F484756
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 888 | 327 | 887 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_12358853|Ga0105238_123588532 |
| Length | 117 |
| Sequence | MTATAETVQAPAKRRNEKVGNVVSTKMQKTIVVEVEMRKAHPKYKRIVKSAKKFYAHDEQNSARVGDVVRIRETRPLSKLKRWNLEEIVRRSSLGQIEELEAPQAAASSGMAKKGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 95 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 97 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 145 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 167 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 187 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 190 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 320 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 321 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 322 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 323 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 324 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.62 |
| Metatranscriptomes | 3.27 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.24 |
| Nodule | 0 |
| Rhizoplane | 4.73 |
| Rhizosphere | 91.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNBas_1013173 | 3300000531 | Bacteria | 521 |
| 2 | LJNas_1000189 | 3300000546 | Bacteria | 10352 |
| 3 | rootH2_10096173 | 3300003320 | Bacteria | 1883 |
| 4 | rootH2_10177754 | 3300003320 | Bacteria | 1996 |
| 5 | JGI25404J52841_10035318 | 3300003659 | Bacteria | 1064 |
| 6 | Ga0058863_10003457 | 3300004799 | Bacteria | 3372 |
| 7 | Ga0058863_11690845 | 3300004799 | Bacteria | 888 |
| 8 | Ga0058861_11532275 | 3300004800 | Bacteria | 540 |
| 9 | Ga0058861_11542957 | 3300004800 | Bacteria | 1002 |
| 10 | Ga0058862_12327023 | 3300004803 | Bacteria | 1010 |
| 11 | Ga0058862_12712161 | 3300004803 | Bacteria | 698 |
| 12 | Ga0070658_10009410 | 3300005327 | Bacteria | 7850 |
| 13 | Ga0070658_10070958 | 3300005327 | Bacteria | 2852 |
| 14 | Ga0070658_10076190 | 3300005327 | Bacteria | 2751 |
| 15 | Ga0070658_10161229 | 3300005327 | Bacteria | 1881 |
| 16 | Ga0070658_10239808 | 3300005327 | Bacteria | 1537 |
| 17 | Ga0070658_10253679 | 3300005327 | Bacteria | 1493 |
| 18 | Ga0070658_10260242 | 3300005327 | Bacteria | 1473 |
| 19 | Ga0070658_10376412 | 3300005327 | Bacteria | 1217 |
| 20 | Ga0070658_11004857 | 3300005327 | Bacteria | 725 |
| 21 | Ga0070658_11047070 | 3300005327 | Bacteria | 710 |
| 22 | Ga0070683_100108530 | 3300005329 | Bacteria | 2617 |
| 23 | Ga0070683_100186088 | 3300005329 | Bacteria | 1971 |
| 24 | Ga0070683_100489624 | 3300005329 | Bacteria | 1174 |
| 25 | Ga0070670_100968493 | 3300005331 | Bacteria | 773 |
| 26 | Ga0070666_10235118 | 3300005335 | Bacteria | 1295 |
| 27 | Ga0070680_100032458 | 3300005336 | Bacteria | 4203 |
| 28 | Ga0070680_100075737 | 3300005336 | Bacteria | 2770 |
| 29 | Ga0070680_100091294 | 3300005336 | Bacteria | 2521 |
| 30 | Ga0070680_100231848 | 3300005336 | Bacteria | 1559 |
| 31 | Ga0070680_100442051 | 3300005336 | Bacteria | 1110 |
| 32 | Ga0070680_101255686 | 3300005336 | Bacteria | 641 |
| 33 | Ga0070682_100524907 | 3300005337 | Bacteria | 922 |
| 34 | Ga0068868_100038932 | 3300005338 | Bacteria | 3691 |
| 35 | Ga0068868_100173056 | 3300005338 | Bacteria | 1788 |
| 36 | Ga0070660_100006108 | 3300005339 | Bacteria | 8329 |
| 37 | Ga0070660_100011289 | 3300005339 | Bacteria | 6341 |
| 38 | Ga0070660_100061278 | 3300005339 | Bacteria | 2921 |
| 39 | Ga0070660_100513948 | 3300005339 | Bacteria | 997 |
| 40 | Ga0070660_101270735 | 3300005339 | Bacteria | 624 |
| 41 | Ga0070691_10337695 | 3300005341 | Bacteria | 833 |
| 42 | Ga0070661_100025903 | 3300005344 | Bacteria | 4215 |
| 43 | Ga0070661_100162072 | 3300005344 | Bacteria | 1694 |
| 44 | Ga0070661_100226031 | 3300005344 | Bacteria | 1437 |
| 45 | Ga0070661_101217640 | 3300005344 | Bacteria | 630 |
| 46 | Ga0070661_101218100 | 3300005344 | Bacteria | 630 |
| 47 | Ga0070671_100001676 | 3300005355 | Bacteria | 16774 |
| 48 | Ga0070674_100496041 | 3300005356 | Bacteria | 1016 |
| 49 | Ga0070659_100001021 | 3300005366 | Bacteria | 20542 |
| 50 | Ga0070659_100016590 | 3300005366 | Bacteria | 5530 |
| 51 | Ga0070659_100445162 | 3300005366 | Bacteria | 1098 |
| 52 | Ga0070667_100292165 | 3300005367 | Bacteria | 1466 |
| 53 | Ga0070667_100326259 | 3300005367 | Bacteria | 1386 |
| 54 | Ga0070709_10495921 | 3300005434 | Bacteria | 927 |
| 55 | Ga0070714_100336931 | 3300005435 | Bacteria | 1414 |
| 56 | Ga0070714_100863857 | 3300005435 | Bacteria | 878 |
| 57 | Ga0070714_101762733 | 3300005435 | Bacteria | 605 |
| 58 | Ga0070713_100015502 | 3300005436 | Bacteria | 5702 |
| 59 | Ga0070713_100256803 | 3300005436 | Bacteria | 1596 |
| 60 | Ga0070713_101554792 | 3300005436 | Bacteria | 642 |
| 61 | Ga0070713_101809854 | 3300005436 | Bacteria | 593 |
| 62 | Ga0070710_10327304 | 3300005437 | Bacteria | 1008 |
| 63 | Ga0070711_100306354 | 3300005439 | Bacteria | 1265 |
| 64 | Ga0070663_100010939 | 3300005455 | Bacteria | 5672 |
| 65 | Ga0070663_100281825 | 3300005455 | Bacteria | 1325 |
| 66 | Ga0070663_100434226 | 3300005455 | Bacteria | 1079 |
| 67 | Ga0070663_100667965 | 3300005455 | Bacteria | 880 |
| 68 | Ga0070663_101194012 | 3300005455 | Bacteria | 668 |
| 69 | Ga0070663_101348258 | 3300005455 | Bacteria | 630 |
| 70 | Ga0070663_101422324 | 3300005455 | Bacteria | 615 |
| 71 | Ga0070678_100686922 | 3300005456 | Bacteria | 921 |
| 72 | Ga0070662_101010675 | 3300005457 | Bacteria | 712 |
| 73 | Ga0070681_10012933 | 3300005458 | Bacteria | 8287 |
| 74 | Ga0070681_10171502 | 3300005458 | Bacteria | 2091 |
| 75 | Ga0070681_10200046 | 3300005458 | Bacteria | 1916 |
| 76 | Ga0070681_10769067 | 3300005458 | Bacteria | 880 |
| 77 | Ga0070681_11194031 | 3300005458 | Bacteria | 683 |
| 78 | Ga0068867_100270131 | 3300005459 | Bacteria | 1390 |
| 79 | Ga0070707_101205634 | 3300005468 | Bacteria | 723 |
| 80 | Ga0070699_100892826 | 3300005518 | Unclassified | 814 |
| 81 | Ga0070679_100003562 | 3300005530 | Bacteria | 14258 |
| 82 | Ga0070679_100015770 | 3300005530 | Bacteria | 7269 |
| 83 | Ga0070679_100030999 | 3300005530 | Bacteria | 5282 |
| 84 | Ga0070679_100067206 | 3300005530 | Bacteria | 3574 |
| 85 | Ga0070679_100279165 | 3300005530 | Bacteria | 1623 |
| 86 | Ga0070679_101411759 | 3300005530 | Bacteria | 642 |
| 87 | Ga0070679_102066377 | 3300005530 | Bacteria | 519 |
| 88 | Ga0070684_100006987 | 3300005535 | Bacteria | 8769 |
| 89 | Ga0070684_100539430 | 3300005535 | Bacteria | 1082 |
| 90 | Ga0070697_100007786 | 3300005536 | Bacteria | 8337 |
| 91 | Ga0068853_100000054 | 3300005539 | Bacteria | 80837 |
| 92 | Ga0068853_100181095 | 3300005539 | Bacteria | 1911 |
| 93 | Ga0068853_100248542 | 3300005539 | Bacteria | 1631 |
| 94 | Ga0070695_100110781 | 3300005545 | Bacteria | 1862 |
| 95 | Ga0070665_100008632 | 3300005548 | Bacteria | 10311 |
| 96 | Ga0070665_100046016 | 3300005548 | Bacteria | 4383 |
| 97 | Ga0070665_100138605 | 3300005548 | Bacteria | 2436 |
| 98 | Ga0070665_100853776 | 3300005548 | Bacteria | 923 |
| 99 | Ga0070665_100881891 | 3300005548 | Bacteria | 907 |
| 100 | Ga0070665_100984802 | 3300005548 | Bacteria | 855 |
| 101 | Ga0068855_100000642 | 3300005563 | Bacteria | 42759 |
| 102 | Ga0068855_100003825 | 3300005563 | Bacteria | 18405 |
| 103 | Ga0068855_100006253 | 3300005563 | Bacteria | 14521 |
| 104 | Ga0068855_100062458 | 3300005563 | Bacteria | 4348 |
| 105 | Ga0068855_100140439 | 3300005563 | Bacteria | 2754 |
| 106 | Ga0068855_100158606 | 3300005563 | Bacteria | 2569 |
| 107 | Ga0068855_100231753 | 3300005563 | Bacteria | 2067 |
| 108 | Ga0068855_100242058 | 3300005563 | Bacteria | 2015 |
| 109 | Ga0068855_100510374 | 3300005563 | Bacteria | 1305 |
| 110 | Ga0068855_100611063 | 3300005563 | Bacteria | 1175 |
| 111 | Ga0068855_101177227 | 3300005563 | Bacteria | 798 |
| 112 | Ga0070664_100163924 | 3300005564 | Bacteria | 1968 |
| 113 | Ga0068857_100063745 | 3300005577 | Bacteria | 3276 |
| 114 | Ga0068857_100171226 | 3300005577 | Bacteria | 1974 |
| 115 | Ga0068857_100619698 | 3300005577 | Bacteria | 1024 |
| 116 | Ga0068854_100000137 | 3300005578 | Bacteria | 50696 |
| 117 | Ga0068854_100037277 | 3300005578 | Bacteria | 3412 |
| 118 | Ga0068854_100357835 | 3300005578 | Bacteria | 1197 |
| 119 | Ga0068854_100506959 | 3300005578 | Bacteria | 1017 |
| 120 | Ga0068856_100026907 | 3300005614 | Bacteria | 5610 |
| 121 | Ga0068856_100100182 | 3300005614 | Bacteria | 2889 |
| 122 | Ga0068856_100173144 | 3300005614 | Bacteria | 2171 |
| 123 | Ga0068856_100461662 | 3300005614 | Bacteria | 1291 |
| 124 | Ga0068856_100569368 | 3300005614 | Bacteria | 1154 |
| 125 | Ga0068856_100645530 | 3300005614 | Bacteria | 1079 |
| 126 | Ga0068856_101846696 | 3300005614 | Bacteria | 616 |
| 127 | Ga0068852_100888369 | 3300005616 | Bacteria | 908 |
| 128 | Ga0068852_102632283 | 3300005616 | Bacteria | 522 |
| 129 | Ga0068864_100008789 | 3300005618 | Bacteria | 8328 |
| 130 | Ga0068851_10004509 | 3300005834 | Bacteria | 6282 |
| 131 | Ga0068851_11005292 | 3300005834 | Bacteria | 526 |
| 132 | Ga0068863_100042299 | 3300005841 | Bacteria | 4329 |
| 133 | Ga0068863_100441707 | 3300005841 | Bacteria | 1276 |
| 134 | Ga0068858_100188042 | 3300005842 | Bacteria | 1951 |
| 135 | Ga0068858_100606443 | 3300005842 | Bacteria | 1062 |
| 136 | Ga0068858_101327357 | 3300005842 | Bacteria | 708 |
| 137 | Ga0081455_10401326 | 3300005937 | Bacteria | 951 |
| 138 | Ga0081540_1027528 | 3300005983 | Bacteria | 3218 |
| 139 | Ga0070717_10050783 | 3300006028 | Bacteria | 3410 |
| 140 | Ga0070716_101013524 | 3300006173 | Unclassified | 657 |
| 141 | Ga0070716_101594069 | 3300006173 | Bacteria | 536 |
| 142 | Ga0070712_101145955 | 3300006175 | Bacteria | 676 |
| 143 | Ga0070712_101349258 | 3300006175 | Bacteria | 622 |
| 144 | Ga0070712_101640752 | 3300006175 | Bacteria | 563 |
| 145 | Ga0097621_102135197 | 3300006237 | Bacteria | 536 |
| 146 | Ga0068871_101611487 | 3300006358 | Bacteria | 615 |
| 147 | Ga0099795_10347177 | 3300007788 | Bacteria | 663 |
| 148 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 149 | Ga0105240_10007537 | 3300009093 | Bacteria | 15778 |
| 150 | Ga0105240_10027101 | 3300009093 | Bacteria | 7509 |
| 151 | Ga0105240_10045768 | 3300009093 | Bacteria | 5549 |
| 152 | Ga0105240_10132535 | 3300009093 | Bacteria | 2988 |
| 153 | Ga0105240_10263275 | 3300009093 | Bacteria | 1988 |
| 154 | Ga0105240_10280570 | 3300009093 | Bacteria | 1914 |
| 155 | Ga0105240_10313386 | 3300009093 | Bacteria | 1791 |
| 156 | Ga0105240_11271638 | 3300009093 | Bacteria | 777 |
| 157 | Ga0105240_12535415 | 3300009093 | Bacteria | 530 |
| 158 | Ga0105245_10115478 | 3300009098 | Bacteria | 2501 |
| 159 | Ga0105245_11108624 | 3300009098 | Bacteria | 838 |
| 160 | Ga0105245_11891649 | 3300009098 | Bacteria | 650 |
| 161 | Ga0105247_10101615 | 3300009101 | Bacteria | 1839 |
| 162 | Ga0114129_10195930 | 3300009147 | Bacteria | 2740 |
| 163 | Ga0105243_11064316 | 3300009148 | Bacteria | 815 |
| 164 | Ga0105241_10083767 | 3300009174 | Bacteria | 2502 |
| 165 | Ga0105241_10160507 | 3300009174 | Bacteria | 1847 |
| 166 | Ga0105241_10232585 | 3300009174 | Bacteria | 1554 |
| 167 | Ga0105241_10363434 | 3300009174 | Bacteria | 1260 |
| 168 | Ga0105241_10912483 | 3300009174 | Bacteria | 816 |
| 169 | Ga0105242_10477631 | 3300009176 | Bacteria | 1181 |
| 170 | Ga0105248_10000094 | 3300009177 | Bacteria | 98558 |
| 171 | Ga0105248_10003761 | 3300009177 | Bacteria | 16804 |
| 172 | Ga0105248_10188672 | 3300009177 | Bacteria | 2323 |
| 173 | Ga0105248_10384554 | 3300009177 | Bacteria | 1580 |
| 174 | Ga0105248_10547026 | 3300009177 | Bacteria | 1306 |
| 175 | Ga0105248_11518860 | 3300009177 | Bacteria | 758 |
| 176 | Ga0105237_10161658 | 3300009545 | Bacteria | 2238 |
| 177 | Ga0105237_10166637 | 3300009545 | Bacteria | 2202 |
| 178 | Ga0105237_10391906 | 3300009545 | Bacteria | 1394 |
| 179 | Ga0105237_10518019 | 3300009545 | Bacteria | 1199 |
| 180 | Ga0105237_10609906 | 3300009545 | Bacteria | 1098 |
| 181 | Ga0105237_10753391 | 3300009545 | Bacteria | 980 |
| 182 | Ga0105237_11273966 | 3300009545 | Bacteria | 742 |
| 183 | Ga0105237_11646534 | 3300009545 | Bacteria | 649 |
| 184 | Ga0105238_10006787 | 3300009551 | Bacteria | 11431 |
| 185 | Ga0105238_10150267 | 3300009551 | Bacteria | 2305 |
| 186 | Ga0105238_10616892 | 3300009551 | Bacteria | 1093 |
| 187 | Ga0105238_11172622 | 3300009551 | Bacteria | 792 |
| 188 | Ga0105238_11498914 | 3300009551 | Bacteria | 703 |
| 189 | Ga0105238_12358853 | 3300009551 | Bacteria | 567 |
| 190 | Ga0105249_10016019 | 3300009553 | Bacteria | 6644 |
| 191 | Ga0099796_10190101 | 3300010159 | Bacteria | 828 |
| 192 | Ga0105239_10263000 | 3300010375 | Bacteria | 1939 |
| 193 | Ga0105239_10517504 | 3300010375 | Bacteria | 1357 |
| 194 | Ga0105239_10890865 | 3300010375 | Bacteria | 1021 |
| 195 | Ga0105239_11900450 | 3300010375 | Bacteria | 690 |
| 196 | Ga0105239_12046595 | 3300010375 | Bacteria | 665 |
| 197 | Ga0105239_13623665 | 3300010375 | Bacteria | 502 |
| 198 | Ga0157373_10196828 | 3300013100 | Bacteria | 1421 |
| 199 | Ga0157373_10278775 | 3300013100 | Bacteria | 1184 |
| 200 | Ga0157373_10327152 | 3300013100 | Bacteria | 1091 |
| 201 | Ga0157373_11286363 | 3300013100 | Bacteria | 553 |
| 202 | Ga0157371_10128407 | 3300013102 | Bacteria | 1803 |
| 203 | Ga0157371_10149884 | 3300013102 | Bacteria | 1663 |
| 204 | Ga0157371_10273346 | 3300013102 | Bacteria | 1220 |
| 205 | Ga0157371_11031153 | 3300013102 | Bacteria | 629 |
| 206 | Ga0157370_10007024 | 3300013104 | Bacteria | 12294 |
| 207 | Ga0157370_10008035 | 3300013104 | Bacteria | 11427 |
| 208 | Ga0157370_10049002 | 3300013104 | Bacteria | 4045 |
| 209 | Ga0157370_10053290 | 3300013104 | Bacteria | 3858 |
| 210 | Ga0157370_10062955 | 3300013104 | Bacteria | 3516 |
| 211 | Ga0157370_10250542 | 3300013104 | Bacteria | 1638 |
| 212 | Ga0157370_10414018 | 3300013104 | Bacteria | 1240 |
| 213 | Ga0157370_10419687 | 3300013104 | Bacteria | 1231 |
| 214 | Ga0157370_10432819 | 3300013104 | Bacteria | 1210 |
| 215 | Ga0157370_10619041 | 3300013104 | Bacteria | 991 |
| 216 | Ga0157370_10678274 | 3300013104 | Bacteria | 941 |
| 217 | Ga0157370_10931090 | 3300013104 | Bacteria | 788 |
| 218 | Ga0157369_10013194 | 3300013105 | Bacteria | 9351 |
| 219 | Ga0157369_10026529 | 3300013105 | Bacteria | 6426 |
| 220 | Ga0157369_10033381 | 3300013105 | Bacteria | 5656 |
| 221 | Ga0157369_10056103 | 3300013105 | Bacteria | 4251 |
| 222 | Ga0157369_10059538 | 3300013105 | Bacteria | 4118 |
| 223 | Ga0157369_10118054 | 3300013105 | Bacteria | 2816 |
| 224 | Ga0157369_10192055 | 3300013105 | Bacteria | 2145 |
| 225 | Ga0157369_10265782 | 3300013105 | Bacteria | 1788 |
| 226 | Ga0157369_10299684 | 3300013105 | Bacteria | 1672 |
| 227 | Ga0157369_10364492 | 3300013105 | Bacteria | 1500 |
| 228 | Ga0157369_10870738 | 3300013105 | Bacteria | 924 |
| 229 | Ga0157369_10903016 | 3300013105 | Bacteria | 906 |
| 230 | Ga0157369_10942606 | 3300013105 | Bacteria | 885 |
| 231 | Ga0157369_11702911 | 3300013105 | Bacteria | 641 |
