0466967_0073852 3300045976 Bacteria 3061
605 Ga0495617_037889 3300046452 Bacteria 1614
606 Ga0495592_0048563 3300046454 Bacteria 3157
607 Ga0495592_0099518 3300046454 Bacteria 2074
608 Ga0495603_0019644 3300046455 Bacteria 4090
609 Ga0495603_0086693 3300046455 Bacteria 1832
610 Ga0495603_0169854 3300046455 Bacteria 1263
611 Ga0495590_0073335 3300046457 Bacteria 1203
612 Ga0495590_0265606 3300046457 Bacteria 640
613 Ga0495629_0051980 3300046459 Bacteria 2867
614 Ga0495629_0055550 3300046459 Bacteria 2768
615 Ga0495629_1129920 3300046459 Bacteria 505
616 Ga0495638_0341614 3300046460 Bacteria 793
617 Ga0495641_0194345 3300046461 Bacteria 909
618 Ga0495641_0574191 3300046461 Bacteria 515
619 Ga0495651_0024980 3300046462 Bacteria 4648
620 Ga0495651_0049871 3300046462 Bacteria 3231
621 Ga0495651_0065572 3300046462 Bacteria 2773
622 Ga0495653_0002196 3300046463 Bacteria 15433
623 Ga0495650_0000010 3300046471 Bacteria 645599
624 Ga0495650_0001875 3300046471 Bacteria 18731
625 Ga0495650_0197969 3300046471 Bacteria 699
626 Ga0495580_0067138 3300046472 Bacteria 2510
627 Ga0495580_0085802 3300046472 Bacteria 2192
628 Ga0495580_0170496 3300046472 Bacteria 1505
629 Ga0495580_0198427 3300046472 Bacteria 1383
630 Ga0495582_0008570 3300046473 Bacteria 5638
631 Ga0495582_0129170 3300046473 Bacteria 1427
632 Ga0495582_0146543 3300046473 Bacteria 1339
633 Ga0495582_0520871 3300046473 Bacteria 687
634 Ga0495605_0151598 3300046474 Bacteria 1034
635 Ga0495639_0001203 3300046475 Bacteria 11668
636 Ga0495639_0076479 3300046475 Bacteria 1553
637 Ga0495662_0000747 3300046476 Bacteria 15591
638 Ga0495662_0101009 3300046476 Bacteria 1411
639 Ga0495664_0107665 3300046477 Bacteria 1682
640 Ga0495664_0127829 3300046477 Bacteria 1538
641 Ga0495664_0160449 3300046477 Bacteria 1364
642 Ga0495664_0401226 3300046477 Bacteria 823
643 Ga0495664_0408212 3300046477 Bacteria 815
644 Ga0495585_0007246 3300046492 Bacteria 6811
645 Ga0495585_0104010 3300046492 Bacteria 1516
646 Ga0495594_0008173 3300046499 Bacteria 5385
647 Ga0495594_0046135 3300046499 Bacteria 2392
648 Ga0495594_0771920 3300046499 Bacteria 542
649 Ga0495596_0038690 3300046500 Bacteria 1885
650 Ga0495607_0240149 3300046501 Bacteria 877
651 Ga0495583_0052529 3300046506 Bacteria 1853
652 Ga0495583_0162272 3300046506 Bacteria 921
653 Ga0495606_0169637 3300046507 Bacteria 1267
654 Ga0495606_0220620 3300046507 Bacteria 1068
655 Ga0495606_0243681 3300046507 Bacteria 1001
656 Ga0495608_0414698 3300046511 Bacteria 822
657 Ga0495618_0139851 3300046514 Bacteria 1549
658 Ga0495628_0040852 3300046516 Bacteria 3704
659 Ga0495628_0332235 3300046516 Bacteria 1120
660 Ga0495628_0487071 3300046516 Bacteria 892
661 Ga0495630_0056994 3300046517 Bacteria 2928
662 Ga0495630_0409047 3300046517 Bacteria 1040
663 Ga0495631_0104248 3300046518 Bacteria 1220
664 Ga0495631_0146549 3300046518 Bacteria 1013
665 Ga0495644_0000777 3300046523 Bacteria 13129
666 Ga0495648_0038427 3300046524 Bacteria 3061
667 Ga0495648_0372927 3300046524 Bacteria 645
668 Ga0495666_0000949 3300046526 Bacteria 13647
669 Ga0495642_0026468 3300046528 Bacteria 2304
670 Ga0495652_0010348 3300046529 Bacteria 8451
671 Ga0495652_0033406 3300046529 Bacteria 4491
672 Ga0495652_0115140 3300046529 Bacteria 2155
673 Ga0495665_0003007 3300046531 Bacteria 9111
674 Ga0495665_0033282 3300046531 Bacteria 2757
675 Ga0495640_0018326 3300046533 Bacteria 5196
676 Ga0495586_0003386 3300046535 Bacteria 8551
677 Ga0495587_0014310 3300046536 Bacteria 4980
678 Ga0495587_0035208 3300046536 Bacteria 3017
679 Ga0495609_0063305 3300046538 Bacteria 1632
680 Ga0495609_0075964 3300046538 Bacteria 1473
681 Ga0495645_0001054 3300046543 Bacteria 18775
682 Ga0495645_0006005 3300046543 Bacteria 8397
683 Ga0495645_0008101 3300046543 Bacteria 7323
684 Ga0495645_0014411 3300046543 Bacteria 5610
685 Ga0495645_0246041 3300046543 Bacteria 1191
686 Ga0495622_0467239 3300046557 Bacteria 540
687 Ga0495633_0013370 3300046558 Bacteria 4329
688 Ga0495667_0003070 3300046559 Bacteria 11203
689 Ga0495667_0794900 3300046559 Bacteria 583
690 Ga0495668_0021631 3300046616 Bacteria 3686
691 Ga0495668_0120025 3300046616 Bacteria 1438
692 Ga0495634_0001003 3300046642 Bacteria 26591
693 Ga0495611_0365400 3300046648 Bacteria 661
694 Ga0495625_0003213 3300046660 Bacteria 16576
695 Ga0495625_0013458 3300046660 Bacteria 6575
696 Ga0495625_0042541 3300046660 Bacteria 3300
697 Ga0495625_0044844 3300046660 Bacteria 3199
698 Ga0495625_0071757 3300046660 Bacteria 2429
699 Ga0495625_0171924 3300046660 Bacteria 1446
700 Ga0495635_0007598 3300046663 Bacteria 7562
701 Ga0495635_0148424 3300046663 Bacteria 1596
702 Ga0495659_0114422 3300046664 Bacteria 1056
703 Ga0495661_0009905 3300046665 Bacteria 6520
704 Ga0495661_0389233 3300046665 Bacteria 680
705 Ga0495588_0020496 3300046674 Bacteria 3251
706 Ga0495588_0200104 3300046674 Bacteria 1055
707 Ga0495657_0497560 3300046675 Bacteria 711
708 Ga0495599_0016425 3300046678 Bacteria 4595
709 Ga0495599_0031846 3300046678 Bacteria 3310
710 Ga0495599_0191735 3300046678 Bacteria 1257
711 Ga0495623_0021136 3300046679 Bacteria 4205
712 Ga0495623_0035235 3300046679 Bacteria 3208
713 Ga0495623_0356629 3300046679 Bacteria 795
714 Ga0495646_0012115 3300046680 Bacteria 5483
715 Ga0495646_0261301 3300046680 Bacteria 925
716 Ga0495646_0292279 3300046680 Bacteria 863
717 Ga0495647_0337116 3300046681 Bacteria 685
718 Ga0495658_0095303 3300046683 Bacteria 1769
719 Ga0495658_0134260 3300046683 Bacteria 1509
720 Ga0495669_0000955 3300046684 Bacteria 12075
721 Ga0495669_0048229 3300046684 Bacteria 1905
722 Ga0495669_0164802 3300046684 Bacteria 1053
723 Ga0495613_0012294 3300046689 Bacteria 6357
724 Ga0495613_0026345 3300046689 Bacteria 4332
725 Ga0495613_0206159 3300046689 Bacteria 1384
726 Ga0495624_0003012 3300046690 Bacteria 12609
727 Ga0495624_0105187 3300046690 Bacteria 1737
728 Ga0495670_0044582 3300046691 Bacteria 2214
729 Ga0495671_0103700 3300046692 Bacteria 1389
730 Ga0495649_0087213 3300046694 Bacteria 1665
731 Ga0495649_0116151 3300046694 Bacteria 1417
732 Ga0495649_0324589 3300046694 Bacteria 781
733 Ga0495649_0403724 3300046694 Bacteria 686
734 Ga0495589_0198735 3300046794 Bacteria 947
735 Ga0495600_0003517 3300046809 Bacteria 9206
736 Ga0495600_0070830 3300046809 Bacteria 2278
737 Ga0495600_0203032 3300046809 Bacteria 1272
738 Ga0495581_0000275 3300047315 Bacteria 24951
739 Ga0495604_0005020 3300047317 Bacteria 10473
740 Ga0495604_0006391 3300047317 Bacteria 9348
741 Ga0495604_0036403 3300047317 Bacteria 3880
742 Ga0495604_0688989 3300047317 Bacteria 649
743 Ga0495636_0026297 3300047318 Bacteria 2367
744 Ga0495674_0022106 3300047319 Bacteria 5870
745 Ga0495674_0657525 3300047319 Bacteria 826
746 Ga0495672_0004479 3300047320 Bacteria 11425
747 Ga0495672_0081242 3300047320 Bacteria 1805
748 Ga0495676_0007390 3300047321 Bacteria 10083
749 Ga0495680_0023728 3300047322 Bacteria 5097
750 Ga0495683_0054067 3300047323 Bacteria 2002
751 Ga0495687_023471 3300047443 Bacteria 2945
752 Ga0495675_0004057 3300047444 Bacteria 8870
753 Ga0495675_0490485 3300047444 Bacteria 706
754 Ga0495675_0608441 3300047444 Bacteria 619
755 Ga0495677_0029395 3300047445 Bacteria 1998
756 Ga0495673_0046320 3300047469 Bacteria 1928
757 Ga0495673_0085086 3300047469 Bacteria 1302
758 Ga0495681_0104518 3300047470 Bacteria 1234
759 Ga0495684_0009955 3300047471 Bacteria 7343
760 Ga0495684_0420787 3300047471 Bacteria 934
761 Ga0495684_0430257 3300047471 Bacteria 921
762 Ga0495686_0000545 3300047472 Bacteria 53866
763 Ga0495686_0002881 3300047472 Bacteria 15450
764 Ga0495686_0006326 3300047472 Bacteria 9086
765 Ga0495686_0014417 3300047472 Bacteria 5440
766 Ga0495686_0024306 3300047472 Bacteria 3984
767 Ga0495686_0045899 3300047472 Bacteria 2763
768 Ga0495686_0066670 3300047472 Bacteria 2224
769 Ga0495686_0420547 3300047472 Bacteria 714
770 Ga0495593_0070451 3300047673 Bacteria 1817
771 Ga0495593_0436075 3300047673 Bacteria 655
772 Ga0495602_0061846 3300048088 Bacteria 3252
773 Ga0495602_0196969 3300048088 Bacteria 1540
774 Ga0495602_0727973 3300048088 Bacteria 671
775 Ga0495614_0004587 3300048089 Bacteria 6220
776 Ga0495614_0042970 3300048089 Bacteria 1937
777 Ga0496100_0931670 3300048903 Bacteria 683
778 Ga0496100_1237580 3300048903 Bacteria 589
779 Ga0496101_0173120 3300048904 Bacteria 1660
780 Ga0496101_0252000 3300048904 Bacteria 1376
781 Ga0496101_0981084 3300048904 Bacteria 665
782 Ga0496101_0984514 3300048904 Bacteria 663
783 Ga0496104_0061071 3300048907 Bacteria 3572
784 Ga0496104_0097200 3300048907 Bacteria 2818
785 Ga0496104_0162506 3300048907 Bacteria 2142
786 Ga0496104_0262614 3300048907 Bacteria 1639