| 232 | Ga0157369_11888698 | 3300013105 | Bacteria | 606 |
| 233 | Ga0157369_12296453 | 3300013105 | Bacteria | 547 |
| 234 | Ga0157374_10010090 | 3300013296 | Bacteria | 8111 |
| 235 | Ga0157374_10034836 | 3300013296 | Bacteria | 4602 |
| 236 | Ga0157374_10070986 | 3300013296 | Bacteria | 3283 |
| 237 | Ga0157374_10191481 | 3300013296 | Bacteria | 2001 |
| 238 | Ga0157374_10226508 | 3300013296 | Bacteria | 1836 |
| 239 | Ga0157374_10330132 | 3300013296 | Bacteria | 1513 |
| 240 | Ga0157374_10367640 | 3300013296 | Bacteria | 1431 |
| 241 | Ga0157374_10389102 | 3300013296 | Bacteria | 1390 |
| 242 | Ga0157374_10587134 | 3300013296 | Bacteria | 1123 |
| 243 | Ga0157374_11071342 | 3300013296 | Bacteria | 826 |
| 244 | Ga0157374_11161494 | 3300013296 | Bacteria | 793 |
| 245 | Ga0157378_10020240 | 3300013297 | Bacteria | 5853 |
| 246 | Ga0157378_10659345 | 3300013297 | Bacteria | 1063 |
| 247 | Ga0157378_10695612 | 3300013297 | Bacteria | 1036 |
| 248 | Ga0163162_10004959 | 3300013306 | Bacteria | 12820 |
| 249 | Ga0157372_10003289 | 3300013307 | Bacteria | 17453 |
| 250 | Ga0157372_10012293 | 3300013307 | Bacteria | 9121 |
| 251 | Ga0157372_10047852 | 3300013307 | Bacteria | 4753 |
| 252 | Ga0157372_10192270 | 3300013307 | Bacteria | 2364 |
| 253 | Ga0157372_10233303 | 3300013307 | Bacteria | 2134 |
| 254 | Ga0157372_10235497 | 3300013307 | Bacteria | 2123 |
| 255 | Ga0157372_10375914 | 3300013307 | Bacteria | 1656 |
| 256 | Ga0157372_10583983 | 3300013307 | Bacteria | 1302 |
| 257 | Ga0157372_10764445 | 3300013307 | Bacteria | 1123 |
| 258 | Ga0157372_10853250 | 3300013307 | Bacteria | 1057 |
| 259 | Ga0157372_11125503 | 3300013307 | Bacteria | 908 |
| 260 | Ga0157372_12134636 | 3300013307 | Bacteria | 644 |
| 261 | Ga0157375_10263404 | 3300013308 | Bacteria | 1885 |
| 262 | Ga0157375_11334027 | 3300013308 | Bacteria | 844 |
| 263 | Ga0157375_13220794 | 3300013308 | Bacteria | 544 |
| 264 | Ga0163163_10019000 | 3300014325 | Bacteria | 6447 |
| 265 | Ga0163163_10111041 | 3300014325 | Bacteria | 2771 |
| 266 | Ga0163163_10335438 | 3300014325 | Bacteria | 1567 |
| 267 | Ga0182008_10258356 | 3300014497 | Bacteria | 900 |
| 268 | Ga0157379_10169847 | 3300014968 | Bacteria | 1969 |
| 269 | Ga0157379_10597111 | 3300014968 | Bacteria | 1030 |
| 270 | Ga0157379_10637831 | 3300014968 | Bacteria | 997 |
| 271 | Ga0157379_11383331 | 3300014968 | Bacteria | 682 |
| 272 | Ga0157379_12446343 | 3300014968 | Bacteria | 522 |
| 273 | Ga0157376_10028432 | 3300014969 | Bacteria | 4443 |
| 274 | Ga0157376_10053211 | 3300014969 | Bacteria | 3369 |
| 275 | Ga0157376_10173307 | 3300014969 | Bacteria | 1966 |
| 276 | Ga0157376_10214467 | 3300014969 | Bacteria | 1779 |
| 277 | Ga0157376_10277569 | 3300014969 | Bacteria | 1577 |
| 278 | Ga0157376_10910835 | 3300014969 | Bacteria | 898 |
| 279 | Ga0157376_11266178 | 3300014969 | Bacteria | 767 |
| 280 | Ga0184598_113851 | 3300019182 | Bacteria | 794 |
| 281 | Ga0197907_11454979 | 3300020069 | Bacteria | 551 |
| 282 | Ga0206356_10233622 | 3300020070 | Bacteria | 655 |
| 283 | Ga0206349_1064812 | 3300020075 | Bacteria | 838 |
| 284 | Ga0206349_1580743 | 3300020075 | Bacteria | 591 |
| 285 | Ga0206351_11002133 | 3300020077 | Bacteria | 1797 |
| 286 | Ga0206352_10132864 | 3300020078 | Bacteria | 735 |
| 287 | Ga0206353_10452776 | 3300020082 | Bacteria | 921 |
| 288 | Ga0154015_1664317 | 3300020610 | Bacteria | 1351 |
| 289 | Ga0213872_10005926 | 3300021361 | Bacteria | 6203 |
| 290 | Ga0213872_10012057 | 3300021361 | Bacteria | 4077 |
| 291 | Ga0213872_10015241 | 3300021361 | Bacteria | 3577 |
| 292 | Ga0213872_10016045 | 3300021361 | Bacteria | 3478 |
| 293 | Ga0213872_10242057 | 3300021361 | Bacteria | 762 |
| 294 | Ga0213871_10002437 | 3300021441 | Bacteria | 3419 |
| 295 | Ga0213871_10012856 | 3300021441 | Bacteria | 1955 |
| 296 | Ga0213871_10214070 | 3300021441 | Bacteria | 604 |
| 297 | Ga0224712_10451513 | 3300022467 | Bacteria | 617 |
| 298 | Ga0224712_10465873 | 3300022467 | Bacteria | 608 |
| 299 | Ga0224572_1040625 | 3300024225 | Bacteria | 877 |
| 300 | Ga0209437_104260 | 3300025233 | Bacteria | 2536 |
| 301 | Ga0209233_1002003 | 3300025261 | Bacteria | 7713 |
| 302 | Ga0209233_1038436 | 3300025261 | Bacteria | 1056 |
| 303 | Ga0207656_10007345 | 3300025321 | Bacteria | 4007 |
| 304 | Ga0207656_10259307 | 3300025321 | Bacteria | 853 |
| 305 | Ga0207656_10581264 | 3300025321 | Bacteria | 571 |
| 306 | Ga0207680_10043011 | 3300025903 | Bacteria | 2646 |
| 307 | Ga0207680_10245261 | 3300025903 | Bacteria | 1236 |
| 308 | Ga0207647_10004892 | 3300025904 | Bacteria | 9886 |
| 309 | Ga0207647_10022019 | 3300025904 | Bacteria | 4241 |
| 310 | Ga0207647_10214128 | 3300025904 | Bacteria | 1112 |
| 311 | Ga0207647_10274467 | 3300025904 | Bacteria | 963 |
| 312 | Ga0207699_10312742 | 3300025906 | Bacteria | 1100 |
| 313 | Ga0207699_10423402 | 3300025906 | Bacteria | 951 |
| 314 | Ga0207705_10000048 | 3300025909 | Bacteria | 171848 |
| 315 | Ga0207705_10010050 | 3300025909 | Bacteria | 6887 |
| 316 | Ga0207705_10013784 | 3300025909 | Bacteria | 5828 |
| 317 | Ga0207705_10026791 | 3300025909 | Bacteria | 4108 |
| 318 | Ga0207705_10042512 | 3300025909 | Bacteria | 3262 |
| 319 | Ga0207705_10042888 | 3300025909 | Bacteria | 3249 |
| 320 | Ga0207705_10692718 | 3300025909 | Bacteria | 792 |
| 321 | Ga0207654_10632971 | 3300025911 | Bacteria | 765 |
| 322 | Ga0207654_10782746 | 3300025911 | Bacteria | 688 |
| 323 | Ga0207707_10007751 | 3300025912 | Bacteria | 9347 |
| 324 | Ga0207707_10223658 | 3300025912 | Bacteria | 1638 |
| 325 | Ga0207707_10485341 | 3300025912 | Bacteria | 1055 |
| 326 | Ga0207707_11492828 | 3300025912 | Bacteria | 536 |
| 327 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 328 | Ga0207695_10003215 | 3300025913 | Bacteria | 23264 |
| 329 | Ga0207695_10014395 | 3300025913 | Bacteria | 9378 |
| 330 | Ga0207695_10021213 | 3300025913 | Bacteria | 7418 |
| 331 | Ga0207695_10067170 | 3300025913 | Bacteria | 3679 |
| 332 | Ga0207695_10146071 | 3300025913 | Bacteria | 2309 |
| 333 | Ga0207695_10332441 | 3300025913 | Bacteria | 1408 |
| 334 | Ga0207695_10486864 | 3300025913 | Bacteria | 1116 |
| 335 | Ga0207695_11398501 | 3300025913 | Bacteria | 580 |
| 336 | Ga0207695_11530822 | 3300025913 | Bacteria | 547 |
| 337 | Ga0207695_11695789 | 3300025913 | Bacteria | 513 |
| 338 | Ga0207671_10047104 | 3300025914 | Bacteria | 3190 |
| 339 | Ga0207671_10409157 | 3300025914 | Bacteria | 1079 |
| 340 | Ga0207671_10855990 | 3300025914 | Bacteria | 720 |
| 341 | Ga0207671_10984782 | 3300025914 | Bacteria | 665 |
| 342 | Ga0207671_11114049 | 3300025914 | Bacteria | 620 |
| 343 | Ga0207671_11606787 | 3300025914 | Bacteria | 500 |
| 344 | Ga0207693_10195081 | 3300025915 | Bacteria | 1593 |
| 345 | Ga0207693_10993744 | 3300025915 | Bacteria | 641 |
| 346 | Ga0207693_11059811 | 3300025915 | Bacteria | 617 |
| 347 | Ga0207663_10017844 | 3300025916 | Bacteria | 3964 |
| 348 | Ga0207663_10138731 | 3300025916 | Bacteria | 1691 |
| 349 | Ga0207660_10033618 | 3300025917 | Bacteria | 3549 |
| 350 | Ga0207660_10099104 | 3300025917 | Bacteria | 2174 |
| 351 | Ga0207660_10201117 | 3300025917 | Bacteria | 1556 |
| 352 | Ga0207660_10203919 | 3300025917 | Bacteria | 1546 |
| 353 | Ga0207660_10695019 | 3300025917 | Bacteria | 830 |
| 354 | Ga0207657_10003185 | 3300025919 | Bacteria | 17559 |
| 355 | Ga0207657_10008913 | 3300025919 | Bacteria | 10142 |
| 356 | Ga0207657_10012382 | 3300025919 | Bacteria | 8427 |
| 357 | Ga0207657_10032755 | 3300025919 | Bacteria | 4691 |
| 358 | Ga0207657_11395162 | 3300025919 | Bacteria | 526 |
| 359 | Ga0207649_10019606 | 3300025920 | Bacteria | 3868 |
| 360 | Ga0207649_10023049 | 3300025920 | Bacteria | 3601 |
| 361 | Ga0207649_10283538 | 3300025920 | Bacteria | 1205 |
| 362 | Ga0207649_10367667 | 3300025920 | Bacteria | 1069 |
| 363 | Ga0207649_11394764 | 3300025920 | Bacteria | 554 |
| 364 | Ga0207649_11429412 | 3300025920 | Unclassified | 547 |
| 365 | Ga0207652_10021006 | 3300025921 | Bacteria | 5385 |
| 366 | Ga0207652_10028452 | 3300025921 | Bacteria | 4663 |
| 367 | Ga0207652_10049501 | 3300025921 | Bacteria | 3597 |
| 368 | Ga0207652_10125219 | 3300025921 | Bacteria | 2289 |
| 369 | Ga0207652_10396006 | 3300025921 | Bacteria | 1246 |
| 370 | Ga0207652_10472137 | 3300025921 | Bacteria | 1130 |
| 371 | Ga0207694_10011619 | 3300025924 | Bacteria | 6643 |
| 372 | Ga0207694_10131015 | 3300025924 | Bacteria | 2010 |
| 373 | Ga0207694_10139542 | 3300025924 | Bacteria | 1949 |
| 374 | Ga0207694_10452964 | 3300025924 | Bacteria | 1071 |
| 375 | Ga0207694_10487183 | 3300025924 | Bacteria | 1032 |
| 376 | Ga0207694_10770405 | 3300025924 | Bacteria | 812 |
| 377 | Ga0207650_10261081 | 3300025925 | Bacteria | 1405 |
| 378 | Ga0207687_10320435 | 3300025927 | Bacteria | 1255 |
| 379 | Ga0207700_10058148 | 3300025928 | Bacteria | 2919 |
| 380 | Ga0207700_10181268 | 3300025928 | Bacteria | 1764 |
| 381 | Ga0207700_10196726 | 3300025928 | Bacteria | 1697 |
| 382 | Ga0207700_10303151 | 3300025928 | Bacteria | 1380 |
| 383 | Ga0207700_11031631 | 3300025928 | Bacteria | 736 |
| 384 | Ga0207700_11114510 | 3300025928 | Bacteria | 705 |
| 385 | Ga0207664_10018040 | 3300025929 | Bacteria | 5185 |
| 386 | Ga0207664_10292060 | 3300025929 | Bacteria | 1433 |
| 387 | Ga0207664_10468553 | 3300025929 | Bacteria | 1126 |
| 388 | Ga0207644_10018963 | 3300025931 | Bacteria | 4663 |
| 389 | Ga0207690_10001487 | 3300025932 | Bacteria | 14647 |
| 390 | Ga0207690_10332266 | 3300025932 | Bacteria | 1197 |
| 391 | Ga0207690_11272767 | 3300025932 | Bacteria | 614 |
| 392 | Ga0207686_10599710 | 3300025934 | Bacteria | 866 |
| 393 | Ga0207669_11450103 | 3300025937 | Bacteria | 585 |
| 394 | Ga0207665_10112861 | 3300025939 | Bacteria | 1911 |
| 395 | Ga0207665_10462352 | 3300025939 | Bacteria | 975 |
| 396 | Ga0207711_10000086 | 3300025941 | Bacteria | 99422 |
| 397 | Ga0207711_10015612 | 3300025941 | Bacteria | 6301 |
| 398 | Ga0207711_10188207 | 3300025941 | Bacteria | 1880 |
| 399 | Ga0207711_10205564 | 3300025941 | Bacteria | 1798 |
| 400 | Ga0207711_10607573 | 3300025941 | Bacteria | 1020 |
| 401 | Ga0207661_10011175 | 3300025944 | Bacteria | 6494 |
| 402 | Ga0207661_10013707 | 3300025944 | Bacteria | 5920 |
| 403 | Ga0207661_10046339 | 3300025944 | Bacteria | 3448 |
| 404 | Ga0207661_10274727 | 3300025944 | Bacteria | 1504 |
| 405 | Ga0207679_10420146 | 3300025945 | Bacteria | 1180 |
| 406 | Ga0207667_10004621 | 3300025949 | Bacteria | 16895 |
| 407 | Ga0207667_10010059 | 3300025949 | Bacteria | 11087 |
| 408 | Ga0207667_10014641 | 3300025949 | Bacteria | 8931 |
| 409 | Ga0207667_10015592 | 3300025949 | Bacteria | 8622 |
| 410 | Ga0207667_10053320 | 3300025949 | Bacteria | 4256 |
| 411 | Ga0207667_10056317 | 3300025949 | Bacteria | 4130 |
| 412 | Ga0207667_10528029 | 3300025949 | Bacteria | 1195 |
| 413 | Ga0207667_10530167 | 3300025949 | Bacteria | 1192 |
| 414 | Ga0207667_10819960 | 3300025949 | Bacteria | 926 |
| 415 | Ga0207712_10006954 | 3300025961 | Bacteria | 7137 |
| 416 | Ga0207640_10000023 | 3300025981 | Bacteria | 160979 |
| 417 | Ga0207640_10075139 | 3300025981 | Bacteria | 2289 |
| 418 | Ga0207640_10262866 | 3300025981 | Bacteria | 1346 |
| 419 | Ga0207640_11111853 | 3300025981 | Bacteria | 699 |
| 420 | Ga0207658_10391746 | 3300025986 | Bacteria | 1219 |
| 421 | Ga0207677_10095968 | 3300026023 | Bacteria | 2168 |
| 422 | Ga0207703_10248950 | 3300026035 | Bacteria | 1601 |
| 423 | Ga0207639_10000034 | 3300026041 | Bacteria | 154355 |
| 424 | Ga0207639_10035600 | 3300026041 | Bacteria | 3685 |
| 425 | Ga0207639_10149778 | 3300026041 | Bacteria | 1953 |
| 426 | Ga0207678_10009514 | 3300026067 | Bacteria | 8551 |
| 427 | Ga0207678_10029842 | 3300026067 | Bacteria | 4761 |
| 428 | Ga0207678_10035886 | 3300026067 | Bacteria | 4317 |
| 429 | Ga0207678_10250236 | 3300026067 | Bacteria | 1517 |
| 430 | Ga0207678_10399148 | 3300026067 | Bacteria | 1190 |
| 431 | Ga0207678_10418017 | 3300026067 | Bacteria | 1162 |
| 432 | Ga0207678_10957686 | 3300026067 | Bacteria | 757 |
| 433 | Ga0207678_11019590 | 3300026067 | Bacteria | 733 |
| 434 | Ga0207678_11438138 | 3300026067 | Bacteria | 609 |
| 435 | Ga0207702_10119468 | 3300026078 | Bacteria | 2357 |
| 436 | Ga0207702_10455360 | 3300026078 | Bacteria | 1242 |
| 437 | Ga0207702_10511364 | 3300026078 | Bacteria | 1171 |
| 438 | Ga0207702_10513881 | 3300026078 | Bacteria | 1169 |
| 439 | Ga0207702_11499125 | 3300026078 | Bacteria | 668 |
| 440 | Ga0207641_10035286 | 3300026088 | Bacteria | 4165 |
| 441 | Ga0207641_10508350 | 3300026088 | Bacteria | 1171 |
| 442 | Ga0207648_10333445 | 3300026089 | Bacteria | 1365 |
| 443 | Ga0207648_10413253 | 3300026089 | Bacteria | 1224 |
| 444 | Ga0207676_10154288 | 3300026095 | Bacteria | 1981 |
| 445 | Ga0207674_10000532 | 3300026116 | Bacteria | 49916 |
| 446 | Ga0207674_10052208 | 3300026116 | Bacteria | 4170 |
| 447 | Ga0207674_10226479 | 3300026116 | Bacteria | 1818 |
| 448 | Ga0207698_10008589 | 3300026142 | Bacteria | 6472 |
| 449 | Ga0207698_10107780 | 3300026142 | Bacteria | 2327 |
| 450 | Ga0207698_10361539 | 3300026142 | Bacteria | 1375 |
| 451 | Ga0268266_10043642 | 3300028379 | Bacteria | 3832 |
| 452 | Ga0268266_10096471 | 3300028379 | Bacteria | 2599 |
| 453 | Ga0268266_10389723 | 3300028379 | Bacteria | 1315 |
| 454 | Ga0268266_10907490 | 3300028379 | Bacteria | 852 |
| 455 | Ga0268266_11631192 | 3300028379 | Bacteria | 620 |
| 456 | Ga0265326_10114635 | 3300028558 | Bacteria | 766 |
| 457 | Ga0265319_1274486 | 3300028563 | Bacteria | 513 |
| 458 | Ga0265318_10024920 | 3300028577 | Bacteria | 2367 |
| 459 | Ga0265336_10002166 | 3300028666 | Bacteria | 8298 |
| 460 | Ga0265336_10055872 | 3300028666 | Bacteria | 1186 |
| 461 | Ga0265336_10157622 | 3300028666 | Bacteria | 675 |
| 462 | Ga0265338_10004125 | 3300028800 | Bacteria | 19883 |
| 463 | Ga0265338_10006099 | 3300028800 | Bacteria | 15475 |
| 464 | Ga0265338_10053598 | 3300028800 | Bacteria | 3606 |
| 465 | Ga0265338_10055532 | 3300028800 | Bacteria | 3522 |
| 466 | Ga0265338_10146685 | 3300028800 | Bacteria | 1840 |
| 467 | Ga0265338_10352108 | 3300028800 | Bacteria | 1058 |
| 468 | Ga0265338_10488535 | 3300028800 | Bacteria | 868 |
| 469 | Ga0265338_10657614 | 3300028800 | Bacteria | 726 |
| 470 | Ga0265324_10177768 | 3300029957 | Bacteria | 723 |
| 471 | Ga0265766_1006890 | 3300030863 | Bacteria | 753 |
| 472 | Ga0265777_104715 | 3300030877 | Bacteria | 880 |
| 473 | Ga0265777_123604 | 3300030877 | Bacteria | 519 |
| 474 | Ga0265770_1021345 | 3300030878 | Bacteria | 1029 |
| 475 | Ga0265765_1015598 | 3300030879 | Bacteria | 885 |
| 476 | Ga0265760_10038980 | 3300031090 | Bacteria | 1414 |
| 477 | Ga0265760_10191784 | 3300031090 | Bacteria | 687 |
| 478 | Ga0265330_10000477 | 3300031235 | Bacteria | 26910 |
| 479 | Ga0265330_10001295 | 3300031235 | Bacteria | 14638 |
| 480 | Ga0265330_10018950 | 3300031235 | Bacteria | 3158 |
| 481 | Ga0265330_10026960 | 3300031235 | Bacteria | 2597 |
| 482 | Ga0265330_10037542 | 3300031235 | Bacteria | 2156 |
| 483 | Ga0265330_10319696 | 3300031235 | Bacteria | 655 |
| 484 | Ga0265332_10007740 | 3300031238 | Bacteria | 4853 |
| 485 | Ga0265328_10006319 | 3300031239 | Bacteria | 5027 |
| 486 | Ga0265328_10055285 | 3300031239 | Bacteria | 1456 |
| 487 | Ga0265328_10075251 | 3300031239 | Bacteria | 1242 |
| 488 | Ga0265328_10117315 | 3300031239 | Bacteria | 991 |
| 489 | Ga0265320_10033478 | 3300031240 | Bacteria | 2623 |
| 490 | Ga0265320_10141861 | 3300031240 | Bacteria | 1088 |
| 491 | Ga0265325_10000701 | 3300031241 | Bacteria | 24270 |
| 492 | Ga0265325_10003065 | 3300031241 | Bacteria | 11039 |
| 493 | Ga0265325_10034719 | 3300031241 | Bacteria | 2681 |
| 494 | Ga0265325_10086886 | 3300031241 | Bacteria | 1546 |
| 495 | Ga0265325_10113416 | 3300031241 | Bacteria | 1315 |
| 496 | Ga0265325_10156559 | 3300031241 | Bacteria | 1074 |
| 497 | Ga0265329_10012888 | 3300031242 | Bacteria | 2994 |
| 498 | Ga0265329_10078833 | 3300031242 | Bacteria | 1043 |
| 499 | Ga0265329_10092814 | 3300031242 | Bacteria | 958 |
| 500 | Ga0265340_10001071 | 3300031247 | Bacteria | 15572 |
| 501 | Ga0265340_10052890 | 3300031247 | Bacteria | 1962 |
| 502 | Ga0265340_10113538 | 3300031247 | Bacteria | 1250 |
| 503 | Ga0265340_10202476 | 3300031247 | Bacteria | 892 |
| 504 | Ga0265340_10388081 | 3300031247 | Bacteria | 616 |
| 505 | Ga0265339_10000029 | 3300031249 | Bacteria | 139089 |
| 506 | Ga0265339_10000921 | 3300031249 | Bacteria | 22618 |
| 507 | Ga0265339_10008463 | 3300031249 | Bacteria | 6547 |
| 508 | Ga0265339_10021757 | 3300031249 | Bacteria | 3724 |
| 509 | Ga0265339_10025776 | 3300031249 | Bacteria | 3371 |
| 510 | Ga0265339_10045677 | 3300031249 | Bacteria | 2410 |
| 511 | Ga0265339_10214568 | 3300031249 | Bacteria | 944 |
| 512 | Ga0265331_10011314 | 3300031250 | Bacteria | 4891 |
| 513 | Ga0265331_10137796 | 3300031250 | Bacteria | 1111 |
| 514 | Ga0265331_10217935 | 3300031250 | Bacteria | 858 |
| 515 | Ga0265316_10006934 | 3300031344 | Bacteria | 10744 |
| 516 | Ga0265316_10007872 | 3300031344 | Bacteria | 9973 |
| 517 | Ga0265316_10013957 | 3300031344 | Bacteria | 7104 |
| 518 | Ga0265316_10030435 | 3300031344 | Bacteria | 4424 |
| 519 | Ga0265316_10040636 | 3300031344 | Bacteria | 3727 |
| 520 | Ga0265316_10073825 | 3300031344 | Bacteria | 2626 |
| 521 | Ga0265316_10074456 | 3300031344 | Bacteria | 2613 |
| 522 | Ga0265316_10187641 | 3300031344 | Bacteria | 1537 |
| 523 | Ga0265316_10274545 | 3300031344 | Bacteria | 1233 |
| 524 | Ga0265316_10328871 | 3300031344 | Bacteria | 1109 |
| 525 | Ga0265316_10389958 | 3300031344 | Bacteria | 1004 |
| 526 | Ga0265316_10565701 | 3300031344 | Bacteria | 808 |
| 527 | Ga0265316_11049467 | 3300031344 | Bacteria | 566 |
| 528 | Ga0265313_10001811 | 3300031595 | Bacteria | 19545 |
| 529 | Ga0265313_10002067 | 3300031595 | Bacteria | 17973 |
| 530 | Ga0265313_10163483 | 3300031595 | Bacteria | 944 |
| 531 | Ga0265314_10001691 | 3300031711 | Bacteria | 24008 |
| 532 | Ga0265314_10003098 | 3300031711 | Bacteria | 16368 |
| 533 | Ga0265314_10009254 | 3300031711 | Bacteria | 8343 |
| 534 | Ga0265314_10120206 | 3300031711 | Bacteria | 1655 |
| 535 | Ga0265314_10130954 | 3300031711 | Bacteria | 1565 |
| 536 | Ga0265342_10000307 | 3300031712 | Bacteria | 55504 |
| 537 | Ga0265342_10003578 | 3300031712 | Bacteria | 12683 |
| 538 | Ga0265342_10005760 | 3300031712 | Bacteria | 9367 |
| 539 | Ga0265342_10008915 | 3300031712 | Bacteria | 7128 |
| 540 | Ga0265342_10011411 | 3300031712 | Bacteria | 6084 |
| 541 | Ga0265342_10023416 | 3300031712 | Bacteria | 3910 |
| 542 | Ga0265342_10042608 | 3300031712 | Bacteria | 2741 |
| 543 | Ga0265342_10212570 | 3300031712 | Bacteria | 1045 |
| 544 | Ga0265342_10230440 | 3300031712 | Bacteria | 995 |
| 545 | Ga0316583_10025716 | 3300032133 | Bacteria | 2102 |
| 546 | Ga0316583_10049402 | 3300032133 | Bacteria | 1481 |
| 547 | Ga0316583_10070914 | 3300032133 | Bacteria | 1219 |
| 548 | Ga0307510_10021356 | 3300033180 | Bacteria | 7544 |
| 549 | Ga0307510_10057933 | 3300033180 | Bacteria | 4015 |
| 550 | Ga0307510_10113631 | 3300033180 | Bacteria | 2440 |
| 551 | Ga0373936_0620030 | 3300035113 | Bacteria | 509 |
| 552 | Ga0373954_0158309 | 3300035118 | Bacteria | 1108 |
| 553 | Ga0373943_0283139 | 3300035170 | Bacteria | 938 |
| 554 | Ga0373955_0044969 | 3300035172 | Bacteria | 2381 |
| 555 | Ga0373935_0798760 | 3300035692 | Bacteria | 697 |
| 556 | Ga0373933_0143009 | 3300035724 | Bacteria | 1511 |
| 557 | Ga0373937_0193668 | 3300036401 | Bacteria | 1910 |
| 558 | Ga0373937_0193913 | 3300036401 | Bacteria | 1909 |
| 559 | Ga0373937_0390770 | 3300036401 | Bacteria | 1320 |
| 560 | Ga0373937_0662167 | 3300036401 | Bacteria | 990 |
| 561 | Ga0373937_0893831 | 3300036401 | Bacteria | 837 |
| 562 | Ga0373937_1268394 | 3300036401 | Bacteria | 685 |
| 563 | Ga0373937_1322130 | 3300036401 | Bacteria | 669 |
| 564 | Ga0265778_000274 | 3300036457 | Bacteria | 3846 |
| 565 | Ga0265778_042012 | 3300036457 | Bacteria | 611 |
| 566 | Ga0372808_025990 | 3300036459 | Bacteria | 841 |
| 567 | Ga0373925_0297434 | 3300037068 | Bacteria | 1303 |
| 568 | Ga0395900_0872580 | 3300037418 | Bacteria | 824 |
| 569 | Ga0395900_0975676 | 3300037418 | Bacteria | 768 |
| 570 | Ga0395898_0874566 | 3300037466 | Bacteria | 837 |
| 571 | Ga0436364_1102996 | 3300037853 | Bacteria | 744 |
| 572 | Ga0395901_0258507 | 3300038443 | Bacteria | 1813 |
| 573 | Ga0395901_0624604 | 3300038443 | Bacteria | 1084 |
| 574 | Ga0436365_0942309 | 3300039437 | Bacteria | 1944 |
| 575 | Ga0436360_0020830 | 3300039438 | Bacteria | 1273 |
| 576 | Ga0436360_0228968 | 3300039438 | Bacteria | 6461 |
| 577 | Ga0436360_0276944 | 3300039438 | Bacteria | 714 |
| 578 | Ga0436360_0385320 | 3300039438 | Bacteria | 1428 |
| 579 | Ga0436360_0686235 | 3300039438 | Bacteria | 739 |
| 580 | Ga0436361_0270740 | 3300039447 | Bacteria | 8649 |
| 581 | Ga0436361_0372633 | 3300039447 | Bacteria | 3166 |
| 582 | Ga0436361_0486474 | 3300039447 | Bacteria | 9580 |
| 583 | Ga0436361_0674593 | 3300039447 | Bacteria | 3692 |
| 584 | Ga0436361_0750744 | 3300039447 | Bacteria | 1142 |
| 585 | Ga0436361_0824839 | 3300039447 | Bacteria | 4602 |
| 586 | Ga0436361_0950252 | 3300039447 | Bacteria | 868 |
| 587 | Ga0436361_1077281 | 3300039447 | Bacteria | 751 |
| 588 | Ga0436361_1086046 | 3300039447 | Bacteria | 694 |
| 589 | Ga0436363_0704407 | 3300039450 | Bacteria | 3613 |
| 590 | Ga0436362_0140245 | 3300039453 | Bacteria | 730 |
| 591 | Ga0436362_0574597 | 3300039453 | Bacteria | 900 |
| 592 | Ga0436362_0929367 | 3300039453 | Bacteria | 838 |
| 593 | Ga0466969_0060890 | 3300044656 | Bacteria | 1835 |
| 594 | Ga0466972_0383083 | 3300044658 | Bacteria | 659 |
| 595 | Ga0466966_0153642 | 3300044684 | Bacteria | 1403 |
| 596 | Ga0466961_0302188 | 3300044693 | Bacteria | 977 |
| 597 | Ga0466961_0504271 | 3300044693 | Bacteria | 731 |
| 598 | Ga0466970_0713229 | 3300044765 | Bacteria | 585 |
| 599 | Ga0466959_0611243 | 3300045049 | Bacteria | 733 |
| 600 | Ga0466958_0391635 | 3300045836 | Bacteria | 896 |
| 601 | Ga0466958_0395944 | 3300045836 | Bacteria | 891 |
| 602 | Ga0466958_0565165 | 3300045836 | Bacteria | 739 |
| 603 | Ga0466958_0568065 | 3300045836 | Bacteria | 737 |
| 604 | Ga0466967_0073852 | 3300045976 | Bacteria | 3061 |
| 605 | Ga0495617_037889 | 3300046452 | Bacteria | 1614 |
| 606 | Ga0495592_0048563 | 3300046454 | Bacteria | 3157 |
| 607 | Ga0495592_0099518 | 3300046454 | Bacteria | 2074 |
| 608 | Ga0495603_0019644 | 3300046455 | Bacteria | 4090 |
| 609 | Ga0495603_0086693 | 3300046455 | Bacteria | 1832 |
| 610 | Ga0495603_0169854 | 3300046455 | Bacteria | 1263 |
| 611 | Ga0495590_0073335 | 3300046457 | Bacteria | 1203 |
| 612 | Ga0495590_0265606 | 3300046457 | Bacteria | 640 |
| 613 | Ga0495629_0051980 | 3300046459 | Bacteria | 2867 |
| 614 | Ga0495629_0055550 | 3300046459 | Bacteria | 2768 |
| 615 | Ga0495629_1129920 | 3300046459 | Bacteria | 505 |
| 616 | Ga0495638_0341614 | 3300046460 | Bacteria | 793 |
| 617 | Ga0495641_0194345 | 3300046461 | Bacteria | 909 |
| 618 | Ga0495641_0574191 | 3300046461 | Bacteria | 515 |
| 619 | Ga0495651_0024980 | 3300046462 | Bacteria | 4648 |
| 620 | Ga0495651_0049871 | 3300046462 | Bacteria | 3231 |
| 621 | Ga0495651_0065572 | 3300046462 | Bacteria | 2773 |
| 622 | Ga0495653_0002196 | 3300046463 | Bacteria | 15433 |
| 623 | Ga0495650_0000010 | 3300046471 | Bacteria | 645599 |
| 624 | Ga0495650_0001875 | 3300046471 | Bacteria | 18731 |
| 625 | Ga0495650_0197969 | 3300046471 | Bacteria | 699 |
| 626 | Ga0495580_0067138 | 3300046472 | Bacteria | 2510 |
| 627 | Ga0495580_0085802 | 3300046472 | Bacteria | 2192 |
| 628 | Ga0495580_0170496 | 3300046472 | Bacteria | 1505 |
| 629 | Ga0495580_0198427 | 3300046472 | Bacteria | 1383 |
| 630 | Ga0495582_0008570 | 3300046473 | Bacteria | 5638 |
| 631 | Ga0495582_0129170 | 3300046473 | Bacteria | 1427 |
| 632 | Ga0495582_0146543 | 3300046473 | Bacteria | 1339 |
| 633 | Ga0495582_0520871 | 3300046473 | Bacteria | 687 |
| 634 | Ga0495605_0151598 | 3300046474 | Bacteria | 1034 |
| 635 | Ga0495639_0001203 | 3300046475 | Bacteria | 11668 |
| 636 | Ga0495639_0076479 | 3300046475 | Bacteria | 1553 |
| 637 | Ga0495662_0000747 | 3300046476 | Bacteria | 15591 |
| 638 | Ga0495662_0101009 | 3300046476 | Bacteria | 1411 |
| 639 | Ga0495664_0107665 | 3300046477 | Bacteria | 1682 |
| 640 | Ga0495664_0127829 | 3300046477 | Bacteria | 1538 |
| 641 | Ga0495664_0160449 | 3300046477 | Bacteria | 1364 |
| 642 | Ga0495664_0401226 | 3300046477 | Bacteria | 823 |
| 643 | Ga0495664_0408212 | 3300046477 | Bacteria | 815 |
| 644 | Ga0495585_0007246 | 3300046492 | Bacteria | 6811 |
| 645 | Ga0495585_0104010 | 3300046492 | Bacteria | 1516 |
| 646 | Ga0495594_0008173 | 3300046499 | Bacteria | 5385 |
| 647 | Ga0495594_0046135 | 3300046499 | Bacteria | 2392 |
| 648 | Ga0495594_0771920 | 3300046499 | Bacteria | 542 |
| 649 | Ga0495596_0038690 | 3300046500 | Bacteria | 1885 |
| 650 | Ga0495607_0240149 | 3300046501 | Bacteria | 877 |
| 651 | Ga0495583_0052529 | 3300046506 | Bacteria | 1853 |
| 652 | Ga0495583_0162272 | 3300046506 | Bacteria | 921 |
| 653 | Ga0495606_0169637 | 3300046507 | Bacteria | 1267 |
| 654 | Ga0495606_0220620 | 3300046507 | Bacteria | 1068 |
| 655 | Ga0495606_0243681 | 3300046507 | Bacteria | 1001 |
| 656 | Ga0495608_0414698 | 3300046511 | Bacteria | 822 |
| 657 | Ga0495618_0139851 | 3300046514 | Bacteria | 1549 |
| 658 | Ga0495628_0040852 | 3300046516 | Bacteria | 3704 |
| 659 | Ga0495628_0332235 | 3300046516 | Bacteria | 1120 |
| 660 | Ga0495628_0487071 | 3300046516 | Bacteria | 892 |
| 661 | Ga0495630_0056994 | 3300046517 | Bacteria | 2928 |
| 662 | Ga0495630_0409047 | 3300046517 | Bacteria | 1040 |
| 663 | Ga0495631_0104248 | 3300046518 | Bacteria | 1220 |
| 664 | Ga0495631_0146549 | 3300046518 | Bacteria | 1013 |
| 665 | Ga0495644_0000777 | 3300046523 | Bacteria | 13129 |
| 666 | Ga0495648_0038427 | 3300046524 | Bacteria | 3061 |
| 667 | Ga0495648_0372927 | 3300046524 | Bacteria | 645 |
| 668 | Ga0495666_0000949 | 3300046526 | Bacteria | 13647 |
| 669 | Ga0495642_0026468 | 3300046528 | Bacteria | 2304 |
| 670 | Ga0495652_0010348 | 3300046529 | Bacteria | 8451 |
| 671 | Ga0495652_0033406 | 3300046529 | Bacteria | 4491 |
| 672 | Ga0495652_0115140 | 3300046529 | Bacteria | 2155 |
| 673 | Ga0495665_0003007 | 3300046531 | Bacteria | 9111 |
| 674 | Ga0495665_0033282 | 3300046531 | Bacteria | 2757 |
| 675 | Ga0495640_0018326 | 3300046533 | Bacteria | 5196 |
| 676 | Ga0495586_0003386 | 3300046535 | Bacteria | 8551 |
| 677 | Ga0495587_0014310 | 3300046536 | Bacteria | 4980 |
| 678 | Ga0495587_0035208 | 3300046536 | Bacteria | 3017 |
| 679 | Ga0495609_0063305 | 3300046538 | Bacteria | 1632 |
| 680 | Ga0495609_0075964 | 3300046538 | Bacteria | 1473 |
| 681 | Ga0495645_0001054 | 3300046543 | Bacteria | 18775 |
| 682 | Ga0495645_0006005 | 3300046543 | Bacteria | 8397 |
| 683 | Ga0495645_0008101 | 3300046543 | Bacteria | 7323 |
| 684 | Ga0495645_0014411 | 3300046543 | Bacteria | 5610 |
| 685 | Ga0495645_0246041 | 3300046543 | Bacteria | 1191 |
| 686 | Ga0495622_0467239 | 3300046557 | Bacteria | 540 |
| 687 | Ga0495633_0013370 | 3300046558 | Bacteria | 4329 |
| 688 | Ga0495667_0003070 | 3300046559 | Bacteria | 11203 |
| 689 | Ga0495667_0794900 | 3300046559 | Bacteria | 583 |
| 690 | Ga0495668_0021631 | 3300046616 | Bacteria | 3686 |
| 691 | Ga0495668_0120025 | 3300046616 | Bacteria | 1438 |
| 692 | Ga0495634_0001003 | 3300046642 | Bacteria | 26591 |
| 693 | Ga0495611_0365400 | 3300046648 | Bacteria | 661 |
| 694 | Ga0495625_0003213 | 3300046660 | Bacteria | 16576 |
| 695 | Ga0495625_0013458 | 3300046660 | Bacteria | 6575 |
| 696 | Ga0495625_0042541 | 3300046660 | Bacteria | 3300 |
| 697 | Ga0495625_0044844 | 3300046660 | Bacteria | 3199 |
| 698 | Ga0495625_0071757 | 3300046660 | Bacteria | 2429 |
| 699 | Ga0495625_0171924 | 3300046660 | Bacteria | 1446 |
| 700 | Ga0495635_0007598 | 3300046663 | Bacteria | 7562 |
| 701 | Ga0495635_0148424 | 3300046663 | Bacteria | 1596 |
| 702 | Ga0495659_0114422 | 3300046664 | Bacteria | 1056 |
| 703 | Ga0495661_0009905 | 3300046665 | Bacteria | 6520 |
| 704 | Ga0495661_0389233 | 3300046665 | Bacteria | 680 |
| 705 | Ga0495588_0020496 | 3300046674 | Bacteria | 3251 |
| 706 | Ga0495588_0200104 | 3300046674 | Bacteria | 1055 |
| 707 | Ga0495657_0497560 | 3300046675 | Bacteria | 711 |
| 708 | Ga0495599_0016425 | 3300046678 | Bacteria | 4595 |
| 709 | Ga0495599_0031846 | 3300046678 | Bacteria | 3310 |
| 710 | Ga0495599_0191735 | 3300046678 | Bacteria | 1257 |
| 711 | Ga0495623_0021136 | 3300046679 | Bacteria | 4205 |
| 712 | Ga0495623_0035235 | 3300046679 | Bacteria | 3208 |
| 713 | Ga0495623_0356629 | 3300046679 | Bacteria | 795 |
| 714 | Ga0495646_0012115 | 3300046680 | Bacteria | 5483 |
| 715 | Ga0495646_0261301 | 3300046680 | Bacteria | 925 |
| 716 | Ga0495646_0292279 | 3300046680 | Bacteria | 863 |
| 717 | Ga0495647_0337116 | 3300046681 | Bacteria | 685 |
| 718 | Ga0495658_0095303 | 3300046683 | Bacteria | 1769 |
| 719 | Ga0495658_0134260 | 3300046683 | Bacteria | 1509 |
| 720 | Ga0495669_0000955 | 3300046684 | Bacteria | 12075 |
| 721 | Ga0495669_0048229 | 3300046684 | Bacteria | 1905 |
| 722 | Ga0495669_0164802 | 3300046684 | Bacteria | 1053 |
| 723 | Ga0495613_0012294 | 3300046689 | Bacteria | 6357 |
| 724 | Ga0495613_0026345 | 3300046689 | Bacteria | 4332 |
| 725 | Ga0495613_0206159 | 3300046689 | Bacteria | 1384 |
| 726 | Ga0495624_0003012 | 3300046690 | Bacteria | 12609 |
| 727 | Ga0495624_0105187 | 3300046690 | Bacteria | 1737 |
| 728 | Ga0495670_0044582 | 3300046691 | Bacteria | 2214 |
| 729 | Ga0495671_0103700 | 3300046692 | Bacteria | 1389 |
| 730 | Ga0495649_0087213 | 3300046694 | Bacteria | 1665 |
| 731 | Ga0495649_0116151 | 3300046694 | Bacteria | 1417 |
| 732 | Ga0495649_0324589 | 3300046694 | Bacteria | 781 |
| 733 | Ga0495649_0403724 | 3300046694 | Bacteria | 686 |
| 734 | Ga0495589_0198735 | 3300046794 | Bacteria | 947 |
| 735 | Ga0495600_0003517 | 3300046809 | Bacteria | 9206 |
| 736 | Ga0495600_0070830 | 3300046809 | Bacteria | 2278 |