787 Ga0496104_1457421 3300048907 Bacteria 587
788 Ga0496105_0133722 3300048908 Bacteria 2043
789 Ga0496105_0339545 3300048908 Bacteria 1201
790 Ga0496105_0497224 3300048908 Bacteria 958
791 Ga0496105_0686913 3300048908 Bacteria 787
792 Ga0496105_1235552 3300048908 Bacteria 548
793 Ga0496106_0458764 3300048909 Bacteria 1024
794 Ga0496106_1095593 3300048909 Bacteria 624
795 Ga0496107_0162603 3300048910 Bacteria 1655
796 Ga0496107_0828685 3300048910 Bacteria 676
797 Ga0496107_0881946 3300048910 Bacteria 653
798 Ga0496108_0179181 3300048911 Bacteria 1835
799 Ga0496108_0454517 3300048911 Bacteria 1119
800 Ga0496109_0425937 3300048912 Bacteria 1254
801 Ga0496110_1178700 3300048913 Bacteria 675
802 Ga0496110_1244749 3300048913 Bacteria 653
803 Ga0496111_0156901 3300048914 Bacteria 1689
804 Ga0496111_0582383 3300048914 Bacteria 820
805 Ga0496112_0310070 3300048915 Bacteria 1523
806 Ga0496112_0630485 3300048915 Bacteria 1002
807 Ga0496112_0636936 3300048915 Bacteria 996
808 Ga0496113_0047824 3300048916 Bacteria 3180
809 Ga0496114_0098797 3300048917 Bacteria 2489
810 Ga0496114_0306071 3300048917 Bacteria 1403
811 Ga0496114_1336806 3300048917 Bacteria 604
812 Ga0496114_1540190 3300048917 Bacteria 553
813 Ga0496115_0027967 3300048918 Bacteria 4415
814 Ga0496115_0104212 3300048918 Bacteria 2328
815 Ga0496115_0152147 3300048918 Bacteria 1911
816 Ga0496115_0310631 3300048918 Bacteria 1291
817 Ga0496115_0335496 3300048918 Bacteria 1234
818 Ga0496115_0450425 3300048918 Bacteria 1040
819 Ga0496120_0172031 3300048923 Bacteria 1071
820 Ga0496121_0419073 3300048924 Bacteria 872
821 Ga0496124_0276545 3300048927 Bacteria 1227
822 Ga0496126_0000005 3300048929 Bacteria 891906
823 Ga0496126_0000209 3300048929 Bacteria 131440
824 Ga0496126_0000560 3300048929 Bacteria 71370
825 Ga0496126_0003148 3300048929 Bacteria 21270
826 Ga0496126_0009044 3300048929 Bacteria 10652
827 Ga0496126_0277238 3300048929 Bacteria 1390
828 Ga0496126_0390269 3300048929 Bacteria 1131
829 Ga0496126_0888953 3300048929 Bacteria 676
830 Ga0496126_0992538 3300048929 Bacteria 631
831 Ga0495682_0020449 3300049460 Bacteria 2485
832 Ga0495682_0026975 3300049460 Bacteria 2132
833 Ga0495682_0094546 3300049460 Bacteria 1073
834 Ga0495682_0171372 3300049460 Bacteria 772
835 Ga0501031_0097064 3300049568 Bacteria 1923
836 Ga0501031_0293977 3300049568 Bacteria 1053
837 Ga0501032_0005510 3300049569 Bacteria 9390
838 Ga0501032_1022762 3300049569 Bacteria 519
839 Ga0501033_0008766 3300049570 Bacteria 7819
840 Ga0501034_0014438 3300049571 Bacteria 8132
841 Ga0501036_0001574 3300049572 Bacteria 17653
842 Ga0501036_1256767 3300049572 Bacteria 602
843 Ga0501037_0007110 3300049573 Bacteria 8181
844 Ga0501037_0034434 3300049573 Bacteria 3737
845 Ga0501038_0039432 3300049574 Bacteria 4131
846 Ga0501039_0033853 3300049575 Bacteria 3942
847 Ga0501043_0002607 3300049579 Bacteria 15212
848 Ga0501043_0146637 3300049579 Bacteria 1848
849 Ga0501043_0776962 3300049579 Bacteria 694
850 Ga0501046_0000150 3300049580 Bacteria 72900
851 Ga0501047_0003876 3300049581 Bacteria 14071
852 Ga0501047_0014539 3300049581 Bacteria 7487
853 Ga0501048_0221075 3300049582 Bacteria 1343
854 Ga0501069_0405717 3300049585 Bacteria 807
855 Ga0501069_0717165 3300049585 Bacteria 604
856 Ga0501070_0073834 3300049586 Bacteria 2823
857 Ga0501073_0011548 3300049589 Bacteria 6458
858 Ga0501073_0046410 3300049589 Bacteria 3055
859 Ga0501079_0636503 3300049741 Bacteria 840
860 Ga0501080_0022666 3300049742 Bacteria 5817
861 Ga0501080_0098664 3300049742 Bacteria 2711
862 Ga0501035_0030018 3300049822 Bacteria 4957
863 Ga0501035_0211173 3300049822 Bacteria 1660
864 Ga0501035_0460411 3300049822 Bacteria 1051
865 Ga0501044_0005372 3300049823 Bacteria 14234
866 Ga0501044_0034545 3300049823 Bacteria 5301
867 Ga0501044_0145264 3300049823 Bacteria 2358
868 Ga0501045_0741216 3300049824 Bacteria 724
869 nmdc:mga05p37_167227_c1 3300050507 Bacteria 2683
870 Ga0495601_0234521 3300053077 Bacteria 1198
871 Ga0495601_0238064 3300053077 Bacteria 1189
872 Ga0495601_0238620 3300053077 Bacteria 1187
873 Ga0495601_0547492 3300053077 Bacteria 745
874 Ga0495595_0333460 3300053084 Bacteria 765
875 Ga0495619_0572229 3300053085 Bacteria 774
876 Ga0495619_0906341 3300053085 Bacteria 593
877 Ga0500643_027281 3300053087 Bacteria 1776
878 Ga0500651_0000049 3300053093 Bacteria 83361
879 Ga0500595_000014 3300053119 Bacteria 247996
880 Ga0500595_009469 3300053119 Bacteria 3929
881 Ga0500595_071903 3300053119 Bacteria 1024
882 Ga0500655_026758 3300053133 Bacteria 1099
883 Ga0500559_0098074 3300053136 Bacteria 1348
884 Ga0500552_098504 3300053733 Bacteria 553
885 Ga0501084_0836701 3300054114 Bacteria 775
886 Ga0587070_235682 3300059491 Bacteria 503
887 Ga0587094_108760 3300059513 Bacteria 543

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059491 Ga0587070_235682 Ga0587070_235682_33_320 90
2 3300024225 Ga0224572_1040625 Ga0224572_10406253 96
3 3300005336 Ga0070680_100075737 Ga0070680_1000757371 98
4 3300039450 Ga0436363_0704407 Ga0436363_0704407_2888_3193 99
5 3300039453 Ga0436362_0574597 Ga0436362_0574597_131_460 99
6 3300010159 Ga0099796_10190101 Ga0099796_101901012 100
7 3300019182 Ga0184598_113851 Ga0184598_1138511 100
8 3300048929 Ga0496126_0888953 Ga0496126_0888953_301_612 100
9 3300004803 Ga0058862_12712161 Ga0058862_127121612 101
10 3300005327 Ga0070658_10253679 Ga0070658_102536792 101
11 3300005327 Ga0070658_11047070 Ga0070658_110470702 101
12 3300005336 Ga0070680_100091294 Ga0070680_1000912943 101
13 3300005455 Ga0070663_101348258 Ga0070663_1013482581 101
14 3300005458 Ga0070681_11194031 Ga0070681_111940312 101
15 3300005530 Ga0070679_101411759 Ga0070679_1014117591 101
16 3300005842 Ga0068858_100606443 Ga0068858_1006064433 101
17 3300013102 Ga0157371_10149884 Ga0157371_101498843 101
18 3300013104 Ga0157370_10419687 Ga0157370_104196873 101
19 3300013105 Ga0157369_10870738 Ga0157369_108707382 101
20 3300013307 Ga0157372_10235497 Ga0157372_102354974 101
21 3300020070 Ga0206356_10233622 Ga0206356_102336221 101
22 3300020075 Ga0206349_1580743 Ga0206349_15807431 101
23 3300020078 Ga0206352_10132864 Ga0206352_101328642 101
24 3300020610 Ga0154015_1664317 Ga0154015_16643172 101
25 3300025919 Ga0207657_11395162 Ga0207657_113951622 101
26 3300025920 Ga0207649_11429412 Ga0207649_114294121 101
27 3300026067 Ga0207678_10418017 Ga0207678_104180173 101
28 3300026067 Ga0207678_11438138 Ga0207678_114381382 101
29 3300037418 Ga0395900_0872580 Ga0395900_0872580_409_717 101
30 3300037466 Ga0395898_0874566 Ga0395898_0874566_463_771 101
31 3300038443 Ga0395901_0624604 Ga0395901_0624604_301_609 101
32 3300039437 Ga0436365_0942309 Ga0436365_0942309_796_1116 101
33 3300049585 Ga0501069_0717165 Ga0501069_0717165_90_398 101
34 3300009148 Ga0105243_11064316 Ga0105243_110643162 102
35 3300013104 Ga0157370_10007024 Ga0157370_1000702417 102
36 3300013105 Ga0157369_10118054 Ga0157369_101180544 102
37 3300013307 Ga0157372_10233303 Ga0157372_102333034 102
38 3300014969 Ga0157376_10028432 Ga0157376_100284325 102
39 3300025928 Ga0207700_10196726 Ga0207700_101967264 102
40 3300025981 Ga0207640_10262866 Ga0207640_102628662 102
41 3300026142 Ga0207698_10107780 Ga0207698_101077803 102
42 3300030879 Ga0265765_1015598 Ga0265765_10155982 102
43 3300036457 Ga0265778_042012 Ga0265778_042012_25_339 102
44 3300039453 Ga0436362_0929367 Ga0436362_0929367_171_482 102
45 3300044693 Ga0466961_0504271 Ga0466961_0504271_204_515 102
46 3300045836 Ga0466958_0395944 Ga0466958_0395944_157_468 102
47 3300048929 Ga0496126_0003148 Ga0496126_0003148_17795_18112 102
48 3300048929 Ga0496126_0277238 Ga0496126_0277238_233_547 102
49 3300048929 Ga0496126_0390269 Ga0496126_0390269_273_587 102
50 3300003659 JGI25404J52841_10035318 JGI25404J52841_100353183 103
51 3300005367 Ga0070667_100326259 Ga0070667_1003262594 103
52 3300005548 Ga0070665_100138605 Ga0070665_1001386056 103
53 3300005841 Ga0068863_100441707 Ga0068863_1004417073 103
54 3300005842 Ga0068858_101327357 Ga0068858_1013273572 103
55 3300005937 Ga0081455_10401326 Ga0081455_104013263 103
56 3300005983 Ga0081540_1027528 Ga0081540_10275286 103
57 3300009545 Ga0105237_10166637 Ga0105237_101666374 103
58 3300010375 Ga0105239_10263000 Ga0105239_102630004 103
59 3300013105 Ga0157369_11888698 Ga0157369_118886981 103
60 3300025903 Ga0207680_10043011 Ga0207680_100430114 103
61 3300025904 Ga0207647_10004892 Ga0207647_100048929 103
62 3300025914 Ga0207671_11114049 Ga0207671_111140492 103
63 3300026088 Ga0207641_10508350 Ga0207641_105083502 103
64 3300028379 Ga0268266_10096471 Ga0268266_100964711 103
65 3300039447 Ga0436361_1086046 Ga0436361_1086046_205_522 103