| 737 | Ga0495600_0203032 | 3300046809 | Bacteria | 1272 |
| 738 | Ga0495581_0000275 | 3300047315 | Bacteria | 24951 |
| 739 | Ga0495604_0005020 | 3300047317 | Bacteria | 10473 |
| 740 | Ga0495604_0006391 | 3300047317 | Bacteria | 9348 |
| 741 | Ga0495604_0036403 | 3300047317 | Bacteria | 3880 |
| 742 | Ga0495604_0688989 | 3300047317 | Bacteria | 649 |
| 743 | Ga0495636_0026297 | 3300047318 | Bacteria | 2367 |
| 744 | Ga0495674_0022106 | 3300047319 | Bacteria | 5870 |
| 745 | Ga0495674_0657525 | 3300047319 | Bacteria | 826 |
| 746 | Ga0495672_0004479 | 3300047320 | Bacteria | 11425 |
| 747 | Ga0495672_0081242 | 3300047320 | Bacteria | 1805 |
| 748 | Ga0495676_0007390 | 3300047321 | Bacteria | 10083 |
| 749 | Ga0495680_0023728 | 3300047322 | Bacteria | 5097 |
| 750 | Ga0495683_0054067 | 3300047323 | Bacteria | 2002 |
| 751 | Ga0495687_023471 | 3300047443 | Bacteria | 2945 |
| 752 | Ga0495675_0004057 | 3300047444 | Bacteria | 8870 |
| 753 | Ga0495675_0490485 | 3300047444 | Bacteria | 706 |
| 754 | Ga0495675_0608441 | 3300047444 | Bacteria | 619 |
| 755 | Ga0495677_0029395 | 3300047445 | Bacteria | 1998 |
| 756 | Ga0495673_0046320 | 3300047469 | Bacteria | 1928 |
| 757 | Ga0495673_0085086 | 3300047469 | Bacteria | 1302 |
| 758 | Ga0495681_0104518 | 3300047470 | Bacteria | 1234 |
| 759 | Ga0495684_0009955 | 3300047471 | Bacteria | 7343 |
| 760 | Ga0495684_0420787 | 3300047471 | Bacteria | 934 |
| 761 | Ga0495684_0430257 | 3300047471 | Bacteria | 921 |
| 762 | Ga0495686_0000545 | 3300047472 | Bacteria | 53866 |
| 763 | Ga0495686_0002881 | 3300047472 | Bacteria | 15450 |
| 764 | Ga0495686_0006326 | 3300047472 | Bacteria | 9086 |
| 765 | Ga0495686_0014417 | 3300047472 | Bacteria | 5440 |
| 766 | Ga0495686_0024306 | 3300047472 | Bacteria | 3984 |
| 767 | Ga0495686_0045899 | 3300047472 | Bacteria | 2763 |
| 768 | Ga0495686_0066670 | 3300047472 | Bacteria | 2224 |
| 769 | Ga0495686_0420547 | 3300047472 | Bacteria | 714 |
| 770 | Ga0495593_0070451 | 3300047673 | Bacteria | 1817 |
| 771 | Ga0495593_0436075 | 3300047673 | Bacteria | 655 |
| 772 | Ga0495602_0061846 | 3300048088 | Bacteria | 3252 |
| 773 | Ga0495602_0196969 | 3300048088 | Bacteria | 1540 |
| 774 | Ga0495602_0727973 | 3300048088 | Bacteria | 671 |
| 775 | Ga0495614_0004587 | 3300048089 | Bacteria | 6220 |
| 776 | Ga0495614_0042970 | 3300048089 | Bacteria | 1937 |
| 777 | Ga0496100_0931670 | 3300048903 | Bacteria | 683 |
| 778 | Ga0496100_1237580 | 3300048903 | Bacteria | 589 |
| 779 | Ga0496101_0173120 | 3300048904 | Bacteria | 1660 |
| 780 | Ga0496101_0252000 | 3300048904 | Bacteria | 1376 |
| 781 | Ga0496101_0981084 | 3300048904 | Bacteria | 665 |
| 782 | Ga0496101_0984514 | 3300048904 | Bacteria | 663 |
| 783 | Ga0496104_0061071 | 3300048907 | Bacteria | 3572 |
| 784 | Ga0496104_0097200 | 3300048907 | Bacteria | 2818 |
| 785 | Ga0496104_0162506 | 3300048907 | Bacteria | 2142 |
| 786 | Ga0496104_0262614 | 3300048907 | Bacteria | 1639 |
| 787 | Ga0496104_1457421 | 3300048907 | Bacteria | 587 |
| 788 | Ga0496105_0133722 | 3300048908 | Bacteria | 2043 |
| 789 | Ga0496105_0339545 | 3300048908 | Bacteria | 1201 |
| 790 | Ga0496105_0497224 | 3300048908 | Bacteria | 958 |
| 791 | Ga0496105_0686913 | 3300048908 | Bacteria | 787 |
| 792 | Ga0496105_1235552 | 3300048908 | Bacteria | 548 |
| 793 | Ga0496106_0458764 | 3300048909 | Bacteria | 1024 |
| 794 | Ga0496106_1095593 | 3300048909 | Bacteria | 624 |
| 795 | Ga0496107_0162603 | 3300048910 | Bacteria | 1655 |
| 796 | Ga0496107_0828685 | 3300048910 | Bacteria | 676 |
| 797 | Ga0496107_0881946 | 3300048910 | Bacteria | 653 |
| 798 | Ga0496108_0179181 | 3300048911 | Bacteria | 1835 |
| 799 | Ga0496108_0454517 | 3300048911 | Bacteria | 1119 |
| 800 | Ga0496109_0425937 | 3300048912 | Bacteria | 1254 |
| 801 | Ga0496110_1178700 | 3300048913 | Bacteria | 675 |
| 802 | Ga0496110_1244749 | 3300048913 | Bacteria | 653 |
| 803 | Ga0496111_0156901 | 3300048914 | Bacteria | 1689 |
| 804 | Ga0496111_0582383 | 3300048914 | Bacteria | 820 |
| 805 | Ga0496112_0310070 | 3300048915 | Bacteria | 1523 |
| 806 | Ga0496112_0630485 | 3300048915 | Bacteria | 1002 |
| 807 | Ga0496112_0636936 | 3300048915 | Bacteria | 996 |
| 808 | Ga0496113_0047824 | 3300048916 | Bacteria | 3180 |
| 809 | Ga0496114_0098797 | 3300048917 | Bacteria | 2489 |
| 810 | Ga0496114_0306071 | 3300048917 | Bacteria | 1403 |
| 811 | Ga0496114_1336806 | 3300048917 | Bacteria | 604 |
| 812 | Ga0496114_1540190 | 3300048917 | Bacteria | 553 |
| 813 | Ga0496115_0027967 | 3300048918 | Bacteria | 4415 |
| 814 | Ga0496115_0104212 | 3300048918 | Bacteria | 2328 |
| 815 | Ga0496115_0152147 | 3300048918 | Bacteria | 1911 |
| 816 | Ga0496115_0310631 | 3300048918 | Bacteria | 1291 |
| 817 | Ga0496115_0335496 | 3300048918 | Bacteria | 1234 |
| 818 | Ga0496115_0450425 | 3300048918 | Bacteria | 1040 |
| 819 | Ga0496120_0172031 | 3300048923 | Bacteria | 1071 |
| 820 | Ga0496121_0419073 | 3300048924 | Bacteria | 872 |
| 821 | Ga0496124_0276545 | 3300048927 | Bacteria | 1227 |
| 822 | Ga0496126_0000005 | 3300048929 | Bacteria | 891906 |
| 823 | Ga0496126_0000209 | 3300048929 | Bacteria | 131440 |
| 824 | Ga0496126_0000560 | 3300048929 | Bacteria | 71370 |
| 825 | Ga0496126_0003148 | 3300048929 | Bacteria | 21270 |
| 826 | Ga0496126_0009044 | 3300048929 | Bacteria | 10652 |
| 827 | Ga0496126_0277238 | 3300048929 | Bacteria | 1390 |
| 828 | Ga0496126_0390269 | 3300048929 | Bacteria | 1131 |
| 829 | Ga0496126_0888953 | 3300048929 | Bacteria | 676 |
| 830 | Ga0496126_0992538 | 3300048929 | Bacteria | 631 |
| 831 | Ga0495682_0020449 | 3300049460 | Bacteria | 2485 |
| 832 | Ga0495682_0026975 | 3300049460 | Bacteria | 2132 |
| 833 | Ga0495682_0094546 | 3300049460 | Bacteria | 1073 |
| 834 | Ga0495682_0171372 | 3300049460 | Bacteria | 772 |
| 835 | Ga0501031_0097064 | 3300049568 | Bacteria | 1923 |
| 836 | Ga0501031_0293977 | 3300049568 | Bacteria | 1053 |
| 837 | Ga0501032_0005510 | 3300049569 | Bacteria | 9390 |
| 838 | Ga0501032_1022762 | 3300049569 | Bacteria | 519 |
| 839 | Ga0501033_0008766 | 3300049570 | Bacteria | 7819 |
| 840 | Ga0501034_0014438 | 3300049571 | Bacteria | 8132 |
| 841 | Ga0501036_0001574 | 3300049572 | Bacteria | 17653 |
| 842 | Ga0501036_1256767 | 3300049572 | Bacteria | 602 |
| 843 | Ga0501037_0007110 | 3300049573 | Bacteria | 8181 |
| 844 | Ga0501037_0034434 | 3300049573 | Bacteria | 3737 |
| 845 | Ga0501038_0039432 | 3300049574 | Bacteria | 4131 |
| 846 | Ga0501039_0033853 | 3300049575 | Bacteria | 3942 |
| 847 | Ga0501043_0002607 | 3300049579 | Bacteria | 15212 |
| 848 | Ga0501043_0146637 | 3300049579 | Bacteria | 1848 |
| 849 | Ga0501043_0776962 | 3300049579 | Bacteria | 694 |
| 850 | Ga0501046_0000150 | 3300049580 | Bacteria | 72900 |
| 851 | Ga0501047_0003876 | 3300049581 | Bacteria | 14071 |
| 852 | Ga0501047_0014539 | 3300049581 | Bacteria | 7487 |
| 853 | Ga0501048_0221075 | 3300049582 | Bacteria | 1343 |
| 854 | Ga0501069_0405717 | 3300049585 | Bacteria | 807 |
| 855 | Ga0501069_0717165 | 3300049585 | Bacteria | 604 |
| 856 | Ga0501070_0073834 | 3300049586 | Bacteria | 2823 |
| 857 | Ga0501073_0011548 | 3300049589 | Bacteria | 6458 |
| 858 | Ga0501073_0046410 | 3300049589 | Bacteria | 3055 |
| 859 | Ga0501079_0636503 | 3300049741 | Bacteria | 840 |
| 860 | Ga0501080_0022666 | 3300049742 | Bacteria | 5817 |
| 861 | Ga0501080_0098664 | 3300049742 | Bacteria | 2711 |
| 862 | Ga0501035_0030018 | 3300049822 | Bacteria | 4957 |
| 863 | Ga0501035_0211173 | 3300049822 | Bacteria | 1660 |
| 864 | Ga0501035_0460411 | 3300049822 | Bacteria | 1051 |
| 865 | Ga0501044_0005372 | 3300049823 | Bacteria | 14234 |
| 866 | Ga0501044_0034545 | 3300049823 | Bacteria | 5301 |
| 867 | Ga0501044_0145264 | 3300049823 | Bacteria | 2358 |
| 868 | Ga0501045_0741216 | 3300049824 | Bacteria | 724 |
| 869 | nmdc:mga05p37_167227_c1 | 3300050507 | Bacteria | 2683 |
| 870 | Ga0495601_0234521 | 3300053077 | Bacteria | 1198 |
| 871 | Ga0495601_0238064 | 3300053077 | Bacteria | 1189 |
| 872 | Ga0495601_0238620 | 3300053077 | Bacteria | 1187 |
| 873 | Ga0495601_0547492 | 3300053077 | Bacteria | 745 |
| 874 | Ga0495595_0333460 | 3300053084 | Bacteria | 765 |
| 875 | Ga0495619_0572229 | 3300053085 | Bacteria | 774 |
| 876 | Ga0495619_0906341 | 3300053085 | Bacteria | 593 |
| 877 | Ga0500643_027281 | 3300053087 | Bacteria | 1776 |
| 878 | Ga0500651_0000049 | 3300053093 | Bacteria | 83361 |
| 879 | Ga0500595_000014 | 3300053119 | Bacteria | 247996 |
| 880 | Ga0500595_009469 | 3300053119 | Bacteria | 3929 |
| 881 | Ga0500595_071903 | 3300053119 | Bacteria | 1024 |
| 882 | Ga0500655_026758 | 3300053133 | Bacteria | 1099 |
| 883 | Ga0500559_0098074 | 3300053136 | Bacteria | 1348 |
| 884 | Ga0500552_098504 | 3300053733 | Bacteria | 553 |
| 885 | Ga0501084_0836701 | 3300054114 | Bacteria | 775 |
| 886 | Ga0587070_235682 | 3300059491 | Bacteria | 503 |
| 887 | Ga0587094_108760 | 3300059513 | Bacteria | 543 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300059491 | Ga0587070_235682 | Ga0587070_235682_33_320 | 90 |
| 2 | 3300024225 | Ga0224572_1040625 | Ga0224572_10406253 | 96 |
| 3 | 3300005336 | Ga0070680_100075737 | Ga0070680_1000757371 | 98 |
| 4 | 3300039450 | Ga0436363_0704407 | Ga0436363_0704407_2888_3193 | 99 |
| 5 | 3300039453 | Ga0436362_0574597 | Ga0436362_0574597_131_460 | 99 |
| 6 | 3300010159 | Ga0099796_10190101 | Ga0099796_101901012 | 100 |
| 7 | 3300019182 | Ga0184598_113851 | Ga0184598_1138511 | 100 |
| 8 | 3300048929 | Ga0496126_0888953 | Ga0496126_0888953_301_612 | 100 |
| 9 | 3300004803 | Ga0058862_12712161 | Ga0058862_127121612 | 101 |
| 10 | 3300005327 | Ga0070658_10253679 | Ga0070658_102536792 | 101 |
| 11 | 3300005327 | Ga0070658_11047070 | Ga0070658_110470702 | 101 |
| 12 | 3300005336 | Ga0070680_100091294 | Ga0070680_1000912943 | 101 |
| 13 | 3300005455 | Ga0070663_101348258 | Ga0070663_1013482581 | 101 |
| 14 | 3300005458 | Ga0070681_11194031 | Ga0070681_111940312 | 101 |
| 15 | 3300005530 | Ga0070679_101411759 | Ga0070679_1014117591 | 101 |
| 16 | 3300005842 | Ga0068858_100606443 | Ga0068858_1006064433 | 101 |
| 17 | 3300013102 | Ga0157371_10149884 | Ga0157371_101498843 | 101 |
| 18 | 3300013104 | Ga0157370_10419687 | Ga0157370_104196873 | 101 |
| 19 | 3300013105 | Ga0157369_10870738 | Ga0157369_108707382 | 101 |
| 20 | 3300013307 | Ga0157372_10235497 | Ga0157372_102354974 | 101 |
| 21 | 3300020070 | Ga0206356_10233622 | Ga0206356_102336221 | 101 |
| 22 | 3300020075 | Ga0206349_1580743 | Ga0206349_15807431 | 101 |
| 23 | 3300020078 | Ga0206352_10132864 | Ga0206352_101328642 | 101 |
| 24 | 3300020610 | Ga0154015_1664317 | Ga0154015_16643172 | 101 |
| 25 | 3300025919 | Ga0207657_11395162 | Ga0207657_113951622 | 101 |
| 26 | 3300025920 | Ga0207649_11429412 | Ga0207649_114294121 | 101 |
| 27 | 3300026067 | Ga0207678_10418017 | Ga0207678_104180173 | 101 |
| 28 | 3300026067 | Ga0207678_11438138 | Ga0207678_114381382 | 101 |
| 29 | 3300037418 | Ga0395900_0872580 | Ga0395900_0872580_409_717 | 101 |
| 30 | 3300037466 | Ga0395898_0874566 | Ga0395898_0874566_463_771 | 101 |
| 31 | 3300038443 | Ga0395901_0624604 | Ga0395901_0624604_301_609 | 101 |
| 32 | 3300039437 | Ga0436365_0942309 | Ga0436365_0942309_796_1116 | 101 |
| 33 | 3300049585 | Ga0501069_0717165 | Ga0501069_0717165_90_398 | 101 |
| 34 | 3300009148 | Ga0105243_11064316 | Ga0105243_110643162 | 102 |
| 35 | 3300013104 | Ga0157370_10007024 | Ga0157370_1000702417 | 102 |
| 36 | 3300013105 | Ga0157369_10118054 | Ga0157369_101180544 | 102 |
| 37 | 3300013307 | Ga0157372_10233303 | Ga0157372_102333034 | 102 |
| 38 | 3300014969 | Ga0157376_10028432 | Ga0157376_100284325 | 102 |
| 39 | 3300025928 | Ga0207700_10196726 | Ga0207700_101967264 | 102 |
| 40 | 3300025981 | Ga0207640_10262866 | Ga0207640_102628662 | 102 |
| 41 | 3300026142 | Ga0207698_10107780 | Ga0207698_101077803 | 102 |
| 42 | 3300030879 | Ga0265765_1015598 | Ga0265765_10155982 | 102 |
| 43 | 3300036457 | Ga0265778_042012 | Ga0265778_042012_25_339 | 102 |
| 44 | 3300039453 | Ga0436362_0929367 | Ga0436362_0929367_171_482 | 102 |
| 45 | 3300044693 | Ga0466961_0504271 | Ga0466961_0504271_204_515 | 102 |
| 46 | 3300045836 | Ga0466958_0395944 | Ga0466958_0395944_157_468 | 102 |
| 47 | 3300048929 | Ga0496126_0003148 | Ga0496126_0003148_17795_18112 | 102 |
| 48 | 3300048929 | Ga0496126_0277238 | Ga0496126_0277238_233_547 | 102 |
| 49 | 3300048929 | Ga0496126_0390269 | Ga0496126_0390269_273_587 | 102 |
| 50 | 3300003659 | JGI25404J52841_10035318 | JGI25404J52841_100353183 | 103 |
| 51 | 3300005367 | Ga0070667_100326259 | Ga0070667_1003262594 | 103 |
| 52 | 3300005548 | Ga0070665_100138605 | Ga0070665_1001386056 | 103 |
| 53 | 3300005841 | Ga0068863_100441707 | Ga0068863_1004417073 | 103 |
| 54 | 3300005842 | Ga0068858_101327357 | Ga0068858_1013273572 | 103 |
| 55 | 3300005937 | Ga0081455_10401326 | Ga0081455_104013263 | 103 |
| 56 | 3300005983 | Ga0081540_1027528 | Ga0081540_10275286 | 103 |
| 57 | 3300009545 | Ga0105237_10166637 | Ga0105237_101666374 | 103 |
| 58 | 3300010375 | Ga0105239_10263000 | Ga0105239_102630004 | 103 |
| 59 | 3300013105 | Ga0157369_11888698 | Ga0157369_118886981 | 103 |
| 60 | 3300025903 | Ga0207680_10043011 | Ga0207680_100430114 | 103 |
| 61 | 3300025904 | Ga0207647_10004892 | Ga0207647_100048929 | 103 |
| 62 | 3300025914 | Ga0207671_11114049 | Ga0207671_111140492 | 103 |
| 63 | 3300026088 | Ga0207641_10508350 | Ga0207641_105083502 | 103 |
| 64 | 3300028379 | Ga0268266_10096471 | Ga0268266_100964711 | 103 |
| 65 | 3300039447 | Ga0436361_1086046 | Ga0436361_1086046_205_522 | 103 |
| 66 | 3300044658 | Ga0466972_0383083 | Ga0466972_0383083_105_425 | 103 |
| 67 | 3300046457 | Ga0495590_0073335 | Ga0495590_0073335_541_861 | 103 |
| 68 | 3300046507 | Ga0495606_0169637 | Ga0495606_0169637_14_334 | 103 |
| 69 | 3300046694 | Ga0495649_0087213 | Ga0495649_0087213_520_840 | 103 |
| 70 | 3300047443 | Ga0495687_023471 | Ga0495687_023471_1199_1519 | 103 |
| 71 | 3300047472 | Ga0495686_0024306 | Ga0495686_0024306_1313_1660 | 103 |
| 72 | 3300049460 | Ga0495682_0094546 | Ga0495682_0094546_83_403 | 103 |
| 73 | 3300005436 | Ga0070713_101809854 | Ga0070713_1018098541 | 104 |
| 74 | 3300005468 | Ga0070707_101205634 | Ga0070707_1012056342 | 104 |
| 75 | 3300005563 | Ga0068855_101177227 | Ga0068855_1011772272 | 104 |
| 76 | 3300005614 | Ga0068856_100645530 | Ga0068856_1006455302 | 104 |
| 77 | 3300006028 | Ga0070717_10050783 | Ga0070717_100507834 | 104 |
| 78 | 3300006175 | Ga0070712_101640752 | Ga0070712_1016407522 | 104 |
| 79 | 3300009098 | Ga0105245_11891649 | Ga0105245_118916491 | 104 |
| 80 | 3300010375 | Ga0105239_10517504 | Ga0105239_105175042 | 104 |
| 81 | 3300013297 | Ga0157378_10695612 | Ga0157378_106956122 | 104 |
| 82 | 3300025906 | Ga0207699_10312742 | Ga0207699_103127423 | 104 |
| 83 | 3300025915 | Ga0207693_11059811 | Ga0207693_110598112 | 104 |
| 84 | 3300025916 | Ga0207663_10017844 | Ga0207663_100178444 | 104 |
| 85 | 3300025928 | Ga0207700_11031631 | Ga0207700_110316312 | 104 |
| 86 | 3300025932 | Ga0207690_11272767 | Ga0207690_112727672 | 104 |
| 87 | 3300025949 | Ga0207667_10528029 | Ga0207667_105280292 | 104 |
| 88 | 3300026078 | Ga0207702_11499125 | Ga0207702_114991251 | 104 |
| 89 | 3300032133 | Ga0316583_10025716 | Ga0316583_100257164 | 104 |
| 90 | 3300035118 | Ga0373954_0158309 | Ga0373954_0158309_411_728 | 104 |
| 91 | 3300036401 | Ga0373937_1322130 | Ga0373937_1322130_45_362 | 104 |
| 92 | 3300039438 | Ga0436360_0686235 | Ga0436360_0686235_331_651 | 104 |
| 93 | 3300046473 | Ga0495582_0129170 | Ga0495582_0129170_368_685 | 104 |
| 94 | 3300046476 | Ga0495662_0101009 | Ga0495662_0101009_266_583 | 104 |
| 95 | 3300046683 | Ga0495658_0095303 | Ga0495658_0095303_1185_1502 | 104 |
| 96 | 3300047319 | Ga0495674_0657525 | Ga0495674_0657525_184_501 | 104 |
| 97 | 3300048907 | Ga0496104_0162506 | Ga0496104_0162506_509_826 | 104 |
| 98 | 3300048908 | Ga0496105_0497224 | Ga0496105_0497224_203_520 | 104 |
| 99 | 3300048917 | Ga0496114_1336806 | Ga0496114_1336806_11_328 | 104 |
| 100 | 3300048918 | Ga0496115_0310631 | Ga0496115_0310631_190_507 | 104 |
| 101 | 3300059513 | Ga0587094_108760 | Ga0587094_108760_29_346 | 104 |
| 102 | 3300005518 | Ga0070699_100892826 | Ga0070699_1008928262 | 105 |
| 103 | 3300005536 | Ga0070697_100007786 | Ga0070697_10000778611 | 105 |
| 104 | 3300005545 | Ga0070695_100110781 | Ga0070695_1001107814 | 105 |
| 105 | 3300006173 | Ga0070716_101013524 | Ga0070716_1010135242 | 105 |
| 106 | 3300006173 | Ga0070716_101594069 | Ga0070716_1015940692 | 105 |
| 107 | 3300009147 | Ga0114129_10195930 | Ga0114129_101959302 | 105 |
| 108 | 3300013307 | Ga0157372_10853250 | Ga0157372_108532502 | 105 |
| 109 | 3300025233 | Ga0209437_104260 | Ga0209437_1042605 | 105 |
| 110 | 3300025261 | Ga0209233_1002003 | Ga0209233_10020038 | 105 |
| 111 | 3300025939 | Ga0207665_10112861 | Ga0207665_101128612 | 105 |
| 112 | 3300035113 | Ga0373936_0620030 | Ga0373936_0620030_61_381 | 105 |
| 113 | 3300035692 | Ga0373935_0798760 | Ga0373935_0798760_353_673 | 105 |
| 114 | 3300036401 | Ga0373937_0390770 | Ga0373937_0390770_585_905 | 105 |
| 115 | 3300036457 | Ga0265778_000274 | Ga0265778_000274_1721_2125 | 105 |
| 116 | 3300044656 | Ga0466969_0060890 | Ga0466969_0060890_752_1072 | 105 |
| 117 | 3300045049 | Ga0466959_0611243 | Ga0466959_0611243_276_596 | 105 |
| 118 | 3300045836 | Ga0466958_0565165 | Ga0466958_0565165_362_691 | 105 |
| 119 | 3300048923 | Ga0496120_0172031 | Ga0496120_0172031_297_614 | 105 |
| 120 | 3300048924 | Ga0496121_0419073 | Ga0496121_0419073_346_663 | 105 |
| 121 | 3300048929 | Ga0496126_0000005 | Ga0496126_0000005_879822_880139 | 105 |
| 122 | 3300050507 | nmdc:mga05p37_167227_c1 | nmdc:mga05p37_167227_c1_1594_1926 | 105 |
| 123 | 3300053077 | Ga0495601_0547492 | Ga0495601_0547492_256_576 | 105 |
| 124 | iso_pu_bacteria | 2884215851 | 2884219638 | 105 |
| 125 | 3300003320 | rootH2_10096173 | rootH2_100961735 | 106 |
| 126 | 3300009177 | Ga0105248_10384554 | Ga0105248_103845544 | 106 |
| 127 | 3300009545 | Ga0105237_10391906 | Ga0105237_103919063 | 106 |
| 128 | 3300009553 | Ga0105249_10016019 | Ga0105249_1001601912 | 106 |
| 129 | 3300013296 | Ga0157374_10389102 | Ga0157374_103891022 | 106 |
| 130 | 3300014968 | Ga0157379_12446343 | Ga0157379_124463432 | 106 |
| 131 | 3300021361 | Ga0213872_10005926 | Ga0213872_1000592612 | 106 |
| 132 | 3300021441 | Ga0213871_10012856 | Ga0213871_100128563 | 106 |
| 133 | 3300025914 | Ga0207671_10409157 | Ga0207671_104091572 | 106 |
| 134 | 3300025941 | Ga0207711_10205564 | Ga0207711_102055641 | 106 |
| 135 | 3300025961 | Ga0207712_10006954 | Ga0207712_100069544 | 106 |
| 136 | 3300028800 | Ga0265338_10006099 | Ga0265338_1000609911 | 106 |
| 137 | 3300031344 | Ga0265316_10274545 | Ga0265316_102745451 | 106 |
| 138 | 3300031711 | Ga0265314_10009254 | Ga0265314_100092543 | 106 |
| 139 | 3300032133 | Ga0316583_10049402 | Ga0316583_100494023 | 106 |
| 140 | 3300032133 | Ga0316583_10070914 | Ga0316583_100709143 | 106 |
| 141 | 3300035170 | Ga0373943_0283139 | Ga0373943_0283139_584_907 | 106 |
| 142 | 3300039438 | Ga0436360_0020830 | Ga0436360_0020830_333_656 | 106 |
| 143 | 3300039447 | Ga0436361_0270740 | Ga0436361_0270740_4985_5308 | 106 |
| 144 | 3300039447 | Ga0436361_1077281 | Ga0436361_1077281_378_701 | 106 |
| 145 | 3300046471 | Ga0495650_0000010 | Ga0495650_0000010_639536_639856 | 106 |
| 146 | 3300046665 | Ga0495661_0389233 | Ga0495661_0389233_317_637 | 106 |
| 147 | 3300046684 | Ga0495669_0164802 | Ga0495669_0164802_671_994 | 106 |
| 148 | 3300047472 | Ga0495686_0045899 | Ga0495686_0045899_2253_2573 | 106 |
| 149 | 3300048927 | Ga0496124_0276545 | Ga0496124_0276545_37_360 | 106 |
| 150 | 3300053087 | Ga0500643_027281 | Ga0500643_027281_178_498 | 106 |
| 151 | 3300004800 | Ga0058861_11532275 | Ga0058861_115322752 | 107 |
| 152 | 3300005327 | Ga0070658_10009410 | Ga0070658_100094106 | 107 |
| 153 | 3300005329 | Ga0070683_100186088 | Ga0070683_1001860884 | 107 |
| 154 | 3300005339 | Ga0070660_100513948 | Ga0070660_1005139482 | 107 |
| 155 | 3300005344 | Ga0070661_101217640 | Ga0070661_1012176402 | 107 |
| 156 | 3300005366 | Ga0070659_100445162 | Ga0070659_1004451622 | 107 |
| 157 | 3300005434 | Ga0070709_10495921 | Ga0070709_104959212 | 107 |
| 158 | 3300005436 | Ga0070713_100256803 | Ga0070713_1002568033 | 107 |
| 159 | 3300005436 | Ga0070713_101554792 | Ga0070713_1015547921 | 107 |
| 160 | 3300005439 | Ga0070711_100306354 | Ga0070711_1003063543 | 107 |
| 161 | 3300005458 | Ga0070681_10012933 | Ga0070681_100129332 | 107 |
| 162 | 3300005530 | Ga0070679_100003562 | Ga0070679_1000035629 | 107 |
| 163 | 3300005535 | Ga0070684_100006987 | Ga0070684_1000069876 | 107 |
| 164 | 3300005535 | Ga0070684_100539430 | Ga0070684_1005394302 | 107 |
| 165 | 3300005539 | Ga0068853_100181095 | Ga0068853_1001810953 | 107 |
| 166 | 3300005548 | Ga0070665_100853776 | Ga0070665_1008537762 | 107 |
| 167 | 3300005563 | Ga0068855_100006253 | Ga0068855_1000062539 | 107 |
| 168 | 3300005563 | Ga0068855_100062458 | Ga0068855_1000624587 | 107 |
| 169 | 3300005577 | Ga0068857_100171226 | Ga0068857_1001712263 | 107 |
| 170 | 3300005614 | Ga0068856_100461662 | Ga0068856_1004616623 | 107 |
| 171 | 3300005616 | Ga0068852_100888369 | Ga0068852_1008883692 | 107 |
| 172 | 3300006358 | Ga0068871_101611487 | Ga0068871_1016114872 | 107 |
| 173 | 3300009093 | Ga0105240_10007537 | Ga0105240_1000753714 | 107 |
| 174 | 3300009174 | Ga0105241_10160507 | Ga0105241_101605074 | 107 |
| 175 | 3300009177 | Ga0105248_10000094 | Ga0105248_1000009477 | 107 |
| 176 | 3300009545 | Ga0105237_11273966 | Ga0105237_112739661 | 107 |
| 177 | 3300009551 | Ga0105238_10006787 | Ga0105238_1000678712 | 107 |
| 178 | 3300010375 | Ga0105239_10890865 | Ga0105239_108908653 | 107 |
| 179 | 3300010375 | Ga0105239_11900450 | Ga0105239_119004502 | 107 |
| 180 | 3300013100 | Ga0157373_10196828 | Ga0157373_101968283 | 107 |
| 181 | 3300013102 | Ga0157371_10128407 | Ga0157371_101284074 | 107 |
| 182 | 3300013104 | Ga0157370_10008035 | Ga0157370_1000803513 | 107 |
| 183 | 3300013104 | Ga0157370_10678274 | Ga0157370_106782741 | 107 |
| 184 | 3300013105 | Ga0157369_10026529 | Ga0157369_100265299 | 107 |
| 185 | 3300013105 | Ga0157369_10033381 | Ga0157369_100333817 | 107 |
| 186 | 3300013105 | Ga0157369_10942606 | Ga0157369_109426063 | 107 |
| 187 | 3300013105 | Ga0157369_11702911 | Ga0157369_117029112 | 107 |
| 188 | 3300013296 | Ga0157374_10070986 | Ga0157374_100709861 | 107 |
| 189 | 3300013307 | Ga0157372_10003289 | Ga0157372_1000328917 | 107 |
| 190 | 3300014497 | Ga0182008_10258356 | Ga0182008_102583562 | 107 |
| 191 | 3300014968 | Ga0157379_10637831 | Ga0157379_106378313 | 107 |
| 192 | 3300014969 | Ga0157376_10277569 | Ga0157376_102775693 | 107 |
| 193 | 3300014969 | Ga0157376_10910835 | Ga0157376_109108351 | 107 |
| 194 | 3300020069 | Ga0197907_11454979 | Ga0197907_114549791 | 107 |
| 195 | 3300020077 | Ga0206351_11002133 | Ga0206351_110021332 | 107 |
| 196 | 3300020082 | Ga0206353_10452776 | Ga0206353_104527762 | 107 |
| 197 | 3300021361 | Ga0213872_10012057 | Ga0213872_100120576 | 107 |
| 198 | 3300021361 | Ga0213872_10015241 | Ga0213872_100152413 | 107 |
| 199 | 3300021361 | Ga0213872_10016045 | Ga0213872_100160454 | 107 |
| 200 | 3300021361 | Ga0213872_10242057 | Ga0213872_102420572 | 107 |
| 201 | 3300021441 | Ga0213871_10002437 | Ga0213871_100024373 | 107 |
| 202 | 3300021441 | Ga0213871_10214070 | Ga0213871_102140702 | 107 |
| 203 | 3300022467 | Ga0224712_10465873 | Ga0224712_104658732 | 107 |
| 204 | 3300025904 | Ga0207647_10274467 | Ga0207647_102744672 | 107 |
| 205 | 3300025906 | Ga0207699_10423402 | Ga0207699_104234022 | 107 |
| 206 | 3300025909 | Ga0207705_10042888 | Ga0207705_100428882 | 107 |
| 207 | 3300025912 | Ga0207707_10007751 | Ga0207707_100077512 | 107 |
| 208 | 3300025913 | Ga0207695_10014395 | Ga0207695_100143958 | 107 |
| 209 | 3300025916 | Ga0207663_10138731 | Ga0207663_101387313 | 107 |
| 210 | 3300025917 | Ga0207660_10033618 | Ga0207660_100336183 | 107 |
| 211 | 3300025919 | Ga0207657_10003185 | Ga0207657_100031857 | 107 |
| 212 | 3300025920 | Ga0207649_10367667 | Ga0207649_103676672 | 107 |
| 213 | 3300025921 | Ga0207652_10021006 | Ga0207652_100210069 | 107 |
| 214 | 3300025924 | Ga0207694_10139542 | Ga0207694_101395424 | 107 |
| 215 | 3300025928 | Ga0207700_10303151 | Ga0207700_103031513 | 107 |
| 216 | 3300025929 | Ga0207664_10468553 | Ga0207664_104685532 | 107 |
| 217 | 3300025939 | Ga0207665_10462352 | Ga0207665_104623523 | 107 |
| 218 | 3300025941 | Ga0207711_10000086 | Ga0207711_1000008612 | 107 |
| 219 | 3300025944 | Ga0207661_10013707 | Ga0207661_100137074 | 107 |
| 220 | 3300025944 | Ga0207661_10046339 | Ga0207661_100463394 | 107 |
| 221 | 3300025949 | Ga0207667_10004621 | Ga0207667_1000462114 | 107 |
| 222 | 3300025949 | Ga0207667_10015592 | Ga0207667_100155926 | 107 |
| 223 | 3300026041 | Ga0207639_10149778 | Ga0207639_101497783 | 107 |
| 224 | 3300026078 | Ga0207702_10511364 | Ga0207702_105113642 | 107 |
| 225 | 3300026089 | Ga0207648_10413253 | Ga0207648_104132531 | 107 |
| 226 | 3300026116 | Ga0207674_10052208 | Ga0207674_100522086 | 107 |
| 227 | 3300026142 | Ga0207698_10361539 | Ga0207698_103615393 | 107 |
| 228 | 3300028558 | Ga0265326_10114635 | Ga0265326_101146352 | 107 |
| 229 | 3300028577 | Ga0265318_10024920 | Ga0265318_100249203 | 107 |
| 230 | 3300028666 | Ga0265336_10002166 | Ga0265336_100021666 | 107 |
| 231 | 3300028800 | Ga0265338_10004125 | Ga0265338_1000412512 | 107 |
| 232 | 3300028800 | Ga0265338_10352108 | Ga0265338_103521083 | 107 |
| 233 | 3300030877 | Ga0265777_123604 | Ga0265777_1236041 | 107 |
| 234 | 3300031235 | Ga0265330_10001295 | Ga0265330_1000129521 | 107 |
| 235 | 3300031238 | Ga0265332_10007740 | Ga0265332_100077403 | 107 |
| 236 | 3300031239 | Ga0265328_10006319 | Ga0265328_100063194 | 107 |
| 237 | 3300031240 | Ga0265320_10033478 | Ga0265320_100334781 | 107 |
| 238 | 3300031241 | Ga0265325_10000701 | Ga0265325_1000070123 | 107 |
| 239 | 3300031241 | Ga0265325_10113416 | Ga0265325_101134163 | 107 |
| 240 | 3300031242 | Ga0265329_10012888 | Ga0265329_100128885 | 107 |
| 241 | 3300031242 | Ga0265329_10092814 | Ga0265329_100928142 | 107 |
| 242 | 3300031247 | Ga0265340_10001071 | Ga0265340_1000107113 | 107 |
| 243 | 3300031249 | Ga0265339_10000921 | Ga0265339_1000092112 | 107 |
| 244 | 3300031249 | Ga0265339_10008463 | Ga0265339_1000846311 | 107 |
| 245 | 3300031250 | Ga0265331_10011314 | Ga0265331_100113144 | 107 |
| 246 | 3300031344 | Ga0265316_10006934 | Ga0265316_1000693410 | 107 |
| 247 | 3300031344 | Ga0265316_10073825 | Ga0265316_100738252 | 107 |
| 248 | 3300031595 | Ga0265313_10001811 | Ga0265313_1000181121 | 107 |
| 249 | 3300031711 | Ga0265314_10001691 | Ga0265314_1000169123 | 107 |
| 250 | 3300031711 | Ga0265314_10003098 | Ga0265314_1000309812 | 107 |
| 251 | 3300031712 | Ga0265342_10003578 | Ga0265342_1000357810 | 107 |
| 252 | 3300031712 | Ga0265342_10008915 | Ga0265342_100089158 | 107 |
| 253 | 3300035172 | Ga0373955_0044969 | Ga0373955_0044969_649_975 | 107 |
| 254 | 3300035724 | Ga0373933_0143009 | Ga0373933_0143009_783_1109 | 107 |
| 255 | 3300036401 | Ga0373937_0193913 | Ga0373937_0193913_679_1005 | 107 |
| 256 | 3300036401 | Ga0373937_1268394 | Ga0373937_1268394_28_354 | 107 |
| 257 | 3300037418 | Ga0395900_0975676 | Ga0395900_0975676_281_607 | 107 |
| 258 | 3300038443 | Ga0395901_0258507 | Ga0395901_0258507_1102_1428 | 107 |
| 259 | 3300039438 | Ga0436360_0228968 | Ga0436360_0228968_5251_5577 | 107 |
| 260 | 3300039438 | Ga0436360_0276944 | Ga0436360_0276944_377_703 | 107 |
| 261 | 3300039438 | Ga0436360_0385320 | Ga0436360_0385320_765_1097 | 107 |
| 262 | 3300039447 | Ga0436361_0372633 | Ga0436361_0372633_576_902 | 107 |
| 263 | 3300039447 | Ga0436361_0486474 | Ga0436361_0486474_6721_7047 | 107 |
| 264 | 3300039447 | Ga0436361_0674593 | Ga0436361_0674593_1720_2046 | 107 |
| 265 | 3300039447 | Ga0436361_0750744 | Ga0436361_0750744_669_995 | 107 |
| 266 | 3300039447 | Ga0436361_0824839 | Ga0436361_0824839_3649_3975 | 107 |
| 267 | 3300039447 | Ga0436361_0950252 | Ga0436361_0950252_177_503 | 107 |
| 268 | 3300039453 | Ga0436362_0140245 | Ga0436362_0140245_361_693 | 107 |
| 269 | 3300044765 | Ga0466970_0713229 | Ga0466970_0713229_151_477 | 107 |
| 270 | 3300045836 | Ga0466958_0391635 | Ga0466958_0391635_13_339 | 107 |
| 271 | 3300046471 | Ga0495650_0197969 | Ga0495650_0197969_335_658 | 107 |
| 272 | 3300047471 | Ga0495684_0420787 | Ga0495684_0420787_406_732 | 107 |
| 273 | 3300047472 | Ga0495686_0000545 | Ga0495686_0000545_7189_7512 | 107 |
| 274 | 3300047472 | Ga0495686_0066670 | Ga0495686_0066670_1653_1976 | 107 |
| 275 | 3300048903 | Ga0496100_0931670 | Ga0496100_0931670_151_477 | 107 |
| 276 | 3300048904 | Ga0496101_0252000 | Ga0496101_0252000_624_950 | 107 |
| 277 | 3300048909 | Ga0496106_0458764 | Ga0496106_0458764_268_594 | 107 |
| 278 | 3300048911 | Ga0496108_0454517 | Ga0496108_0454517_634_960 | 107 |
| 279 | 3300048917 | Ga0496114_1540190 | Ga0496114_1540190_35_361 | 107 |
| 280 | 3300048918 | Ga0496115_0450425 | Ga0496115_0450425_508_834 | 107 |
| 281 | 3300053119 | Ga0500595_071903 | Ga0500595_071903_572_898 | 107 |
| 282 | 3300053136 | Ga0500559_0098074 | Ga0500559_0098074_220_543 | 107 |
| 283 | 3300005327 | Ga0070658_10260242 | Ga0070658_102602421 | 108 |
| 284 | 3300005329 | Ga0070683_100489624 | Ga0070683_1004896243 | 108 |
| 285 | 3300005337 | Ga0070682_100524907 | Ga0070682_1005249072 | 108 |
| 286 | 3300005344 | Ga0070661_100025903 | Ga0070661_1000259037 | 108 |
| 287 | 3300005455 | Ga0070663_100434226 | Ga0070663_1004342261 | 108 |
| 288 | 3300005530 | Ga0070679_102066377 | Ga0070679_1020663771 | 108 |
| 289 | 3300005563 | Ga0068855_100000642 | Ga0068855_1000006427 | 108 |
| 290 | 3300005563 | Ga0068855_100510374 | Ga0068855_1005103742 | 108 |
| 291 | 3300005563 | Ga0068855_100611063 | Ga0068855_1006110631 | 108 |
| 292 | 3300005577 | Ga0068857_100619698 | Ga0068857_1006196983 | 108 |
| 293 | 3300005578 | Ga0068854_100357835 | Ga0068854_1003578353 | 108 |
| 294 | 3300005614 | Ga0068856_100026907 | Ga0068856_10002690711 | 108 |