66 3300044658 Ga0466972_0383083 Ga0466972_0383083_105_425 103
67 3300046457 Ga0495590_0073335 Ga0495590_0073335_541_861 103
68 3300046507 Ga0495606_0169637 Ga0495606_0169637_14_334 103
69 3300046694 Ga0495649_0087213 Ga0495649_0087213_520_840 103
70 3300047443 Ga0495687_023471 Ga0495687_023471_1199_1519 103
71 3300047472 Ga0495686_0024306 Ga0495686_0024306_1313_1660 103
72 3300049460 Ga0495682_0094546 Ga0495682_0094546_83_403 103
73 3300005436 Ga0070713_101809854 Ga0070713_1018098541 104
74 3300005468 Ga0070707_101205634 Ga0070707_1012056342 104
75 3300005563 Ga0068855_101177227 Ga0068855_1011772272 104
76 3300005614 Ga0068856_100645530 Ga0068856_1006455302 104
77 3300006028 Ga0070717_10050783 Ga0070717_100507834 104
78 3300006175 Ga0070712_101640752 Ga0070712_1016407522 104
79 3300009098 Ga0105245_11891649 Ga0105245_118916491 104
80 3300010375 Ga0105239_10517504 Ga0105239_105175042 104
81 3300013297 Ga0157378_10695612 Ga0157378_106956122 104
82 3300025906 Ga0207699_10312742 Ga0207699_103127423 104
83 3300025915 Ga0207693_11059811 Ga0207693_110598112 104
84 3300025916 Ga0207663_10017844 Ga0207663_100178444 104
85 3300025928 Ga0207700_11031631 Ga0207700_110316312 104
86 3300025932 Ga0207690_11272767 Ga0207690_112727672 104
87 3300025949 Ga0207667_10528029 Ga0207667_105280292 104
88 3300026078 Ga0207702_11499125 Ga0207702_114991251 104
89 3300032133 Ga0316583_10025716 Ga0316583_100257164 104
90 3300035118 Ga0373954_0158309 Ga0373954_0158309_411_728 104
91 3300036401 Ga0373937_1322130 Ga0373937_1322130_45_362 104
92 3300039438 Ga0436360_0686235 Ga0436360_0686235_331_651 104
93 3300046473 Ga0495582_0129170 Ga0495582_0129170_368_685 104
94 3300046476 Ga0495662_0101009 Ga0495662_0101009_266_583 104
95 3300046683 Ga0495658_0095303 Ga0495658_0095303_1185_1502 104
96 3300047319 Ga0495674_0657525 Ga0495674_0657525_184_501 104
97 3300048907 Ga0496104_0162506 Ga0496104_0162506_509_826 104
98 3300048908 Ga0496105_0497224 Ga0496105_0497224_203_520 104
99 3300048917 Ga0496114_1336806 Ga0496114_1336806_11_328 104
100 3300048918 Ga0496115_0310631 Ga0496115_0310631_190_507 104
101 3300059513 Ga0587094_108760 Ga0587094_108760_29_346 104
102 3300005518 Ga0070699_100892826 Ga0070699_1008928262 105
103 3300005536 Ga0070697_100007786 Ga0070697_10000778611 105
104 3300005545 Ga0070695_100110781 Ga0070695_1001107814 105
105 3300006173 Ga0070716_101013524 Ga0070716_1010135242 105
106 3300006173 Ga0070716_101594069 Ga0070716_1015940692 105
107 3300009147 Ga0114129_10195930 Ga0114129_101959302 105
108 3300013307 Ga0157372_10853250 Ga0157372_108532502 105
109 3300025233 Ga0209437_104260 Ga0209437_1042605 105
110 3300025261 Ga0209233_1002003 Ga0209233_10020038 105
111 3300025939 Ga0207665_10112861 Ga0207665_101128612 105
112 3300035113 Ga0373936_0620030 Ga0373936_0620030_61_381 105
113 3300035692 Ga0373935_0798760 Ga0373935_0798760_353_673 105
114 3300036401 Ga0373937_0390770 Ga0373937_0390770_585_905 105
115 3300036457 Ga0265778_000274 Ga0265778_000274_1721_2125 105
116 3300044656 Ga0466969_0060890 Ga0466969_0060890_752_1072 105
117 3300045049 Ga0466959_0611243 Ga0466959_0611243_276_596 105
118 3300045836 Ga0466958_0565165 Ga0466958_0565165_362_691 105
119 3300048923 Ga0496120_0172031 Ga0496120_0172031_297_614 105
120 3300048924 Ga0496121_0419073 Ga0496121_0419073_346_663 105
121 3300048929 Ga0496126_0000005 Ga0496126_0000005_879822_880139 105
122 3300050507 nmdc:mga05p37_167227_c1 nmdc:mga05p37_167227_c1_1594_1926 105
123 3300053077 Ga0495601_0547492 Ga0495601_0547492_256_576 105
124 iso_pu_bacteria 2884215851 2884219638 105
125 3300003320 rootH2_10096173 rootH2_100961735 106
126 3300009177 Ga0105248_10384554 Ga0105248_103845544 106
127 3300009545 Ga0105237_10391906 Ga0105237_103919063 106
128 3300009553 Ga0105249_10016019 Ga0105249_1001601912 106
129 3300013296 Ga0157374_10389102 Ga0157374_103891022 106
130 3300014968 Ga0157379_12446343 Ga0157379_124463432 106
131 3300021361 Ga0213872_10005926 Ga0213872_1000592612 106
132 3300021441 Ga0213871_10012856 Ga0213871_100128563 106
133 3300025914 Ga0207671_10409157 Ga0207671_104091572 106
134 3300025941 Ga0207711_10205564 Ga0207711_102055641 106
135 3300025961 Ga0207712_10006954 Ga0207712_100069544 106
136 3300028800 Ga0265338_10006099 Ga0265338_1000609911 106
137 3300031344 Ga0265316_10274545 Ga0265316_102745451 106
138 3300031711 Ga0265314_10009254 Ga0265314_100092543 106
139 3300032133 Ga0316583_10049402 Ga0316583_100494023 106
140 3300032133 Ga0316583_10070914 Ga0316583_100709143 106
141 3300035170 Ga0373943_0283139 Ga0373943_0283139_584_907 106
142 3300039438 Ga0436360_0020830 Ga0436360_0020830_333_656 106
143 3300039447 Ga0436361_0270740 Ga0436361_0270740_4985_5308 106
144 3300039447 Ga0436361_1077281 Ga0436361_1077281_378_701 106
145 3300046471 Ga0495650_0000010 Ga0495650_0000010_639536_639856 106
146 3300046665 Ga0495661_0389233 Ga0495661_0389233_317_637 106
147 3300046684 Ga0495669_0164802 Ga0495669_0164802_671_994 106
148 3300047472 Ga0495686_0045899 Ga0495686_0045899_2253_2573 106
149 3300048927 Ga0496124_0276545 Ga0496124_0276545_37_360 106
150 3300053087 Ga0500643_027281 Ga0500643_027281_178_498 106
151 3300004800 Ga0058861_11532275 Ga0058861_115322752 107
152 3300005327 Ga0070658_10009410 Ga0070658_100094106 107
153 3300005329 Ga0070683_100186088 Ga0070683_1001860884 107
154 3300005339 Ga0070660_100513948 Ga0070660_1005139482 107
155 3300005344 Ga0070661_101217640 Ga0070661_1012176402 107
156 3300005366 Ga0070659_100445162 Ga0070659_1004451622 107
157 3300005434 Ga0070709_10495921 Ga0070709_104959212 107
158 3300005436 Ga0070713_100256803 Ga0070713_1002568033 107
159 3300005436 Ga0070713_101554792 Ga0070713_1015547921 107
160 3300005439 Ga0070711_100306354 Ga0070711_1003063543 107
161 3300005458 Ga0070681_10012933 Ga0070681_100129332 107
162 3300005530 Ga0070679_100003562 Ga0070679_1000035629 107
163 3300005535 Ga0070684_100006987 Ga0070684_1000069876 107
164 3300005535 Ga0070684_100539430 Ga0070684_1005394302 107
165 3300005539 Ga0068853_100181095 Ga0068853_1001810953 107
166 3300005548 Ga0070665_100853776 Ga0070665_1008537762 107
167 3300005563 Ga0068855_100006253 Ga0068855_1000062539 107
168 3300005563 Ga0068855_100062458 Ga0068855_1000624587 107
169 3300005577 Ga0068857_100171226 Ga0068857_1001712263 107
170 3300005614 Ga0068856_100461662 Ga0068856_1004616623 107
171 3300005616 Ga0068852_100888369 Ga0068852_1008883692 107
172 3300006358 Ga0068871_101611487 Ga0068871_1016114872 107
173 3300009093 Ga0105240_10007537 Ga0105240_1000753714 107
174 3300009174 Ga0105241_10160507 Ga0105241_101605074 107
175 3300009177 Ga0105248_10000094 Ga0105248_1000009477 107
176 3300009545 Ga0105237_11273966 Ga0105237_112739661 107
177 3300009551 Ga0105238_10006787 Ga0105238_1000678712 107
178 3300010375 Ga0105239_10890865 Ga0105239_108908653 107
179 3300010375 Ga0105239_11900450 Ga0105239_119004502 107
180 3300013100 Ga0157373_10196828 Ga0157373_101968283 107
181 3300013102 Ga0157371_10128407 Ga0157371_101284074 107
182 3300013104 Ga0157370_10008035 Ga0157370_1000803513 107
183 3300013104 Ga0157370_10678274 Ga0157370_106782741 107
184 3300013105 Ga0157369_10026529 Ga0157369_100265299 107
185 3300013105 Ga0157369_10033381 Ga0157369_100333817 107
186 3300013105 Ga0157369_10942606 Ga0157369_109426063 107
187 3300013105 Ga0157369_11702911 Ga0157369_117029112 107
188 3300013296 Ga0157374_10070986 Ga0157374_100709861 107
189 3300013307 Ga0157372_10003289 Ga0157372_1000328917 107
190 3300014497 Ga0182008_10258356 Ga0182008_102583562 107
191 3300014968 Ga0157379_10637831 Ga0157379_106378313 107
192 3300014969 Ga0157376_10277569 Ga0157376_102775693 107
193 3300014969 Ga0157376_10910835 Ga0157376_109108351 107
194 3300020069 Ga0197907_11454979 Ga0197907_114549791 107
195 3300020077 Ga0206351_11002133 Ga0206351_110021332 107
196 3300020082 Ga0206353_10452776 Ga0206353_104527762 107
197 3300021361 Ga0213872_10012057 Ga0213872_100120576 107
198 3300021361 Ga0213872_10015241 Ga0213872_100152413 107
199 3300021361 Ga0213872_10016045 Ga0213872_100160454 107
200 3300021361 Ga0213872_10242057 Ga0213872_102420572 107
201 3300021441 Ga0213871_10002437 Ga0213871_100024373 107
202 3300021441 Ga0213871_10214070 Ga0213871_102140702 107
203 3300022467 Ga0224712_10465873 Ga0224712_104658732 107
204 3300025904 Ga0207647_10274467 Ga0207647_102744672 107
205 3300025906 Ga0207699_10423402 Ga0207699_104234022 107
206 3300025909 Ga0207705_10042888 Ga0207705_100428882 107
207 3300025912 Ga0207707_10007751 Ga0207707_100077512 107
208 3300025913 Ga0207695_10014395 Ga0207695_100143958 107
209 3300025916 Ga0207663_10138731 Ga0207663_101387313 107
210 3300025917 Ga0207660_10033618 Ga0207660_100336183 107
211 3300025919 Ga0207657_10003185 Ga0207657_100031857 107
212 3300025920 Ga0207649_10367667 Ga0207649_103676672 107
213 3300025921 Ga0207652_10021006 Ga0207652_100210069 107
214 3300025924 Ga0207694_10139542 Ga0207694_101395424 107
215 3300025928 Ga0207700_10303151 Ga0207700_103031513 107
216 3300025929 Ga0207664_10468553 Ga0207664_104685532 107
217 3300025939 Ga0207665_10462352 Ga0207665_104623523 107
218 3300025941 Ga0207711_10000086 Ga0207711_1000008612 107
219 3300025944 Ga0207661_10013707 Ga0207661_100137074 107
220 3300025944 Ga0207661_10046339 Ga0207661_100463394 107
221 3300025949 Ga0207667_10004621 Ga0207667_1000462114 107
222 3300025949 Ga0207667_10015592 Ga0207667_100155926 107
223 3300026041 Ga0207639_10149778 Ga0207639_101497783 107
224 3300026078 Ga0207702_10511364 Ga0207702_105113642 107
225 3300026089 Ga0207648_10413253 Ga0207648_104132531 107
226 3300026116 Ga0207674_10052208 Ga0207674_100522086 107
227 3300026142 Ga0207698_10361539 Ga0207698_103615393 107
228 3300028558 Ga0265326_10114635 Ga0265326_101146352 107
229 3300028577 Ga0265318_10024920 Ga0265318_100249203 107
230 3300028666 Ga0265336_10002166 Ga0265336_100021666 107
231 3300028800 Ga0265338_10004125 Ga0265338_1000412512 107
232 3300028800 Ga0265338_10352108 Ga0265338_103521083 107
233 3300030877 Ga0265777_123604 Ga0265777_1236041 107
234 3300031235 Ga0265330_10001295 Ga0265330_1000129521 107
235 3300031238 Ga0265332_10007740 Ga0265332_100077403 107
236 3300031239 Ga0265328_10006319 Ga0265328_100063194 107
237 3300031240 Ga0265320_10033478 Ga0265320_100334781 107
238 3300031241 Ga0265325_10000701 Ga0265325_1000070123 107
239 3300031241 Ga0265325_10113416 Ga0265325_101134163 107
240 3300031242 Ga0265329_10012888 Ga0265329_100128885 107
241 3300031242 Ga0265329_10092814 Ga0265329_100928142 107
242 3300031247 Ga0265340_10001071 Ga0265340_1000107113 107
243 3300031249 Ga0265339_10000921 Ga0265339_1000092112 107
244 3300031249 Ga0265339_10008463 Ga0265339_1000846311 107
245 3300031250 Ga0265331_10011314 Ga0265331_100113144 107
246 3300031344 Ga0265316_10006934 Ga0265316_1000693410 107
247 3300031344 Ga0265316_10073825 Ga0265316_100738252 107
248 3300031595 Ga0265313_10001811 Ga0265313_1000181121 107
249 3300031711 Ga0265314_10001691 Ga0265314_1000169123 107
250 3300031711 Ga0265314_10003098 Ga0265314_1000309812 107
251 3300031712 Ga0265342_10003578 Ga0265342_1000357810 107
252 3300031712 Ga0265342_10008915 Ga0265342_100089158 107
253 3300035172 Ga0373955_0044969 Ga0373955_0044969_649_975 107
254 3300035724 Ga0373933_0143009 Ga0373933_0143009_783_1109 107
255 3300036401 Ga0373937_0193913 Ga0373937_0193913_679_1005 107
256 3300036401 Ga0373937_1268394 Ga0373937_1268394_28_354 107
257 3300037418 Ga0395900_0975676 Ga0395900_0975676_281_607 107
258 3300038443 Ga0395901_0258507 Ga0395901_0258507_1102_1428 107
259 3300039438 Ga0436360_0228968 Ga0436360_0228968_5251_5577 107
260 3300039438 Ga0436360_0276944 Ga0436360_0276944_377_703 107
261 3300039438 Ga0436360_0385320 Ga0436360_0385320_765_1097 107
262 3300039447 Ga0436361_0372633 Ga0436361_0372633_576_902 107
263 3300039447 Ga0436361_0486474 Ga0436361_0486474_6721_7047 107
264 3300039447 Ga0436361_0674593 Ga0436361_0674593_1720_2046 107
265 3300039447 Ga0436361_0750744 Ga0436361_0750744_669_995 107
266 3300039447 Ga0436361_0824839 Ga0436361_0824839_3649_3975 107
267 3300039447 Ga0436361_0950252 Ga0436361_0950252_177_503 107
268 3300039453 Ga0436362_0140245 Ga0436362_0140245_361_693 107
269 3300044765 Ga0466970_0713229 Ga0466970_0713229_151_477 107
270 3300045836 Ga0466958_0391635 Ga0466958_0391635_13_339 107
271 3300046471 Ga0495650_0197969 Ga0495650_0197969_335_658 107
272 3300047471 Ga0495684_0420787 Ga0495684_0420787_406_732 107
273 3300047472 Ga0495686_0000545 Ga0495686_0000545_7189_7512 107
274 3300047472 Ga0495686_0066670 Ga0495686_0066670_1653_1976 107
275 3300048903 Ga0496100_0931670 Ga0496100_0931670_151_477 107
276 3300048904 Ga0496101_0252000 Ga0496101_0252000_624_950 107
277 3300048909 Ga0496106_0458764 Ga0496106_0458764_268_594 107
278 3300048911 Ga0496108_0454517 Ga0496108_0454517_634_960 107
279 3300048917 Ga0496114_1540190 Ga0496114_1540190_35_361 107
280 3300048918 Ga0496115_0450425 Ga0496115_0450425_508_834 107
281 3300053119 Ga0500595_071903 Ga0500595_071903_572_898 107
282 3300053136 Ga0500559_0098074 Ga0500559_0098074_220_543 107
283 3300005327 Ga0070658_10260242 Ga0070658_102602421 108
284 3300005329 Ga0070683_100489624 Ga0070683_1004896243 108
285 3300005337 Ga0070682_100524907 Ga0070682_1005249072 108
286 3300005344 Ga0070661_100025903 Ga0070661_1000259037 108
287 3300005455 Ga0070663_100434226 Ga0070663_1004342261 108
288 3300005530 Ga0070679_102066377 Ga0070679_1020663771 108
289 3300005563 Ga0068855_100000642 Ga0068855_1000006427 108
290 3300005563 Ga0068855_100510374 Ga0068855_1005103742 108
291 3300005563 Ga0068855_100611063 Ga0068855_1006110631 108
292 3300005577 Ga0068857_100619698 Ga0068857_1006196983 108
293 3300005578 Ga0068854_100357835 Ga0068854_1003578353 108
294 3300005614 Ga0068856_100026907 Ga0068856_10002690711 108
295 3300005614 Ga0068856_100173144 Ga0068856_1001731444 108
296 3300005614 Ga0068856_101846696 Ga0068856_1018466961 108
297 3300005616 Ga0068852_102632283 Ga0068852_1026322832 108
298 3300005834 Ga0068851_10004509 Ga0068851_100045094 108
299 3300006237 Ga0097621_102135197 Ga0097621_1021351972 108
300 3300009093 Ga0105240_10027101 Ga0105240_100271015 108
301 3300009174 Ga0105241_10232585 Ga0105241_102325853 108
302 3300009174 Ga0105241_10912483 Ga0105241_109124832 108
303 3300009545 Ga0105237_10753391 Ga0105237_107533911 108
304 3300009545 Ga0105237_11646534 Ga0105237_116465341 108
305 3300009551 Ga0105238_10150267 Ga0105238_101502672 108
306 3300009551 Ga0105238_10616892 Ga0105238_106168923 108
307 3300010375 Ga0105239_12046595 Ga0105239_120465952 108
308 3300013100 Ga0157373_10327152 Ga0157373_103271523 108
309 3300013102 Ga0157371_11031153 Ga0157371_110311531 108
310 3300013104 Ga0157370_10432819 Ga0157370_104328192 108
311 3300013105 Ga0157369_10013194 Ga0157369_1001319411 108
312 3300013105 Ga0157369_10192055 Ga0157369_101920553 108
313 3300013105 Ga0157369_10299684 Ga0157369_102996841 108
314 3300013296 Ga0157374_10010090 Ga0157374_1001009012 108
315 3300013296 Ga0157374_10330132 Ga0157374_103301321 108
316 3300013296 Ga0157374_11071342 Ga0157374_110713422 108
317 3300013297 Ga0157378_10020240 Ga0157378_1002024010 108
318 3300013307 Ga0157372_10012293 Ga0157372_100122935 108
319 3300013307 Ga0157372_10375914 Ga0157372_103759142 108
320 3300013308 Ga0157375_13220794 Ga0157375_132207941 108
321 3300014325 Ga0163163_10335438 Ga0163163_103354383 108
322 3300014968 Ga0157379_10169847 Ga0157379_101698473 108
323 3300014969 Ga0157376_10214467 Ga0157376_102144672 108
324 3300025321 Ga0207656_10007345 Ga0207656_100073456 108
325 3300025909 Ga0207705_10692718 Ga0207705_106927182 108
326 3300025911 Ga0207654_10632971 Ga0207654_106329712 108
327 3300025911 Ga0207654_10782746 Ga0207654_107827462 108
328 3300025912 Ga0207707_11492828 Ga0207707_114928282 108
329 3300025913 Ga0207695_10003215 Ga0207695_1000321512 108
330 3300025913 Ga0207695_10021213 Ga0207695_1002121311 108
331 3300025913 Ga0207695_11398501 Ga0207695_113985012 108
332 3300025914 Ga0207671_10855990 Ga0207671_108559901 108
333 3300025920 Ga0207649_10283538 Ga0207649_102835382 108
334 3300025924 Ga0207694_10131015 Ga0207694_101310152 108
335 3300025924 Ga0207694_10452964 Ga0207694_104529642 108
336 3300025928 Ga0207700_10181268 Ga0207700_101812683 108
337 3300025928 Ga0207700_11114510 Ga0207700_111145102 108
338 3300025929 Ga0207664_10018040 Ga0207664_100180408 108
339 3300025944 Ga0207661_10274727 Ga0207661_102747273 108
340 3300025949 Ga0207667_10014641 Ga0207667_100146417 108
341 3300025949 Ga0207667_10530167 Ga0207667_105301673 108
342 3300026078 Ga0207702_10119468 Ga0207702_101194685 108
343 3300026116 Ga0207674_10226479 Ga0207674_102264792 108
344 3300026142 Ga0207698_10008589 Ga0207698_100085893 108
345 3300028379 Ga0268266_10907490 Ga0268266_109074903 108
346 3300031239 Ga0265328_10075251 Ga0265328_100752512 108
347 3300036401 Ga0373937_0662167 Ga0373937_0662167_13_345 108
348 3300036401 Ga0373937_0893831 Ga0373937_0893831_440_772 108
349 3300044693 Ga0466961_0302188 Ga0466961_0302188_549_884 108
350 3300045836 Ga0466958_0568065 Ga0466958_0568065_58_393 108
351 3300045976 Ga0466967_0073852 Ga0466967_0073852_333_665 108
352 3300046459 Ga0495629_1129920 Ga0495629_1129920_100_432 108
353 3300046472 Ga0495580_0067138 Ga0495580_0067138_902_1234 108