| 295 | 3300005614 | Ga0068856_100173144 | Ga0068856_1001731444 | 108 |
| 296 | 3300005614 | Ga0068856_101846696 | Ga0068856_1018466961 | 108 |
| 297 | 3300005616 | Ga0068852_102632283 | Ga0068852_1026322832 | 108 |
| 298 | 3300005834 | Ga0068851_10004509 | Ga0068851_100045094 | 108 |
| 299 | 3300006237 | Ga0097621_102135197 | Ga0097621_1021351972 | 108 |
| 300 | 3300009093 | Ga0105240_10027101 | Ga0105240_100271015 | 108 |
| 301 | 3300009174 | Ga0105241_10232585 | Ga0105241_102325853 | 108 |
| 302 | 3300009174 | Ga0105241_10912483 | Ga0105241_109124832 | 108 |
| 303 | 3300009545 | Ga0105237_10753391 | Ga0105237_107533911 | 108 |
| 304 | 3300009545 | Ga0105237_11646534 | Ga0105237_116465341 | 108 |
| 305 | 3300009551 | Ga0105238_10150267 | Ga0105238_101502672 | 108 |
| 306 | 3300009551 | Ga0105238_10616892 | Ga0105238_106168923 | 108 |
| 307 | 3300010375 | Ga0105239_12046595 | Ga0105239_120465952 | 108 |
| 308 | 3300013100 | Ga0157373_10327152 | Ga0157373_103271523 | 108 |
| 309 | 3300013102 | Ga0157371_11031153 | Ga0157371_110311531 | 108 |
| 310 | 3300013104 | Ga0157370_10432819 | Ga0157370_104328192 | 108 |
| 311 | 3300013105 | Ga0157369_10013194 | Ga0157369_1001319411 | 108 |
| 312 | 3300013105 | Ga0157369_10192055 | Ga0157369_101920553 | 108 |
| 313 | 3300013105 | Ga0157369_10299684 | Ga0157369_102996841 | 108 |
| 314 | 3300013296 | Ga0157374_10010090 | Ga0157374_1001009012 | 108 |
| 315 | 3300013296 | Ga0157374_10330132 | Ga0157374_103301321 | 108 |
| 316 | 3300013296 | Ga0157374_11071342 | Ga0157374_110713422 | 108 |
| 317 | 3300013297 | Ga0157378_10020240 | Ga0157378_1002024010 | 108 |
| 318 | 3300013307 | Ga0157372_10012293 | Ga0157372_100122935 | 108 |
| 319 | 3300013307 | Ga0157372_10375914 | Ga0157372_103759142 | 108 |
| 320 | 3300013308 | Ga0157375_13220794 | Ga0157375_132207941 | 108 |
| 321 | 3300014325 | Ga0163163_10335438 | Ga0163163_103354383 | 108 |
| 322 | 3300014968 | Ga0157379_10169847 | Ga0157379_101698473 | 108 |
| 323 | 3300014969 | Ga0157376_10214467 | Ga0157376_102144672 | 108 |
| 324 | 3300025321 | Ga0207656_10007345 | Ga0207656_100073456 | 108 |
| 325 | 3300025909 | Ga0207705_10692718 | Ga0207705_106927182 | 108 |
| 326 | 3300025911 | Ga0207654_10632971 | Ga0207654_106329712 | 108 |
| 327 | 3300025911 | Ga0207654_10782746 | Ga0207654_107827462 | 108 |
| 328 | 3300025912 | Ga0207707_11492828 | Ga0207707_114928282 | 108 |
| 329 | 3300025913 | Ga0207695_10003215 | Ga0207695_1000321512 | 108 |
| 330 | 3300025913 | Ga0207695_10021213 | Ga0207695_1002121311 | 108 |
| 331 | 3300025913 | Ga0207695_11398501 | Ga0207695_113985012 | 108 |
| 332 | 3300025914 | Ga0207671_10855990 | Ga0207671_108559901 | 108 |
| 333 | 3300025920 | Ga0207649_10283538 | Ga0207649_102835382 | 108 |
| 334 | 3300025924 | Ga0207694_10131015 | Ga0207694_101310152 | 108 |
| 335 | 3300025924 | Ga0207694_10452964 | Ga0207694_104529642 | 108 |
| 336 | 3300025928 | Ga0207700_10181268 | Ga0207700_101812683 | 108 |
| 337 | 3300025928 | Ga0207700_11114510 | Ga0207700_111145102 | 108 |
| 338 | 3300025929 | Ga0207664_10018040 | Ga0207664_100180408 | 108 |
| 339 | 3300025944 | Ga0207661_10274727 | Ga0207661_102747273 | 108 |
| 340 | 3300025949 | Ga0207667_10014641 | Ga0207667_100146417 | 108 |
| 341 | 3300025949 | Ga0207667_10530167 | Ga0207667_105301673 | 108 |
| 342 | 3300026078 | Ga0207702_10119468 | Ga0207702_101194685 | 108 |
| 343 | 3300026116 | Ga0207674_10226479 | Ga0207674_102264792 | 108 |
| 344 | 3300026142 | Ga0207698_10008589 | Ga0207698_100085893 | 108 |
| 345 | 3300028379 | Ga0268266_10907490 | Ga0268266_109074903 | 108 |
| 346 | 3300031239 | Ga0265328_10075251 | Ga0265328_100752512 | 108 |
| 347 | 3300036401 | Ga0373937_0662167 | Ga0373937_0662167_13_345 | 108 |
| 348 | 3300036401 | Ga0373937_0893831 | Ga0373937_0893831_440_772 | 108 |
| 349 | 3300044693 | Ga0466961_0302188 | Ga0466961_0302188_549_884 | 108 |
| 350 | 3300045836 | Ga0466958_0568065 | Ga0466958_0568065_58_393 | 108 |
| 351 | 3300045976 | Ga0466967_0073852 | Ga0466967_0073852_333_665 | 108 |
| 352 | 3300046459 | Ga0495629_1129920 | Ga0495629_1129920_100_432 | 108 |
| 353 | 3300046472 | Ga0495580_0067138 | Ga0495580_0067138_902_1234 | 108 |
| 354 | 3300046473 | Ga0495582_0520871 | Ga0495582_0520871_283_615 | 108 |
| 355 | 3300046475 | Ga0495639_0076479 | Ga0495639_0076479_821_1153 | 108 |
| 356 | 3300046477 | Ga0495664_0107665 | Ga0495664_0107665_356_688 | 108 |
| 357 | 3300046517 | Ga0495630_0409047 | Ga0495630_0409047_337_669 | 108 |
| 358 | 3300046531 | Ga0495665_0033282 | Ga0495665_0033282_215_547 | 108 |
| 359 | 3300046543 | Ga0495645_0246041 | Ga0495645_0246041_212_544 | 108 |
| 360 | 3300046660 | Ga0495625_0013458 | Ga0495625_0013458_4548_4874 | 108 |
| 361 | 3300046675 | Ga0495657_0497560 | Ga0495657_0497560_181_513 | 108 |
| 362 | 3300046679 | Ga0495623_0356629 | Ga0495623_0356629_433_765 | 108 |
| 363 | 3300046680 | Ga0495646_0261301 | Ga0495646_0261301_412_744 | 108 |
| 364 | 3300046689 | Ga0495613_0206159 | Ga0495613_0206159_64_396 | 108 |
| 365 | 3300047317 | Ga0495604_0688989 | Ga0495604_0688989_67_399 | 108 |
| 366 | 3300047444 | Ga0495675_0608441 | Ga0495675_0608441_163_495 | 108 |
| 367 | 3300047471 | Ga0495684_0430257 | Ga0495684_0430257_362_694 | 108 |
| 368 | 3300047472 | Ga0495686_0420547 | Ga0495686_0420547_197_526 | 108 |
| 369 | 3300048088 | Ga0495602_0196969 | Ga0495602_0196969_512_844 | 108 |
| 370 | 3300048904 | Ga0496101_0981084 | Ga0496101_0981084_160_486 | 108 |
| 371 | 3300048904 | Ga0496101_0984514 | Ga0496101_0984514_245_577 | 108 |
| 372 | 3300048907 | Ga0496104_0097200 | Ga0496104_0097200_184_516 | 108 |
| 373 | 3300048908 | Ga0496105_0133722 | Ga0496105_0133722_1610_1942 | 108 |
| 374 | 3300048908 | Ga0496105_0339545 | Ga0496105_0339545_309_641 | 108 |
| 375 | 3300048909 | Ga0496106_1095593 | Ga0496106_1095593_157_489 | 108 |
| 376 | 3300048910 | Ga0496107_0162603 | Ga0496107_0162603_1210_1542 | 108 |
| 377 | 3300048910 | Ga0496107_0828685 | Ga0496107_0828685_265_597 | 108 |
| 378 | 3300048913 | Ga0496110_1244749 | Ga0496110_1244749_174_506 | 108 |
| 379 | 3300048914 | Ga0496111_0156901 | Ga0496111_0156901_538_870 | 108 |
| 380 | 3300048917 | Ga0496114_0098797 | Ga0496114_0098797_154_486 | 108 |
| 381 | 3300048918 | Ga0496115_0335496 | Ga0496115_0335496_865_1197 | 108 |
| 382 | 3300049460 | Ga0495682_0026975 | Ga0495682_0026975_1233_1559 | 108 |
| 383 | 3300053077 | Ga0495601_0238620 | Ga0495601_0238620_712_1044 | 108 |
| 384 | 3300053085 | Ga0495619_0572229 | Ga0495619_0572229_239_571 | 108 |
| 385 | 3300053085 | Ga0495619_0906341 | Ga0495619_0906341_168_500 | 108 |
| 386 | 3300000546 | LJNas_1000189 | LJNas_100018910 | 109 |
| 387 | 3300003320 | rootH2_10177754 | rootH2_101777543 | 109 |
| 388 | 3300004799 | Ga0058863_10003457 | Ga0058863_100034573 | 109 |
| 389 | 3300004800 | Ga0058861_11542957 | Ga0058861_115429572 | 109 |
| 390 | 3300005327 | Ga0070658_10376412 | Ga0070658_103764122 | 109 |
| 391 | 3300005336 | Ga0070680_100231848 | Ga0070680_1002318483 | 109 |
| 392 | 3300005336 | Ga0070680_100442051 | Ga0070680_1004420513 | 109 |
| 393 | 3300005338 | Ga0068868_100038932 | Ga0068868_1000389322 | 109 |
| 394 | 3300005435 | Ga0070714_101762733 | Ga0070714_1017627331 | 109 |
| 395 | 3300005437 | Ga0070710_10327304 | Ga0070710_103273042 | 109 |
| 396 | 3300005455 | Ga0070663_101194012 | Ga0070663_1011940122 | 109 |
| 397 | 3300005530 | Ga0070679_100030999 | Ga0070679_1000309997 | 109 |
| 398 | 3300005530 | Ga0070679_100067206 | Ga0070679_1000672066 | 109 |
| 399 | 3300005539 | Ga0068853_100248542 | Ga0068853_1002485423 | 109 |
| 400 | 3300005548 | Ga0070665_100046016 | Ga0070665_1000460166 | 109 |
| 401 | 3300005548 | Ga0070665_100984802 | Ga0070665_1009848021 | 109 |
| 402 | 3300005614 | Ga0068856_100569368 | Ga0068856_1005693681 | 109 |
| 403 | 3300005842 | Ga0068858_100188042 | Ga0068858_1001880424 | 109 |
| 404 | 3300006175 | Ga0070712_101349258 | Ga0070712_1013492581 | 109 |
| 405 | 3300009093 | Ga0105240_10132535 | Ga0105240_101325352 | 109 |
| 406 | 3300009093 | Ga0105240_10280570 | Ga0105240_102805702 | 109 |
| 407 | 3300009098 | Ga0105245_10115478 | Ga0105245_101154784 | 109 |
| 408 | 3300009101 | Ga0105247_10101615 | Ga0105247_101016154 | 109 |
| 409 | 3300009177 | Ga0105248_10003761 | Ga0105248_1000376121 | 109 |
| 410 | 3300009545 | Ga0105237_10161658 | Ga0105237_101616582 | 109 |
| 411 | 3300009551 | Ga0105238_12358853 | Ga0105238_123588532 | 109 |
| 412 | 3300010375 | Ga0105239_13623665 | Ga0105239_136236651 | 109 |
| 413 | 3300013104 | Ga0157370_10049002 | Ga0157370_100490027 | 109 |
| 414 | 3300013104 | Ga0157370_10619041 | Ga0157370_106190413 | 109 |
| 415 | 3300013105 | Ga0157369_10059538 | Ga0157369_100595387 | 109 |
| 416 | 3300013105 | Ga0157369_12296453 | Ga0157369_122964531 | 109 |
| 417 | 3300013296 | Ga0157374_10191481 | Ga0157374_101914814 | 109 |
| 418 | 3300013296 | Ga0157374_10367640 | Ga0157374_103676401 | 109 |
| 419 | 3300013296 | Ga0157374_11161494 | Ga0157374_111614942 | 109 |
| 420 | 3300013297 | Ga0157378_10659345 | Ga0157378_106593453 | 109 |
| 421 | 3300013307 | Ga0157372_10583983 | Ga0157372_105839833 | 109 |
| 422 | 3300013307 | Ga0157372_11125503 | Ga0157372_111255032 | 109 |
| 423 | 3300014325 | Ga0163163_10111041 | Ga0163163_101110412 | 109 |
| 424 | 3300014968 | Ga0157379_11383331 | Ga0157379_113833312 | 109 |
| 425 | 3300014969 | Ga0157376_10173307 | Ga0157376_101733073 | 109 |
| 426 | 3300020075 | Ga0206349_1064812 | Ga0206349_10648122 | 109 |
| 427 | 3300025321 | Ga0207656_10259307 | Ga0207656_102593072 | 109 |
| 428 | 3300025904 | Ga0207647_10022019 | Ga0207647_100220198 | 109 |
| 429 | 3300025913 | Ga0207695_10332441 | Ga0207695_103324411 | 109 |
| 430 | 3300025913 | Ga0207695_11530822 | Ga0207695_115308222 | 109 |
| 431 | 3300025914 | Ga0207671_10047104 | Ga0207671_100471042 | 109 |
| 432 | 3300025915 | Ga0207693_10993744 | Ga0207693_109937442 | 109 |
| 433 | 3300025917 | Ga0207660_10099104 | Ga0207660_100991041 | 109 |
| 434 | 3300025917 | Ga0207660_10201117 | Ga0207660_102011172 | 109 |
| 435 | 3300025921 | Ga0207652_10049501 | Ga0207652_100495016 | 109 |
| 436 | 3300025921 | Ga0207652_10472137 | Ga0207652_104721372 | 109 |
| 437 | 3300025924 | Ga0207694_10011619 | Ga0207694_100116194 | 109 |
| 438 | 3300025927 | Ga0207687_10320435 | Ga0207687_103204352 | 109 |
| 439 | 3300025941 | Ga0207711_10015612 | Ga0207711_100156124 | 109 |
| 440 | 3300026023 | Ga0207677_10095968 | Ga0207677_100959683 | 109 |
| 441 | 3300026035 | Ga0207703_10248950 | Ga0207703_102489502 | 109 |
| 442 | 3300026041 | Ga0207639_10035600 | Ga0207639_100356004 | 109 |
| 443 | 3300026067 | Ga0207678_11019590 | Ga0207678_110195902 | 109 |
| 444 | 3300026078 | Ga0207702_10455360 | Ga0207702_104553601 | 109 |
| 445 | 3300028379 | Ga0268266_10043642 | Ga0268266_100436426 | 109 |
| 446 | 3300028379 | Ga0268266_11631192 | Ga0268266_116311922 | 109 |
| 447 | 3300028563 | Ga0265319_1274486 | Ga0265319_12744862 | 109 |
| 448 | 3300028666 | Ga0265336_10157622 | Ga0265336_101576221 | 109 |
| 449 | 3300028800 | Ga0265338_10146685 | Ga0265338_101466852 | 109 |
| 450 | 3300029957 | Ga0265324_10177768 | Ga0265324_101777682 | 109 |
| 451 | 3300031235 | Ga0265330_10319696 | Ga0265330_103196962 | 109 |
| 452 | 3300031239 | Ga0265328_10055285 | Ga0265328_100552852 | 109 |
| 453 | 3300031239 | Ga0265328_10117315 | Ga0265328_101173153 | 109 |
| 454 | 3300031241 | Ga0265325_10086886 | Ga0265325_100868862 | 109 |
| 455 | 3300031249 | Ga0265339_10000029 | Ga0265339_1000002912 | 109 |
| 456 | 3300031249 | Ga0265339_10214568 | Ga0265339_102145682 | 109 |
| 457 | 3300031250 | Ga0265331_10137796 | Ga0265331_101377963 | 109 |
| 458 | 3300031344 | Ga0265316_10187641 | Ga0265316_101876411 | 109 |
| 459 | 3300031712 | Ga0265342_10000307 | Ga0265342_1000030747 | 109 |
| 460 | 3300031712 | Ga0265342_10005760 | Ga0265342_1000576015 | 109 |
| 461 | 3300044684 | Ga0466966_0153642 | Ga0466966_0153642_647_985 | 109 |
| 462 | 3300046471 | Ga0495650_0001875 | Ga0495650_0001875_12564_12896 | 109 |
| 463 | 3300046477 | Ga0495664_0408212 | Ga0495664_0408212_458_796 | 109 |
| 464 | 3300046543 | Ga0495645_0014411 | Ga0495645_0014411_2507_2845 | 109 |
| 465 | 3300046660 | Ga0495625_0003213 | Ga0495625_0003213_14819_15151 | 109 |
| 466 | 3300046684 | Ga0495669_0048229 | Ga0495669_0048229_184_522 | 109 |
| 467 | 3300046694 | Ga0495649_0116151 | Ga0495649_0116151_176_508 | 109 |
| 468 | 3300047472 | Ga0495686_0002881 | Ga0495686_0002881_8133_8465 | 109 |
| 469 | 3300048088 | Ga0495602_0727973 | Ga0495602_0727973_138_476 | 109 |
| 470 | 3300048907 | Ga0496104_0262614 | Ga0496104_0262614_988_1326 | 109 |
| 471 | 3300048908 | Ga0496105_1235552 | Ga0496105_1235552_46_384 | 109 |
| 472 | 3300048912 | Ga0496109_0425937 | Ga0496109_0425937_218_556 | 109 |
| 473 | 3300048913 | Ga0496110_1178700 | Ga0496110_1178700_135_473 | 109 |
| 474 | 3300048914 | Ga0496111_0582383 | Ga0496111_0582383_464_802 | 109 |
| 475 | 3300048915 | Ga0496112_0630485 | Ga0496112_0630485_243_581 | 109 |
| 476 | 3300048915 | Ga0496112_0636936 | Ga0496112_0636936_243_581 | 109 |
| 477 | 3300048916 | Ga0496113_0047824 | Ga0496113_0047824_2151_2489 | 109 |
| 478 | 3300048918 | Ga0496115_0027967 | Ga0496115_0027967_2116_2454 | 109 |
| 479 | 3300048929 | Ga0496126_0009044 | Ga0496126_0009044_4721_5059 | 109 |
| 480 | 3300048929 | Ga0496126_0992538 | Ga0496126_0992538_253_585 | 109 |
| 481 | 3300049568 | Ga0501031_0097064 | Ga0501031_0097064_1514_1846 | 109 |
| 482 | 3300049568 | Ga0501031_0293977 | Ga0501031_0293977_13_345 | 109 |
| 483 | 3300049569 | Ga0501032_0005510 | Ga0501032_0005510_8392_8724 | 109 |
| 484 | 3300049570 | Ga0501033_0008766 | Ga0501033_0008766_1635_1967 | 109 |
| 485 | 3300049571 | Ga0501034_0014438 | Ga0501034_0014438_2382_2714 | 109 |
| 486 | 3300049572 | Ga0501036_0001574 | Ga0501036_0001574_4547_4879 | 109 |
| 487 | 3300049572 | Ga0501036_1256767 | Ga0501036_1256767_126_458 | 109 |
| 488 | 3300049573 | Ga0501037_0007110 | Ga0501037_0007110_5178_5510 | 109 |
| 489 | 3300049574 | Ga0501038_0039432 | Ga0501038_0039432_659_991 | 109 |
| 490 | 3300049575 | Ga0501039_0033853 | Ga0501039_0033853_2971_3303 | 109 |
| 491 | 3300049579 | Ga0501043_0002607 | Ga0501043_0002607_9105_9437 | 109 |
| 492 | 3300049579 | Ga0501043_0776962 | Ga0501043_0776962_145_477 | 109 |
| 493 | 3300049580 | Ga0501046_0000150 | Ga0501046_0000150_5826_6158 | 109 |
| 494 | 3300049581 | Ga0501047_0003876 | Ga0501047_0003876_5738_6070 | 109 |
| 495 | 3300049582 | Ga0501048_0221075 | Ga0501048_0221075_42_374 | 109 |
| 496 | 3300049589 | Ga0501073_0011548 | Ga0501073_0011548_336_668 | 109 |
| 497 | 3300049741 | Ga0501079_0636503 | Ga0501079_0636503_57_389 | 109 |
| 498 | 3300049742 | Ga0501080_0022666 | Ga0501080_0022666_2127_2459 | 109 |
| 499 | 3300049822 | Ga0501035_0030018 | Ga0501035_0030018_4152_4484 | 109 |
| 500 | 3300049822 | Ga0501035_0211173 | Ga0501035_0211173_1285_1617 | 109 |
| 501 | 3300049823 | Ga0501044_0005372 | Ga0501044_0005372_7984_8316 | 109 |
| 502 | 3300049823 | Ga0501044_0034545 | Ga0501044_0034545_145_477 | 109 |
| 503 | 3300049824 | Ga0501045_0741216 | Ga0501045_0741216_38_370 | 109 |
| 504 | 3300053077 | Ga0495601_0234521 | Ga0495601_0234521_187_525 | 109 |
| 505 | 3300053077 | Ga0495601_0238064 | Ga0495601_0238064_735_1073 | 109 |
| 506 | 3300053133 | Ga0500655_026758 | Ga0500655_026758_133_468 | 109 |
| 507 | 3300053733 | Ga0500552_098504 | Ga0500552_098504_126_461 | 109 |
| 508 | 3300054114 | Ga0501084_0836701 | Ga0501084_0836701_68_400 | 109 |
| 509 | 3300005331 | Ga0070670_100968493 | Ga0070670_1009684931 | 110 |
| 510 | 3300005335 | Ga0070666_10235118 | Ga0070666_102351182 | 110 |
| 511 | 3300005338 | Ga0068868_100173056 | Ga0068868_1001730561 | 110 |
| 512 | 3300005339 | Ga0070660_100011289 | Ga0070660_1000112899 | 110 |
| 513 | 3300005344 | Ga0070661_100226031 | Ga0070661_1002260314 | 110 |
| 514 | 3300005344 | Ga0070661_101218100 | Ga0070661_1012181002 | 110 |
| 515 | 3300005355 | Ga0070671_100001676 | Ga0070671_10000167626 | 110 |
| 516 | 3300005356 | Ga0070674_100496041 | Ga0070674_1004960411 | 110 |
| 517 | 3300005366 | Ga0070659_100001021 | Ga0070659_10000102123 | 110 |
| 518 | 3300005367 | Ga0070667_100292165 | Ga0070667_1002921652 | 110 |
| 519 | 3300005456 | Ga0070678_100686922 | Ga0070678_1006869223 | 110 |
| 520 | 3300005457 | Ga0070662_101010675 | Ga0070662_1010106752 | 110 |
| 521 | 3300005459 | Ga0068867_100270131 | Ga0068867_1002701312 | 110 |
| 522 | 3300005539 | Ga0068853_100000054 | Ga0068853_10000005412 | 110 |
| 523 | 3300005548 | Ga0070665_100008632 | Ga0070665_10000863218 | 110 |
| 524 | 3300005548 | Ga0070665_100881891 | Ga0070665_1008818912 | 110 |
| 525 | 3300005578 | Ga0068854_100000137 | Ga0068854_10000013748 | 110 |
| 526 | 3300005618 | Ga0068864_100008789 | Ga0068864_10000878913 | 110 |
| 527 | 3300005834 | Ga0068851_11005292 | Ga0068851_110052921 | 110 |
| 528 | 3300005841 | Ga0068863_100042299 | Ga0068863_1000422993 | 110 |
| 529 | 3300009093 | Ga0105240_10263275 | Ga0105240_102632753 | 110 |
| 530 | 3300009093 | Ga0105240_10313386 | Ga0105240_103133862 | 110 |
| 531 | 3300009174 | Ga0105241_10363434 | Ga0105241_103634341 | 110 |
| 532 | 3300009176 | Ga0105242_10477631 | Ga0105242_104776312 | 110 |
| 533 | 3300009177 | Ga0105248_10188672 | Ga0105248_101886724 | 110 |
| 534 | 3300009177 | Ga0105248_10547026 | Ga0105248_105470263 | 110 |
| 535 | 3300009177 | Ga0105248_11518860 | Ga0105248_115188603 | 110 |
| 536 | 3300009545 | Ga0105237_10609906 | Ga0105237_106099062 | 110 |
| 537 | 3300009551 | Ga0105238_11172622 | Ga0105238_111726222 | 110 |
| 538 | 3300013105 | Ga0157369_10903016 | Ga0157369_109030162 | 110 |
| 539 | 3300013296 | Ga0157374_10034836 | Ga0157374_100348366 | 110 |
| 540 | 3300013296 | Ga0157374_10226508 | Ga0157374_102265082 | 110 |
| 541 | 3300013296 | Ga0157374_10587134 | Ga0157374_105871342 | 110 |
| 542 | 3300013306 | Ga0163162_10004959 | Ga0163162_1000495912 | 110 |
| 543 | 3300013307 | Ga0157372_12134636 | Ga0157372_121346361 | 110 |
| 544 | 3300013308 | Ga0157375_10263404 | Ga0157375_102634043 | 110 |
| 545 | 3300013308 | Ga0157375_11334027 | Ga0157375_113340272 | 110 |
| 546 | 3300014325 | Ga0163163_10019000 | Ga0163163_1001900011 | 110 |
| 547 | 3300014968 | Ga0157379_10597111 | Ga0157379_105971113 | 110 |
| 548 | 3300014969 | Ga0157376_10053211 | Ga0157376_100532113 | 110 |
| 549 | 3300014969 | Ga0157376_11266178 | Ga0157376_112661782 | 110 |
| 550 | 3300025321 | Ga0207656_10581264 | Ga0207656_105812641 | 110 |
| 551 | 3300025903 | Ga0207680_10245261 | Ga0207680_102452613 | 110 |
| 552 | 3300025913 | Ga0207695_10486864 | Ga0207695_104868643 | 110 |
| 553 | 3300025913 | Ga0207695_11695789 | Ga0207695_116957891 | 110 |
| 554 | 3300025914 | Ga0207671_11606787 | Ga0207671_116067871 | 110 |
| 555 | 3300025919 | Ga0207657_10008913 | Ga0207657_1000891312 | 110 |
| 556 | 3300025920 | Ga0207649_10023049 | Ga0207649_100230495 | 110 |
| 557 | 3300025920 | Ga0207649_11394764 | Ga0207649_113947641 | 110 |
| 558 | 3300025924 | Ga0207694_10487183 | Ga0207694_104871832 | 110 |
| 559 | 3300025925 | Ga0207650_10261081 | Ga0207650_102610813 | 110 |
| 560 | 3300025931 | Ga0207644_10018963 | Ga0207644_100189634 | 110 |
| 561 | 3300025932 | Ga0207690_10001487 | Ga0207690_1000148721 | 110 |
| 562 | 3300025934 | Ga0207686_10599710 | Ga0207686_105997102 | 110 |
| 563 | 3300025937 | Ga0207669_11450103 | Ga0207669_114501031 | 110 |
| 564 | 3300025941 | Ga0207711_10188207 | Ga0207711_101882073 | 110 |
| 565 | 3300025941 | Ga0207711_10607573 | Ga0207711_106075732 | 110 |
| 566 | 3300025981 | Ga0207640_10000023 | Ga0207640_1000002312 | 110 |
| 567 | 3300025986 | Ga0207658_10391746 | Ga0207658_103917462 | 110 |
| 568 | 3300026041 | Ga0207639_10000034 | Ga0207639_1000003481 | 110 |
| 569 | 3300026067 | Ga0207678_10250236 | Ga0207678_102502363 | 110 |
| 570 | 3300026088 | Ga0207641_10035286 | Ga0207641_100352867 | 110 |
| 571 | 3300026089 | Ga0207648_10333445 | Ga0207648_103334452 | 110 |
| 572 | 3300026095 | Ga0207676_10154288 | Ga0207676_101542883 | 110 |
| 573 | 3300028379 | Ga0268266_10389723 | Ga0268266_103897232 | 110 |
| 574 | 3300028800 | Ga0265338_10053598 | Ga0265338_100535986 | 110 |
| 575 | 3300028800 | Ga0265338_10488535 | Ga0265338_104885352 | 110 |
| 576 | 3300028800 | Ga0265338_10657614 | Ga0265338_106576142 | 110 |
| 577 | 3300030877 | Ga0265777_104715 | Ga0265777_1047151 | 110 |
| 578 | 3300031235 | Ga0265330_10026960 | Ga0265330_100269604 | 110 |
| 579 | 3300031235 | Ga0265330_10037542 | Ga0265330_100375423 | 110 |
| 580 | 3300031242 | Ga0265329_10078833 | Ga0265329_100788333 | 110 |
| 581 | 3300031250 | Ga0265331_10217935 | Ga0265331_102179352 | 110 |
| 582 | 3300031344 | Ga0265316_10030435 | Ga0265316_100304359 | 110 |
| 583 | 3300031344 | Ga0265316_10074456 | Ga0265316_100744565 | 110 |
| 584 | 3300031344 | Ga0265316_10389958 | Ga0265316_103899581 | 110 |
| 585 | 3300031344 | Ga0265316_10565701 | Ga0265316_105657012 | 110 |
| 586 | 3300031595 | Ga0265313_10163483 | Ga0265313_101634832 | 110 |
| 587 | 3300031712 | Ga0265342_10011411 | Ga0265342_100114111 | 110 |
| 588 | 3300031712 | Ga0265342_10212570 | Ga0265342_102125701 | 110 |
| 589 | 3300033180 | Ga0307510_10057933 | Ga0307510_100579337 | 110 |
| 590 | 3300033180 | Ga0307510_10113631 | Ga0307510_101136314 | 110 |
| 591 | 3300036401 | Ga0373937_0193668 | Ga0373937_0193668_120_455 | 110 |
| 592 | 3300037068 | Ga0373925_0297434 | Ga0373925_0297434_115_450 | 110 |
| 593 | 3300037853 | Ga0436364_1102996 | Ga0436364_1102996_160_495 | 110 |
| 594 | 3300046452 | Ga0495617_037889 | Ga0495617_037889_891_1226 | 110 |
| 595 | 3300046454 | Ga0495592_0048563 | Ga0495592_0048563_1178_1513 | 110 |
| 596 | 3300046454 | Ga0495592_0099518 | Ga0495592_0099518_1252_1587 | 110 |
| 597 | 3300046455 | Ga0495603_0019644 | Ga0495603_0019644_1714_2049 | 110 |
| 598 | 3300046455 | Ga0495603_0086693 | Ga0495603_0086693_1163_1498 | 110 |
| 599 | 3300046455 | Ga0495603_0169854 | Ga0495603_0169854_559_894 | 110 |
| 600 | 3300046457 | Ga0495590_0265606 | Ga0495590_0265606_65_400 | 110 |
| 601 | 3300046459 | Ga0495629_0051980 | Ga0495629_0051980_1471_1806 | 110 |
| 602 | 3300046459 | Ga0495629_0055550 | Ga0495629_0055550_872_1207 | 110 |
| 603 | 3300046460 | Ga0495638_0341614 | Ga0495638_0341614_260_595 | 110 |
| 604 | 3300046461 | Ga0495641_0194345 | Ga0495641_0194345_376_711 | 110 |
| 605 | 3300046461 | Ga0495641_0574191 | Ga0495641_0574191_119_454 | 110 |
| 606 | 3300046462 | Ga0495651_0024980 | Ga0495651_0024980_2166_2501 | 110 |
| 607 | 3300046462 | Ga0495651_0049871 | Ga0495651_0049871_2597_2932 | 110 |
| 608 | 3300046462 | Ga0495651_0065572 | Ga0495651_0065572_46_378 | 110 |
| 609 | 3300046463 | Ga0495653_0002196 | Ga0495653_0002196_14238_14573 | 110 |
| 610 | 3300046472 | Ga0495580_0085802 | Ga0495580_0085802_354_689 | 110 |
| 611 | 3300046472 | Ga0495580_0170496 | Ga0495580_0170496_1076_1411 | 110 |
| 612 | 3300046472 | Ga0495580_0198427 | Ga0495580_0198427_893_1228 | 110 |
| 613 | 3300046473 | Ga0495582_0008570 | Ga0495582_0008570_3709_4044 | 110 |
| 614 | 3300046473 | Ga0495582_0146543 | Ga0495582_0146543_268_603 | 110 |
| 615 | 3300046474 | Ga0495605_0151598 | Ga0495605_0151598_540_875 | 110 |
| 616 | 3300046475 | Ga0495639_0001203 | Ga0495639_0001203_8452_8787 | 110 |
| 617 | 3300046476 | Ga0495662_0000747 | Ga0495662_0000747_10829_11164 | 110 |
| 618 | 3300046477 | Ga0495664_0160449 | Ga0495664_0160449_16_351 | 110 |
| 619 | 3300046477 | Ga0495664_0401226 | Ga0495664_0401226_61_393 | 110 |
| 620 | 3300046492 | Ga0495585_0007246 | Ga0495585_0007246_3988_4323 | 110 |
| 621 | 3300046499 | Ga0495594_0008173 | Ga0495594_0008173_1631_1966 | 110 |
| 622 | 3300046499 | Ga0495594_0046135 | Ga0495594_0046135_1630_1965 | 110 |
| 623 | 3300046500 | Ga0495596_0038690 | Ga0495596_0038690_798_1133 | 110 |
| 624 | 3300046501 | Ga0495607_0240149 | Ga0495607_0240149_188_523 | 110 |
| 625 | 3300046506 | Ga0495583_0052529 | Ga0495583_0052529_322_657 | 110 |
| 626 | 3300046506 | Ga0495583_0162272 | Ga0495583_0162272_422_757 | 110 |
| 627 | 3300046507 | Ga0495606_0220620 | Ga0495606_0220620_656_991 | 110 |
| 628 | 3300046507 | Ga0495606_0243681 | Ga0495606_0243681_562_894 | 110 |
| 629 | 3300046511 | Ga0495608_0414698 | Ga0495608_0414698_264_599 | 110 |
| 630 | 3300046514 | Ga0495618_0139851 | Ga0495618_0139851_567_902 | 110 |
| 631 | 3300046516 | Ga0495628_0040852 | Ga0495628_0040852_603_938 | 110 |
| 632 | 3300046516 | Ga0495628_0332235 | Ga0495628_0332235_639_974 | 110 |
| 633 | 3300046517 | Ga0495630_0056994 | Ga0495630_0056994_1606_1941 | 110 |
| 634 | 3300046518 | Ga0495631_0104248 | Ga0495631_0104248_226_561 | 110 |
| 635 | 3300046518 | Ga0495631_0146549 | Ga0495631_0146549_429_764 | 110 |
| 636 | 3300046523 | Ga0495644_0000777 | Ga0495644_0000777_8148_8483 | 110 |
| 637 | 3300046524 | Ga0495648_0038427 | Ga0495648_0038427_2630_2962 | 110 |
| 638 | 3300046524 | Ga0495648_0372927 | Ga0495648_0372927_283_618 | 110 |
| 639 | 3300046526 | Ga0495666_0000949 | Ga0495666_0000949_10110_10445 | 110 |
| 640 | 3300046528 | Ga0495642_0026468 | Ga0495642_0026468_1718_2053 | 110 |
| 641 | 3300046529 | Ga0495652_0010348 | Ga0495652_0010348_711_1046 | 110 |
| 642 | 3300046529 | Ga0495652_0033406 | Ga0495652_0033406_1536_1871 | 110 |
| 643 | 3300046529 | Ga0495652_0115140 | Ga0495652_0115140_319_651 | 110 |
| 644 | 3300046531 | Ga0495665_0003007 | Ga0495665_0003007_5764_6099 | 110 |
| 645 | 3300046533 | Ga0495640_0018326 | Ga0495640_0018326_3714_4049 | 110 |
| 646 | 3300046535 | Ga0495586_0003386 | Ga0495586_0003386_6381_6716 | 110 |
| 647 | 3300046536 | Ga0495587_0014310 | Ga0495587_0014310_2030_2365 | 110 |
| 648 | 3300046536 | Ga0495587_0035208 | Ga0495587_0035208_94_429 | 110 |
| 649 | 3300046538 | Ga0495609_0063305 | Ga0495609_0063305_1277_1612 | 110 |
| 650 | 3300046538 | Ga0495609_0075964 | Ga0495609_0075964_590_925 | 110 |
| 651 | 3300046543 | Ga0495645_0001054 | Ga0495645_0001054_5463_5798 | 110 |
| 652 | 3300046543 | Ga0495645_0008101 | Ga0495645_0008101_3075_3410 | 110 |
| 653 | 3300046557 | Ga0495622_0467239 | Ga0495622_0467239_163_498 | 110 |
| 654 | 3300046558 | Ga0495633_0013370 | Ga0495633_0013370_1839_2174 | 110 |
| 655 | 3300046559 | Ga0495667_0003070 | Ga0495667_0003070_3947_4282 | 110 |
| 656 | 3300046559 | Ga0495667_0794900 | Ga0495667_0794900_178_510 | 110 |
| 657 | 3300046616 | Ga0495668_0021631 | Ga0495668_0021631_2246_2581 | 110 |
| 658 | 3300046616 | Ga0495668_0120025 | Ga0495668_0120025_695_1030 | 110 |
| 659 | 3300046642 | Ga0495634_0001003 | Ga0495634_0001003_19323_19658 | 110 |
| 660 | 3300046648 | Ga0495611_0365400 | Ga0495611_0365400_69_404 | 110 |
| 661 | 3300046660 | Ga0495625_0042541 | Ga0495625_0042541_708_1043 | 110 |
| 662 | 3300046660 | Ga0495625_0044844 | Ga0495625_0044844_2187_2522 | 110 |
| 663 | 3300046660 | Ga0495625_0071757 | Ga0495625_0071757_2022_2357 | 110 |
| 664 | 3300046660 | Ga0495625_0171924 | Ga0495625_0171924_274_609 | 110 |
| 665 | 3300046663 | Ga0495635_0007598 | Ga0495635_0007598_1529_1864 | 110 |
| 666 | 3300046663 | Ga0495635_0148424 | Ga0495635_0148424_420_755 | 110 |
| 667 | 3300046664 | Ga0495659_0114422 | Ga0495659_0114422_466_801 | 110 |
| 668 | 3300046665 | Ga0495661_0009905 | Ga0495661_0009905_4740_5072 | 110 |
| 669 | 3300046674 | Ga0495588_0020496 | Ga0495588_0020496_168_503 | 110 |
| 670 | 3300046674 | Ga0495588_0200104 | Ga0495588_0200104_155_490 | 110 |
| 671 | 3300046678 | Ga0495599_0016425 | Ga0495599_0016425_2248_2583 | 110 |
| 672 | 3300046678 | Ga0495599_0031846 | Ga0495599_0031846_1572_1907 | 110 |
| 673 | 3300046678 | Ga0495599_0191735 | Ga0495599_0191735_868_1200 | 110 |
| 674 | 3300046679 | Ga0495623_0021136 | Ga0495623_0021136_2721_3056 | 110 |
| 675 | 3300046679 | Ga0495623_0035235 | Ga0495623_0035235_1982_2317 | 110 |
| 676 | 3300046680 | Ga0495646_0012115 | Ga0495646_0012115_4001_4336 | 110 |
| 677 | 3300046680 | Ga0495646_0292279 | Ga0495646_0292279_260_595 | 110 |
| 678 | 3300046681 | Ga0495647_0337116 | Ga0495647_0337116_115_450 | 110 |
| 679 | 3300046683 | Ga0495658_0134260 | Ga0495658_0134260_99_434 | 110 |
| 680 | 3300046684 | Ga0495669_0000955 | Ga0495669_0000955_238_573 | 110 |
| 681 | 3300046689 | Ga0495613_0012294 | Ga0495613_0012294_713_1048 | 110 |
| 682 | 3300046689 | Ga0495613_0026345 | Ga0495613_0026345_1542_1877 | 110 |
| 683 | 3300046690 | Ga0495624_0003012 | Ga0495624_0003012_6122_6457 | 110 |
| 684 | 3300046690 | Ga0495624_0105187 | Ga0495624_0105187_964_1296 | 110 |
| 685 | 3300046691 | Ga0495670_0044582 | Ga0495670_0044582_775_1110 | 110 |
| 686 | 3300046692 | Ga0495671_0103700 | Ga0495671_0103700_332_667 | 110 |
| 687 | 3300046694 | Ga0495649_0324589 | Ga0495649_0324589_431_766 | 110 |
| 688 | 3300046694 | Ga0495649_0403724 | Ga0495649_0403724_203_538 | 110 |
| 689 | 3300046794 | Ga0495589_0198735 | Ga0495589_0198735_157_492 | 110 |
| 690 | 3300046809 | Ga0495600_0003517 | Ga0495600_0003517_5550_5885 | 110 |
| 691 | 3300046809 | Ga0495600_0070830 | Ga0495600_0070830_1002_1337 | 110 |
| 692 | 3300046809 | Ga0495600_0203032 | Ga0495600_0203032_894_1226 | 110 |
| 693 | 3300047315 | Ga0495581_0000275 | Ga0495581_0000275_5268_5603 | 110 |
| 694 | 3300047317 | Ga0495604_0005020 | Ga0495604_0005020_6425_6760 | 110 |
| 695 | 3300047317 | Ga0495604_0006391 | Ga0495604_0006391_5361_5696 | 110 |
| 696 | 3300047317 | Ga0495604_0036403 | Ga0495604_0036403_1262_1594 | 110 |
| 697 | 3300047318 | Ga0495636_0026297 | Ga0495636_0026297_1658_1993 | 110 |
| 698 | 3300047319 | Ga0495674_0022106 | Ga0495674_0022106_1535_1870 | 110 |
| 699 | 3300047320 | Ga0495672_0004479 | Ga0495672_0004479_2020_2355 | 110 |
| 700 | 3300047320 | Ga0495672_0081242 | Ga0495672_0081242_896_1231 | 110 |
| 701 | 3300047321 | Ga0495676_0007390 | Ga0495676_0007390_3236_3571 | 110 |
| 702 | 3300047322 | Ga0495680_0023728 | Ga0495680_0023728_3822_4157 | 110 |
| 703 | 3300047323 | Ga0495683_0054067 | Ga0495683_0054067_200_535 | 110 |
| 704 | 3300047444 | Ga0495675_0004057 | Ga0495675_0004057_2709_3044 | 110 |