354 3300046473 Ga0495582_0520871 Ga0495582_0520871_283_615 108
355 3300046475 Ga0495639_0076479 Ga0495639_0076479_821_1153 108
356 3300046477 Ga0495664_0107665 Ga0495664_0107665_356_688 108
357 3300046517 Ga0495630_0409047 Ga0495630_0409047_337_669 108
358 3300046531 Ga0495665_0033282 Ga0495665_0033282_215_547 108
359 3300046543 Ga0495645_0246041 Ga0495645_0246041_212_544 108
360 3300046660 Ga0495625_0013458 Ga0495625_0013458_4548_4874 108
361 3300046675 Ga0495657_0497560 Ga0495657_0497560_181_513 108
362 3300046679 Ga0495623_0356629 Ga0495623_0356629_433_765 108
363 3300046680 Ga0495646_0261301 Ga0495646_0261301_412_744 108
364 3300046689 Ga0495613_0206159 Ga0495613_0206159_64_396 108
365 3300047317 Ga0495604_0688989 Ga0495604_0688989_67_399 108
366 3300047444 Ga0495675_0608441 Ga0495675_0608441_163_495 108
367 3300047471 Ga0495684_0430257 Ga0495684_0430257_362_694 108
368 3300047472 Ga0495686_0420547 Ga0495686_0420547_197_526 108
369 3300048088 Ga0495602_0196969 Ga0495602_0196969_512_844 108
370 3300048904 Ga0496101_0981084 Ga0496101_0981084_160_486 108
371 3300048904 Ga0496101_0984514 Ga0496101_0984514_245_577 108
372 3300048907 Ga0496104_0097200 Ga0496104_0097200_184_516 108
373 3300048908 Ga0496105_0133722 Ga0496105_0133722_1610_1942 108
374 3300048908 Ga0496105_0339545 Ga0496105_0339545_309_641 108
375 3300048909 Ga0496106_1095593 Ga0496106_1095593_157_489 108
376 3300048910 Ga0496107_0162603 Ga0496107_0162603_1210_1542 108
377 3300048910 Ga0496107_0828685 Ga0496107_0828685_265_597 108
378 3300048913 Ga0496110_1244749 Ga0496110_1244749_174_506 108
379 3300048914 Ga0496111_0156901 Ga0496111_0156901_538_870 108
380 3300048917 Ga0496114_0098797 Ga0496114_0098797_154_486 108
381 3300048918 Ga0496115_0335496 Ga0496115_0335496_865_1197 108
382 3300049460 Ga0495682_0026975 Ga0495682_0026975_1233_1559 108
383 3300053077 Ga0495601_0238620 Ga0495601_0238620_712_1044 108
384 3300053085 Ga0495619_0572229 Ga0495619_0572229_239_571 108
385 3300053085 Ga0495619_0906341 Ga0495619_0906341_168_500 108
386 3300000546 LJNas_1000189 LJNas_100018910 109
387 3300003320 rootH2_10177754 rootH2_101777543 109
388 3300004799 Ga0058863_10003457 Ga0058863_100034573 109
389 3300004800 Ga0058861_11542957 Ga0058861_115429572 109
390 3300005327 Ga0070658_10376412 Ga0070658_103764122 109
391 3300005336 Ga0070680_100231848 Ga0070680_1002318483 109
392 3300005336 Ga0070680_100442051 Ga0070680_1004420513 109
393 3300005338 Ga0068868_100038932 Ga0068868_1000389322 109
394 3300005435 Ga0070714_101762733 Ga0070714_1017627331 109
395 3300005437 Ga0070710_10327304 Ga0070710_103273042 109
396 3300005455 Ga0070663_101194012 Ga0070663_1011940122 109
397 3300005530 Ga0070679_100030999 Ga0070679_1000309997 109
398 3300005530 Ga0070679_100067206 Ga0070679_1000672066 109
399 3300005539 Ga0068853_100248542 Ga0068853_1002485423 109
400 3300005548 Ga0070665_100046016 Ga0070665_1000460166 109
401 3300005548 Ga0070665_100984802 Ga0070665_1009848021 109
402 3300005614 Ga0068856_100569368 Ga0068856_1005693681 109
403 3300005842 Ga0068858_100188042 Ga0068858_1001880424 109
404 3300006175 Ga0070712_101349258 Ga0070712_1013492581 109
405 3300009093 Ga0105240_10132535 Ga0105240_101325352 109
406 3300009093 Ga0105240_10280570 Ga0105240_102805702 109
407 3300009098 Ga0105245_10115478 Ga0105245_101154784 109
408 3300009101 Ga0105247_10101615 Ga0105247_101016154 109
409 3300009177 Ga0105248_10003761 Ga0105248_1000376121 109
410 3300009545 Ga0105237_10161658 Ga0105237_101616582 109
411 3300009551 Ga0105238_12358853 Ga0105238_123588532 109
412 3300010375 Ga0105239_13623665 Ga0105239_136236651 109
413 3300013104 Ga0157370_10049002 Ga0157370_100490027 109
414 3300013104 Ga0157370_10619041 Ga0157370_106190413 109
415 3300013105 Ga0157369_10059538 Ga0157369_100595387 109
416 3300013105 Ga0157369_12296453 Ga0157369_122964531 109
417 3300013296 Ga0157374_10191481 Ga0157374_101914814 109
418 3300013296 Ga0157374_10367640 Ga0157374_103676401 109
419 3300013296 Ga0157374_11161494 Ga0157374_111614942 109
420 3300013297 Ga0157378_10659345 Ga0157378_106593453 109
421 3300013307 Ga0157372_10583983 Ga0157372_105839833 109
422 3300013307 Ga0157372_11125503 Ga0157372_111255032 109
423 3300014325 Ga0163163_10111041 Ga0163163_101110412 109
424 3300014968 Ga0157379_11383331 Ga0157379_113833312 109
425 3300014969 Ga0157376_10173307 Ga0157376_101733073 109
426 3300020075 Ga0206349_1064812 Ga0206349_10648122 109
427 3300025321 Ga0207656_10259307 Ga0207656_102593072 109
428 3300025904 Ga0207647_10022019 Ga0207647_100220198 109
429 3300025913 Ga0207695_10332441 Ga0207695_103324411 109
430 3300025913 Ga0207695_11530822 Ga0207695_115308222 109
431 3300025914 Ga0207671_10047104 Ga0207671_100471042 109
432 3300025915 Ga0207693_10993744 Ga0207693_109937442 109
433 3300025917 Ga0207660_10099104 Ga0207660_100991041 109
434 3300025917 Ga0207660_10201117 Ga0207660_102011172 109
435 3300025921 Ga0207652_10049501 Ga0207652_100495016 109
436 3300025921 Ga0207652_10472137 Ga0207652_104721372 109
437 3300025924 Ga0207694_10011619 Ga0207694_100116194 109
438 3300025927 Ga0207687_10320435 Ga0207687_103204352 109
439 3300025941 Ga0207711_10015612 Ga0207711_100156124 109
440 3300026023 Ga0207677_10095968 Ga0207677_100959683 109
441 3300026035 Ga0207703_10248950 Ga0207703_102489502 109
442 3300026041 Ga0207639_10035600 Ga0207639_100356004 109
443 3300026067 Ga0207678_11019590 Ga0207678_110195902 109
444 3300026078 Ga0207702_10455360 Ga0207702_104553601 109
445 3300028379 Ga0268266_10043642 Ga0268266_100436426 109
446 3300028379 Ga0268266_11631192 Ga0268266_116311922 109
447 3300028563 Ga0265319_1274486 Ga0265319_12744862 109
448 3300028666 Ga0265336_10157622 Ga0265336_101576221 109
449 3300028800 Ga0265338_10146685 Ga0265338_101466852 109
450 3300029957 Ga0265324_10177768 Ga0265324_101777682 109
451 3300031235 Ga0265330_10319696 Ga0265330_103196962 109
452 3300031239 Ga0265328_10055285 Ga0265328_100552852 109
453 3300031239 Ga0265328_10117315 Ga0265328_101173153 109
454 3300031241 Ga0265325_10086886 Ga0265325_100868862 109
455 3300031249 Ga0265339_10000029 Ga0265339_1000002912 109
456 3300031249 Ga0265339_10214568 Ga0265339_102145682 109
457 3300031250 Ga0265331_10137796 Ga0265331_101377963 109
458 3300031344 Ga0265316_10187641 Ga0265316_101876411 109
459 3300031712 Ga0265342_10000307 Ga0265342_1000030747 109
460 3300031712 Ga0265342_10005760 Ga0265342_1000576015 109
461 3300044684 Ga0466966_0153642 Ga0466966_0153642_647_985 109
462 3300046471 Ga0495650_0001875 Ga0495650_0001875_12564_12896 109
463 3300046477 Ga0495664_0408212 Ga0495664_0408212_458_796 109
464 3300046543 Ga0495645_0014411 Ga0495645_0014411_2507_2845 109
465 3300046660 Ga0495625_0003213 Ga0495625_0003213_14819_15151 109
466 3300046684 Ga0495669_0048229 Ga0495669_0048229_184_522 109
467 3300046694 Ga0495649_0116151 Ga0495649_0116151_176_508 109
468 3300047472 Ga0495686_0002881 Ga0495686_0002881_8133_8465 109
469 3300048088 Ga0495602_0727973 Ga0495602_0727973_138_476 109
470 3300048907 Ga0496104_0262614 Ga0496104_0262614_988_1326 109
471 3300048908 Ga0496105_1235552 Ga0496105_1235552_46_384 109
472 3300048912 Ga0496109_0425937 Ga0496109_0425937_218_556 109
473 3300048913 Ga0496110_1178700 Ga0496110_1178700_135_473 109
474 3300048914 Ga0496111_0582383 Ga0496111_0582383_464_802 109
475 3300048915 Ga0496112_0630485 Ga0496112_0630485_243_581 109
476 3300048915 Ga0496112_0636936 Ga0496112_0636936_243_581 109
477 3300048916 Ga0496113_0047824 Ga0496113_0047824_2151_2489 109
478 3300048918 Ga0496115_0027967 Ga0496115_0027967_2116_2454 109
479 3300048929 Ga0496126_0009044 Ga0496126_0009044_4721_5059 109
480 3300048929 Ga0496126_0992538 Ga0496126_0992538_253_585 109
481 3300049568 Ga0501031_0097064 Ga0501031_0097064_1514_1846 109
482 3300049568 Ga0501031_0293977 Ga0501031_0293977_13_345 109
483 3300049569 Ga0501032_0005510 Ga0501032_0005510_8392_8724 109
484 3300049570 Ga0501033_0008766 Ga0501033_0008766_1635_1967 109
485 3300049571 Ga0501034_0014438 Ga0501034_0014438_2382_2714 109
486 3300049572 Ga0501036_0001574 Ga0501036_0001574_4547_4879 109
487 3300049572 Ga0501036_1256767 Ga0501036_1256767_126_458 109
488 3300049573 Ga0501037_0007110 Ga0501037_0007110_5178_5510 109
489 3300049574 Ga0501038_0039432 Ga0501038_0039432_659_991 109
490 3300049575 Ga0501039_0033853 Ga0501039_0033853_2971_3303 109
491 3300049579 Ga0501043_0002607 Ga0501043_0002607_9105_9437 109
492 3300049579 Ga0501043_0776962 Ga0501043_0776962_145_477 109
493 3300049580 Ga0501046_0000150 Ga0501046_0000150_5826_6158 109
494 3300049581 Ga0501047_0003876 Ga0501047_0003876_5738_6070 109
495 3300049582 Ga0501048_0221075 Ga0501048_0221075_42_374 109
496 3300049589 Ga0501073_0011548 Ga0501073_0011548_336_668 109
497 3300049741 Ga0501079_0636503 Ga0501079_0636503_57_389 109
498 3300049742 Ga0501080_0022666 Ga0501080_0022666_2127_2459 109
499 3300049822 Ga0501035_0030018 Ga0501035_0030018_4152_4484 109
500 3300049822 Ga0501035_0211173 Ga0501035_0211173_1285_1617 109
501 3300049823 Ga0501044_0005372 Ga0501044_0005372_7984_8316 109
502 3300049823 Ga0501044_0034545 Ga0501044_0034545_145_477 109
503 3300049824 Ga0501045_0741216 Ga0501045_0741216_38_370 109
504 3300053077 Ga0495601_0234521 Ga0495601_0234521_187_525 109
505 3300053077 Ga0495601_0238064 Ga0495601_0238064_735_1073 109
506 3300053133 Ga0500655_026758 Ga0500655_026758_133_468 109
507 3300053733 Ga0500552_098504 Ga0500552_098504_126_461 109
508 3300054114 Ga0501084_0836701 Ga0501084_0836701_68_400 109
509 3300005331 Ga0070670_100968493 Ga0070670_1009684931 110
510 3300005335 Ga0070666_10235118 Ga0070666_102351182 110
511 3300005338 Ga0068868_100173056 Ga0068868_1001730561 110
512 3300005339 Ga0070660_100011289 Ga0070660_1000112899 110
513 3300005344 Ga0070661_100226031 Ga0070661_1002260314 110
514 3300005344 Ga0070661_101218100 Ga0070661_1012181002 110
515 3300005355 Ga0070671_100001676 Ga0070671_10000167626 110
516 3300005356 Ga0070674_100496041 Ga0070674_1004960411 110
517 3300005366 Ga0070659_100001021 Ga0070659_10000102123 110
518 3300005367 Ga0070667_100292165 Ga0070667_1002921652 110
519 3300005456 Ga0070678_100686922 Ga0070678_1006869223 110
520 3300005457 Ga0070662_101010675 Ga0070662_1010106752 110
521 3300005459 Ga0068867_100270131 Ga0068867_1002701312 110
522 3300005539 Ga0068853_100000054 Ga0068853_10000005412 110
523 3300005548 Ga0070665_100008632 Ga0070665_10000863218 110
524 3300005548 Ga0070665_100881891 Ga0070665_1008818912 110
525 3300005578 Ga0068854_100000137 Ga0068854_10000013748 110
526 3300005618 Ga0068864_100008789 Ga0068864_10000878913 110
527 3300005834 Ga0068851_11005292 Ga0068851_110052921 110
528 3300005841 Ga0068863_100042299 Ga0068863_1000422993 110
529 3300009093 Ga0105240_10263275 Ga0105240_102632753 110
530 3300009093 Ga0105240_10313386 Ga0105240_103133862 110
531 3300009174 Ga0105241_10363434 Ga0105241_103634341 110
532 3300009176 Ga0105242_10477631 Ga0105242_104776312 110
533 3300009177 Ga0105248_10188672 Ga0105248_101886724 110
534 3300009177 Ga0105248_10547026 Ga0105248_105470263 110
535 3300009177 Ga0105248_11518860 Ga0105248_115188603 110
536 3300009545 Ga0105237_10609906 Ga0105237_106099062 110
537 3300009551 Ga0105238_11172622 Ga0105238_111726222 110
538 3300013105 Ga0157369_10903016 Ga0157369_109030162 110
539 3300013296 Ga0157374_10034836 Ga0157374_100348366 110
540 3300013296 Ga0157374_10226508 Ga0157374_102265082 110
541 3300013296 Ga0157374_10587134 Ga0157374_105871342 110
542 3300013306 Ga0163162_10004959 Ga0163162_1000495912 110
543 3300013307 Ga0157372_12134636 Ga0157372_121346361 110
544 3300013308 Ga0157375_10263404 Ga0157375_102634043 110
545 3300013308 Ga0157375_11334027 Ga0157375_113340272 110
546 3300014325 Ga0163163_10019000 Ga0163163_1001900011 110
547 3300014968 Ga0157379_10597111 Ga0157379_105971113 110
548 3300014969 Ga0157376_10053211 Ga0157376_100532113 110
549 3300014969 Ga0157376_11266178 Ga0157376_112661782 110
550 3300025321 Ga0207656_10581264 Ga0207656_105812641 110
551 3300025903 Ga0207680_10245261 Ga0207680_102452613 110
552 3300025913 Ga0207695_10486864 Ga0207695_104868643 110
553 3300025913 Ga0207695_11695789 Ga0207695_116957891 110
554 3300025914 Ga0207671_11606787 Ga0207671_116067871 110
555 3300025919 Ga0207657_10008913 Ga0207657_1000891312 110
556 3300025920 Ga0207649_10023049 Ga0207649_100230495 110
557 3300025920 Ga0207649_11394764 Ga0207649_113947641 110
558 3300025924 Ga0207694_10487183 Ga0207694_104871832 110
559 3300025925 Ga0207650_10261081 Ga0207650_102610813 110
560 3300025931 Ga0207644_10018963 Ga0207644_100189634 110
561 3300025932 Ga0207690_10001487 Ga0207690_1000148721 110
562 3300025934 Ga0207686_10599710 Ga0207686_105997102 110
563 3300025937 Ga0207669_11450103 Ga0207669_114501031 110
564 3300025941 Ga0207711_10188207 Ga0207711_101882073 110
565 3300025941 Ga0207711_10607573 Ga0207711_106075732 110
566 3300025981 Ga0207640_10000023 Ga0207640_1000002312 110
567 3300025986 Ga0207658_10391746 Ga0207658_103917462 110
568 3300026041 Ga0207639_10000034 Ga0207639_1000003481 110
569 3300026067 Ga0207678_10250236 Ga0207678_102502363 110
570 3300026088 Ga0207641_10035286 Ga0207641_100352867 110
571 3300026089 Ga0207648_10333445 Ga0207648_103334452 110
572 3300026095 Ga0207676_10154288 Ga0207676_101542883 110
573 3300028379 Ga0268266_10389723 Ga0268266_103897232 110
574 3300028800 Ga0265338_10053598 Ga0265338_100535986 110
575 3300028800 Ga0265338_10488535 Ga0265338_104885352 110
576 3300028800 Ga0265338_10657614 Ga0265338_106576142 110
577 3300030877 Ga0265777_104715 Ga0265777_1047151 110
578 3300031235 Ga0265330_10026960 Ga0265330_100269604 110
579 3300031235 Ga0265330_10037542 Ga0265330_100375423 110
580 3300031242 Ga0265329_10078833 Ga0265329_100788333 110
581 3300031250 Ga0265331_10217935 Ga0265331_102179352 110
582 3300031344 Ga0265316_10030435 Ga0265316_100304359 110
583 3300031344 Ga0265316_10074456 Ga0265316_100744565 110
584 3300031344 Ga0265316_10389958 Ga0265316_103899581 110
585 3300031344 Ga0265316_10565701 Ga0265316_105657012 110
586 3300031595 Ga0265313_10163483 Ga0265313_101634832 110
587 3300031712 Ga0265342_10011411 Ga0265342_100114111 110
588 3300031712 Ga0265342_10212570 Ga0265342_102125701 110
589 3300033180 Ga0307510_10057933 Ga0307510_100579337 110
590 3300033180 Ga0307510_10113631 Ga0307510_101136314 110
591 3300036401 Ga0373937_0193668 Ga0373937_0193668_120_455 110
592 3300037068 Ga0373925_0297434 Ga0373925_0297434_115_450 110
593 3300037853 Ga0436364_1102996 Ga0436364_1102996_160_495 110
594 3300046452 Ga0495617_037889 Ga0495617_037889_891_1226 110
595 3300046454 Ga0495592_0048563 Ga0495592_0048563_1178_1513 110
596 3300046454 Ga0495592_0099518 Ga0495592_0099518_1252_1587 110
597 3300046455 Ga0495603_0019644 Ga0495603_0019644_1714_2049 110
598 3300046455 Ga0495603_0086693 Ga0495603_0086693_1163_1498 110
599 3300046455 Ga0495603_0169854 Ga0495603_0169854_559_894 110
600 3300046457 Ga0495590_0265606 Ga0495590_0265606_65_400 110
601 3300046459 Ga0495629_0051980 Ga0495629_0051980_1471_1806 110
602 3300046459 Ga0495629_0055550 Ga0495629_0055550_872_1207 110
603 3300046460 Ga0495638_0341614 Ga0495638_0341614_260_595 110
604 3300046461 Ga0495641_0194345 Ga0495641_0194345_376_711 110
605 3300046461 Ga0495641_0574191 Ga0495641_0574191_119_454 110
606 3300046462 Ga0495651_0024980 Ga0495651_0024980_2166_2501 110
607 3300046462 Ga0495651_0049871 Ga0495651_0049871_2597_2932 110
608 3300046462 Ga0495651_0065572 Ga0495651_0065572_46_378 110
609 3300046463 Ga0495653_0002196 Ga0495653_0002196_14238_14573 110
610 3300046472 Ga0495580_0085802 Ga0495580_0085802_354_689 110
611 3300046472 Ga0495580_0170496 Ga0495580_0170496_1076_1411 110
612 3300046472 Ga0495580_0198427 Ga0495580_0198427_893_1228 110
613 3300046473 Ga0495582_0008570 Ga0495582_0008570_3709_4044 110
614 3300046473 Ga0495582_0146543 Ga0495582_0146543_268_603 110
615 3300046474 Ga0495605_0151598 Ga0495605_0151598_540_875 110
616 3300046475 Ga0495639_0001203 Ga0495639_0001203_8452_8787 110
617 3300046476 Ga0495662_0000747 Ga0495662_0000747_10829_11164 110
618 3300046477 Ga0495664_0160449 Ga0495664_0160449_16_351 110
619 3300046477 Ga0495664_0401226 Ga0495664_0401226_61_393 110
620 3300046492 Ga0495585_0007246 Ga0495585_0007246_3988_4323 110
621 3300046499 Ga0495594_0008173 Ga0495594_0008173_1631_1966 110
622 3300046499 Ga0495594_0046135 Ga0495594_0046135_1630_1965 110
623 3300046500 Ga0495596_0038690 Ga0495596_0038690_798_1133 110
624 3300046501 Ga0495607_0240149 Ga0495607_0240149_188_523 110
625 3300046506 Ga0495583_0052529 Ga0495583_0052529_322_657 110
626 3300046506 Ga0495583_0162272 Ga0495583_0162272_422_757 110
627 3300046507 Ga0495606_0220620 Ga0495606_0220620_656_991 110
628 3300046507 Ga0495606_0243681 Ga0495606_0243681_562_894 110
629 3300046511 Ga0495608_0414698 Ga0495608_0414698_264_599 110
630 3300046514 Ga0495618_0139851 Ga0495618_0139851_567_902 110
631 3300046516 Ga0495628_0040852 Ga0495628_0040852_603_938 110
632 3300046516 Ga0495628_0332235 Ga0495628_0332235_639_974 110
633 3300046517 Ga0495630_0056994 Ga0495630_0056994_1606_1941 110
634 3300046518 Ga0495631_0104248 Ga0495631_0104248_226_561 110
635 3300046518 Ga0495631_0146549 Ga0495631_0146549_429_764 110
636 3300046523 Ga0495644_0000777 Ga0495644_0000777_8148_8483 110
637 3300046524 Ga0495648_0038427 Ga0495648_0038427_2630_2962 110
638 3300046524 Ga0495648_0372927 Ga0495648_0372927_283_618 110
639 3300046526 Ga0495666_0000949 Ga0495666_0000949_10110_10445 110
640 3300046528 Ga0495642_0026468 Ga0495642_0026468_1718_2053 110
641 3300046529 Ga0495652_0010348 Ga0495652_0010348_711_1046 110
642 3300046529 Ga0495652_0033406 Ga0495652_0033406_1536_1871 110
643 3300046529 Ga0495652_0115140 Ga0495652_0115140_319_651 110
644 3300046531 Ga0495665_0003007 Ga0495665_0003007_5764_6099 110
645 3300046533 Ga0495640_0018326 Ga0495640_0018326_3714_4049 110
646 3300046535 Ga0495586_0003386 Ga0495586_0003386_6381_6716 110
647 3300046536 Ga0495587_0014310 Ga0495587_0014310_2030_2365 110
648 3300046536 Ga0495587_0035208 Ga0495587_0035208_94_429 110
649 3300046538 Ga0495609_0063305 Ga0495609_0063305_1277_1612 110
650 3300046538 Ga0495609_0075964 Ga0495609_0075964_590_925 110
651 3300046543 Ga0495645_0001054 Ga0495645_0001054_5463_5798 110
652 3300046543 Ga0495645_0008101 Ga0495645_0008101_3075_3410 110
653 3300046557 Ga0495622_0467239 Ga0495622_0467239_163_498 110
654 3300046558 Ga0495633_0013370 Ga0495633_0013370_1839_2174 110
655 3300046559 Ga0495667_0003070 Ga0495667_0003070_3947_4282 110
656 3300046559 Ga0495667_0794900 Ga0495667_0794900_178_510 110
657 3300046616 Ga0495668_0021631 Ga0495668_0021631_2246_2581 110
658 3300046616 Ga0495668_0120025 Ga0495668_0120025_695_1030 110
659 3300046642 Ga0495634_0001003 Ga0495634_0001003_19323_19658 110
660 3300046648 Ga0495611_0365400 Ga0495611_0365400_69_404 110
661 3300046660 Ga0495625_0042541 Ga0495625_0042541_708_1043 110
662 3300046660 Ga0495625_0044844 Ga0495625_0044844_2187_2522 110
663 3300046660 Ga0495625_0071757 Ga0495625_0071757_2022_2357 110
664 3300046660 Ga0495625_0171924 Ga0495625_0171924_274_609 110
665 3300046663 Ga0495635_0007598 Ga0495635_0007598_1529_1864 110
666 3300046663 Ga0495635_0148424 Ga0495635_0148424_420_755 110
667 3300046664 Ga0495659_0114422 Ga0495659_0114422_466_801 110
668 3300046665 Ga0495661_0009905 Ga0495661_0009905_4740_5072 110
669 3300046674 Ga0495588_0020496 Ga0495588_0020496_168_503 110
670 3300046674 Ga0495588_0200104 Ga0495588_0200104_155_490 110
671 3300046678 Ga0495599_0016425 Ga0495599_0016425_2248_2583 110
672 3300046678 Ga0495599_0031846 Ga0495599_0031846_1572_1907 110
673 3300046678 Ga0495599_0191735 Ga0495599_0191735_868_1200 110
674 3300046679 Ga0495623_0021136 Ga0495623_0021136_2721_3056 110
675 3300046679 Ga0495623_0035235 Ga0495623_0035235_1982_2317 110
676 3300046680 Ga0495646_0012115 Ga0495646_0012115_4001_4336 110
677 3300046680 Ga0495646_0292279 Ga0495646_0292279_260_595 110
678 3300046681 Ga0495647_0337116 Ga0495647_0337116_115_450 110
679 3300046683 Ga0495658_0134260 Ga0495658_0134260_99_434 110
680 3300046684 Ga0495669_0000955 Ga0495669_0000955_238_573 110
681 3300046689 Ga0495613_0012294 Ga0495613_0012294_713_1048 110
682 3300046689 Ga0495613_0026345 Ga0495613_0026345_1542_1877 110
683 3300046690 Ga0495624_0003012 Ga0495624_0003012_6122_6457 110
684 3300046690 Ga0495624_0105187 Ga0495624_0105187_964_1296 110
685 3300046691 Ga0495670_0044582 Ga0495670_0044582_775_1110 110
686 3300046692 Ga0495671_0103700 Ga0495671_0103700_332_667 110
687 3300046694 Ga0495649_0324589 Ga0495649_0324589_431_766 110
688 3300046694 Ga0495649_0403724 Ga0495649_0403724_203_538 110
689 3300046794 Ga0495589_0198735 Ga0495589_0198735_157_492 110
690 3300046809 Ga0495600_0003517 Ga0495600_0003517_5550_5885 110
691 3300046809 Ga0495600_0070830 Ga0495600_0070830_1002_1337 110
692 3300046809 Ga0495600_0203032 Ga0495600_0203032_894_1226 110
693 3300047315 Ga0495581_0000275 Ga0495581_0000275_5268_5603 110
694 3300047317 Ga0495604_0005020 Ga0495604_0005020_6425_6760 110
695 3300047317 Ga0495604_0006391 Ga0495604_0006391_5361_5696 110
696 3300047317 Ga0495604_0036403 Ga0495604_0036403_1262_1594 110
697 3300047318 Ga0495636_0026297 Ga0495636_0026297_1658_1993 110
698 3300047319 Ga0495674_0022106 Ga0495674_0022106_1535_1870 110
699 3300047320 Ga0495672_0004479 Ga0495672_0004479_2020_2355 110
700 3300047320 Ga0495672_0081242 Ga0495672_0081242_896_1231 110
701 3300047321 Ga0495676_0007390 Ga0495676_0007390_3236_3571 110
702 3300047322 Ga0495680_0023728 Ga0495680_0023728_3822_4157 110
703 3300047323 Ga0495683_0054067 Ga0495683_0054067_200_535 110
704 3300047444 Ga0495675_0004057 Ga0495675_0004057_2709_3044 110
705 3300047444 Ga0495675_0490485 Ga0495675_0490485_95_430 110
706 3300047445 Ga0495677_0029395 Ga0495677_0029395_440_775 110
707 3300047469 Ga0495673_0046320 Ga0495673_0046320_977_1312 110
708 3300047469 Ga0495673_0085086 Ga0495673_0085086_891_1226 110
709 3300047470 Ga0495681_0104518 Ga0495681_0104518_565_900 110
710 3300047471 Ga0495684_0009955 Ga0495684_0009955_6319_6654 110
711 3300047472 Ga0495686_0006326 Ga0495686_0006326_7590_7925 110
712 3300047472 Ga0495686_0014417 Ga0495686_0014417_330_662 110
713 3300047673 Ga0495593_0070451 Ga0495593_0070451_754_1089 110
714 3300047673 Ga0495593_0436075 Ga0495593_0436075_121_456 110
715 3300048088 Ga0495602_0061846 Ga0495602_0061846_516_851 110
716 3300048089 Ga0495614_0004587 Ga0495614_0004587_5152_5487 110
717 3300048089 Ga0495614_0042970 Ga0495614_0042970_199_534 110
718 3300048903 Ga0496100_1237580 Ga0496100_1237580_179_511 110
719 3300048904 Ga0496101_0173120 Ga0496101_0173120_968_1303 110
720 3300048907 Ga0496104_0061071 Ga0496104_0061071_2862_3194 110
721 3300048908 Ga0496105_0686913 Ga0496105_0686913_341_673 110
722 3300048910 Ga0496107_0881946 Ga0496107_0881946_258_590 110
723 3300048911 Ga0496108_0179181 Ga0496108_0179181_765_1100 110
724 3300048915 Ga0496112_0310070 Ga0496112_0310070_572_907 110
725 3300048917 Ga0496114_0306071 Ga0496114_0306071_1054_1386 110
726 3300048918 Ga0496115_0152147 Ga0496115_0152147_90_422 110
727 3300048929 Ga0496126_0000560 Ga0496126_0000560_5849_6181 110
728 3300049460 Ga0495682_0020449 Ga0495682_0020449_1184_1519 110
729 3300053084 Ga0495595_0333460 Ga0495595_0333460_418_753 110
730 3300053093 Ga0500651_0000049 Ga0500651_0000049_5745_6077 110
731 3300053119 Ga0500595_000014 Ga0500595_000014_5763_6095 110
732 3300053119 Ga0500595_009469 Ga0500595_009469_2292_2627 110
733 3300004799 Ga0058863_11690845 Ga0058863_116908452 111
734 3300004803 Ga0058862_12327023 Ga0058862_123270232 111
735 3300005327 Ga0070658_10076190 Ga0070658_100761905 111
736 3300005336 Ga0070680_101255686 Ga0070680_1012556861 111
737 3300005339 Ga0070660_100006108 Ga0070660_1000061089 111
738 3300005341 Ga0070691_10337695 Ga0070691_103376953 111
739 3300005435 Ga0070714_100336931 Ga0070714_1003369313 111
740 3300005455 Ga0070663_100281825 Ga0070663_1002818253 111
741 3300005458 Ga0070681_10769067 Ga0070681_107690671 111
742 3300005530 Ga0070679_100015770 Ga0070679_1000157707 111
743 3300005563 Ga0068855_100140439 Ga0068855_1001404395 111
744 3300005578 Ga0068854_100506959 Ga0068854_1005069593 111
745 3300005614 Ga0068856_100100182 Ga0068856_1001001824 111
746 3300009098 Ga0105245_11108624 Ga0105245_111086242 111
747 3300013100 Ga0157373_11286363 Ga0157373_112863632 111
748 3300013104 Ga0157370_10062955 Ga0157370_100629557 111
749 3300013105 Ga0157369_10364492 Ga0157369_103644921 111
750 3300013307 Ga0157372_10047852 Ga0157372_100478529 111
751 3300025261 Ga0209233_1038436 Ga0209233_10384362 111
752 3300025909 Ga0207705_10010050 Ga0207705_100100503 111
753 3300025917 Ga0207660_10695019 Ga0207660_106950192 111
754 3300025919 Ga0207657_10032755 Ga0207657_1003275510 111
755 3300025921 Ga0207652_10028452 Ga0207652_100284526 111
756 3300025921 Ga0207652_10125219 Ga0207652_101252193 111
757 3300025929 Ga0207664_10292060 Ga0207664_102920602 111
758 3300025949 Ga0207667_10010059 Ga0207667_100100599 111
759 3300026067 Ga0207678_10399148 Ga0207678_103991482 111
760 3300026078 Ga0207702_10513881 Ga0207702_105138813 111
761 3300028666 Ga0265336_10055872 Ga0265336_100558723 111
762 3300028800 Ga0265338_10055532 Ga0265338_100555326 111
763 3300030863 Ga0265766_1006890 Ga0265766_10068902 111
764 3300030878 Ga0265770_1021345 Ga0265770_10213452 111
765 3300031090 Ga0265760_10038980 Ga0265760_100389803 111
766 3300031090 Ga0265760_10191784 Ga0265760_101917842 111
767 3300031235 Ga0265330_10000477 Ga0265330_1000047711 111
768 3300031235 Ga0265330_10018950 Ga0265330_100189506 111
769 3300031240 Ga0265320_10141861 Ga0265320_101418613 111
770 3300031241 Ga0265325_10003065 Ga0265325_1000306510 111
771 3300031241 Ga0265325_10034719 Ga0265325_100347194 111
772 3300031241 Ga0265325_10156559 Ga0265325_101565592 111
773 3300031247 Ga0265340_10052890 Ga0265340_100528902 111
774 3300031247 Ga0265340_10113538 Ga0265340_101135382 111
775 3300031247 Ga0265340_10202476 Ga0265340_102024761 111
776 3300031247 Ga0265340_10388081 Ga0265340_103880812 111
777 3300031249 Ga0265339_10021757 Ga0265339_100217571 111
778 3300031249 Ga0265339_10025776 Ga0265339_100257763 111
779 3300031249 Ga0265339_10045677 Ga0265339_100456775 111
780 3300031344 Ga0265316_10007872 Ga0265316_1000787211 111
781 3300031344 Ga0265316_10013957 Ga0265316_1001395710 111
782 3300031344 Ga0265316_10040636 Ga0265316_100406364 111
783 3300031344 Ga0265316_10328871 Ga0265316_103288712 111
784 3300031344 Ga0265316_11049467 Ga0265316_110494671 111
785 3300031595 Ga0265313_10002067 Ga0265313_1000206725 111
786 3300031711 Ga0265314_10120206 Ga0265314_101202063 111
787 3300031711 Ga0265314_10130954 Ga0265314_101309543 111
788 3300031712 Ga0265342_10023416 Ga0265342_100234165 111
789 3300031712 Ga0265342_10042608 Ga0265342_100426085 111
790 3300031712 Ga0265342_10230440 Ga0265342_102304402 111
791 3300036459 Ga0372808_025990 Ga0372808_025990_159_500 111
792 3300005327 Ga0070658_10161229 Ga0070658_101612294 112
793 3300005327 Ga0070658_10239808 Ga0070658_102398084 112
794 3300005435 Ga0070714_100863857 Ga0070714_1008638572 112
795 3300005455 Ga0070663_100010939 Ga0070663_1000109396 112
796 3300005458 Ga0070681_10171502 Ga0070681_101715023 112
797 3300005563 Ga0068855_100231753 Ga0068855_1002317532 112
798 3300005563 Ga0068855_100242058 Ga0068855_1002420582 112
799 3300009093 Ga0105240_10000001 Ga0105240_10000001920 112
800 3300009093 Ga0105240_12535415 Ga0105240_125354152 112
801 3300013102 Ga0157371_10273346 Ga0157371_102733463 112
802 3300013104 Ga0157370_10931090 Ga0157370_109310902 112
803 3300013105 Ga0157369_10265782 Ga0157369_102657824 112
804 3300025909 Ga0207705_10013784 Ga0207705_100137844 112
805 3300025912 Ga0207707_10485341 Ga0207707_104853412 112
806 3300025913 Ga0207695_10000001 Ga0207695_10000001923 112
807 3300025949 Ga0207667_10819960 Ga0207667_108199601 112
808 3300025981 Ga0207640_11111853 Ga0207640_111118531 112
809 3300026067 Ga0207678_10009514 Ga0207678_100095145 112
810 3300048907 Ga0496104_1457421 Ga0496104_1457421_165_515 112
811 3300005327 Ga0070658_10070958 Ga0070658_100709584 113
812 3300005339 Ga0070660_101270735 Ga0070660_1012707351 113
813 3300005436 Ga0070713_100015502 Ga0070713_1000155027 113
814 3300006175 Ga0070712_101145955 Ga0070712_1011459551 113
815 3300009093 Ga0105240_11271638 Ga0105240_112716382 113
816 3300013104 Ga0157370_10250542 Ga0157370_102505422 113
817 3300013307 Ga0157372_10192270 Ga0157372_101922704 113
818 3300022467 Ga0224712_10451513 Ga0224712_104515132 113
819 3300025909 Ga0207705_10042512 Ga0207705_100425124 113
820 3300025913 Ga0207695_10146071 Ga0207695_101460714 113
821 3300025928 Ga0207700_10058148 Ga0207700_100581486 113
822 3300026067 Ga0207678_10035886 Ga0207678_100358865 113
823 3300033180 Ga0307510_10021356 Ga0307510_100213562 113
824 3300046477 Ga0495664_0127829 Ga0495664_0127829_324_665 113
825 3300046516 Ga0495628_0487071 Ga0495628_0487071_370_711 113
826 3300046543 Ga0495645_0006005 Ga0495645_0006005_3605_3946 113
827 3300048918 Ga0496115_0104212 Ga0496115_0104212_270_611 113
828 3300049460 Ga0495682_0171372 Ga0495682_0171372_364_705 113
829 3300049569 Ga0501032_1022762 Ga0501032_1022762_83_430 113
830 3300049573 Ga0501037_0034434 Ga0501037_0034434_1718_2065 113
831 3300049579 Ga0501043_0146637 Ga0501043_0146637_319_666 113
832 3300049581 Ga0501047_0014539 Ga0501047_0014539_3500_3847 113
833 3300049585 Ga0501069_0405717 Ga0501069_0405717_361_708 113
834 3300049586 Ga0501070_0073834 Ga0501070_0073834_1195_1542 113
835 3300049589 Ga0501073_0046410 Ga0501073_0046410_1228_1575 113
836 3300049742 Ga0501080_0098664 Ga0501080_0098664_1540_1887 113
837 3300049822 Ga0501035_0460411 Ga0501035_0460411_151_498 113
838 3300049823 Ga0501044_0145264 Ga0501044_0145264_585_932 113
839 3300000531 CNBas_1013173 CNBas_10131731 114
840 3300005327 Ga0070658_11004857 Ga0070658_110048572 114
841 3300005329 Ga0070683_100108530 Ga0070683_1001085304 114
842 3300005336 Ga0070680_100032458 Ga0070680_1000324584 114
843 3300005339 Ga0070660_100061278 Ga0070660_1000612781 114
844 3300005344 Ga0070661_100162072 Ga0070661_1001620723 114
845 3300005366 Ga0070659_100016590 Ga0070659_10001659010 114
846 3300005455 Ga0070663_100667965 Ga0070663_1006679653 114
847 3300005455 Ga0070663_101422324 Ga0070663_1014223242 114
848 3300005458 Ga0070681_10200046 Ga0070681_102000462 114
849 3300005530 Ga0070679_100279165 Ga0070679_1002791652 114
850 3300005563 Ga0068855_100003825 Ga0068855_1000038257 114
851 3300005563 Ga0068855_100158606 Ga0068855_1001586064 114
852 3300005564 Ga0070664_100163924 Ga0070664_1001639242 114
853 3300005577 Ga0068857_100063745 Ga0068857_1000637453 114
854 3300005578 Ga0068854_100037277 Ga0068854_1000372773 114
855 3300007788 Ga0099795_10347177 Ga0099795_103471771 114
856 3300009093 Ga0105240_10045768 Ga0105240_100457687 114
857 3300009174 Ga0105241_10083767 Ga0105241_100837674 114
858 3300009545 Ga0105237_10518019 Ga0105237_105180192 114
859 3300009551 Ga0105238_11498914 Ga0105238_114989142 114
860 3300013100 Ga0157373_10278775 Ga0157373_102787751 114
861 3300013104 Ga0157370_10053290 Ga0157370_100532904 114
862 3300013104 Ga0157370_10414018 Ga0157370_104140183 114
863 3300013105 Ga0157369_10056103 Ga0157369_100561033 114
864 3300013307 Ga0157372_10764445 Ga0157372_107644453 114
865 3300025904 Ga0207647_10214128 Ga0207647_102141282 114
866 3300025909 Ga0207705_10000048 Ga0207705_10000048160 114
867 3300025909 Ga0207705_10026791 Ga0207705_100267916 114
868 3300025912 Ga0207707_10223658 Ga0207707_102236583 114
869 3300025913 Ga0207695_10067170 Ga0207695_100671704 114
870 3300025914 Ga0207671_10984782 Ga0207671_109847821 114
871 3300025915 Ga0207693_10195081 Ga0207693_101950813 114
872 3300025917 Ga0207660_10203919 Ga0207660_102039193 114
873 3300025919 Ga0207657_10012382 Ga0207657_1001238211 114
874 3300025920 Ga0207649_10019606 Ga0207649_100196062 114
875 3300025921 Ga0207652_10396006 Ga0207652_103960062 114
876 3300025924 Ga0207694_10770405 Ga0207694_107704051 114
877 3300025932 Ga0207690_10332266 Ga0207690_103322663 114
878 3300025944 Ga0207661_10011175 Ga0207661_1001117511 114
879 3300025945 Ga0207679_10420146 Ga0207679_104201462 114
880 3300025949 Ga0207667_10053320 Ga0207667_100533207 114
881 3300025949 Ga0207667_10056317 Ga0207667_100563177 114
882 3300025981 Ga0207640_10075139 Ga0207640_100751394 114
883 3300026067 Ga0207678_10029842 Ga0207678_100298426 114
884 3300026067 Ga0207678_10957686 Ga0207678_109576862 114
885 3300026116 Ga0207674_10000532 Ga0207674_1000053212 114
886 3300046492 Ga0495585_0104010 Ga0495585_0104010_340_684 114
887 3300046499 Ga0495594_0771920 Ga0495594_0771920_159_503 114
888 3300048929 Ga0496126_0000209 Ga0496126_0000209_125256_125600 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

20

87

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fmw-assembly1.cif.gz_Q the structure of a hibernating ribosome in the lyme disease pathogen 0.9032 22 98
7pnw-assembly1.cif.gz_N mouse mitochondrial ribosome small subunit lacking m5u modification 0.8936 21 96
4v4w-assembly1.cif.gz_AQ structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.8928 22 97
6ydw-assembly1.cif.gz_AQ 55s mammalian mitochondrial ribosome with mtefg1 and two trnamet (ti-post) 0.8923 21 94
7l08-assembly1.cif.gz_AN cryo-em structure of the human 55s mitoribosome-rrfmt complex. 0.888 21 96
ID Description Score Start End Superfamily
6neqQ00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8887 21 97 2.40.50.140
af_Q4E4R7_93_168_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8807 23 97 2.40.50.140
af_C6T0V9_1_79_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8788 22 97 2.40.50.140
af_I1KKK3_1_96_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8765 22 98 2.40.50.140
af_Q25811_2_74_2.40.50.1000 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8669 21 94 2.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1S8W181-F1-model_v4 deleted 0.9019 22 98
AF-A0A0G2ZCR4-F1-model_v4 Small ribosomal subunit protein uS17 0.9014 22 98 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A1V5SVS5-F1-model_v4 Small ribosomal subunit protein uS17 0.9001 22 98 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A2D9P5K4-F1-model_v4 Small ribosomal subunit protein uS17 0.9 22 98 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-B5YDV2-F1-model_v4 Small ribosomal subunit protein uS17 0.898 22 98 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
76.44 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map