| 705 | 3300047444 | Ga0495675_0490485 | Ga0495675_0490485_95_430 | 110 |
| 706 | 3300047445 | Ga0495677_0029395 | Ga0495677_0029395_440_775 | 110 |
| 707 | 3300047469 | Ga0495673_0046320 | Ga0495673_0046320_977_1312 | 110 |
| 708 | 3300047469 | Ga0495673_0085086 | Ga0495673_0085086_891_1226 | 110 |
| 709 | 3300047470 | Ga0495681_0104518 | Ga0495681_0104518_565_900 | 110 |
| 710 | 3300047471 | Ga0495684_0009955 | Ga0495684_0009955_6319_6654 | 110 |
| 711 | 3300047472 | Ga0495686_0006326 | Ga0495686_0006326_7590_7925 | 110 |
| 712 | 3300047472 | Ga0495686_0014417 | Ga0495686_0014417_330_662 | 110 |
| 713 | 3300047673 | Ga0495593_0070451 | Ga0495593_0070451_754_1089 | 110 |
| 714 | 3300047673 | Ga0495593_0436075 | Ga0495593_0436075_121_456 | 110 |
| 715 | 3300048088 | Ga0495602_0061846 | Ga0495602_0061846_516_851 | 110 |
| 716 | 3300048089 | Ga0495614_0004587 | Ga0495614_0004587_5152_5487 | 110 |
| 717 | 3300048089 | Ga0495614_0042970 | Ga0495614_0042970_199_534 | 110 |
| 718 | 3300048903 | Ga0496100_1237580 | Ga0496100_1237580_179_511 | 110 |
| 719 | 3300048904 | Ga0496101_0173120 | Ga0496101_0173120_968_1303 | 110 |
| 720 | 3300048907 | Ga0496104_0061071 | Ga0496104_0061071_2862_3194 | 110 |
| 721 | 3300048908 | Ga0496105_0686913 | Ga0496105_0686913_341_673 | 110 |
| 722 | 3300048910 | Ga0496107_0881946 | Ga0496107_0881946_258_590 | 110 |
| 723 | 3300048911 | Ga0496108_0179181 | Ga0496108_0179181_765_1100 | 110 |
| 724 | 3300048915 | Ga0496112_0310070 | Ga0496112_0310070_572_907 | 110 |
| 725 | 3300048917 | Ga0496114_0306071 | Ga0496114_0306071_1054_1386 | 110 |
| 726 | 3300048918 | Ga0496115_0152147 | Ga0496115_0152147_90_422 | 110 |
| 727 | 3300048929 | Ga0496126_0000560 | Ga0496126_0000560_5849_6181 | 110 |
| 728 | 3300049460 | Ga0495682_0020449 | Ga0495682_0020449_1184_1519 | 110 |
| 729 | 3300053084 | Ga0495595_0333460 | Ga0495595_0333460_418_753 | 110 |
| 730 | 3300053093 | Ga0500651_0000049 | Ga0500651_0000049_5745_6077 | 110 |
| 731 | 3300053119 | Ga0500595_000014 | Ga0500595_000014_5763_6095 | 110 |
| 732 | 3300053119 | Ga0500595_009469 | Ga0500595_009469_2292_2627 | 110 |
| 733 | 3300004799 | Ga0058863_11690845 | Ga0058863_116908452 | 111 |
| 734 | 3300004803 | Ga0058862_12327023 | Ga0058862_123270232 | 111 |
| 735 | 3300005327 | Ga0070658_10076190 | Ga0070658_100761905 | 111 |
| 736 | 3300005336 | Ga0070680_101255686 | Ga0070680_1012556861 | 111 |
| 737 | 3300005339 | Ga0070660_100006108 | Ga0070660_1000061089 | 111 |
| 738 | 3300005341 | Ga0070691_10337695 | Ga0070691_103376953 | 111 |
| 739 | 3300005435 | Ga0070714_100336931 | Ga0070714_1003369313 | 111 |
| 740 | 3300005455 | Ga0070663_100281825 | Ga0070663_1002818253 | 111 |
| 741 | 3300005458 | Ga0070681_10769067 | Ga0070681_107690671 | 111 |
| 742 | 3300005530 | Ga0070679_100015770 | Ga0070679_1000157707 | 111 |
| 743 | 3300005563 | Ga0068855_100140439 | Ga0068855_1001404395 | 111 |
| 744 | 3300005578 | Ga0068854_100506959 | Ga0068854_1005069593 | 111 |
| 745 | 3300005614 | Ga0068856_100100182 | Ga0068856_1001001824 | 111 |
| 746 | 3300009098 | Ga0105245_11108624 | Ga0105245_111086242 | 111 |
| 747 | 3300013100 | Ga0157373_11286363 | Ga0157373_112863632 | 111 |
| 748 | 3300013104 | Ga0157370_10062955 | Ga0157370_100629557 | 111 |
| 749 | 3300013105 | Ga0157369_10364492 | Ga0157369_103644921 | 111 |
| 750 | 3300013307 | Ga0157372_10047852 | Ga0157372_100478529 | 111 |
| 751 | 3300025261 | Ga0209233_1038436 | Ga0209233_10384362 | 111 |
| 752 | 3300025909 | Ga0207705_10010050 | Ga0207705_100100503 | 111 |
| 753 | 3300025917 | Ga0207660_10695019 | Ga0207660_106950192 | 111 |
| 754 | 3300025919 | Ga0207657_10032755 | Ga0207657_1003275510 | 111 |
| 755 | 3300025921 | Ga0207652_10028452 | Ga0207652_100284526 | 111 |
| 756 | 3300025921 | Ga0207652_10125219 | Ga0207652_101252193 | 111 |
| 757 | 3300025929 | Ga0207664_10292060 | Ga0207664_102920602 | 111 |
| 758 | 3300025949 | Ga0207667_10010059 | Ga0207667_100100599 | 111 |
| 759 | 3300026067 | Ga0207678_10399148 | Ga0207678_103991482 | 111 |
| 760 | 3300026078 | Ga0207702_10513881 | Ga0207702_105138813 | 111 |
| 761 | 3300028666 | Ga0265336_10055872 | Ga0265336_100558723 | 111 |
| 762 | 3300028800 | Ga0265338_10055532 | Ga0265338_100555326 | 111 |
| 763 | 3300030863 | Ga0265766_1006890 | Ga0265766_10068902 | 111 |
| 764 | 3300030878 | Ga0265770_1021345 | Ga0265770_10213452 | 111 |
| 765 | 3300031090 | Ga0265760_10038980 | Ga0265760_100389803 | 111 |
| 766 | 3300031090 | Ga0265760_10191784 | Ga0265760_101917842 | 111 |
| 767 | 3300031235 | Ga0265330_10000477 | Ga0265330_1000047711 | 111 |
| 768 | 3300031235 | Ga0265330_10018950 | Ga0265330_100189506 | 111 |
| 769 | 3300031240 | Ga0265320_10141861 | Ga0265320_101418613 | 111 |
| 770 | 3300031241 | Ga0265325_10003065 | Ga0265325_1000306510 | 111 |
| 771 | 3300031241 | Ga0265325_10034719 | Ga0265325_100347194 | 111 |
| 772 | 3300031241 | Ga0265325_10156559 | Ga0265325_101565592 | 111 |
| 773 | 3300031247 | Ga0265340_10052890 | Ga0265340_100528902 | 111 |
| 774 | 3300031247 | Ga0265340_10113538 | Ga0265340_101135382 | 111 |
| 775 | 3300031247 | Ga0265340_10202476 | Ga0265340_102024761 | 111 |
| 776 | 3300031247 | Ga0265340_10388081 | Ga0265340_103880812 | 111 |
| 777 | 3300031249 | Ga0265339_10021757 | Ga0265339_100217571 | 111 |
| 778 | 3300031249 | Ga0265339_10025776 | Ga0265339_100257763 | 111 |
| 779 | 3300031249 | Ga0265339_10045677 | Ga0265339_100456775 | 111 |
| 780 | 3300031344 | Ga0265316_10007872 | Ga0265316_1000787211 | 111 |
| 781 | 3300031344 | Ga0265316_10013957 | Ga0265316_1001395710 | 111 |
| 782 | 3300031344 | Ga0265316_10040636 | Ga0265316_100406364 | 111 |
| 783 | 3300031344 | Ga0265316_10328871 | Ga0265316_103288712 | 111 |
| 784 | 3300031344 | Ga0265316_11049467 | Ga0265316_110494671 | 111 |
| 785 | 3300031595 | Ga0265313_10002067 | Ga0265313_1000206725 | 111 |
| 786 | 3300031711 | Ga0265314_10120206 | Ga0265314_101202063 | 111 |
| 787 | 3300031711 | Ga0265314_10130954 | Ga0265314_101309543 | 111 |
| 788 | 3300031712 | Ga0265342_10023416 | Ga0265342_100234165 | 111 |
| 789 | 3300031712 | Ga0265342_10042608 | Ga0265342_100426085 | 111 |
| 790 | 3300031712 | Ga0265342_10230440 | Ga0265342_102304402 | 111 |
| 791 | 3300036459 | Ga0372808_025990 | Ga0372808_025990_159_500 | 111 |
| 792 | 3300005327 | Ga0070658_10161229 | Ga0070658_101612294 | 112 |
| 793 | 3300005327 | Ga0070658_10239808 | Ga0070658_102398084 | 112 |
| 794 | 3300005435 | Ga0070714_100863857 | Ga0070714_1008638572 | 112 |
| 795 | 3300005455 | Ga0070663_100010939 | Ga0070663_1000109396 | 112 |
| 796 | 3300005458 | Ga0070681_10171502 | Ga0070681_101715023 | 112 |
| 797 | 3300005563 | Ga0068855_100231753 | Ga0068855_1002317532 | 112 |
| 798 | 3300005563 | Ga0068855_100242058 | Ga0068855_1002420582 | 112 |
| 799 | 3300009093 | Ga0105240_10000001 | Ga0105240_10000001920 | 112 |
| 800 | 3300009093 | Ga0105240_12535415 | Ga0105240_125354152 | 112 |
| 801 | 3300013102 | Ga0157371_10273346 | Ga0157371_102733463 | 112 |
| 802 | 3300013104 | Ga0157370_10931090 | Ga0157370_109310902 | 112 |
| 803 | 3300013105 | Ga0157369_10265782 | Ga0157369_102657824 | 112 |
| 804 | 3300025909 | Ga0207705_10013784 | Ga0207705_100137844 | 112 |
| 805 | 3300025912 | Ga0207707_10485341 | Ga0207707_104853412 | 112 |
| 806 | 3300025913 | Ga0207695_10000001 | Ga0207695_10000001923 | 112 |
| 807 | 3300025949 | Ga0207667_10819960 | Ga0207667_108199601 | 112 |
| 808 | 3300025981 | Ga0207640_11111853 | Ga0207640_111118531 | 112 |
| 809 | 3300026067 | Ga0207678_10009514 | Ga0207678_100095145 | 112 |
| 810 | 3300048907 | Ga0496104_1457421 | Ga0496104_1457421_165_515 | 112 |
| 811 | 3300005327 | Ga0070658_10070958 | Ga0070658_100709584 | 113 |
| 812 | 3300005339 | Ga0070660_101270735 | Ga0070660_1012707351 | 113 |
| 813 | 3300005436 | Ga0070713_100015502 | Ga0070713_1000155027 | 113 |
| 814 | 3300006175 | Ga0070712_101145955 | Ga0070712_1011459551 | 113 |
| 815 | 3300009093 | Ga0105240_11271638 | Ga0105240_112716382 | 113 |
| 816 | 3300013104 | Ga0157370_10250542 | Ga0157370_102505422 | 113 |
| 817 | 3300013307 | Ga0157372_10192270 | Ga0157372_101922704 | 113 |
| 818 | 3300022467 | Ga0224712_10451513 | Ga0224712_104515132 | 113 |
| 819 | 3300025909 | Ga0207705_10042512 | Ga0207705_100425124 | 113 |
| 820 | 3300025913 | Ga0207695_10146071 | Ga0207695_101460714 | 113 |
| 821 | 3300025928 | Ga0207700_10058148 | Ga0207700_100581486 | 113 |
| 822 | 3300026067 | Ga0207678_10035886 | Ga0207678_100358865 | 113 |
| 823 | 3300033180 | Ga0307510_10021356 | Ga0307510_100213562 | 113 |
| 824 | 3300046477 | Ga0495664_0127829 | Ga0495664_0127829_324_665 | 113 |
| 825 | 3300046516 | Ga0495628_0487071 | Ga0495628_0487071_370_711 | 113 |
| 826 | 3300046543 | Ga0495645_0006005 | Ga0495645_0006005_3605_3946 | 113 |
| 827 | 3300048918 | Ga0496115_0104212 | Ga0496115_0104212_270_611 | 113 |
| 828 | 3300049460 | Ga0495682_0171372 | Ga0495682_0171372_364_705 | 113 |
| 829 | 3300049569 | Ga0501032_1022762 | Ga0501032_1022762_83_430 | 113 |
| 830 | 3300049573 | Ga0501037_0034434 | Ga0501037_0034434_1718_2065 | 113 |
| 831 | 3300049579 | Ga0501043_0146637 | Ga0501043_0146637_319_666 | 113 |
| 832 | 3300049581 | Ga0501047_0014539 | Ga0501047_0014539_3500_3847 | 113 |
| 833 | 3300049585 | Ga0501069_0405717 | Ga0501069_0405717_361_708 | 113 |
| 834 | 3300049586 | Ga0501070_0073834 | Ga0501070_0073834_1195_1542 | 113 |
| 835 | 3300049589 | Ga0501073_0046410 | Ga0501073_0046410_1228_1575 | 113 |
| 836 | 3300049742 | Ga0501080_0098664 | Ga0501080_0098664_1540_1887 | 113 |
| 837 | 3300049822 | Ga0501035_0460411 | Ga0501035_0460411_151_498 | 113 |
| 838 | 3300049823 | Ga0501044_0145264 | Ga0501044_0145264_585_932 | 113 |
| 839 | 3300000531 | CNBas_1013173 | CNBas_10131731 | 114 |
| 840 | 3300005327 | Ga0070658_11004857 | Ga0070658_110048572 | 114 |
| 841 | 3300005329 | Ga0070683_100108530 | Ga0070683_1001085304 | 114 |
| 842 | 3300005336 | Ga0070680_100032458 | Ga0070680_1000324584 | 114 |
| 843 | 3300005339 | Ga0070660_100061278 | Ga0070660_1000612781 | 114 |
| 844 | 3300005344 | Ga0070661_100162072 | Ga0070661_1001620723 | 114 |
| 845 | 3300005366 | Ga0070659_100016590 | Ga0070659_10001659010 | 114 |
| 846 | 3300005455 | Ga0070663_100667965 | Ga0070663_1006679653 | 114 |
| 847 | 3300005455 | Ga0070663_101422324 | Ga0070663_1014223242 | 114 |
| 848 | 3300005458 | Ga0070681_10200046 | Ga0070681_102000462 | 114 |
| 849 | 3300005530 | Ga0070679_100279165 | Ga0070679_1002791652 | 114 |
| 850 | 3300005563 | Ga0068855_100003825 | Ga0068855_1000038257 | 114 |
| 851 | 3300005563 | Ga0068855_100158606 | Ga0068855_1001586064 | 114 |
| 852 | 3300005564 | Ga0070664_100163924 | Ga0070664_1001639242 | 114 |
| 853 | 3300005577 | Ga0068857_100063745 | Ga0068857_1000637453 | 114 |
| 854 | 3300005578 | Ga0068854_100037277 | Ga0068854_1000372773 | 114 |
| 855 | 3300007788 | Ga0099795_10347177 | Ga0099795_103471771 | 114 |
| 856 | 3300009093 | Ga0105240_10045768 | Ga0105240_100457687 | 114 |
| 857 | 3300009174 | Ga0105241_10083767 | Ga0105241_100837674 | 114 |
| 858 | 3300009545 | Ga0105237_10518019 | Ga0105237_105180192 | 114 |
| 859 | 3300009551 | Ga0105238_11498914 | Ga0105238_114989142 | 114 |
| 860 | 3300013100 | Ga0157373_10278775 | Ga0157373_102787751 | 114 |
| 861 | 3300013104 | Ga0157370_10053290 | Ga0157370_100532904 | 114 |
| 862 | 3300013104 | Ga0157370_10414018 | Ga0157370_104140183 | 114 |
| 863 | 3300013105 | Ga0157369_10056103 | Ga0157369_100561033 | 114 |
| 864 | 3300013307 | Ga0157372_10764445 | Ga0157372_107644453 | 114 |
| 865 | 3300025904 | Ga0207647_10214128 | Ga0207647_102141282 | 114 |
| 866 | 3300025909 | Ga0207705_10000048 | Ga0207705_10000048160 | 114 |
| 867 | 3300025909 | Ga0207705_10026791 | Ga0207705_100267916 | 114 |
| 868 | 3300025912 | Ga0207707_10223658 | Ga0207707_102236583 | 114 |
| 869 | 3300025913 | Ga0207695_10067170 | Ga0207695_100671704 | 114 |
| 870 | 3300025914 | Ga0207671_10984782 | Ga0207671_109847821 | 114 |
| 871 | 3300025915 | Ga0207693_10195081 | Ga0207693_101950813 | 114 |
| 872 | 3300025917 | Ga0207660_10203919 | Ga0207660_102039193 | 114 |
| 873 | 3300025919 | Ga0207657_10012382 | Ga0207657_1001238211 | 114 |
| 874 | 3300025920 | Ga0207649_10019606 | Ga0207649_100196062 | 114 |
| 875 | 3300025921 | Ga0207652_10396006 | Ga0207652_103960062 | 114 |
| 876 | 3300025924 | Ga0207694_10770405 | Ga0207694_107704051 | 114 |
| 877 | 3300025932 | Ga0207690_10332266 | Ga0207690_103322663 | 114 |
| 878 | 3300025944 | Ga0207661_10011175 | Ga0207661_1001117511 | 114 |
| 879 | 3300025945 | Ga0207679_10420146 | Ga0207679_104201462 | 114 |
| 880 | 3300025949 | Ga0207667_10053320 | Ga0207667_100533207 | 114 |
| 881 | 3300025949 | Ga0207667_10056317 | Ga0207667_100563177 | 114 |
| 882 | 3300025981 | Ga0207640_10075139 | Ga0207640_100751394 | 114 |
| 883 | 3300026067 | Ga0207678_10029842 | Ga0207678_100298426 | 114 |
| 884 | 3300026067 | Ga0207678_10957686 | Ga0207678_109576862 | 114 |
| 885 | 3300026116 | Ga0207674_10000532 | Ga0207674_1000053212 | 114 |
| 886 | 3300046492 | Ga0495585_0104010 | Ga0495585_0104010_340_684 | 114 |
| 887 | 3300046499 | Ga0495594_0771920 | Ga0495594_0771920_159_503 | 114 |
| 888 | 3300048929 | Ga0496126_0000209 | Ga0496126_0000209_125256_125600 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fmw-assembly1.cif.gz_Q | the structure of a hibernating ribosome in the lyme disease pathogen | 0.9032 | 22 | 98 |
| 7pnw-assembly1.cif.gz_N | mouse mitochondrial ribosome small subunit lacking m5u modification | 0.8936 | 21 | 96 |
| 4v4w-assembly1.cif.gz_AQ | structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 | 0.8928 | 22 | 97 |
| 6ydw-assembly1.cif.gz_AQ | 55s mammalian mitochondrial ribosome with mtefg1 and two trnamet (ti-post) | 0.8923 | 21 | 94 |
| 7l08-assembly1.cif.gz_AN | cryo-em structure of the human 55s mitoribosome-rrfmt complex. | 0.888 | 21 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6neqQ00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8887 | 21 | 97 | 2.40.50.140 |
| af_Q4E4R7_93_168_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8807 | 23 | 97 | 2.40.50.140 |
| af_C6T0V9_1_79_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8788 | 22 | 97 | 2.40.50.140 |
| af_I1KKK3_1_96_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8765 | 22 | 98 | 2.40.50.140 |
| af_Q25811_2_74_2.40.50.1000 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.8669 | 21 | 94 | 2.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1S8W181-F1-model_v4 | deleted | 0.9019 | 22 | 98 |
|
| AF-A0A0G2ZCR4-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9014 | 22 | 98 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A1V5SVS5-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9001 | 22 | 98 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A2D9P5K4-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9 | 22 | 98 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-B5YDV2-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.898 | 22 | 98 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar