F484635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 884 | 527 | 630 | 454 |
Family's Representative Sequence
| Representative Sequence | 3300041405|Ga0439438_007901|Ga0439438_007901_1478_2902 |
| Length | 474 |
| Sequence | MRRAPLMLAALSLKNLRRVRMTSNNPQTREWQTLSNDHHLAPFSDFKQLKEKGPRIITNAKGVYLWDSEGNKILDGMAGLWCVAIGYGRDELADAASKQMRELPYYNLFFQTAHPPVLELAKAISDIAPQGMNHVFFTGSGSEGNDTMLRMVRHYWAIKGQPKKKVIISRKNGYHGSTVAGASLGGMTYMHEQGDLPIPGIVHIAQPYWFAEGGEMTPEEFGVWAANQLEEKILEVGVDNVGAFIAEPIQGAGGVIIPPATYWPRIKEILAKYDILFVADEVICGFGRTGEWFGSDFYDLKPDMMTIAKGLTSGYIPMGGLIVRDEVVEVLNEGGDFNHGFTYSGHPVAAAVALENIRILREEKIIERVHAETAPYLQKRLRELSDHPLVGEVRGVGLLGAIELVQDKATRKRYEGKGAGMICRTFCFENGLIMRAVGDTMIIAPPLVITPAEIDELVTKARKCLDLTLSALQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 10 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 11 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 12 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 13 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 14 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 15 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 16 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 17 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 18 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 19 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 20 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 21 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 22 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 23 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 24 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 25 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 26 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 27 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 28 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 29 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 30 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 31 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 32 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 33 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 34 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 35 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 36 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 37 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 38 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 39 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 40 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 41 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 42 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 43 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 44 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 45 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 46 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 47 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 48 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 49 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 50 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 51 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 52 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 53 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 54 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 55 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 56 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 57 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 58 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 59 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 60 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 61 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 62 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 63 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 64 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 65 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 66 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 67 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 68 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 69 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 70 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 71 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 72 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 73 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 74 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 75 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 76 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 77 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 78 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 79 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 80 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 81 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 82 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 83 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 84 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 85 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 86 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 87 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 88 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 89 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 90 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 91 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 92 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 93 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 94 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 95 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 96 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 97 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 98 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 99 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 100 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 101 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 102 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 103 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 104 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 105 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 106 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 107 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 108 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 109 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 110 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 111 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 112 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 113 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 114 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 115 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 116 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 117 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 118 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 119 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 120 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 121 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 122 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 123 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 124 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 125 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 126 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 127 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 128 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 129 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 130 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 131 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 132 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 133 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 134 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 135 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 136 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 137 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 138 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 139 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 140 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 141 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 142 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 143 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 144 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 145 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 146 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 147 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 148 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 149 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 150 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 151 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 152 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 153 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 154 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 155 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 156 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 157 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 158 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 159 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 160 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 161 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 162 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 163 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 164 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 165 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 166 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 167 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 168 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 169 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 170 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 171 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 172 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 173 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 174 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 175 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 176 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 177 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 178 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 179 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 180 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 181 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 182 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 183 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 184 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 185 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 186 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 187 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 188 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 189 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 190 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 191 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 192 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 193 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 194 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 195 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 196 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 197 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 198 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 199 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 200 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 201 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 202 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 203 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 204 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 205 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 206 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 207 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 208 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 209 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 210 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 211 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 212 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 213 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 214 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 215 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 216 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 217 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 218 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 219 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 220 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 221 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 222 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 223 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 224 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 225 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 226 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 227 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 228 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 229 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 230 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 231 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 232 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 233 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 234 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 235 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 236 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 237 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 238 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 239 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 240 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 241 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 242 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 243 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 244 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 245 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 246 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 247 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 248 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 249 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 250 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 251 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 252 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 253 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 256 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 262 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 264 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 266 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 267 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 268 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 269 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 270 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 271 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 272 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 273 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 274 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 275 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 276 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 280 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 290 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 291 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 299 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 301 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 302 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 303 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 305 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 312 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 315 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 316 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 318 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 321 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 322 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 353 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 354 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 356 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 357 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 358 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 359 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 360 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 361 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 362 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 363 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 364 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 365 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 366 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 367 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 368 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 369 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 370 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 371 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 372 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 373 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 374 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 375 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 376 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 377 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 378 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 379 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 380 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 381 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 382 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 383 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 384 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 385 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 386 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 387 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 388 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 389 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 390 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 391 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 392 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 393 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 394 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 395 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 396 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 397 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 398 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 399 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 400 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 401 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 402 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 403 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 404 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 405 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 406 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 407 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 466 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 467 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 468 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 469 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 470 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 471 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 472 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 473 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 474 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 475 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 476 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 477 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 478 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 479 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 489 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 494 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 495 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 496 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 497 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 499 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 500 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 501 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 502 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 503 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 504 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 505 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 506 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 507 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 508 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 509 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 510 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 511 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 512 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 513 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 514 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 515 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 516 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 517 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 518 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 519 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 520 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 521 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 522 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 523 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 524 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 525 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 526 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 527 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.27 |
| Metatranscriptomes | 0 |
| Isolates | 28.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.2 |
| Nodule | 3.73 |
| Rhizoplane | 8.48 |
| Rhizosphere | 60.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_136 | 2124908027 | Bacteria | 16261 |
| 2 | SwRhRL2b_contig_180730 | 2162886007 | Bacteria | 3385 |
| 3 | JGI24741J21665_1004873 | 3300001915 | Bacteria | 2898 |
| 4 | JGI25156J39149_1000278 | 3300002705 | Bacteria | 34709 |
| 5 | JGI25156J39149_1000973 | 3300002705 | Bacteria | 13642 |
| 6 | JGI25156J39149_1009634 | 3300002705 | Bacteria | 2332 |
| 7 | JGI25162J39368_1000505 | 3300002737 | Bacteria | 29260 |
| 8 | JGI25162J39368_1000520 | 3300002737 | Bacteria | 28748 |
| 9 | JGI25154J39366_1000221 | 3300002738 | Bacteria | 38916 |
| 10 | JGI25157J39369_1000049 | 3300002741 | Bacteria | 115611 |
| 11 | JGI25163J39215_1002359 | 3300002771 | Bacteria | 2003 |
| 12 | JGI25164J39214_1000342 | 3300002772 | Bacteria | 29260 |
| 13 | JGI25164J39214_1000350 | 3300002772 | Bacteria | 28748 |
| 14 | JGI25165J46597_1000629 | 3300003214 | Bacteria | 29260 |
| 15 | JGI25165J46597_1000645 | 3300003214 | Bacteria | 28748 |
| 16 | rootH1_10025580 | 3300003323 | Bacteria | 2734 |
| 17 | Ga0055538_1000007 | 3300003751 | Bacteria | 399715 |
| 18 | Ga0055538_1000032 | 3300003751 | Bacteria | 199718 |
| 19 | Ga0055539_1000043 | 3300003752 | Bacteria | 199718 |
| 20 | Ga0055539_1000583 | 3300003752 | Bacteria | 10242 |
| 21 | Ga0055539_1001782 | 3300003752 | Bacteria | 3705 |
| 22 | Ga0055533_1000010 | 3300003756 | Bacteria | 491196 |
| 23 | Ga0055533_1000052 | 3300003756 | Bacteria | 199718 |
| 24 | Ga0055532_1000047 | 3300003758 | Bacteria | 179201 |
| 25 | Ga0055525_1000062 | 3300003759 | Bacteria | 199718 |
| 26 | Ga0055525_1000775 | 3300003759 | Bacteria | 10334 |
| 27 | Ga0055535_1000607 | 3300003761 | Bacteria | 29519 |
| 28 | Ga0055535_1000906 | 3300003761 | Bacteria | 20145 |
| 29 | Ga0055535_1004623 | 3300003761 | Bacteria | 3274 |
| 30 | Ga0055529_1000731 | 3300003763 | Bacteria | 21383 |
| 31 | Ga0055536_1001013 | 3300003781 | Bacteria | 17859 |
| 32 | Ga0055536_1004708 | 3300003781 | Bacteria | 6871 |
| 33 | Ga0055536_1004755 | 3300003781 | Bacteria | 6817 |
| 34 | Ga0055530_10000150 | 3300003791 | Bacteria | 63051 |
| 35 | Ga0055530_10001395 | 3300003791 | Bacteria | 17859 |
| 36 | Ga0055530_10004701 | 3300003791 | Bacteria | 6915 |
| 37 | Ga0055530_10009077 | 3300003791 | Bacteria | 3872 |
| 38 | Ga0055540_1000175 | 3300003792 | Bacteria | 63051 |
| 39 | Ga0055540_1002862 | 3300003792 | Bacteria | 8769 |
| 40 | Ga0055540_1003956 | 3300003792 | Bacteria | 6915 |
| 41 | Ga0055540_1007251 | 3300003792 | Bacteria | 4230 |
| 42 | Ga0055531_10008572 | 3300003794 | Bacteria | 5367 |
| 43 | Ga0055541_1000030 | 3300003841 | Bacteria | 199616 |
| 44 | Ga0058692_1001311 | 3300003856 | Bacteria | 9374 |
| 45 | Ga0065165_1000774 | 3300005262 | Bacteria | 43046 |
| 46 | Ga0065714_10003458 | 3300005288 | Bacteria | 7061 |
| 47 | Ga0065714_10008011 | 3300005288 | Bacteria | 4309 |
| 48 | Ga0065714_10019612 | 3300005288 | Bacteria | 1684 |
| 49 | Ga0065704_10071473 | 3300005289 | Bacteria | 11003 |
| 50 | Ga0065712_10000927 | 3300005290 | Bacteria | 7406 |
| 51 | Ga0065712_10069335 | 3300005290 | Bacteria | 7506 |
| 52 | Ga0065712_10072290 | 3300005290 | Bacteria | 4824 |
| 53 | Ga0065715_10002954 | 3300005293 | Bacteria | 7366 |
| 54 | Ga0070658_10136714 | 3300005327 | Bacteria | 2045 |
| 55 | Ga0070670_100001953 | 3300005331 | Bacteria | 16902 |
| 56 | Ga0070670_100210681 | 3300005331 | Bacteria | 1690 |
| 57 | Ga0068869_100053998 | 3300005334 | Bacteria | 2923 |
| 58 | Ga0070660_100097909 | 3300005339 | Bacteria | 2321 |
| 59 | Ga0070661_100001640 | 3300005344 | Bacteria | 15489 |
| 60 | Ga0070669_100002598 | 3300005353 | Bacteria | 13053 |
| 61 | Ga0070669_100011283 | 3300005353 | Bacteria | 6344 |
| 62 | Ga0070663_100034782 | 3300005455 | Bacteria | 3491 |
| 63 | Ga0070662_100008312 | 3300005457 | Bacteria | 6763 |
| 64 | Ga0070662_100078941 | 3300005457 | Bacteria | 2446 |
| 65 | Ga0068853_100000187 | 3300005539 | Bacteria | 43749 |
| 66 | Ga0070665_100078213 | 3300005548 | Bacteria | 3314 |
| 67 | Ga0068855_100052495 | 3300005563 | Bacteria | 4799 |
| 68 | Ga0070664_100001886 | 3300005564 | Bacteria | 16837 |
| 69 | Ga0068857_100024975 | 3300005577 | Bacteria | 5263 |
| 70 | Ga0068861_100040263 | 3300005719 | Bacteria | 3493 |
| 71 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 72 | Ga0075364_10154732 | 3300006051 | Bacteria | 1546 |
| 73 | Ga0075432_10007217 | 3300006058 | Bacteria | 3782 |
| 74 | Ga0075432_10009884 | 3300006058 | Bacteria | 3243 |
| 75 | Ga0075432_10015661 | 3300006058 | Bacteria | 2587 |
| 76 | Ga0075366_10001453 | 3300006195 | Bacteria | 11797 |
| 77 | Ga0075366_10006476 | 3300006195 | Bacteria | 6421 |
| 78 | Ga0075366_10006521 | 3300006195 | Bacteria | 6399 |
| 79 | Ga0075370_10016883 | 3300006353 | Bacteria | 3936 |
| 80 | Ga0075434_100203650 | 3300006871 | Unclassified | 1999 |
| 81 | Ga0099823_1000043 | 3300006944 | Bacteria | 60786 |
| 82 | Ga0099823_1000050 | 3300006944 | Bacteria | 57425 |
| 83 | Ga0099823_1022982 | 3300006944 | Bacteria | 5739 |
| 84 | Ga0099823_1063234 | 3300006944 | Bacteria | 1855 |
| 85 | Ga0079104_1001103 | 3300006946 | Bacteria | 19997 |
| 86 | Ga0079104_1003465 | 3300006946 | Bacteria | 7309 |
| 87 | Ga0099826_10004877 | 3300006948 | Bacteria | 9495 |
| 88 | Ga0105251_10000024 | 3300009011 | Bacteria | 133058 |
| 89 | Ga0105251_10002156 | 3300009011 | Bacteria | 15794 |
| 90 | Ga0105251_10004294 | 3300009011 | Bacteria | 9779 |
| 91 | Ga0105251_10015050 | 3300009011 | Bacteria | 4243 |
| 92 | Ga0105251_10018016 | 3300009011 | Bacteria | 3768 |
| 93 | Ga0105251_10018659 | 3300009011 | Bacteria | 3681 |
| 94 | Ga0105251_10054573 | 3300009011 | Bacteria | 1897 |
| 95 | Ga0105244_10000265 | 3300009036 | Bacteria | 52791 |
| 96 | Ga0105244_10000542 | 3300009036 | Bacteria | 33662 |
| 97 | Ga0105244_10007755 | 3300009036 | Bacteria | 6793 |
| 98 | Ga0105244_10014617 | 3300009036 | Bacteria | 4535 |
| 99 | Ga0105244_10018100 | 3300009036 | Bacteria | 3963 |
| 100 | Ga0105244_10025226 | 3300009036 | Bacteria | 3234 |
| 101 | Ga0105244_10028356 | 3300009036 | Bacteria | 3005 |
| 102 | Ga0105244_10080040 | 3300009036 | Bacteria | 1618 |
| 103 | Ga0105250_10001113 | 3300009092 | Bacteria | 15161 |
| 104 | Ga0105250_10012888 | 3300009092 | Bacteria | 3441 |
| 105 | Ga0105240_10072481 | 3300009093 | Bacteria | 4257 |
| 106 | Ga0111539_10344589 | 3300009094 | Bacteria | 1734 |
| 107 | Ga0105243_10001572 | 3300009148 | Bacteria | 19964 |
| 108 | Ga0105243_10001599 | 3300009148 | Bacteria | 19744 |
| 109 | Ga0105243_10011620 | 3300009148 | Bacteria | 6660 |
| 110 | Ga0105243_10052138 | 3300009148 | Bacteria | 3239 |
| 111 | Ga0105243_10125045 | 3300009148 | Bacteria | 2174 |
| 112 | Ga0105242_10001499 | 3300009176 | Bacteria | 18352 |
| 113 | Ga0105242_10194169 | 3300009176 | Bacteria | 1799 |
| 114 | Ga0105248_10007834 | 3300009177 | Bacteria | 11730 |
| 115 | Ga0105237_10010598 | 3300009545 | Bacteria | 9791 |
| 116 | Ga0105237_10111123 | 3300009545 | Bacteria | 2732 |
| 117 | Ga0105238_10170899 | 3300009551 | Bacteria | 2150 |
| 118 | Ga0105249_10007064 | 3300009553 | Bacteria | 9797 |
| 119 | Ga0105239_10025926 | 3300010375 | Bacteria | 6455 |
| 120 | Ga0105246_10002803 | 3300011119 | Bacteria | 10549 |
| 121 | Ga0105246_10007983 | 3300011119 | Bacteria | 6497 |
| 122 | Ga0105246_10011130 | 3300011119 | Bacteria | 5575 |
| 123 | Ga0157337_1000729 | 3300012483 | Bacteria | 1562 |
| 124 | Ga0157345_1000705 | 3300012498 | Bacteria | 2699 |
| 125 | Ga0157373_10013919 | 3300013100 | Bacteria | 5900 |
| 126 | Ga0157373_10033727 | 3300013100 | Bacteria | 3680 |
| 127 | Ga0157373_10047177 | 3300013100 | Bacteria | 3073 |
| 128 | Ga0157371_10001604 | 3300013102 | Bacteria | 23194 |
| 129 | Ga0157371_10013168 | 3300013102 | Bacteria | 6296 |
| 130 | Ga0157371_10013733 | 3300013102 | Bacteria | 6141 |
| 131 | Ga0157371_10038069 | 3300013102 | Bacteria | 3442 |
| 132 | Ga0157371_10043778 | 3300013102 | Bacteria | 3188 |
| 133 | Ga0157370_10003242 | 3300013104 | Bacteria | 19198 |
| 134 | Ga0157370_10003759 | 3300013104 | Bacteria | 17721 |
| 135 | Ga0157370_10063716 | 3300013104 | Bacteria | 3491 |
| 136 | Ga0157370_10069376 | 3300013104 | Bacteria | 3330 |
| 137 | Ga0157370_10084960 | 3300013104 | Bacteria | 2973 |
| 138 | Ga0157370_10135753 | 3300013104 | Bacteria | 2293 |
| 139 | Ga0157369_10030463 | 3300013105 | Bacteria | 5950 |
| 140 | Ga0157369_10043726 | 3300013105 | Bacteria | 4881 |
| 141 | Ga0157369_10055802 | 3300013105 | Bacteria | 4263 |
| 142 | Ga0157369_10122753 | 3300013105 | Bacteria | 2755 |
| 143 | Ga0157369_10166556 | 3300013105 | Bacteria | 2324 |
| 144 | Ga0157369_10301600 | 3300013105 | Bacteria | 1666 |
| 145 | Ga0163162_10030569 | 3300013306 | Bacteria | 5337 |
| 146 | Ga0157372_10015782 | 3300013307 | Bacteria | 8102 |
| 147 | Ga0157375_10152615 | 3300013308 | Bacteria | 2446 |
| 148 | Ga0157375_10256711 | 3300013308 | Bacteria | 1909 |
| 149 | Ga0182008_10006484 | 3300014497 | Bacteria | 6535 |
| 150 | Ga0182008_10007506 | 3300014497 | Bacteria | 6016 |
| 151 | Ga0157379_10070294 | 3300014968 | Bacteria | 3132 |
| 152 | Ga0182006_1003062 | 3300015261 | Bacteria | 8773 |
| 153 | Ga0182006_1012007 | 3300015261 | Bacteria | 3794 |
| 154 | Ga0182006_1030231 | 3300015261 | Bacteria | 2190 |
| 155 | Ga0182006_1052089 | 3300015261 | Bacteria | 1573 |
| 156 | Ga0182007_10002733 | 3300015262 | Bacteria | 8624 |
| 157 | Ga0182005_1002836 | 3300015265 | Bacteria | 6038 |
| 158 | Ga0182005_1003780 | 3300015265 | Bacteria | 5033 |
| 159 | Ga0182005_1008200 | 3300015265 | Bacteria | 3090 |
| 160 | Ga0163161_10089329 | 3300017792 | Bacteria | 2279 |
| 161 | Ga0163161_10093556 | 3300017792 | Bacteria | 2227 |
| 162 | Ga0213872_10000066 | 3300021361 | Bacteria | 93052 |
| 163 | Ga0213872_10000187 | 3300021361 | Bacteria | 55101 |
| 164 | Ga0213872_10062256 | 3300021361 | Bacteria | 1686 |
| 165 | Ga0209760_100027 | 3300025207 | Bacteria | 153290 |
| 166 | Ga0209760_100197 | 3300025207 | Bacteria | 29065 |
| 167 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 168 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 169 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 170 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 171 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 172 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 173 | Ga0209563_100049 | 3300025230 | Bacteria | 358472 |
| 174 | Ga0209563_101931 | 3300025230 | Bacteria | 5007 |
| 175 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 176 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 177 | Ga0207427_100280 | 3300025231 | Bacteria | 37213 |
| 178 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 179 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 180 | Ga0209437_101479 | 3300025233 | Bacteria | 5645 |
| 181 | Ga0209258_100163 | 3300025242 | Bacteria | 149677 |
| 182 | Ga0209258_100169 | 3300025242 | Bacteria | 145227 |
| 183 | Ga0209646_1000138 | 3300025246 | Bacteria | 114892 |
| 184 | Ga0209646_1000184 | 3300025246 | Bacteria | 78423 |
| 185 | Ga0209026_1000021 | 3300025250 | Bacteria | 375165 |
| 186 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 187 | Ga0209677_100145 | 3300025253 | Bacteria | 65577 |
| 188 | Ga0209677_100209 | 3300025253 | Bacteria | 45370 |
| 189 | Ga0209677_107310 | 3300025253 | Bacteria | 2376 |
| 190 | Ga0209759_1000025 | 3300025256 | Bacteria | 317082 |
| 191 | Ga0209759_1001401 | 3300025256 | Bacteria | 13807 |
| 192 | Ga0209759_1002119 | 3300025256 | Bacteria | 9190 |
| 193 | Ga0209759_1010090 | 3300025256 | Bacteria | 2794 |
| 194 | Ga0209759_1011333 | 3300025256 | Bacteria | 2542 |
| 195 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 196 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 197 | Ga0209455_1000059 | 3300025272 | Bacteria | 339995 |
| 198 | Ga0209673_1005874 | 3300025273 | Bacteria | 6071 |
| 199 | Ga0209675_1002099 | 3300025291 | Bacteria | 10560 |
| 200 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 201 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 202 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 203 | Ga0209676_1000617 | 3300025292 | Bacteria | 51959 |
| 204 | Ga0209676_1001192 | 3300025292 | Bacteria | 27932 |
| 205 | Ga0209676_1005922 | 3300025292 | Bacteria | 6193 |
| 206 | Ga0209676_1007365 | 3300025292 | Bacteria | 5181 |
| 207 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 208 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 209 | Ga0209050_1000374 | 3300025298 | Bacteria | 85298 |
| 210 | Ga0209050_1000518 | 3300025298 | Bacteria | 64332 |
| 211 | Ga0209050_1000647 | 3300025298 | Bacteria | 54000 |
| 212 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 213 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 214 | Ga0209051_1000881 | 3300025303 | Bacteria | 30220 |
| 215 | Ga0209051_1003155 | 3300025303 | Bacteria | 11068 |
| 216 | Ga0209051_1005236 | 3300025303 | Bacteria | 7659 |
| 217 | Ga0209257_1000069 | 3300025304 | Bacteria | 339826 |
| 218 | Ga0209257_1004945 | 3300025304 | Bacteria | 9776 |
| 219 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 220 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 221 | Ga0207696_1000050 | 3300025711 | Bacteria | 276983 |
| 222 | Ga0207696_1000105 | 3300025711 | Bacteria | 163421 |
| 223 | Ga0207696_1000156 | 3300025711 | Bacteria | 112840 |
| 224 | Ga0207696_1000541 | 3300025711 | Bacteria | 30663 |
| 225 | Ga0207696_1008940 | 3300025711 | Bacteria | 3772 |
| 226 | Ga0207696_1009541 | 3300025711 | Bacteria | 3614 |
| 227 | Ga0207696_1013612 | 3300025711 | Bacteria | 2824 |
| 228 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 229 | Ga0207655_1000202 | 3300025728 | Bacteria | 103907 |
| 230 | Ga0207655_1000216 | 3300025728 | Bacteria | 99551 |
| 231 | Ga0207655_1000295 | 3300025728 | Bacteria | 75367 |
| 232 | Ga0207655_1000388 | 3300025728 | Bacteria | 61513 |
| 233 | Ga0207655_1001189 | 3300025728 | Bacteria | 25183 |
| 234 | Ga0207655_1002393 | 3300025728 | Bacteria | 15296 |
| 235 | Ga0207655_1002424 | 3300025728 | Bacteria | 15154 |
| 236 | Ga0207655_1005954 | 3300025728 | Bacteria | 8168 |
| 237 | Ga0207655_1007793 | 3300025728 | Bacteria | 6900 |
| 238 | Ga0207655_1009633 | 3300025728 | Bacteria | 5976 |
| 239 | Ga0207655_1012780 | 3300025728 | Bacteria | 4869 |
| 240 | Ga0207655_1013044 | 3300025728 | Bacteria | 4798 |
| 241 | Ga0207655_1020188 | 3300025728 | Bacteria | 3437 |
| 242 | Ga0207655_1027790 | 3300025728 | Bacteria | 2684 |
| 243 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 244 | Ga0207713_1000077 | 3300025735 | Bacteria | 176517 |
| 245 | Ga0207713_1001506 | 3300025735 | Bacteria | 18410 |
| 246 | Ga0207713_1003359 | 3300025735 | Bacteria | 10976 |
| 247 | Ga0207713_1003953 | 3300025735 | Bacteria | 9846 |
| 248 | Ga0207713_1004110 | 3300025735 | Bacteria | 9590 |
| 249 | Ga0207713_1004772 | 3300025735 | Bacteria | 8713 |
| 250 | Ga0207713_1007874 | 3300025735 | Bacteria | 6211 |
| 251 | Ga0207713_1009206 | 3300025735 | Bacteria | 5593 |
| 252 | Ga0207713_1019128 | 3300025735 | Bacteria | 3363 |
| 253 | Ga0207713_1028390 | 3300025735 | Bacteria | 2525 |
| 254 | Ga0207705_10020837 | 3300025909 | Bacteria | 4680 |
| 255 | Ga0207671_10000131 | 3300025914 | Bacteria | 116866 |
| 256 | Ga0207657_10029841 | 3300025919 | Bacteria | 4957 |
| 257 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 258 | Ga0207681_10000099 | 3300025923 | Bacteria | 73220 |
| 259 | Ga0207681_10008578 | 3300025923 | Bacteria | 6242 |
| 260 | Ga0207650_10000157 | 3300025925 | Bacteria | 81959 |
| 261 | Ga0207650_10000185 | 3300025925 | Bacteria | 72385 |
| 262 | Ga0207650_10071195 | 3300025925 | Bacteria | 2615 |
| 263 | Ga0207690_10070448 | 3300025932 | Bacteria | 2409 |
| 264 | Ga0207706_10001069 | 3300025933 | Bacteria | 27808 |
| 265 | Ga0207706_10009625 | 3300025933 | Bacteria | 8870 |
| 266 | Ga0207686_10000319 | 3300025934 | Bacteria | 34615 |
| 267 | Ga0207709_10000071 | 3300025935 | Bacteria | 181156 |
| 268 | Ga0207709_10000337 | 3300025935 | Bacteria | 49221 |
| 269 | Ga0207709_10045241 | 3300025935 | Bacteria | 2664 |
| 270 | Ga0207709_10081986 | 3300025935 | Bacteria | 2081 |
| 271 | Ga0207711_10056958 | 3300025941 | Bacteria | 3359 |
| 272 | Ga0207689_10014227 | 3300025942 | Bacteria | 6771 |
| 273 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 274 | Ga0207667_10009539 | 3300025949 | Bacteria | 11420 |
| 275 | Ga0207712_10004516 | 3300025961 | Bacteria | 8788 |
| 276 | Ga0207640_10072216 | 3300025981 | Bacteria | 2327 |
| 277 | Ga0207677_10180154 | 3300026023 | Bacteria | 1661 |
| 278 | Ga0207639_10000775 | 3300026041 | Bacteria | 21763 |
| 279 | Ga0207678_10015659 | 3300026067 | Bacteria | 6665 |
| 280 | Ga0207702_10000800 | 3300026078 | Bacteria | 33369 |
| 281 | Ga0207674_10043460 | 3300026116 | Bacteria | 4633 |
| 282 | Ga0207675_100052490 | 3300026118 | Bacteria | 3804 |
| 283 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 284 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 285 | Ga0209281_1001944 | 3300027111 | Bacteria | 9656 |
| 286 | Ga0209389_1000017 | 3300027296 | Bacteria | 180543 |
| 287 | Ga0209389_1000053 | 3300027296 | Bacteria | 108874 |
| 288 | Ga0209389_1072180 | 3300027296 | Bacteria | 1862 |
| 289 | Ga0209371_1000032 | 3300027312 | Bacteria | 392355 |
| 290 | Ga0207428_10027106 | 3300027907 | Bacteria | 4772 |
| 291 | Ga0207428_10111895 | 3300027907 | Bacteria | 2101 |
| 292 | Ga0265336_10000006 | 3300028666 | Bacteria | 348453 |
| 293 | Ga0307515_10023444 | 3300028794 | Bacteria | 10813 |
| 294 | Ga0265324_10002529 | 3300029957 | Bacteria | 9267 |
| 295 | Ga0268256_1000050 | 3300030500 | Bacteria | 300675 |
| 296 | Ga0307511_10083198 | 3300030521 | Bacteria | 2231 |
| 297 | Ga0314311_1099326 | 3300030733 | Bacteria | 5378 |
| 298 | Ga0316178_1008333 | 3300030735 | Bacteria | 44288 |
| 299 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 300 | Ga0307408_100000077 | 3300031548 | Bacteria | 110022 |
| 301 | Ga0307408_100022947 | 3300031548 | Bacteria | 4246 |
| 302 | Ga0307408_100047222 | 3300031548 | Bacteria | 3082 |
| 303 | Ga0307514_10001133 | 3300031649 | Bacteria | 36650 |
| 304 | Ga0307516_10000878 | 3300031730 | Bacteria | 41335 |
| 305 | Ga0307405_10024462 | 3300031731 | Bacteria | 3450 |
| 306 | Ga0307409_100129357 | 3300031995 | Bacteria | 2154 |
| 307 | Ga0307416_100206385 | 3300032002 | Bacteria | 1869 |
| 308 | Ga0307414_10016650 | 3300032004 | Bacteria | 4475 |
| 309 | Ga0307414_10026324 | 3300032004 | Bacteria | 3743 |
| 310 | Ga0307411_10066333 | 3300032005 | Bacteria | 2424 |
| 311 | Ga0307510_10122871 | 3300033180 | Bacteria | 2294 |
| 312 | Ga0373937_0023779 | 3300036401 | Bacteria | 5524 |
| 313 | Ga0373937_0119750 | 3300036401 | Bacteria | 2453 |
| 314 | Ga0395905_0051786 | 3300037471 | Bacteria | 3845 |
| 315 | Ga0395901_0014533 | 3300038443 | Bacteria | 8005 |
| 316 | Ga0237819_01098 | 3300038705 | Bacteria | 7931 |
| 317 | Ga0436361_0313405 | 3300039447 | Bacteria | 87904 |
| 318 | Ga0436361_0525200 | 3300039447 | Bacteria | 11317 |
| 319 | Ga0436361_0857598 | 3300039447 | Bacteria | 5129 |
| 320 | Ga0436361_1024184 | 3300039447 | Bacteria | 85708 |
| 321 | Ga0439438_004878 | 3300041405 | Bacteria | 5035 |
| 322 | Ga0439438_006624 | 3300041405 | Bacteria | 4058 |
| 323 | Ga0439438_007901 | 3300041405 | Bacteria | 3587 |
| 324 | Ga0439447_003423 | 3300041407 | Bacteria | 5642 |
| 325 | Ga0439447_003817 | 3300041407 | Bacteria | 5289 |
| 326 | Ga0439447_008152 | 3300041407 | Bacteria | 3264 |
| 327 | Ga0439466_0000466 | 3300041411 | Bacteria | 15422 |
| 328 | Ga0439466_0002245 | 3300041411 | Bacteria | 7567 |
| 329 | Ga0439466_0003958 | 3300041411 | Bacteria | 5714 |
| 330 | Ga0439466_0017860 | 3300041411 | Bacteria | 2550 |
| 331 | Ga0439432_001621 | 3300042006 | Bacteria | 8420 |
| 332 | Ga0439432_005789 | 3300042006 | Bacteria | 4440 |
| 333 | Ga0439432_011624 | 3300042006 | Bacteria | 3032 |
| 334 | Ga0439432_019622 | 3300042006 | Bacteria | 2251 |
| 335 | Ga0439452_003753 | 3300042010 | Bacteria | 5231 |
| 336 | Ga0439452_004104 | 3300042010 | Bacteria | 4951 |
| 337 | Ga0439452_004757 | 3300042010 | Bacteria | 4487 |
| 338 | Ga0439452_005513 | 3300042010 | Bacteria | 4065 |
| 339 | Ga0439456_003040 | 3300042013 | Bacteria | 3389 |
| 340 | Ga0439456_010509 | 3300042013 | Bacteria | 1913 |
| 341 | Ga0439463_002333 | 3300042016 | Bacteria | 4842 |
| 342 | Ga0439463_002471 | 3300042016 | Bacteria | 4693 |
| 343 | Ga0450911_000027 | 3300042115 | Bacteria | 82476 |
| 344 | Ga0450911_000100 | 3300042115 | Bacteria | 34941 |
| 345 | Ga0450911_002622 | 3300042115 | Bacteria | 3457 |
| 346 | Ga0450890_000509 | 3300042127 | Bacteria | 5716 |
| 347 | Ga0450905_004727 | 3300042142 | Bacteria | 1813 |
| 348 | Ga0450907_001254 | 3300042146 | Bacteria | 5697 |
| 349 | Ga0450907_003651 | 3300042146 | Bacteria | 2719 |
| 350 | Ga0439446_0001826 | 3300042156 | Bacteria | 4980 |
| 351 | Ga0439446_0017545 | 3300042156 | Bacteria | 2001 |
| 352 | Ga0439434_0003416 | 3300042435 | Bacteria | 4641 |
| 353 | Ga0439459_0012881 | 3300042438 | Bacteria | 1496 |
| 354 | Ga0439464_0002231 | 3300042439 | Bacteria | 4739 |
| 355 | Ga0439460_0000875 | 3300042461 | Bacteria | 6881 |
| 356 | Ga0450916_000042 | 3300042530 | Bacteria | 6810 |
| 357 | Ga0451577_0164037 | 3300042876 | Bacteria | 2002 |
| 358 | Ga0466969_0009333 | 3300044656 | Bacteria | 5199 |
| 359 | Ga0466965_0000692 | 3300044683 | Bacteria | 12482 |
| 360 | Ga0466966_0005876 | 3300044684 | Bacteria | 8094 |
| 361 | Ga0466961_0015298 | 3300044693 | Bacteria | 4927 |
| 362 | Ga0466963_0057201 | 3300044694 | Bacteria | 2597 |
| 363 | Ga0466964_0001646 | 3300044706 | Bacteria | 7720 |
| 364 | Ga0453684_0012190 | 3300044712 | Bacteria | 14255 |
| 365 | Ga0453684_0012554 | 3300044712 | Bacteria | 13945 |
| 366 | Ga0466971_0006553 | 3300044719 | Bacteria | 5059 |
| 367 | Ga0466957_0002678 | 3300044842 | Bacteria | 9618 |
| 368 | Ga0466959_0003818 | 3300045049 | Bacteria | 9988 |
| 369 | Ga0466958_0031576 | 3300045836 | Bacteria | 3148 |
| 370 | Ga0466967_0058693 | 3300045976 | Bacteria | 3402 |
| 371 | Ga0495617_003398 | 3300046452 | Bacteria | 5999 |
| 372 | Ga0495617_019767 | 3300046452 | Bacteria | 2277 |
| 373 | Ga0495627_000102 | 3300046453 | Bacteria | 104889 |
| 374 | Ga0495627_004313 | 3300046453 | Bacteria | 5977 |
| 375 | Ga0495627_012419 | 3300046453 | Bacteria | 3022 |
| 376 | Ga0495590_0016101 | 3300046457 | Bacteria | 2704 |
| 377 | Ga0495591_000105 | 3300046458 | Bacteria | 97199 |
| 378 | Ga0495591_003166 | 3300046458 | Bacteria | 8682 |
| 379 | Ga0495591_004534 | 3300046458 | Bacteria | 6746 |
| 380 | Ga0495591_004959 | 3300046458 | Bacteria | 6303 |
| 381 | Ga0495591_006424 | 3300046458 | Bacteria | 5196 |
| 382 | Ga0495591_014983 | 3300046458 | Bacteria | 2757 |
| 383 | Ga0495591_015401 | 3300046458 | Bacteria | 2703 |
| 384 | Ga0495591_018892 | 3300046458 | Bacteria | 2324 |
| 385 | Ga0495651_0146508 | 3300046462 | Bacteria | 1706 |
| 386 | Ga0495653_0022923 | 3300046463 | Bacteria | 5049 |
| 387 | Ga0495653_0040147 | 3300046463 | Bacteria | 3659 |
| 388 | Ga0495653_0048713 | 3300046463 | Bacteria | 3269 |
| 389 | Ga0495650_0000578 | 3300046471 | Bacteria | 51315 |
| 390 | Ga0495650_0015211 | 3300046471 | Bacteria | 3956 |
| 391 | Ga0495650_0030023 | 3300046471 | Bacteria | 2469 |
| 392 | Ga0495650_0037793 | 3300046471 | Bacteria | 2097 |
| 393 | Ga0495605_0000590 | 3300046474 | Bacteria | 28966 |
| 394 | Ga0495605_0000625 | 3300046474 | Bacteria | 27283 |
| 395 | Ga0495605_0001226 | 3300046474 | Bacteria | 17066 |
| 396 | Ga0495605_0001398 | 3300046474 | Bacteria | 15876 |
| 397 | Ga0495605_0010112 | 3300046474 | Bacteria | 5284 |
| 398 | Ga0495605_0027479 | 3300046474 | Bacteria | 2947 |
| 399 | Ga0495605_0067345 | 3300046474 | Bacteria | 1699 |
| 400 | Ga0495639_0003111 | 3300046475 | Bacteria | 7214 |
| 401 | Ga0495584_0009566 | 3300046491 | Bacteria | 4993 |
| 402 | Ga0495584_0012700 | 3300046491 | Bacteria | 4298 |
| 403 | Ga0495584_0093849 | 3300046491 | Bacteria | 1514 |
| 404 | Ga0495585_0007063 | 3300046492 | Bacteria | 6904 |
| 405 | Ga0495585_0010687 | 3300046492 | Bacteria | 5452 |
| 406 | Ga0495585_0028569 | 3300046492 | Bacteria | 3180 |
| 407 | Ga0495585_0047158 | 3300046492 | Bacteria | 2400 |
| 408 | Ga0495596_0004395 | 3300046500 | Bacteria | 6880 |
| 409 | Ga0495607_0001133 | 3300046501 | Bacteria | 24182 |
| 410 | Ga0495607_0001267 | 3300046501 | Bacteria | 22574 |
| 411 | Ga0495607_0004588 | 3300046501 | Bacteria | 10120 |
| 412 | Ga0495607_0005049 | 3300046501 | Bacteria | 9572 |
| 413 | Ga0495607_0013525 | 3300046501 | Bacteria | 5346 |
| 414 | Ga0495607_0030626 | 3300046501 | Bacteria | 3302 |
| 415 | Ga0495607_0039997 | 3300046501 | Bacteria | 2795 |
| 416 | Ga0495607_0050428 | 3300046501 | Bacteria | 2422 |
| 417 | Ga0495583_0000015 | 3300046506 | Bacteria | 316392 |
| 418 | Ga0495583_0000927 | 3300046506 | Bacteria | 34448 |
| 419 | Ga0495583_0004981 | 3300046506 | Bacteria | 9213 |
| 420 | Ga0495583_0013180 | 3300046506 | Bacteria | 4627 |
| 421 | Ga0495583_0016105 | 3300046506 | Bacteria | 4036 |
| 422 | Ga0495583_0023578 | 3300046506 | Bacteria | 3110 |
| 423 | Ga0495583_0062515 | 3300046506 | Bacteria | 1658 |
| 424 | Ga0495606_0000083 | 3300046507 | Bacteria | 159263 |
| 425 | Ga0495606_0003050 | 3300046507 | Bacteria | 18259 |
| 426 | Ga0495606_0008185 | 3300046507 | Bacteria | 9147 |
| 427 | Ga0495606_0015235 | 3300046507 | Bacteria | 5936 |
| 428 | Ga0495606_0018166 | 3300046507 | Bacteria | 5285 |
| 429 | Ga0495610_0009929 | 3300046512 | Bacteria | 5954 |
| 430 | Ga0495610_0011079 | 3300046512 | Bacteria | 5538 |
| 431 | Ga0495616_0014738 | 3300046513 | Bacteria | 4365 |
| 432 | Ga0495620_0000171 | 3300046515 | Bacteria | 51260 |
| 433 | Ga0495620_0000229 | 3300046515 | Bacteria | 41859 |
| 434 | Ga0495620_0005486 | 3300046515 | Bacteria | 7069 |
| 435 | Ga0495620_0014267 | 3300046515 | Bacteria | 4042 |
| 436 | Ga0495631_0004242 | 3300046518 | Bacteria | 7670 |
| 437 | Ga0495631_0017782 | 3300046518 | Bacteria | 3356 |
| 438 | Ga0495632_0007443 | 3300046519 | Bacteria | 6876 |
| 439 | Ga0495632_0008782 | 3300046519 | Bacteria | 6156 |
| 440 | Ga0495632_0037321 | 3300046519 | Bacteria | 2466 |
| 441 | Ga0495632_0088007 | 3300046519 | Bacteria | 1475 |
| 442 | Ga0495637_0000271 | 3300046520 | Bacteria | 40891 |
| 443 | Ga0495637_0002084 | 3300046520 | Bacteria | 11247 |
| 444 | Ga0495637_0005947 | 3300046520 | Bacteria | 6169 |
| 445 | Ga0495637_0015531 | 3300046520 | Bacteria | 3571 |
| 446 | Ga0495637_0019714 | 3300046520 | Bacteria | 3114 |
| 447 | Ga0495637_0027237 | 3300046520 | Bacteria | 2559 |
| 448 | Ga0495643_0000345 | 3300046522 | Bacteria | 63090 |
| 449 | Ga0495643_0000627 | 3300046522 | Bacteria | 41961 |
| 450 | Ga0495643_0002030 | 3300046522 | Bacteria | 16840 |
| 451 | Ga0495643_0007948 | 3300046522 | Bacteria | 6763 |
| 452 | Ga0495643_0011277 | 3300046522 | Bacteria | 5453 |
| 453 | Ga0495643_0012620 | 3300046522 | Bacteria | 5089 |
| 454 | Ga0495643_0017811 | 3300046522 | Bacteria | 4143 |
| 455 | Ga0495643_0039455 | 3300046522 | Bacteria | 2582 |
| 456 | Ga0495644_0005075 | 3300046523 | Bacteria | 5152 |
| 457 | Ga0495648_0013922 | 3300046524 | Bacteria | 5922 |
| 458 | Ga0495648_0022554 | 3300046524 | Bacteria | 4331 |
| 459 | Ga0495648_0023818 | 3300046524 | Bacteria | 4182 |
| 460 | Ga0495648_0030158 | 3300046524 | Bacteria | 3590 |
| 461 | Ga0495648_0059154 | 3300046524 | Bacteria | 2287 |
| 462 | Ga0495642_0000631 | 3300046528 | Bacteria | 17653 |
| 463 | Ga0495642_0024565 | 3300046528 | Bacteria | 2384 |
| 464 | Ga0495654_0005941 | 3300046530 | Bacteria | 7014 |
| 465 | Ga0495654_0006795 | 3300046530 | Bacteria | 6459 |
| 466 | Ga0495654_0015100 | 3300046530 | Bacteria | 4104 |
| 467 | Ga0495654_0021575 | 3300046530 | Bacteria | 3349 |
| 468 | Ga0495586_0120780 | 3300046535 | Bacteria | 1464 |
| 469 | Ga0495587_0015762 | 3300046536 | Bacteria | 4712 |
| 470 | Ga0495609_0000023 | 3300046538 | Bacteria | 269702 |
| 471 | Ga0495609_0000458 | 3300046538 | Bacteria | 33250 |
| 472 | Ga0495609_0000759 | 3300046538 | Bacteria | 24242 |
| 473 | Ga0495609_0003174 | 3300046538 | Bacteria | 9560 |
| 474 | Ga0495597_0000221 | 3300046542 | Bacteria | 52360 |
| 475 | Ga0495597_0005155 | 3300046542 | Bacteria | 6962 |
| 476 | Ga0495622_0002873 | 3300046557 | Bacteria | 8224 |
| 477 | Ga0495633_0000115 | 3300046558 | Bacteria | 108676 |
| 478 | Ga0495656_0003150 | 3300046615 | Bacteria | 5551 |
| 479 | Ga0495668_0009606 | 3300046616 | Bacteria | 5919 |
| 480 | Ga0495668_0018591 | 3300046616 | Bacteria | 4015 |
| 481 | Ga0495668_0058209 | 3300046616 | Bacteria | 2133 |
| 482 | Ga0495668_0107117 | 3300046616 | Bacteria | 1528 |
| 483 | Ga0495634_0019357 | 3300046642 | Bacteria | 4838 |
| 484 | Ga0495611_0000749 | 3300046648 | Bacteria | 18315 |
| 485 | Ga0495611_0003126 | 3300046648 | Bacteria | 7342 |
| 486 | Ga0495611_0046839 | 3300046648 | Bacteria | 1939 |
| 487 | Ga0495625_0000187 | 3300046660 | Bacteria | 97797 |
| 488 | Ga0495635_0020678 | 3300046663 | Bacteria | 4584 |
| 489 | Ga0495661_0000061 | 3300046665 | Bacteria | 130811 |
| 490 | Ga0495661_0000865 | 3300046665 | Bacteria | 28200 |
| 491 | Ga0495661_0002054 | 3300046665 | Bacteria | 15804 |
| 492 | Ga0495661_0002403 | 3300046665 | Bacteria | 14449 |
| 493 | Ga0495661_0019070 | 3300046665 | Bacteria | 4499 |
| 494 | Ga0495661_0079958 | 3300046665 | Bacteria | 1888 |
| 495 | Ga0495623_0022811 | 3300046679 | Bacteria | 4041 |
| 496 | Ga0495670_0004412 | 3300046691 | Bacteria | 6902 |
| 497 | Ga0495671_0005463 | 3300046692 | Bacteria | 7438 |
| 498 | Ga0495671_0009031 | 3300046692 | Bacteria | 5594 |
| 499 | Ga0495671_0011710 | 3300046692 | Bacteria | 4809 |
| 500 | Ga0495671_0024764 | 3300046692 | Bacteria | 3122 |
| 501 | Ga0495649_0000464 | 3300046694 | Bacteria | 34868 |
| 502 | Ga0495649_0004778 | 3300046694 | Bacteria | 8776 |
| 503 | Ga0495649_0008513 | 3300046694 | Bacteria | 6166 |
| 504 | Ga0495649_0009795 | 3300046694 | Bacteria | 5673 |
| 505 | Ga0495649_0023432 | 3300046694 | Bacteria | 3449 |
| 506 | Ga0495589_0008703 | 3300046794 | Bacteria | 5286 |
| 507 | Ga0495589_0010021 | 3300046794 | Bacteria | 4923 |
| 508 | Ga0495589_0012850 | 3300046794 | Bacteria | 4328 |
| 509 | Ga0495589_0052557 | 3300046794 | Bacteria | 2012 |
| 510 | Ga0495600_0003343 | 3300046809 | Bacteria | 9426 |
| 511 | Ga0495660_0000831 | 3300046810 | Bacteria | 22952 |
| 512 | Ga0495660_0026271 | 3300046810 | Bacteria | 3301 |
| 513 | Ga0495660_0045243 | 3300046810 | Bacteria | 2417 |
| 514 | Ga0495636_0010451 | 3300047318 | Bacteria | 3666 |
| 515 | Ga0495672_0012072 | 3300047320 | Bacteria | 6048 |
| 516 | Ga0495672_0036083 | 3300047320 | Bacteria | 3038 |
| 517 | Ga0495672_0036806 | 3300047320 | Bacteria | 3002 |
| 518 | Ga0495672_0090366 | 3300047320 | Bacteria | 1683 |
| 519 | Ga0495676_0000011 | 3300047321 | Bacteria | 242612 |
| 520 | Ga0495676_0040008 | 3300047321 | Bacteria | 3874 |
| 521 | Ga0495680_0014977 | 3300047322 | Bacteria | 6697 |
| 522 | Ga0495680_0094802 | 3300047322 | Bacteria | 2232 |
| 523 | Ga0495683_0000106 | 3300047323 | Bacteria | 86579 |
| 524 | Ga0495683_0000207 | 3300047323 | Bacteria | 55998 |
| 525 | Ga0495683_0007048 | 3300047323 | Bacteria | 6100 |
| 526 | Ga0495683_0008997 | 3300047323 | Bacteria | 5328 |
| 527 | Ga0495683_0012111 | 3300047323 | Bacteria | 4533 |
| 528 | Ga0495687_007653 | 3300047443 | Bacteria | 6321 |
| 529 | Ga0495679_000274 | 3300047446 | Bacteria | 43056 |
| 530 | Ga0495679_000704 | 3300047446 | Bacteria | 21744 |
| 531 | Ga0495673_0001682 | 3300047469 | Bacteria | 16994 |
| 532 | Ga0495673_0005616 | 3300047469 | Bacteria | 7542 |
| 533 | Ga0495673_0007829 | 3300047469 | Bacteria | 6080 |
| 534 | Ga0495673_0010604 | 3300047469 | Bacteria | 5001 |
| 535 | Ga0495673_0014010 | 3300047469 | Bacteria | 4185 |
| 536 | Ga0495681_0012867 | 3300047470 | Bacteria | 4892 |
| 537 | Ga0495681_0018926 | 3300047470 | Bacteria | 3777 |
| 538 | Ga0495686_0003059 | 3300047472 | Bacteria | 14830 |
| 539 | Ga0495686_0075073 | 3300047472 | Bacteria | 2073 |
| 540 | Ga0495593_0014851 | 3300047673 | Bacteria | 4423 |
| 541 | Ga0495626_0000068 | 3300048091 | Bacteria | 139126 |
| 542 | Ga0495626_0005680 | 3300048091 | Bacteria | 7222 |
| 543 | Ga0495626_0007093 | 3300048091 | Bacteria | 6278 |
| 544 | Ga0495626_0008893 | 3300048091 | Bacteria | 5455 |
| 545 | Ga0496102_0026312 | 3300048905 | Bacteria | 5188 |
| 546 | Ga0496110_0019824 | 3300048913 | Bacteria | 5668 |
| 547 | Ga0496114_0005705 | 3300048917 | Bacteria | 9760 |
| 548 | Ga0496114_0103367 | 3300048917 | Bacteria | 2435 |
| 549 | Ga0496116_0008830 | 3300048919 | Bacteria | 8682 |
| 550 | Ga0496116_0018636 | 3300048919 | Bacteria | 5341 |
| 551 | Ga0496116_0021869 | 3300048919 | Bacteria | 4811 |
| 552 | Ga0496117_0000961 | 3300048920 | Bacteria | 44128 |
| 553 | Ga0496117_0018385 | 3300048920 | Bacteria | 5789 |
| 554 | Ga0496117_0038087 | 3300048920 | Bacteria | 3572 |
| 555 | Ga0496117_0039315 | 3300048920 | Bacteria | 3493 |
| 556 | Ga0496117_0060179 | 3300048920 | Bacteria | 2619 |
| 557 | Ga0496118_0014197 | 3300048921 | Bacteria | 7469 |
| 558 | Ga0496118_0016655 | 3300048921 | Bacteria | 6735 |
| 559 | Ga0496118_0023180 | 3300048921 | Bacteria | 5400 |
| 560 | Ga0496118_0068461 | 3300048921 | Bacteria | 2578 |
| 561 | Ga0496119_0004034 | 3300048922 | Bacteria | 14828 |
| 562 | Ga0496120_0003119 | 3300048923 | Bacteria | 15545 |
| 563 | Ga0496121_0011294 | 3300048924 | Bacteria | 9945 |
| 564 | Ga0496121_0013055 | 3300048924 | Bacteria | 8970 |
| 565 | Ga0496121_0020706 | 3300048924 | Bacteria | 6490 |
| 566 | Ga0496121_0021850 | 3300048924 | Bacteria | 6248 |
| 567 | Ga0496122_0001707 | 3300048925 | Bacteria | 34056 |
| 568 | Ga0496122_0002086 | 3300048925 | Bacteria | 29621 |
| 569 | Ga0496122_0004723 | 3300048925 | Bacteria | 16722 |
| 570 | Ga0496122_0006443 | 3300048925 | Bacteria | 13471 |
| 571 | Ga0496122_0019987 | 3300048925 | Bacteria | 6087 |
| 572 | Ga0496122_0074921 | 3300048925 | Bacteria | 2391 |
| 573 | Ga0496123_0000178 | 3300048926 | Bacteria | 128587 |
| 574 | Ga0496123_0000445 | 3300048926 | Bacteria | 74126 |
| 575 | Ga0496123_0000607 | 3300048926 | Bacteria | 60365 |
| 576 | Ga0496123_0037585 | 3300048926 | Bacteria | 3417 |
| 577 | Ga0496123_0042041 | 3300048926 | Bacteria | 3160 |
| 578 | Ga0496123_0057209 | 3300048926 | Bacteria | 2540 |
| 579 | Ga0496124_0000073 | 3300048927 | Bacteria | 219306 |
| 580 | Ga0496124_0004545 | 3300048927 | Bacteria | 16148 |
| 581 | Ga0496124_0019279 | 3300048927 | Bacteria | 6356 |
| 582 | Ga0496124_0022258 | 3300048927 | Bacteria | 5817 |
| 583 | Ga0496124_0033513 | 3300048927 | Bacteria | 4518 |
| 584 | Ga0496125_0011967 | 3300048928 | Bacteria | 8639 |
| 585 | Ga0496125_0012388 | 3300048928 | Bacteria | 8469 |
| 586 | Ga0496125_0103660 | 3300048928 | Bacteria | 2086 |
| 587 | Ga0496125_0123922 | 3300048928 | Bacteria | 1836 |
| 588 | Ga0496126_0039798 | 3300048929 | Bacteria | 4359 |
| 589 | Ga0496126_0097773 | 3300048929 | Bacteria | 2572 |
| 590 | Ga0496126_0178237 | 3300048929 | Bacteria | 1807 |
| 591 | Ga0495678_000017 | 3300049459 | Bacteria | 282592 |
| 592 | Ga0495678_000404 | 3300049459 | Bacteria | 43644 |
| 593 | Ga0495678_006385 | 3300049459 | Bacteria | 6285 |
| 594 | Ga0495678_015394 | 3300049459 | Bacteria | 3518 |
| 595 | Ga0495678_015771 | 3300049459 | Bacteria | 3469 |
| 596 | Ga0495682_0000054 | 3300049460 | Bacteria | 104787 |
| 597 | Ga0495682_0000124 | 3300049460 | Bacteria | 67600 |
| 598 | Ga0495682_0007005 | 3300049460 | Bacteria | 4518 |
| 599 | Ga0501033_0073415 | 3300049570 | Bacteria | 2512 |
| 600 | Ga0501034_0000143 | 3300049571 | Bacteria | 133317 |
| 601 | Ga0501034_0000200 | 3300049571 | Bacteria | 113556 |
| 602 | Ga0501039_0028547 | 3300049575 | Bacteria | 4295 |
| 603 | Ga0501040_0027158 | 3300049576 | Bacteria | 3852 |
| 604 | Ga0501072_0044165 | 3300049588 | Bacteria | 3504 |
| 605 | Ga0501075_0010316 | 3300049591 | Bacteria | 6564 |
| 606 | Ga0501076_0000757 | 3300049592 | Bacteria | 20885 |
| 607 | Ga0501222_005362 | 3300049662 | Bacteria | 1732 |
| 608 | Ga0501079_0001187 | 3300049741 | Bacteria | 18244 |
| 609 | Ga0501080_0080217 | 3300049742 | Bacteria | 3033 |
| 610 | Ga0501081_0000552 | 3300049743 | Bacteria | 21253 |
| 611 | Ga0501083_0075748 | 3300049744 | Bacteria | 2234 |
| 612 | Ga0501241_008201 | 3300049758 | Bacteria | 1910 |
| 613 | Ga0501226_000001 | 3300049853 | Bacteria | 432595 |
| 614 | nmdc:mga0k408_1301_c1 | 3300050493 | Bacteria | 13499 |
| 615 | nmdc:mga0k408_41573_c1 | 3300050493 | Bacteria | 2647 |
| 616 | nmdc:mga07m45_3438_c1 | 3300050496 | Bacteria | 3093 |
| 617 | nmdc:mga07m45_4618_c1 | 3300050496 | Bacteria | 6752 |
| 618 | nmdc:mga05p37_41370_c1 | 3300050507 | Bacteria | 5658 |
| 619 | Ga0500635_0000017 | 3300053080 | Bacteria | 113720 |
| 620 | Ga0500635_0013483 | 3300053080 | Bacteria | 2375 |
| 621 | Ga0500578_0000683 | 3300053086 | Bacteria | 40592 |
| 622 | Ga0500652_000930 | 3300053131 | Bacteria | 9670 |
| 623 | Ga0500659_0003436 | 3300053135 | Bacteria | 9256 |
| 624 | Ga0500559_0010928 | 3300053136 | Bacteria | 3889 |
| 625 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 626 | Ga0500622_0000028 | 3300053156 | Bacteria | 218994 |
| 627 | Ga0500636_0045507 | 3300053177 | Bacteria | 2588 |
| 628 | Ga0466962_0001425 | 3300061719 | Bacteria | 11134 |
| 629 | Ga0530510_0009039 | 3300061734 | Bacteria | 6983 |
| 630 | Ga0530510_0010256 | 3300061734 | Bacteria | 6564 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046535 | Ga0495586_0120780 | Ga0495586_0120780_290_1426 | 367 |
| 2 | 3300048928 | Ga0496125_0103660 | Ga0496125_0103660_641_1819 | 392 |
| 3 | 3300046491 | Ga0495584_0093849 | Ga0495584_0093849_296_1501 | 395 |
| 4 | 3300046506 | Ga0495583_0023578 | Ga0495583_0023578_1903_3099 | 398 |
| 5 | 3300006871 | Ga0075434_100203650 | Ga0075434_1002036502 | 435 |
| 6 | 3300039447 | Ga0436361_0313405 | Ga0436361_0313405_18332_19660 | 435 |
| 7 | 3300036401 | Ga0373937_0119750 | Ga0373937_0119750_409_1761 | 436 |
| 8 | 3300009094 | Ga0111539_10344589 | Ga0111539_103445892 | 443 |
| 9 | 3300050507 | nmdc:mga05p37_41370_c1 | nmdc:mga05p37_41370_c1_2576_3961 | 443 |
| 10 | iso_pu_bacteria | 2946006987 | 2946013297 | 443 |
| 11 | iso_pu_bacteria | 2923525760 | 2923526223 | 447 |
| 12 | 3300037471 | Ga0395905_0051786 | Ga0395905_0051786_69_1439 | 448 |
| 13 | iso_pu_bacteria | 2511231024 | 2511375692 | 448 |
| 14 | iso_pu_bacteria | 2554235231 | 2555245930 | 448 |
| 15 | iso_pu_bacteria | 2738543020 | 2739285133 | 448 |
| 16 | iso_pu_bacteria | 2738543021 | 2739290447 | 448 |
| 17 | iso_pu_bacteria | 2842805378 | 2842806224 | 448 |
| 18 | iso_pu_bacteria | 2912963787 | 2912968885 | 448 |
| 19 | iso_pu_bacteria | 2939651529 | 2939654226 | 448 |
| 20 | iso_pu_bacteria | 3007803356 | 3007803577 | 448 |
| 21 | iso_pu_bacteria | 8052494512 | 8052496366 | 448 |
| 22 | iso_pu_bacteria | 8056125926 | 8056131593 | 448 |
| 23 | 3300003751 | Ga0055538_1000007 | Ga0055538_1000007134 | 449 |
| 24 | 3300009011 | Ga0105251_10002156 | Ga0105251_100021569 | 449 |
| 25 | 3300048913 | Ga0496110_0019824 | Ga0496110_0019824_2483_3877 | 449 |
| 26 | 3300049570 | Ga0501033_0073415 | Ga0501033_0073415_35_1399 | 449 |
| 27 | 3300049575 | Ga0501039_0028547 | Ga0501039_0028547_496_1860 | 449 |
| 28 | 3300049576 | Ga0501040_0027158 | Ga0501040_0027158_2091_3455 | 449 |
| 29 | 3300049588 | Ga0501072_0044165 | Ga0501072_0044165_2103_3467 | 449 |
| 30 | 3300049591 | Ga0501075_0010316 | Ga0501075_0010316_4273_5637 | 449 |
| 31 | 3300049592 | Ga0501076_0000757 | Ga0501076_0000757_609_1973 | 449 |
| 32 | 3300049741 | Ga0501079_0001187 | Ga0501079_0001187_3715_5079 | 449 |
| 33 | 3300049742 | Ga0501080_0080217 | Ga0501080_0080217_1301_2665 | 449 |
| 34 | 3300049743 | Ga0501081_0000552 | Ga0501081_0000552_12659_14023 | 449 |
| 35 | 3300049744 | Ga0501083_0075748 | Ga0501083_0075748_401_1765 | 449 |
| 36 | 3300053156 | Ga0500622_0000001 | Ga0500622_0000001_272403_273797 | 449 |
| 37 | 3300061734 | Ga0530510_0009039 | Ga0530510_0009039_2895_4259 | 449 |
| 38 | iso_pu_bacteria | 2765235841 | 2765581401 | 449 |
| 39 | iso_pu_bacteria | 2919155634 | 2919155905 | 449 |
| 40 | iso_pu_bacteria | 2919501602 | 2919502463 | 449 |
| 41 | iso_pu_bacteria | 2926063275 | 2926064136 | 449 |
| 42 | iso_pu_bacteria | 8052494512 | 8052494845 | 449 |
| 43 | 3300005455 | Ga0070663_100034782 | Ga0070663_1000347822 | 450 |
| 44 | 3300026067 | Ga0207678_10015659 | Ga0207678_100156594 | 450 |
| 45 | iso_pu_bacteria | 2511231004 | 2511254009 | 450 |
| 46 | iso_pu_bacteria | 2511231006 | 2511266851 | 450 |
| 47 | iso_pu_bacteria | 2511231007 | 2511272443 | 450 |
| 48 | iso_pu_bacteria | 2511231008 | 2511275102 | 450 |
| 49 | iso_pu_bacteria | 2511231010 | 2511289394 | 450 |
| 50 | iso_pu_bacteria | 2511231011 | 2511297762 | 450 |
| 51 | iso_pu_bacteria | 2511231012 | 2511302826 | 450 |
| 52 | iso_pu_bacteria | 2511231014 | 2511314420 | 450 |
| 53 | iso_pu_bacteria | 2511231015 | 2511317222 | 450 |
| 54 | iso_pu_bacteria | 2511231016 | 2511328020 | 450 |
| 55 | iso_pu_bacteria | 2511231017 | 2511329659 | 450 |
| 56 | iso_pu_bacteria | 2511231018 | 2511336844 | 450 |
| 57 | iso_pu_bacteria | 2511231019 | 2511344807 | 450 |
| 58 | iso_pu_bacteria | 2511231020 | 2511349570 | 450 |
| 59 | iso_pu_bacteria | 2511231021 | 2511359298 | 450 |
| 60 | iso_pu_bacteria | 2511231022 | 2511360908 | 450 |
| 61 | iso_pu_bacteria | 2511231023 | 2511370984 | 450 |
| 62 | iso_pu_bacteria | 2511231031 | 2511413476 | 450 |
| 63 | iso_pu_bacteria | 2511231156 | 2511827624 | 450 |
| 64 | iso_pu_bacteria | 2512047018 | 2512329503 | 450 |
| 65 | iso_pu_bacteria | 2554235341 | 2555672825 | 450 |
| 66 | iso_pu_bacteria | 2582580891 | 2583795735 | 450 |
| 67 | iso_pu_bacteria | 2585428057 | 2587729511 | 450 |
| 68 | iso_pu_bacteria | 2585428058 | 2587733974 | 450 |
| 69 | iso_pu_bacteria | 2588253510 | 2588294591 | 450 |
| 70 | iso_pu_bacteria | 2597489887 | 2597860869 | 450 |
| 71 | iso_pu_bacteria | 2597489888 | 2597866619 | 450 |
| 72 | iso_pu_bacteria | 2597489889 | 2597872475 | 450 |
| 73 | iso_pu_bacteria | 2599185155 | 2599331154 | 450 |
| 74 | iso_pu_bacteria | 2599185160 | 2599355971 | 450 |
| 75 | iso_pu_bacteria | 2599185161 | 2599362627 | 450 |
| 76 | iso_pu_bacteria | 2599185162 | 2599369067 | 450 |
| 77 | iso_pu_bacteria | 2599185163 | 2599375736 | 450 |
| 78 | iso_pu_bacteria | 2599185164 | 2599381077 | 450 |
| 79 | iso_pu_bacteria | 2599185165 | 2599387407 | 450 |
| 80 | iso_pu_bacteria | 2599185166 | 2599394594 | 450 |
| 81 | iso_pu_bacteria | 2599185167 | 2599400550 | 450 |
| 82 | iso_pu_bacteria | 2599185168 | 2599406359 | 450 |
| 83 | iso_pu_bacteria | 2599185179 | 2599449874 | 450 |
| 84 | iso_pu_bacteria | 2599185181 | 2599462805 | 450 |
| 85 | iso_pu_bacteria | 2599185182 | 2599467772 | 450 |
| 86 | iso_pu_bacteria | 2599185185 | 2599485895 | 450 |
| 87 | iso_pu_bacteria | 2599185186 | 2599491822 | 450 |
| 88 | iso_pu_bacteria | 2599185188 | 2599500250 | 450 |
| 89 | iso_pu_bacteria | 2599185189 | 2599505741 | 450 |
| 90 | iso_pu_bacteria | 2599185190 | 2599511948 | 450 |
| 91 | iso_pu_bacteria | 2599185191 | 2599516932 | 450 |
| 92 | iso_pu_bacteria | 2599185212 | 2599614419 | 450 |
| 93 | iso_pu_bacteria | 2599185248 | 2599768162 | 450 |
| 94 | iso_pu_bacteria | 2599185257 | 2599804677 | 450 |
| 95 | iso_pu_bacteria | 2599185288 | 2599879026 | 450 |
| 96 | iso_pu_bacteria | 2599185289 | 2599885597 | 450 |
| 97 | iso_pu_bacteria | 2599185290 | 2599892690 | 450 |
| 98 | iso_pu_bacteria | 2599185291 | 2599897311 | 450 |
| 99 | iso_pu_bacteria | 2599185300 | 2599930720 | 450 |
| 100 | iso_pu_bacteria | 2599185302 | 2599942359 | 450 |
| 101 | iso_pu_bacteria | 2599185303 | 2599951440 | 450 |
| 102 | iso_pu_bacteria | 2599185304 | 2599954228 | 450 |
| 103 | iso_pu_bacteria | 2599185305 | 2599961901 | 450 |
| 104 | iso_pu_bacteria | 2599185306 | 2599965927 | 450 |
| 105 | iso_pu_bacteria | 2599185307 | 2599972217 | 450 |
| 106 | iso_pu_bacteria | 2599185308 | 2599980890 | 450 |
| 107 | iso_pu_bacteria | 2599185309 | 2599982929 | 450 |
| 108 | iso_pu_bacteria | 2599185310 | 2599988321 | 450 |
| 109 | iso_pu_bacteria | 2599185311 | 2599993980 | 450 |
| 110 | iso_pu_bacteria | 2599185312 | 2599999115 | 450 |
| 111 | iso_pu_bacteria | 2599185313 | 2600004325 | 450 |
| 112 | iso_pu_bacteria | 2599185314 | 2600014766 | 450 |
| 113 | iso_pu_bacteria | 2599185315 | 2600020386 | 450 |
| 114 | iso_pu_bacteria | 2599185316 | 2600026350 | 450 |
| 115 | iso_pu_bacteria | 2599185317 | 2600032100 | 450 |
| 116 | iso_pu_bacteria | 2599185318 | 2600035963 | 450 |
| 117 | iso_pu_bacteria | 2599185319 | 2600042327 | 450 |
| 118 | iso_pu_bacteria | 2599185320 | 2600046646 | 450 |
| 119 | iso_pu_bacteria | 2599185321 | 2600054936 | 450 |
| 120 | iso_pu_bacteria | 2599185322 | 2600061037 | 450 |
| 121 | iso_pu_bacteria | 2599185323 | 2600066379 | 450 |
| 122 | iso_pu_bacteria | 2599185324 | 2600074377 | 450 |
| 123 | iso_pu_bacteria | 2599185325 | 2600076549 | 450 |
| 124 | iso_pu_bacteria | 2599185356 | 2600215431 | 450 |
| 125 | iso_pu_bacteria | 2600254930 | 2600359003 | 450 |
| 126 | iso_pu_bacteria | 2600254931 | 2600363559 | 450 |
| 127 | iso_pu_bacteria | 2600255283 | 2601627300 | 450 |
| 128 | iso_pu_bacteria | 2600255296 | 2601693456 | 450 |
| 129 | iso_pu_bacteria | 2600255313 | 2601775597 | 450 |
| 130 | iso_pu_bacteria | 2600255318 | 2601798571 | 450 |
| 131 | iso_pu_bacteria | 2603880185 | 2606077465 | 450 |
| 132 | iso_pu_bacteria | 2603880199 | 2606129289 | 450 |
| 133 | iso_pu_bacteria | 2619619299 | 2621296857 | 450 |
| 134 | iso_pu_bacteria | 2623620443 | 2624483401 | 450 |
| 135 | iso_pu_bacteria | 2623620446 | 2624494921 | 450 |
| 136 | iso_pu_bacteria | 2643221565 | 2643842952 | 450 |
| 137 | iso_pu_bacteria | 2643221571 | 2643872253 | 450 |
| 138 | iso_pu_bacteria | 2643221589 | 2643955645 | 450 |
| 139 | iso_pu_bacteria | 2643221592 | 2643969636 | 450 |
| 140 | iso_pu_bacteria | 2643221602 | 2644020439 | 450 |
| 141 | iso_pu_bacteria | 2643221625 | 2644143936 | 450 |
| 142 | iso_pu_bacteria | 2643221633 | 2644184494 | 450 |
| 143 | iso_pu_bacteria | 2643221648 | 2644276357 | 450 |
| 144 | iso_pu_bacteria | 2643221650 | 2644283239 | 450 |
| 145 | iso_pu_bacteria | 2643221713 | 2644620156 | 450 |
| 146 | iso_pu_bacteria | 2651869719 | 2652544923 | 450 |
| 147 | iso_pu_bacteria | 2667528170 | 2671089539 | 450 |
| 148 | iso_pu_bacteria | 2667528171 | 2671099267 | 450 |
| 149 | iso_pu_bacteria | 2667528176 | 2671128595 | 450 |
| 150 | iso_pu_bacteria | 2671180172 | 2671771684 | 450 |
| 151 | iso_pu_bacteria | 2675903420 | 2677897119 | 450 |
| 152 | iso_pu_bacteria | 2675903515 | 2678266137 | 450 |
| 153 | iso_pu_bacteria | 2713897148 | 2715749842 | 450 |
| 154 | iso_pu_bacteria | 2713897149 | 2715754858 | 450 |
| 155 | iso_pu_bacteria | 2718217725 | 2718636602 | 450 |
| 156 | iso_pu_bacteria | 2721755607 | 2723251355 | 450 |
| 157 | iso_pu_bacteria | 2738541265 | 2738671677 | 450 |
| 158 | iso_pu_bacteria | 2738541271 | 2738691946 | 450 |
| 159 | iso_pu_bacteria | 2738541282 | 2738750071 | 450 |
| 160 | iso_pu_bacteria | 2738541294 | 2738807242 | 450 |
| 161 | iso_pu_bacteria | 2738541303 | 2738859111 | 450 |
| 162 | iso_pu_bacteria | 2738541309 | 2738894602 | 450 |
| 163 | iso_pu_bacteria | 2738543004 | 2739199047 | 450 |
| 164 | iso_pu_bacteria | 2738543015 | 2739258988 | 450 |
| 165 | iso_pu_bacteria | 2738543016 | 2739263304 | 450 |
| 166 | iso_pu_bacteria | 2738543020 | 2739289617 | 450 |
| 167 | iso_pu_bacteria | 2738543021 | 2739294929 | 450 |
| 168 | iso_pu_bacteria | 2738543025 | 2739312517 | 450 |
| 169 | iso_pu_bacteria | 2740892503 | 2743740411 | 450 |
| 170 | iso_pu_bacteria | 2744054620 | 2745007369 | 450 |
| 171 | iso_pu_bacteria | 2773857670 | 2774118389 | 450 |
| 172 | iso_pu_bacteria | 2773857673 | 2774135579 | 450 |
| 173 | iso_pu_bacteria | 2784132063 | 2784261830 | 450 |
| 174 | iso_pu_bacteria | 2784132072 | 2784313563 | 450 |
| 175 | iso_pu_bacteria | 2791355520 | 2794593850 | 450 |
| 176 | iso_pu_bacteria | 2808606361 | 2808855706 | 450 |
| 177 | iso_pu_bacteria | 2808606376 | 2808926499 | 450 |
| 178 | iso_pu_bacteria | 2808606377 | 2808928454 | 450 |
| 179 | iso_pu_bacteria | 2808606378 | 2808935457 | 450 |
| 180 | iso_pu_bacteria | 2808606380 | 2808948660 | 450 |
| 181 | iso_pu_bacteria | 2808606381 | 2808950363 | 450 |
| 182 | iso_pu_bacteria | 2808606382 | 2808959855 | 450 |
| 183 | iso_pu_bacteria | 2808606383 | 2808964065 | 450 |
| 184 | iso_pu_bacteria | 2808606385 | 2808976138 | 450 |
| 185 | iso_pu_bacteria | 2808606388 | 2808993238 | 450 |
| 186 | iso_pu_bacteria | 2808606389 | 2808999099 | 450 |
| 187 | iso_pu_bacteria | 2808606445 | 2809217174 | 450 |
| 188 | iso_pu_bacteria | 2816332298 | 2817494030 | 450 |
| 189 | iso_pu_bacteria | 2818991456 | 2819655119 | 450 |
| 190 | iso_pu_bacteria | 2818991464 | 2819704389 | 450 |
| 191 | iso_pu_bacteria | 2825651385 | 2825655106 | 450 |
| 192 | iso_pu_bacteria | 2834028612 | 2834030939 | 450 |
| 193 | iso_pu_bacteria | 2842805378 | 2842807777 | 450 |
| 194 | iso_pu_bacteria | 2842826826 | 2842831296 | 450 |
| 195 | iso_pu_bacteria | 2842832357 | 2842833449 | 450 |
| 196 | iso_pu_bacteria | 2842837860 | 2842837888 | 450 |
| 197 | iso_pu_bacteria | 2842843487 | 2842845679 | 450 |
| 198 | iso_pu_bacteria | 2842854478 | 2842855610 | 450 |
| 199 | iso_pu_bacteria | 2844665904 | 2844667076 | 450 |
| 200 | iso_pu_bacteria | 2852612431 | 2852616340 | 450 |
| 201 | iso_pu_bacteria | 2852657418 | 2852659666 | 450 |
| 202 | iso_pu_bacteria | 2852667396 | 2852671308 | 450 |
| 203 | iso_pu_bacteria | 2860339153 | 2860341702 | 450 |
| 204 | iso_pu_bacteria | 2860867994 | 2860873017 | 450 |
| 205 | iso_pu_bacteria | 2878029506 | 2878035343 | 450 |
| 206 | iso_pu_bacteria | 2880230671 | 2880235984 | 450 |
| 207 | iso_pu_bacteria | 2904518522 | 2904518968 | 450 |
| 208 | iso_pu_bacteria | 2904550169 | 2904551339 | 450 |
| 209 | iso_pu_bacteria | 2908446538 | 2908452570 | 450 |
| 210 | iso_pu_bacteria | 2913036834 | 2913042518 | 450 |
| 211 | iso_pu_bacteria | 2917070673 | 2917076721 | 450 |
| 212 | iso_pu_bacteria | 2919063839 | 2919065528 | 450 |
| 213 | iso_pu_bacteria | 2919385768 | 2919389200 | 450 |
| 214 | iso_pu_bacteria | 2919456309 | 2919457536 | 450 |
| 215 | iso_pu_bacteria | 2919481497 | 2919485645 | 450 |
| 216 | iso_pu_bacteria | 2919487758 | 2919488177 | 450 |
| 217 | iso_pu_bacteria | 2919697872 | 2919700587 | 450 |
| 218 | iso_pu_bacteria | 2923153595 | 2923159504 | 450 |
| 219 | iso_pu_bacteria | 2923586266 | 2923588988 | 450 |
| 220 | iso_pu_bacteria | 2929144301 | 2929149909 | 450 |
| 221 | iso_pu_bacteria | 2929189879 | 2929195139 | 450 |
| 222 | iso_pu_bacteria | 2931369376 | 2931372651 | 450 |
| 223 | iso_pu_bacteria | 2931390751 | 2931396399 | 450 |
| 224 | iso_pu_bacteria | 2931396565 | 2931398067 | 450 |
| 225 | iso_pu_bacteria | 2935353572 | 2935358312 | 450 |
| 226 | iso_pu_bacteria | 2939636861 | 2939640816 | 450 |
| 227 | iso_pu_bacteria | 2945928738 | 2945930920 | 450 |
| 228 | iso_pu_bacteria | 2945961074 | 2945966844 | 450 |
| 229 | iso_pu_bacteria | 2946027586 | 2946027892 | 450 |
| 230 | iso_pu_bacteria | 2947233263 | 2947234412 | 450 |
| 231 | iso_pu_bacteria | 2969304461 | 2969310163 | 450 |
| 232 | iso_pu_bacteria | 2974289157 | 2974294089 | 450 |
| 233 | iso_pu_bacteria | 2984286254 | 2984286612 | 450 |
| 234 | iso_pu_bacteria | 2988728565 | 2988731450 | 450 |
| 235 | iso_pu_bacteria | 2998139840 | 2998145386 | 450 |
| 236 | iso_pu_bacteria | 3007252601 | 3007255270 | 450 |
| 237 | iso_pu_bacteria | 3007315729 | 3007315928 | 450 |
| 238 | iso_pu_bacteria | 3007395558 | 3007399409 | 450 |
| 239 | iso_pu_bacteria | 3007419365 | 3007419828 | 450 |
| 240 | iso_pu_bacteria | 3007511990 | 3007517167 | 450 |
| 241 | iso_pu_bacteria | 3007614139 | 3007618520 | 450 |
| 242 | iso_pu_bacteria | 3007619802 | 3007622511 | 450 |
| 243 | iso_pu_bacteria | 3007718800 | 3007721744 | 450 |
| 244 | iso_pu_bacteria | 3007855910 | 3007859181 | 450 |
| 245 | iso_pu_bacteria | 3007861166 | 3007865113 | 450 |
| 246 | iso_pu_bacteria | 3007866637 | 3007866790 | 450 |
| 247 | iso_pu_bacteria | 637000220 | 637323262 | 450 |
| 248 | iso_pu_bacteria | 8015687852 | 8015693603 | 450 |
| 249 | iso_pu_bacteria | 8019769354 | 8019769781 | 450 |
| 250 | iso_pu_bacteria | 8019775933 | 8019777694 | 450 |
| 251 | iso_pu_bacteria | 8029995093 | 8029995515 | 450 |
| 252 | iso_pu_bacteria | 8054285046 | 8054287908 | 450 |
| 253 | iso_pu_bacteria | 8054347763 | 8054349593 | 450 |
| 254 | iso_pu_bacteria | 8054503363 | 8054508921 | 450 |
| 255 | iso_pu_bacteria | 8055770955 | 8055776849 | 450 |
| 256 | iso_pu_bacteria | 8055817908 | 8055823890 | 450 |
| 257 | iso_pu_bacteria | 8056131705 | 8056137297 | 450 |
| 258 | iso_pu_bacteria | 8056143049 | 8056148759 | 450 |
| 259 | iso_pu_bacteria | 8056148874 | 8056151505 | 450 |
| 260 | iso_pu_bacteria | 8056155041 | 8056160840 | 450 |
| 261 | iso_pu_bacteria | 8056161164 | 8056163621 | 450 |
| 262 | iso_pu_bacteria | 8056166840 | 8056171318 | 450 |
| 263 | iso_pu_bacteria | 8056172158 | 8056177420 | 450 |
| 264 | iso_pu_bacteria | 8056177738 | 8056181988 | 450 |
| 265 | iso_pu_bacteria | 8056569372 | 8056570454 | 450 |
| 266 | 3300005262 | Ga0065165_1000774 | Ga0065165_100077437 | 451 |
| 267 | 3300006195 | Ga0075366_10001453 | Ga0075366_100014536 | 451 |
| 268 | 3300006195 | Ga0075366_10006476 | Ga0075366_100064765 | 451 |
| 269 | 3300006195 | Ga0075366_10006521 | Ga0075366_100065216 | 451 |
| 270 | 3300013104 | Ga0157370_10003759 | Ga0157370_100037593 | 451 |
| 271 | 3300014968 | Ga0157379_10070294 | Ga0157379_100702942 | 451 |
| 272 | 3300025273 | Ga0209673_1005874 | Ga0209673_10058743 | 451 |
| 273 | 3300025298 | Ga0209050_1000374 | Ga0209050_100037423 | 451 |
| 274 | 3300025933 | Ga0207706_10009625 | Ga0207706_100096257 | 451 |
| 275 | 3300036401 | Ga0373937_0023779 | Ga0373937_0023779_3030_4430 | 451 |
| 276 | 3300039447 | Ga0436361_0525200 | Ga0436361_0525200_2072_3451 | 451 |
| 277 | 3300042115 | Ga0450911_000100 | Ga0450911_000100_22050_23432 | 451 |
| 278 | 3300042876 | Ga0451577_0164037 | Ga0451577_0164037_143_1540 | 451 |
| 279 | 3300044712 | Ga0453684_0012190 | Ga0453684_0012190_749_2149 | 451 |
| 280 | 3300046519 | Ga0495632_0007443 | Ga0495632_0007443_4990_6372 | 451 |
| 281 | 3300046522 | Ga0495643_0000627 | Ga0495643_0000627_24410_25783 | 451 |
| 282 | 3300046692 | Ga0495671_0009031 | Ga0495671_0009031_3701_5074 | 451 |
| 283 | 3300047472 | Ga0495686_0003059 | Ga0495686_0003059_1711_3096 | 451 |
| 284 | 3300050493 | nmdc:mga0k408_1301_c1 | nmdc:mga0k408_1301_c1_4801_6192 | 451 |
| 285 | 3300050493 | nmdc:mga0k408_41573_c1 | nmdc:mga0k408_41573_c1_1052_2434 | 451 |
| 286 | 3300053086 | Ga0500578_0000683 | Ga0500578_0000683_2518_3915 | 451 |
| 287 | 3300053131 | Ga0500652_000930 | Ga0500652_000930_5879_7261 | 451 |
| 288 | 3300053156 | Ga0500622_0000028 | Ga0500622_0000028_188729_190111 | 451 |
| 289 | iso_pu_bacteria | 2600254954 | 2600444088 | 451 |
| 290 | iso_pu_bacteria | 2600254954 | 2600445720 | 451 |
| 291 | iso_pu_bacteria | 2600255389 | 2602008427 | 451 |
| 292 | iso_pu_bacteria | 2600255389 | 2602012564 | 451 |
| 293 | iso_pu_bacteria | 2643221654 | 2644304782 | 451 |
| 294 | iso_pu_bacteria | 2808606373 | 2808905735 | 451 |
| 295 | iso_pu_bacteria | 2808606379 | 2808942154 | 451 |
| 296 | iso_pu_bacteria | 2808606379 | 2808942793 | 451 |
| 297 | iso_pu_bacteria | 2823421272 | 2823424048 | 451 |
| 298 | iso_pu_bacteria | 2823421272 | 2823425716 | 451 |
| 299 | iso_pu_bacteria | 2826581358 | 2826581927 | 451 |
| 300 | iso_pu_bacteria | 2842815866 | 2842816818 | 451 |
| 301 | iso_pu_bacteria | 2842849001 | 2842853967 | 451 |
| 302 | iso_pu_bacteria | 2919501602 | 2919503701 | 451 |
| 303 | iso_pu_bacteria | 2926063275 | 2926065727 | 451 |
| 304 | iso_pu_bacteria | 2990196909 | 2990199686 | 451 |
| 305 | 3300002705 | JGI25156J39149_1000278 | JGI25156J39149_100027826 | 452 |
| 306 | 3300002705 | JGI25156J39149_1000973 | JGI25156J39149_10009738 | 452 |
| 307 | 3300002705 | JGI25156J39149_1009634 | JGI25156J39149_10096342 | 452 |
| 308 | 3300002738 | JGI25154J39366_1000221 | JGI25154J39366_10002219 | 452 |
| 309 | 3300002741 | JGI25157J39369_1000049 | JGI25157J39369_100004933 | 452 |
| 310 | 3300003323 | rootH1_10025580 | rootH1_100255802 | 452 |
| 311 | 3300003752 | Ga0055539_1000583 | Ga0055539_10005838 | 452 |
| 312 | 3300003752 | Ga0055539_1001782 | Ga0055539_10017822 | 452 |
| 313 | 3300003756 | Ga0055533_1000010 | Ga0055533_1000010211 | 452 |
| 314 | 3300003759 | Ga0055525_1000775 | Ga0055525_10007752 | 452 |
| 315 | 3300003761 | Ga0055535_1000607 | Ga0055535_10006078 | 452 |
| 316 | 3300003761 | Ga0055535_1000906 | Ga0055535_100090610 | 452 |
| 317 | 3300003763 | Ga0055529_1000731 | Ga0055529_10007319 | 452 |
| 318 | 3300005327 | Ga0070658_10136714 | Ga0070658_101367142 | 452 |
| 319 | 3300005334 | Ga0068869_100053998 | Ga0068869_1000539981 | 452 |
| 320 | 3300005339 | Ga0070660_100097909 | Ga0070660_1000979092 | 452 |
| 321 | 3300005563 | Ga0068855_100052495 | Ga0068855_1000524953 | 452 |
| 322 | 3300005577 | Ga0068857_100024975 | Ga0068857_1000249755 | 452 |
| 323 | 3300005719 | Ga0068861_100040263 | Ga0068861_1000402633 | 452 |
| 324 | 3300006058 | Ga0075432_10015661 | Ga0075432_100156612 | 452 |
| 325 | 3300006353 | Ga0075370_10016883 | Ga0075370_100168833 | 452 |
| 326 | 3300006944 | Ga0099823_1000043 | Ga0099823_100004335 | 452 |
| 327 | 3300006944 | Ga0099823_1000050 | Ga0099823_100005034 | 452 |
| 328 | 3300006944 | Ga0099823_1022982 | Ga0099823_10229822 | 452 |
| 329 | 3300006944 | Ga0099823_1063234 | Ga0099823_10632341 | 452 |
| 330 | 3300009036 | Ga0105244_10000265 | Ga0105244_1000026528 | 452 |
| 331 | 3300009036 | Ga0105244_10000542 | Ga0105244_1000054222 | 452 |
| 332 | 3300009036 | Ga0105244_10028356 | Ga0105244_100283562 | 452 |
| 333 | 3300009093 | Ga0105240_10072481 | Ga0105240_100724814 | 452 |
| 334 | 3300009148 | Ga0105243_10052138 | Ga0105243_100521382 | 452 |
| 335 | 3300009176 | Ga0105242_10194169 | Ga0105242_101941691 | 452 |
| 336 | 3300009545 | Ga0105237_10111123 | Ga0105237_101111232 | 452 |
| 337 | 3300009551 | Ga0105238_10170899 | Ga0105238_101708992 | 452 |
| 338 | 3300010375 | Ga0105239_10025926 | Ga0105239_100259266 | 452 |
| 339 | 3300013105 | Ga0157369_10043726 | Ga0157369_100437264 | 452 |
| 340 | 3300013307 | Ga0157372_10015782 | Ga0157372_100157825 | 452 |
| 341 | 3300021361 | Ga0213872_10000066 | Ga0213872_1000006619 | 452 |
| 342 | 3300021361 | Ga0213872_10000187 | Ga0213872_100001876 | 452 |
| 343 | 3300021361 | Ga0213872_10062256 | Ga0213872_100622561 | 452 |
| 344 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031547 | 452 |
| 345 | 3300025230 | Ga0209563_100049 | Ga0209563_1000499 | 452 |
| 346 | 3300025231 | Ga0207427_100280 | Ga0207427_10028021 | 452 |
| 347 | 3300025242 | Ga0209258_100163 | Ga0209258_1001639 | 452 |
| 348 | 3300025246 | Ga0209646_1000138 | Ga0209646_100013876 | 452 |
| 349 | 3300025250 | Ga0209026_1000021 | Ga0209026_1000021235 | 452 |
| 350 | 3300025253 | Ga0209677_100145 | Ga0209677_10014524 | 452 |
| 351 | 3300025253 | Ga0209677_100209 | Ga0209677_10020927 | 452 |
| 352 | 3300025253 | Ga0209677_107310 | Ga0209677_1073102 | 452 |
| 353 | 3300025256 | Ga0209759_1000025 | Ga0209759_1000025235 | 452 |
| 354 | 3300025256 | Ga0209759_1001401 | Ga0209759_10014016 | 452 |
| 355 | 3300025256 | Ga0209759_1002119 | Ga0209759_10021192 | 452 |
| 356 | 3300025256 | Ga0209759_1011333 | Ga0209759_10113332 | 452 |
| 357 | 3300025272 | Ga0209455_1000059 | Ga0209455_1000059285 | 452 |
| 358 | 3300025292 | Ga0209676_1000617 | Ga0209676_100061736 | 452 |
| 359 | 3300025292 | Ga0209676_1001192 | Ga0209676_10011922 | 452 |
| 360 | 3300025711 | Ga0207696_1000050 | Ga0207696_1000050100 | 452 |
| 361 | 3300025711 | Ga0207696_1009541 | Ga0207696_10095412 | 452 |
| 362 | 3300025728 | Ga0207655_1000216 | Ga0207655_100021647 | 452 |
| 363 | 3300025728 | Ga0207655_1000295 | Ga0207655_100029548 | 452 |
| 364 | 3300025728 | Ga0207655_1002393 | Ga0207655_10023933 | 452 |
| 365 | 3300025728 | Ga0207655_1002424 | Ga0207655_10024242 | 452 |
| 366 | 3300025728 | Ga0207655_1012780 | Ga0207655_10127803 | 452 |
| 367 | 3300025728 | Ga0207655_1020188 | Ga0207655_10201882 | 452 |
| 368 | 3300025735 | Ga0207713_1003953 | Ga0207713_10039533 | 452 |
| 369 | 3300025735 | Ga0207713_1004110 | Ga0207713_100411011 | 452 |
| 370 | 3300025735 | Ga0207713_1004772 | Ga0207713_10047725 | 452 |
| 371 | 3300025735 | Ga0207713_1009206 | Ga0207713_10092063 | 452 |
| 372 | 3300025909 | Ga0207705_10020837 | Ga0207705_100208374 | 452 |
| 373 | 3300025919 | Ga0207657_10029841 | Ga0207657_100298412 | 452 |
| 374 | 3300025925 | Ga0207650_10071195 | Ga0207650_100711952 | 452 |
| 375 | 3300025932 | Ga0207690_10070448 | Ga0207690_100704482 | 452 |
| 376 | 3300025935 | Ga0207709_10045241 | Ga0207709_100452411 | 452 |
| 377 | 3300025942 | Ga0207689_10014227 | Ga0207689_100142272 | 452 |
| 378 | 3300025949 | Ga0207667_10009539 | Ga0207667_100095398 | 452 |
| 379 | 3300026023 | Ga0207677_10180154 | Ga0207677_101801541 | 452 |
| 380 | 3300026078 | Ga0207702_10000800 | Ga0207702_100008003 | 452 |
| 381 | 3300026116 | Ga0207674_10043460 | Ga0207674_100434602 | 452 |
| 382 | 3300026118 | Ga0207675_100052490 | Ga0207675_1000524903 | 452 |
| 383 | 3300027296 | Ga0209389_1000017 | Ga0209389_100001755 | 452 |
| 384 | 3300027296 | Ga0209389_1000053 | Ga0209389_100005341 | 452 |
| 385 | 3300027296 | Ga0209389_1072180 | Ga0209389_10721802 | 452 |
| 386 | 3300028666 | Ga0265336_10000006 | Ga0265336_1000000639 | 452 |
| 387 | 3300028794 | Ga0307515_10023444 | Ga0307515_100234445 | 452 |
| 388 | 3300029957 | Ga0265324_10002529 | Ga0265324_100025292 | 452 |
| 389 | 3300031548 | Ga0307408_100000002 | Ga0307408_100000002402 | 452 |
| 390 | 3300031649 | Ga0307514_10001133 | Ga0307514_1000113313 | 452 |
| 391 | 3300031730 | Ga0307516_10000878 | Ga0307516_100008782 | 452 |
| 392 | 3300038443 | Ga0395901_0014533 | Ga0395901_0014533_295_1674 | 452 |
| 393 | 3300039447 | Ga0436361_0857598 | Ga0436361_0857598_420_1799 | 452 |
| 394 | 3300039447 | Ga0436361_1024184 | Ga0436361_1024184_82777_84159 | 452 |
| 395 | 3300041405 | Ga0439438_006624 | Ga0439438_006624_1945_3306 | 452 |
| 396 | 3300042006 | Ga0439432_005789 | Ga0439432_005789_817_2175 | 452 |
| 397 | 3300042006 | Ga0439432_019622 | Ga0439432_019622_347_1708 | 452 |
| 398 | 3300042142 | Ga0450905_004727 | Ga0450905_004727_38_1396 | 452 |
| 399 | 3300044656 | Ga0466969_0009333 | Ga0466969_0009333_3717_5093 | 452 |
| 400 | 3300044683 | Ga0466965_0000692 | Ga0466965_0000692_3893_5269 | 452 |
| 401 | 3300044684 | Ga0466966_0005876 | Ga0466966_0005876_133_1509 | 452 |
| 402 | 3300044693 | Ga0466961_0015298 | Ga0466961_0015298_3287_4663 | 452 |
| 403 | 3300044694 | Ga0466963_0057201 | Ga0466963_0057201_357_1733 | 452 |
| 404 | 3300044706 | Ga0466964_0001646 | Ga0466964_0001646_5858_7234 | 452 |
| 405 | 3300044719 | Ga0466971_0006553 | Ga0466971_0006553_2768_4144 | 452 |
| 406 | 3300044842 | Ga0466957_0002678 | Ga0466957_0002678_7297_8673 | 452 |
| 407 | 3300045049 | Ga0466959_0003818 | Ga0466959_0003818_8127_9503 | 452 |
| 408 | 3300045836 | Ga0466958_0031576 | Ga0466958_0031576_1698_3074 | 452 |
| 409 | 3300045976 | Ga0466967_0058693 | Ga0466967_0058693_1324_2700 | 452 |
| 410 | 3300046462 | Ga0495651_0146508 | Ga0495651_0146508_201_1580 | 452 |
| 411 | 3300046471 | Ga0495650_0030023 | Ga0495650_0030023_238_1617 | 452 |
| 412 | 3300046506 | Ga0495583_0000927 | Ga0495583_0000927_24542_25921 | 452 |
| 413 | 3300046507 | Ga0495606_0003050 | Ga0495606_0003050_7524_8903 | 452 |
| 414 | 3300046515 | Ga0495620_0000229 | Ga0495620_0000229_35999_37360 | 452 |
| 415 | 3300046519 | Ga0495632_0008782 | Ga0495632_0008782_4378_5739 | 452 |
| 416 | 3300046522 | Ga0495643_0000345 | Ga0495643_0000345_11609_12967 | 452 |
| 417 | 3300046522 | Ga0495643_0002030 | Ga0495643_0002030_15128_16489 | 452 |
| 418 | 3300046522 | Ga0495643_0012620 | Ga0495643_0012620_1751_3112 | 452 |
| 419 | 3300046524 | Ga0495648_0013922 | Ga0495648_0013922_4312_5673 | 452 |
| 420 | 3300046694 | Ga0495649_0000464 | Ga0495649_0000464_24967_26346 | 452 |
| 421 | 3300046794 | Ga0495589_0012850 | Ga0495589_0012850_13_1392 | 452 |
| 422 | 3300048917 | Ga0496114_0005705 | Ga0496114_0005705_239_1597 | 452 |
| 423 | 3300048917 | Ga0496114_0103367 | Ga0496114_0103367_578_1939 | 452 |
| 424 | 3300048920 | Ga0496117_0000961 | Ga0496117_0000961_12065_13423 | 452 |
| 425 | 3300048920 | Ga0496117_0018385 | Ga0496117_0018385_2367_3728 | 452 |
| 426 | 3300048920 | Ga0496117_0038087 | Ga0496117_0038087_510_1871 | 452 |
| 427 | 3300048920 | Ga0496117_0039315 | Ga0496117_0039315_1818_3179 | 452 |
| 428 | 3300048921 | Ga0496118_0014197 | Ga0496118_0014197_2034_3395 | 452 |
| 429 | 3300048921 | Ga0496118_0016655 | Ga0496118_0016655_2435_3796 | 452 |
| 430 | 3300048921 | Ga0496118_0023180 | Ga0496118_0023180_273_1631 | 452 |
| 431 | 3300048922 | Ga0496119_0004034 | Ga0496119_0004034_11329_12690 | 452 |
| 432 | 3300048923 | Ga0496120_0003119 | Ga0496120_0003119_12116_13477 | 452 |
| 433 | 3300048924 | Ga0496121_0021850 | Ga0496121_0021850_3324_4682 | 452 |
| 434 | 3300048925 | Ga0496122_0002086 | Ga0496122_0002086_26738_28099 | 452 |
| 435 | 3300048925 | Ga0496122_0004723 | Ga0496122_0004723_12037_13395 | 452 |
| 436 | 3300048926 | Ga0496123_0000178 | Ga0496123_0000178_5382_6743 | 452 |
| 437 | 3300048926 | Ga0496123_0000445 | Ga0496123_0000445_15285_16643 | 452 |
| 438 | 3300048926 | Ga0496123_0037585 | Ga0496123_0037585_932_2290 | 452 |
| 439 | 3300048927 | Ga0496124_0004545 | Ga0496124_0004545_14698_16056 | 452 |
| 440 | 3300048927 | Ga0496124_0019279 | Ga0496124_0019279_4497_5858 | 452 |
| 441 | 3300048927 | Ga0496124_0022258 | Ga0496124_0022258_2022_3395 | 452 |
| 442 | 3300048928 | Ga0496125_0011967 | Ga0496125_0011967_58_1416 | 452 |
| 443 | 3300048928 | Ga0496125_0012388 | Ga0496125_0012388_2062_3423 | 452 |
| 444 | 3300048928 | Ga0496125_0123922 | Ga0496125_0123922_161_1534 | 452 |
| 445 | 3300048929 | Ga0496126_0039798 | Ga0496126_0039798_1285_2658 | 452 |
| 446 | 3300048929 | Ga0496126_0097773 | Ga0496126_0097773_650_2011 | 452 |
| 447 | 3300048929 | Ga0496126_0178237 | Ga0496126_0178237_195_1556 | 452 |
| 448 | 3300049571 | Ga0501034_0000143 | Ga0501034_0000143_127238_128599 | 452 |
| 449 | 3300049571 | Ga0501034_0000200 | Ga0501034_0000200_69725_71083 | 452 |
| 450 | 3300049662 | Ga0501222_005362 | Ga0501222_005362_269_1678 | 452 |
| 451 | 3300050496 | nmdc:mga07m45_3438_c1 | nmdc:mga07m45_3438_c1_1591_3000 | 452 |
| 452 | 3300050496 | nmdc:mga07m45_4618_c1 | nmdc:mga07m45_4618_c1_817_2196 | 452 |
| 453 | 3300053080 | Ga0500635_0000017 | Ga0500635_0000017_92830_94209 | 452 |
| 454 | 3300053080 | Ga0500635_0013483 | Ga0500635_0013483_590_2032 | 452 |
| 455 | 3300053135 | Ga0500659_0003436 | Ga0500659_0003436_5510_6868 | 452 |
| 456 | 3300053136 | Ga0500559_0010928 | Ga0500559_0010928_1298_2677 | 452 |
| 457 | 3300053177 | Ga0500636_0045507 | Ga0500636_0045507_918_2360 | 452 |
| 458 | 3300061719 | Ga0466962_0001425 | Ga0466962_0001425_5503_6879 | 452 |
| 459 | 3300003792 | Ga0055540_1007251 | Ga0055540_10072512 | 453 |
| 460 | 3300003856 | Ga0058692_1001311 | Ga0058692_10013112 | 453 |
| 461 | 3300009011 | Ga0105251_10000024 | Ga0105251_100000244 | 453 |
| 462 | 3300009092 | Ga0105250_10001113 | Ga0105250_100011132 | 453 |
| 463 | 3300009148 | Ga0105243_10125045 | Ga0105243_101250452 | 453 |
| 464 | 3300013102 | Ga0157371_10001604 | Ga0157371_1000160416 | 453 |
| 465 | 3300013102 | Ga0157371_10013733 | Ga0157371_100137335 | 453 |
| 466 | 3300013104 | Ga0157370_10003242 | Ga0157370_1000324215 | 453 |
| 467 | 3300013104 | Ga0157370_10135753 | Ga0157370_101357532 | 453 |
| 468 | 3300015261 | Ga0182006_1003062 | Ga0182006_10030622 | 453 |
| 469 | 3300025303 | Ga0209051_1005236 | Ga0209051_10052362 | 453 |
| 470 | 3300025711 | Ga0207696_1000156 | Ga0207696_1000156108 | 453 |
| 471 | 3300025735 | Ga0207713_1000010 | Ga0207713_1000010301 | 453 |
| 472 | 3300025935 | Ga0207709_10081986 | Ga0207709_100819862 | 453 |
| 473 | 3300027312 | Ga0209371_1000032 | Ga0209371_1000032195 | 453 |
| 474 | 3300030500 | Ga0268256_1000050 | Ga0268256_1000050117 | 453 |
| 475 | 3300042156 | Ga0439446_0001826 | Ga0439446_0001826_847_2214 | 453 |
| 476 | 3300046492 | Ga0495585_0047158 | Ga0495585_0047158_321_1703 | 453 |
| 477 | 3300046522 | Ga0495643_0007948 | Ga0495643_0007948_2855_4222 | 453 |
| 478 | 3300046524 | Ga0495648_0023818 | Ga0495648_0023818_664_2025 | 453 |
| 479 | 3300046692 | Ga0495671_0024764 | Ga0495671_0024764_1003_2370 | 453 |
| 480 | 3300046694 | Ga0495649_0008513 | Ga0495649_0008513_3504_4871 | 453 |
| 481 | 3300049460 | Ga0495682_0000054 | Ga0495682_0000054_43878_45245 | 453 |
| 482 | 3300049460 | Ga0495682_0000124 | Ga0495682_0000124_5744_7108 | 453 |
| 483 | 3300061734 | Ga0530510_0010256 | Ga0530510_0010256_1958_3379 | 453 |
| 484 | 2124908027 | MRS2a_Contig_136 | MRS2a_00036460 | 454 |
| 485 | 2162886007 | SwRhRL2b_contig_180730 | SwRhRL2b_0225.00003570 | 454 |
| 486 | 3300001915 | JGI24741J21665_1004873 | JGI24741J21665_10048732 | 454 |
| 487 | 3300002737 | JGI25162J39368_1000505 | JGI25162J39368_100050526 | 454 |
| 488 | 3300002737 | JGI25162J39368_1000520 | JGI25162J39368_10005203 | 454 |
| 489 | 3300002771 | JGI25163J39215_1002359 | JGI25163J39215_10023591 | 454 |
| 490 | 3300002772 | JGI25164J39214_1000342 | JGI25164J39214_10003423 | 454 |
| 491 | 3300002772 | JGI25164J39214_1000350 | JGI25164J39214_10003503 | 454 |
| 492 | 3300003214 | JGI25165J46597_1000629 | JGI25165J46597_10006293 | 454 |
| 493 | 3300003214 | JGI25165J46597_1000645 | JGI25165J46597_10006453 | 454 |
| 494 | 3300003751 | Ga0055538_1000032 | Ga0055538_1000032125 | 454 |
| 495 | 3300003752 | Ga0055539_1000043 | Ga0055539_1000043125 | 454 |
| 496 | 3300003756 | Ga0055533_1000052 | Ga0055533_1000052125 | 454 |
| 497 | 3300003758 | Ga0055532_1000047 | Ga0055532_1000047105 | 454 |
| 498 | 3300003759 | Ga0055525_1000062 | Ga0055525_1000062125 | 454 |
| 499 | 3300003761 | Ga0055535_1004623 | Ga0055535_10046232 | 454 |
| 500 | 3300003781 | Ga0055536_1001013 | Ga0055536_100101315 | 454 |
| 501 | 3300003781 | Ga0055536_1004708 | Ga0055536_10047084 | 454 |
| 502 | 3300003781 | Ga0055536_1004755 | Ga0055536_10047554 | 454 |
| 503 | 3300003791 | Ga0055530_10000150 | Ga0055530_100001503 | 454 |
| 504 | 3300003791 | Ga0055530_10001395 | Ga0055530_1000139515 | 454 |
| 505 | 3300003791 | Ga0055530_10004701 | Ga0055530_100047014 | 454 |
| 506 | 3300003791 | Ga0055530_10009077 | Ga0055530_100090773 | 454 |
| 507 | 3300003792 | Ga0055540_1000175 | Ga0055540_10001753 | 454 |
| 508 | 3300003792 | Ga0055540_1002862 | Ga0055540_10028626 | 454 |
| 509 | 3300003792 | Ga0055540_1003956 | Ga0055540_10039564 | 454 |
| 510 | 3300003794 | Ga0055531_10008572 | Ga0055531_100085722 | 454 |
| 511 | 3300003841 | Ga0055541_1000030 | Ga0055541_1000030125 | 454 |
| 512 | 3300005288 | Ga0065714_10003458 | Ga0065714_100034583 | 454 |
| 513 | 3300005288 | Ga0065714_10008011 | Ga0065714_100080112 | 454 |
| 514 | 3300005288 | Ga0065714_10019612 | Ga0065714_100196121 | 454 |
| 515 | 3300005289 | Ga0065704_10071473 | Ga0065704_100714733 | 454 |
| 516 | 3300005290 | Ga0065712_10000927 | Ga0065712_100009272 | 454 |
| 517 | 3300005290 | Ga0065712_10069335 | Ga0065712_100693352 | 454 |
| 518 | 3300005290 | Ga0065712_10072290 | Ga0065712_100722904 | 454 |
| 519 | 3300005293 | Ga0065715_10002954 | Ga0065715_100029543 | 454 |
| 520 | 3300005331 | Ga0070670_100001953 | Ga0070670_1000019532 | 454 |
| 521 | 3300005331 | Ga0070670_100210681 | Ga0070670_1002106811 | 454 |
| 522 | 3300005344 | Ga0070661_100001640 | Ga0070661_1000016402 | 454 |
| 523 | 3300005353 | Ga0070669_100002598 | Ga0070669_1000025982 | 454 |
| 524 | 3300005353 | Ga0070669_100011283 | Ga0070669_1000112833 | 454 |
| 525 | 3300005457 | Ga0070662_100008312 | Ga0070662_1000083123 | 454 |
| 526 | 3300005457 | Ga0070662_100078941 | Ga0070662_1000789412 | 454 |
| 527 | 3300005539 | Ga0068853_100000187 | Ga0068853_10000018721 | 454 |
| 528 | 3300005548 | Ga0070665_100078213 | Ga0070665_1000782132 | 454 |
| 529 | 3300005564 | Ga0070664_100001886 | Ga0070664_10000188611 | 454 |
| 530 | 3300005834 | Ga0068851_10000007 | Ga0068851_1000000727 | 454 |
| 531 | 3300006051 | Ga0075364_10154732 | Ga0075364_101547321 | 454 |
| 532 | 3300006058 | Ga0075432_10007217 | Ga0075432_100072172 | 454 |
| 533 | 3300006058 | Ga0075432_10009884 | Ga0075432_100098842 | 454 |
| 534 | 3300006946 | Ga0079104_1001103 | Ga0079104_10011034 | 454 |
| 535 | 3300006946 | Ga0079104_1003465 | Ga0079104_10034654 | 454 |
| 536 | 3300006948 | Ga0099826_10004877 | Ga0099826_100048776 | 454 |
| 537 | 3300009011 | Ga0105251_10004294 | Ga0105251_100042946 | 454 |
| 538 | 3300009011 | Ga0105251_10015050 | Ga0105251_100150502 | 454 |
| 539 | 3300009011 | Ga0105251_10018016 | Ga0105251_100180163 | 454 |
| 540 | 3300009011 | Ga0105251_10018659 | Ga0105251_100186592 | 454 |
| 541 | 3300009011 | Ga0105251_10054573 | Ga0105251_100545731 | 454 |
| 542 | 3300009036 | Ga0105244_10007755 | Ga0105244_100077554 | 454 |
| 543 | 3300009036 | Ga0105244_10014617 | Ga0105244_100146172 | 454 |
| 544 | 3300009036 | Ga0105244_10018100 | Ga0105244_100181002 | 454 |
| 545 | 3300009036 | Ga0105244_10025226 | Ga0105244_100252262 | 454 |
| 546 | 3300009036 | Ga0105244_10080040 | Ga0105244_100800401 | 454 |
| 547 | 3300009092 | Ga0105250_10012888 | Ga0105250_100128883 | 454 |
| 548 | 3300009148 | Ga0105243_10001572 | Ga0105243_1000157219 | 454 |
| 549 | 3300009148 | Ga0105243_10001599 | Ga0105243_1000159917 | 454 |
| 550 | 3300009148 | Ga0105243_10011620 | Ga0105243_100116203 | 454 |
| 551 | 3300009176 | Ga0105242_10001499 | Ga0105242_100014997 | 454 |
| 552 | 3300009177 | Ga0105248_10007834 | Ga0105248_100078349 | 454 |
| 553 | 3300009545 | Ga0105237_10010598 | Ga0105237_100105987 | 454 |
| 554 | 3300009553 | Ga0105249_10007064 | Ga0105249_100070644 | 454 |
| 555 | 3300011119 | Ga0105246_10002803 | Ga0105246_100028032 | 454 |
| 556 | 3300011119 | Ga0105246_10007983 | Ga0105246_100079836 | 454 |
| 557 | 3300011119 | Ga0105246_10011130 | Ga0105246_100111302 | 454 |
| 558 | 3300012483 | Ga0157337_1000729 | Ga0157337_10007291 | 454 |
| 559 | 3300012498 | Ga0157345_1000705 | Ga0157345_10007052 | 454 |
| 560 | 3300013100 | Ga0157373_10013919 | Ga0157373_100139195 | 454 |
| 561 | 3300013100 | Ga0157373_10033727 | Ga0157373_100337271 | 454 |
| 562 | 3300013100 | Ga0157373_10047177 | Ga0157373_100471772 | 454 |
| 563 | 3300013102 | Ga0157371_10013168 | Ga0157371_100131685 | 454 |
| 564 | 3300013102 | Ga0157371_10038069 | Ga0157371_100380691 | 454 |
| 565 | 3300013102 | Ga0157371_10043778 | Ga0157371_100437781 | 454 |
| 566 | 3300013104 | Ga0157370_10063716 | Ga0157370_100637162 | 454 |
| 567 | 3300013104 | Ga0157370_10069376 | Ga0157370_100693763 | 454 |
| 568 | 3300013104 | Ga0157370_10084960 | Ga0157370_100849602 | 454 |
| 569 | 3300013105 | Ga0157369_10030463 | Ga0157369_100304634 | 454 |
| 570 | 3300013105 | Ga0157369_10055802 | Ga0157369_100558022 | 454 |
| 571 | 3300013105 | Ga0157369_10122753 | Ga0157369_101227531 | 454 |
| 572 | 3300013105 | Ga0157369_10166556 | Ga0157369_101665561 | 454 |
| 573 | 3300013105 | Ga0157369_10301600 | Ga0157369_103016001 | 454 |
| 574 | 3300013306 | Ga0163162_10030569 | Ga0163162_100305692 | 454 |
| 575 | 3300013308 | Ga0157375_10152615 | Ga0157375_101526152 | 454 |
| 576 | 3300013308 | Ga0157375_10256711 | Ga0157375_102567112 | 454 |
| 577 | 3300014497 | Ga0182008_10006484 | Ga0182008_100064842 | 454 |
| 578 | 3300014497 | Ga0182008_10007506 | Ga0182008_100075062 | 454 |
| 579 | 3300015261 | Ga0182006_1012007 | Ga0182006_10120073 | 454 |
| 580 | 3300015261 | Ga0182006_1030231 | Ga0182006_10302312 | 454 |
| 581 | 3300015261 | Ga0182006_1052089 | Ga0182006_10520892 | 454 |
| 582 | 3300015262 | Ga0182007_10002733 | Ga0182007_100027334 | 454 |
| 583 | 3300015265 | Ga0182005_1002836 | Ga0182005_10028362 | 454 |
| 584 | 3300015265 | Ga0182005_1003780 | Ga0182005_10037801 | 454 |
| 585 | 3300015265 | Ga0182005_1008200 | Ga0182005_10082002 | 454 |
| 586 | 3300017792 | Ga0163161_10089329 | Ga0163161_100893292 | 454 |
| 587 | 3300017792 | Ga0163161_10093556 | Ga0163161_100935562 | 454 |
| 588 | 3300025207 | Ga0209760_100027 | Ga0209760_100027119 | 454 |
| 589 | 3300025207 | Ga0209760_100197 | Ga0209760_1001973 | 454 |
| 590 | 3300025224 | Ga0209784_100007 | Ga0209784_100007391 | 454 |
| 591 | 3300025225 | Ga0209566_100009 | Ga0209566_100009391 | 454 |
| 592 | 3300025226 | Ga0209674_100021 | Ga0209674_100021391 | 454 |
| 593 | 3300025229 | Ga0209147_100009 | Ga0209147_100009391 | 454 |
| 594 | 3300025230 | Ga0209563_100018 | Ga0209563_100018391 | 454 |
| 595 | 3300025230 | Ga0209563_101931 | Ga0209563_1019312 | 454 |
| 596 | 3300025231 | Ga0207427_100005 | Ga0207427_100005320 | 454 |
| 597 | 3300025231 | Ga0207427_100006 | Ga0207427_100006451 | 454 |
| 598 | 3300025233 | Ga0209437_100013 | Ga0209437_100013451 | 454 |
| 599 | 3300025233 | Ga0209437_100018 | Ga0209437_100018230 | 454 |
| 600 | 3300025233 | Ga0209437_101479 | Ga0209437_1014794 | 454 |
| 601 | 3300025242 | Ga0209258_100169 | Ga0209258_10016993 | 454 |
| 602 | 3300025246 | Ga0209646_1000184 | Ga0209646_10001849 | 454 |
| 603 | 3300025253 | Ga0209677_100012 | Ga0209677_100012391 | 454 |
| 604 | 3300025256 | Ga0209759_1010090 | Ga0209759_10100902 | 454 |
| 605 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021320 | 454 |
| 606 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022451 | 454 |
| 607 | 3300025291 | Ga0209675_1002099 | Ga0209675_100209910 | 454 |
| 608 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015421 | 454 |
| 609 | 3300025292 | Ga0209676_1000030 | Ga0209676_1000030258 | 454 |
| 610 | 3300025292 | Ga0209676_1000041 | Ga0209676_1000041182 | 454 |
| 611 | 3300025292 | Ga0209676_1005922 | Ga0209676_10059222 | 454 |
| 612 | 3300025292 | Ga0209676_1007365 | Ga0209676_10073653 | 454 |
| 613 | 3300025298 | Ga0209050_1000024 | Ga0209050_1000024182 | 454 |
| 614 | 3300025298 | Ga0209050_1000030 | Ga0209050_100003017 | 454 |
| 615 | 3300025298 | Ga0209050_1000518 | Ga0209050_100051845 | 454 |
| 616 | 3300025298 | Ga0209050_1000647 | Ga0209050_100064715 | 454 |
| 617 | 3300025303 | Ga0209051_1000012 | Ga0209051_1000012259 | 454 |
| 618 | 3300025303 | Ga0209051_1000023 | Ga0209051_100002398 | 454 |
| 619 | 3300025303 | Ga0209051_1000881 | Ga0209051_100088126 | 454 |
| 620 | 3300025303 | Ga0209051_1003155 | Ga0209051_10031556 | 454 |
| 621 | 3300025304 | Ga0209257_1000069 | Ga0209257_10000694 | 454 |
| 622 | 3300025304 | Ga0209257_1004945 | Ga0209257_10049452 | 454 |
| 623 | 3300025321 | Ga0207656_10000006 | Ga0207656_1000000675 | 454 |
| 624 | 3300025711 | Ga0207696_1000031 | Ga0207696_1000031223 | 454 |
| 625 | 3300025711 | Ga0207696_1000105 | Ga0207696_10001053 | 454 |
| 626 | 3300025711 | Ga0207696_1000541 | Ga0207696_10005416 | 454 |
| 627 | 3300025711 | Ga0207696_1008940 | Ga0207696_10089403 | 454 |
| 628 | 3300025711 | Ga0207696_1013612 | Ga0207696_10136121 | 454 |
| 629 | 3300025728 | Ga0207655_1000014 | Ga0207655_1000014423 | 454 |
| 630 | 3300025728 | Ga0207655_1000202 | Ga0207655_100020252 | 454 |
| 631 | 3300025728 | Ga0207655_1000388 | Ga0207655_100038851 | 454 |
| 632 | 3300025728 | Ga0207655_1001189 | Ga0207655_10011892 | 454 |
| 633 | 3300025728 | Ga0207655_1005954 | Ga0207655_10059547 | 454 |
| 634 | 3300025728 | Ga0207655_1007793 | Ga0207655_10077933 | 454 |
| 635 | 3300025728 | Ga0207655_1009633 | Ga0207655_10096332 | 454 |
| 636 | 3300025728 | Ga0207655_1013044 | Ga0207655_10130441 | 454 |
| 637 | 3300025728 | Ga0207655_1027790 | Ga0207655_10277902 | 454 |
| 638 | 3300025735 | Ga0207713_1000077 | Ga0207713_100007742 | 454 |
| 639 | 3300025735 | Ga0207713_1001506 | Ga0207713_10015062 | 454 |
| 640 | 3300025735 | Ga0207713_1003359 | Ga0207713_10033597 | 454 |
| 641 | 3300025735 | Ga0207713_1007874 | Ga0207713_10078744 | 454 |
| 642 | 3300025735 | Ga0207713_1019128 | Ga0207713_10191283 | 454 |
| 643 | 3300025735 | Ga0207713_1028390 | Ga0207713_10283902 | 454 |
| 644 | 3300025914 | Ga0207671_10000131 | Ga0207671_1000013131 | 454 |
| 645 | 3300025920 | Ga0207649_10000012 | Ga0207649_1000001296 | 454 |
| 646 | 3300025923 | Ga0207681_10000099 | Ga0207681_1000009947 | 454 |
| 647 | 3300025923 | Ga0207681_10008578 | Ga0207681_100085784 | 454 |
| 648 | 3300025925 | Ga0207650_10000157 | Ga0207650_1000015778 | 454 |
| 649 | 3300025925 | Ga0207650_10000185 | Ga0207650_1000018566 | 454 |
| 650 | 3300025933 | Ga0207706_10001069 | Ga0207706_100010692 | 454 |
| 651 | 3300025934 | Ga0207686_10000319 | Ga0207686_1000031919 | 454 |
| 652 | 3300025935 | Ga0207709_10000071 | Ga0207709_1000007133 | 454 |
| 653 | 3300025935 | Ga0207709_10000337 | Ga0207709_1000033742 | 454 |
| 654 | 3300025941 | Ga0207711_10056958 | Ga0207711_100569582 | 454 |
| 655 | 3300025945 | Ga0207679_10000015 | Ga0207679_1000001596 | 454 |
| 656 | 3300025961 | Ga0207712_10004516 | Ga0207712_100045166 | 454 |
| 657 | 3300025981 | Ga0207640_10072216 | Ga0207640_100722162 | 454 |
| 658 | 3300026041 | Ga0207639_10000775 | Ga0207639_1000077517 | 454 |
| 659 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016302 | 454 |
| 660 | 3300027111 | Ga0209281_1000019 | Ga0209281_1000019234 | 454 |
| 661 | 3300027111 | Ga0209281_1001944 | Ga0209281_10019445 | 454 |
| 662 | 3300027907 | Ga0207428_10027106 | Ga0207428_100271062 | 454 |
| 663 | 3300027907 | Ga0207428_10111895 | Ga0207428_101118952 | 454 |
| 664 | 3300030521 | Ga0307511_10083198 | Ga0307511_100831981 | 454 |
| 665 | 3300030733 | Ga0314311_1099326 | Ga0314311_10993263 | 454 |
| 666 | 3300030735 | Ga0316178_1008333 | Ga0316178_10083336 | 454 |
| 667 | 3300031548 | Ga0307408_100000077 | Ga0307408_10000007799 | 454 |
| 668 | 3300031548 | Ga0307408_100022947 | Ga0307408_1000229472 | 454 |
| 669 | 3300031548 | Ga0307408_100047222 | Ga0307408_1000472222 | 454 |
| 670 | 3300031731 | Ga0307405_10024462 | Ga0307405_100244622 | 454 |
| 671 | 3300031995 | Ga0307409_100129357 | Ga0307409_1001293572 | 454 |
| 672 | 3300032002 | Ga0307416_100206385 | Ga0307416_1002063851 | 454 |
| 673 | 3300032004 | Ga0307414_10016650 | Ga0307414_100166502 | 454 |
| 674 | 3300032004 | Ga0307414_10026324 | Ga0307414_100263242 | 454 |
| 675 | 3300032005 | Ga0307411_10066333 | Ga0307411_100663332 | 454 |
| 676 | 3300033180 | Ga0307510_10122871 | Ga0307510_101228711 | 454 |
| 677 | 3300038705 | Ga0237819_01098 | Ga0237819_01098_2695_4059 | 454 |
| 678 | 3300041405 | Ga0439438_004878 | Ga0439438_004878_2132_3496 | 454 |
| 679 | 3300041405 | Ga0439438_007901 | Ga0439438_007901_1478_2902 | 454 |
| 680 | 3300041407 | Ga0439447_003423 | Ga0439447_003423_3529_4893 | 454 |
| 681 | 3300041407 | Ga0439447_003817 | Ga0439447_003817_675_2099 | 454 |
| 682 | 3300041407 | Ga0439447_008152 | Ga0439447_008152_580_1944 | 454 |
| 683 | 3300041411 | Ga0439466_0000466 | Ga0439466_0000466_2498_3862 | 454 |
| 684 | 3300041411 | Ga0439466_0002245 | Ga0439466_0002245_1954_3318 | 454 |
| 685 | 3300041411 | Ga0439466_0003958 | Ga0439466_0003958_3606_4970 | 454 |
| 686 | 3300041411 | Ga0439466_0017860 | Ga0439466_0017860_624_2048 | 454 |
| 687 | 3300042006 | Ga0439432_001621 | Ga0439432_001621_2542_3906 | 454 |
| 688 | 3300042006 | Ga0439432_011624 | Ga0439432_011624_669_2093 | 454 |
| 689 | 3300042010 | Ga0439452_003753 | Ga0439452_003753_47_1411 | 454 |
| 690 | 3300042010 | Ga0439452_004104 | Ga0439452_004104_2752_4116 | 454 |
| 691 | 3300042010 | Ga0439452_004757 | Ga0439452_004757_2374_3738 | 454 |
| 692 | 3300042010 | Ga0439452_005513 | Ga0439452_005513_808_2172 | 454 |
| 693 | 3300042013 | Ga0439456_003040 | Ga0439456_003040_669_2093 | 454 |
| 694 | 3300042013 | Ga0439456_010509 | Ga0439456_010509_530_1894 | 454 |
| 695 | 3300042016 | Ga0439463_002333 | Ga0439463_002333_2745_4109 | 454 |
| 696 | 3300042016 | Ga0439463_002471 | Ga0439463_002471_505_1881 | 454 |
| 697 | 3300042115 | Ga0450911_000027 | Ga0450911_000027_14943_16316 | 454 |
| 698 | 3300042115 | Ga0450911_002622 | Ga0450911_002622_52_1416 | 454 |
| 699 | 3300042127 | Ga0450890_000509 | Ga0450890_000509_769_2133 | 454 |
| 700 | 3300042146 | Ga0450907_001254 | Ga0450907_001254_436_1860 | 454 |
| 701 | 3300042146 | Ga0450907_003651 | Ga0450907_003651_578_1942 | 454 |
| 702 | 3300042156 | Ga0439446_0017545 | Ga0439446_0017545_508_1872 | 454 |
| 703 | 3300042435 | Ga0439434_0003416 | Ga0439434_0003416_469_1893 | 454 |
| 704 | 3300042438 | Ga0439459_0012881 | Ga0439459_0012881_65_1438 | 454 |
| 705 | 3300042439 | Ga0439464_0002231 | Ga0439464_0002231_3171_4544 | 454 |
| 706 | 3300042461 | Ga0439460_0000875 | Ga0439460_0000875_447_1871 | 454 |
| 707 | 3300042530 | Ga0450916_000042 | Ga0450916_000042_2528_3901 | 454 |
| 708 | 3300044712 | Ga0453684_0012554 | Ga0453684_0012554_5606_6991 | 454 |
| 709 | 3300046452 | Ga0495617_003398 | Ga0495617_003398_1268_2632 | 454 |
| 710 | 3300046452 | Ga0495617_019767 | Ga0495617_019767_81_1445 | 454 |
| 711 | 3300046453 | Ga0495627_000102 | Ga0495627_000102_84418_85782 | 454 |
| 712 | 3300046453 | Ga0495627_004313 | Ga0495627_004313_3009_4373 | 454 |
| 713 | 3300046453 | Ga0495627_012419 | Ga0495627_012419_958_2322 | 454 |
| 714 | 3300046457 | Ga0495590_0016101 | Ga0495590_0016101_817_2181 | 454 |
| 715 | 3300046458 | Ga0495591_000105 | Ga0495591_000105_27474_28850 | 454 |
| 716 | 3300046458 | Ga0495591_003166 | Ga0495591_003166_1552_2916 | 454 |
| 717 | 3300046458 | Ga0495591_004534 | Ga0495591_004534_2588_3952 | 454 |
| 718 | 3300046458 | Ga0495591_004959 | Ga0495591_004959_2128_3492 | 454 |
| 719 | 3300046458 | Ga0495591_006424 | Ga0495591_006424_1088_2452 | 454 |
| 720 | 3300046458 | Ga0495591_014983 | Ga0495591_014983_739_2103 | 454 |
| 721 | 3300046458 | Ga0495591_015401 | Ga0495591_015401_1095_2471 | 454 |
| 722 | 3300046458 | Ga0495591_018892 | Ga0495591_018892_66_1430 | 454 |
| 723 | 3300046463 | Ga0495653_0022923 | Ga0495653_0022923_2081_3445 | 454 |
| 724 | 3300046463 | Ga0495653_0040147 | Ga0495653_0040147_184_1548 | 454 |
| 725 | 3300046463 | Ga0495653_0048713 | Ga0495653_0048713_290_1654 | 454 |
| 726 | 3300046471 | Ga0495650_0000578 | Ga0495650_0000578_38372_39736 | 454 |
| 727 | 3300046471 | Ga0495650_0015211 | Ga0495650_0015211_388_1752 | 454 |
| 728 | 3300046471 | Ga0495650_0037793 | Ga0495650_0037793_64_1440 | 454 |
| 729 | 3300046474 | Ga0495605_0000590 | Ga0495605_0000590_25463_26827 | 454 |
| 730 | 3300046474 | Ga0495605_0000625 | Ga0495605_0000625_2606_3970 | 454 |
| 731 | 3300046474 | Ga0495605_0001226 | Ga0495605_0001226_15294_16658 | 454 |
| 732 | 3300046474 | Ga0495605_0001398 | Ga0495605_0001398_13744_15108 | 454 |
| 733 | 3300046474 | Ga0495605_0010112 | Ga0495605_0010112_1416_2780 | 454 |
| 734 | 3300046474 | Ga0495605_0027479 | Ga0495605_0027479_171_1535 | 454 |
| 735 | 3300046474 | Ga0495605_0067345 | Ga0495605_0067345_155_1519 | 454 |
| 736 | 3300046475 | Ga0495639_0003111 | Ga0495639_0003111_1265_2629 | 454 |
| 737 | 3300046491 | Ga0495584_0009566 | Ga0495584_0009566_3315_4679 | 454 |
| 738 | 3300046491 | Ga0495584_0012700 | Ga0495584_0012700_346_1710 | 454 |
| 739 | 3300046492 | Ga0495585_0007063 | Ga0495585_0007063_5236_6600 | 454 |
| 740 | 3300046492 | Ga0495585_0010687 | Ga0495585_0010687_2114_3478 | 454 |
| 741 | 3300046492 | Ga0495585_0028569 | Ga0495585_0028569_460_1824 | 454 |
| 742 | 3300046500 | Ga0495596_0004395 | Ga0495596_0004395_3387_4751 | 454 |
| 743 | 3300046501 | Ga0495607_0001133 | Ga0495607_0001133_20124_21488 | 454 |
| 744 | 3300046501 | Ga0495607_0001267 | Ga0495607_0001267_2704_4068 | 454 |
| 745 | 3300046501 | Ga0495607_0004588 | Ga0495607_0004588_4758_6122 | 454 |
| 746 | 3300046501 | Ga0495607_0005049 | Ga0495607_0005049_5194_6570 | 454 |
| 747 | 3300046501 | Ga0495607_0013525 | Ga0495607_0013525_1275_2639 | 454 |
| 748 | 3300046501 | Ga0495607_0030626 | Ga0495607_0030626_1654_3030 | 454 |
| 749 | 3300046501 | Ga0495607_0039997 | Ga0495607_0039997_900_2264 | 454 |
| 750 | 3300046501 | Ga0495607_0050428 | Ga0495607_0050428_190_1554 | 454 |
| 751 | 3300046506 | Ga0495583_0000015 | Ga0495583_0000015_37470_38834 | 454 |
| 752 | 3300046506 | Ga0495583_0004981 | Ga0495583_0004981_2780_4144 | 454 |
| 753 | 3300046506 | Ga0495583_0013180 | Ga0495583_0013180_782_2146 | 454 |
| 754 | 3300046506 | Ga0495583_0016105 | Ga0495583_0016105_117_1493 | 454 |
| 755 | 3300046506 | Ga0495583_0062515 | Ga0495583_0062515_281_1645 | 454 |
| 756 | 3300046507 | Ga0495606_0000083 | Ga0495606_0000083_136298_137662 | 454 |
| 757 | 3300046507 | Ga0495606_0008185 | Ga0495606_0008185_5196_6560 | 454 |
| 758 | 3300046507 | Ga0495606_0015235 | Ga0495606_0015235_3386_4753 | 454 |
| 759 | 3300046507 | Ga0495606_0018166 | Ga0495606_0018166_3574_4938 | 454 |
| 760 | 3300046512 | Ga0495610_0009929 | Ga0495610_0009929_374_1738 | 454 |
| 761 | 3300046512 | Ga0495610_0011079 | Ga0495610_0011079_1950_3314 | 454 |
| 762 | 3300046513 | Ga0495616_0014738 | Ga0495616_0014738_1967_3331 | 454 |
| 763 | 3300046515 | Ga0495620_0000171 | Ga0495620_0000171_47297_48661 | 454 |
| 764 | 3300046515 | Ga0495620_0005486 | Ga0495620_0005486_2613_3989 | 454 |
| 765 | 3300046515 | Ga0495620_0014267 | Ga0495620_0014267_842_2206 | 454 |
| 766 | 3300046518 | Ga0495631_0004242 | Ga0495631_0004242_2134_3498 | 454 |
| 767 | 3300046518 | Ga0495631_0017782 | Ga0495631_0017782_834_2198 | 454 |
| 768 | 3300046519 | Ga0495632_0037321 | Ga0495632_0037321_761_2137 | 454 |
| 769 | 3300046519 | Ga0495632_0088007 | Ga0495632_0088007_50_1414 | 454 |
| 770 | 3300046520 | Ga0495637_0000271 | Ga0495637_0000271_22823_24187 | 454 |
| 771 | 3300046520 | Ga0495637_0002084 | Ga0495637_0002084_9782_11158 | 454 |
| 772 | 3300046520 | Ga0495637_0005947 | Ga0495637_0005947_3363_4727 | 454 |
| 773 | 3300046520 | Ga0495637_0015531 | Ga0495637_0015531_731_2095 | 454 |
| 774 | 3300046520 | Ga0495637_0019714 | Ga0495637_0019714_990_2354 | 454 |
| 775 | 3300046520 | Ga0495637_0027237 | Ga0495637_0027237_1073_2437 | 454 |
| 776 | 3300046522 | Ga0495643_0011277 | Ga0495643_0011277_3842_5206 | 454 |
| 777 | 3300046522 | Ga0495643_0017811 | Ga0495643_0017811_563_1927 | 454 |
| 778 | 3300046522 | Ga0495643_0039455 | Ga0495643_0039455_202_1578 | 454 |
| 779 | 3300046523 | Ga0495644_0005075 | Ga0495644_0005075_2955_4319 | 454 |
| 780 | 3300046524 | Ga0495648_0022554 | Ga0495648_0022554_2707_4083 | 454 |
| 781 | 3300046524 | Ga0495648_0030158 | Ga0495648_0030158_1539_2903 | 454 |
| 782 | 3300046524 | Ga0495648_0059154 | Ga0495648_0059154_707_2071 | 454 |
| 783 | 3300046528 | Ga0495642_0000631 | Ga0495642_0000631_15547_16911 | 454 |
| 784 | 3300046528 | Ga0495642_0024565 | Ga0495642_0024565_757_2121 | 454 |
| 785 | 3300046530 | Ga0495654_0005941 | Ga0495654_0005941_3291_4655 | 454 |
| 786 | 3300046530 | Ga0495654_0006795 | Ga0495654_0006795_2599_3963 | 454 |
| 787 | 3300046530 | Ga0495654_0015100 | Ga0495654_0015100_461_1837 | 454 |
| 788 | 3300046530 | Ga0495654_0021575 | Ga0495654_0021575_46_1410 | 454 |
| 789 | 3300046536 | Ga0495587_0015762 | Ga0495587_0015762_1221_2585 | 454 |
| 790 | 3300046538 | Ga0495609_0000023 | Ga0495609_0000023_204698_206062 | 454 |
| 791 | 3300046538 | Ga0495609_0000458 | Ga0495609_0000458_29291_30655 | 454 |
| 792 | 3300046538 | Ga0495609_0000759 | Ga0495609_0000759_20253_21617 | 454 |
| 793 | 3300046538 | Ga0495609_0003174 | Ga0495609_0003174_7413_8777 | 454 |
| 794 | 3300046542 | Ga0495597_0000221 | Ga0495597_0000221_48276_49652 | 454 |
| 795 | 3300046542 | Ga0495597_0005155 | Ga0495597_0005155_2605_3969 | 454 |
| 796 | 3300046557 | Ga0495622_0002873 | Ga0495622_0002873_4587_5951 | 454 |
| 797 | 3300046558 | Ga0495633_0000115 | Ga0495633_0000115_104707_106071 | 454 |
| 798 | 3300046615 | Ga0495656_0003150 | Ga0495656_0003150_1152_2516 | 454 |
| 799 | 3300046616 | Ga0495668_0009606 | Ga0495668_0009606_3218_4594 | 454 |
| 800 | 3300046616 | Ga0495668_0018591 | Ga0495668_0018591_670_2034 | 454 |
| 801 | 3300046616 | Ga0495668_0058209 | Ga0495668_0058209_122_1486 | 454 |
| 802 | 3300046616 | Ga0495668_0107117 | Ga0495668_0107117_146_1510 | 454 |
| 803 | 3300046642 | Ga0495634_0019357 | Ga0495634_0019357_783_2147 | 454 |
| 804 | 3300046648 | Ga0495611_0000749 | Ga0495611_0000749_1206_2570 | 454 |
| 805 | 3300046648 | Ga0495611_0003126 | Ga0495611_0003126_3374_4738 | 454 |
| 806 | 3300046648 | Ga0495611_0046839 | Ga0495611_0046839_167_1531 | 454 |
| 807 | 3300046660 | Ga0495625_0000187 | Ga0495625_0000187_43158_44522 | 454 |
| 808 | 3300046663 | Ga0495635_0020678 | Ga0495635_0020678_2644_4008 | 454 |
| 809 | 3300046665 | Ga0495661_0000061 | Ga0495661_0000061_69332_70699 | 454 |
| 810 | 3300046665 | Ga0495661_0000865 | Ga0495661_0000865_24211_25575 | 454 |
| 811 | 3300046665 | Ga0495661_0002054 | Ga0495661_0002054_2599_3975 | 454 |
| 812 | 3300046665 | Ga0495661_0002403 | Ga0495661_0002403_2605_3969 | 454 |
| 813 | 3300046665 | Ga0495661_0019070 | Ga0495661_0019070_949_2313 | 454 |
| 814 | 3300046665 | Ga0495661_0079958 | Ga0495661_0079958_351_1727 | 454 |
| 815 | 3300046679 | Ga0495623_0022811 | Ga0495623_0022811_528_1892 | 454 |
| 816 | 3300046691 | Ga0495670_0004412 | Ga0495670_0004412_2891_4255 | 454 |
| 817 | 3300046692 | Ga0495671_0005463 | Ga0495671_0005463_5593_6957 | 454 |
| 818 | 3300046692 | Ga0495671_0011710 | Ga0495671_0011710_822_2198 | 454 |
| 819 | 3300046694 | Ga0495649_0004778 | Ga0495649_0004778_1165_2529 | 454 |
| 820 | 3300046694 | Ga0495649_0009795 | Ga0495649_0009795_4059_5423 | 454 |
| 821 | 3300046694 | Ga0495649_0023432 | Ga0495649_0023432_375_1739 | 454 |
| 822 | 3300046794 | Ga0495589_0008703 | Ga0495589_0008703_2654_4018 | 454 |
| 823 | 3300046794 | Ga0495589_0010021 | Ga0495589_0010021_2931_4295 | 454 |
| 824 | 3300046794 | Ga0495589_0052557 | Ga0495589_0052557_295_1659 | 454 |
| 825 | 3300046809 | Ga0495600_0003343 | Ga0495600_0003343_1277_2641 | 454 |
| 826 | 3300046810 | Ga0495660_0000831 | Ga0495660_0000831_1359_2735 | 454 |
| 827 | 3300046810 | Ga0495660_0026271 | Ga0495660_0026271_1228_2592 | 454 |
| 828 | 3300046810 | Ga0495660_0045243 | Ga0495660_0045243_115_1491 | 454 |
| 829 | 3300047318 | Ga0495636_0010451 | Ga0495636_0010451_1506_2870 | 454 |
| 830 | 3300047320 | Ga0495672_0012072 | Ga0495672_0012072_1292_2656 | 454 |
| 831 | 3300047320 | Ga0495672_0036083 | Ga0495672_0036083_1268_2632 | 454 |
| 832 | 3300047320 | Ga0495672_0036806 | Ga0495672_0036806_647_2053 | 454 |
| 833 | 3300047320 | Ga0495672_0090366 | Ga0495672_0090366_273_1649 | 454 |
| 834 | 3300047321 | Ga0495676_0000011 | Ga0495676_0000011_220902_222266 | 454 |
| 835 | 3300047321 | Ga0495676_0040008 | Ga0495676_0040008_869_2233 | 454 |
| 836 | 3300047322 | Ga0495680_0014977 | Ga0495680_0014977_1401_2765 | 454 |
| 837 | 3300047322 | Ga0495680_0094802 | Ga0495680_0094802_848_2212 | 454 |
| 838 | 3300047323 | Ga0495683_0000106 | Ga0495683_0000106_47269_48633 | 454 |
| 839 | 3300047323 | Ga0495683_0000207 | Ga0495683_0000207_39861_41228 | 454 |
| 840 | 3300047323 | Ga0495683_0007048 | Ga0495683_0007048_2126_3490 | 454 |
| 841 | 3300047323 | Ga0495683_0008997 | Ga0495683_0008997_605_1969 | 454 |
| 842 | 3300047323 | Ga0495683_0012111 | Ga0495683_0012111_1235_2599 | 454 |
| 843 | 3300047443 | Ga0495687_007653 | Ga0495687_007653_3840_5204 | 454 |
| 844 | 3300047446 | Ga0495679_000274 | Ga0495679_000274_23760_25124 | 454 |
| 845 | 3300047446 | Ga0495679_000704 | Ga0495679_000704_19488_20852 | 454 |
| 846 | 3300047469 | Ga0495673_0001682 | Ga0495673_0001682_1031_2407 | 454 |
| 847 | 3300047469 | Ga0495673_0005616 | Ga0495673_0005616_1424_2800 | 454 |
| 848 | 3300047469 | Ga0495673_0007829 | Ga0495673_0007829_2130_3494 | 454 |
| 849 | 3300047469 | Ga0495673_0010604 | Ga0495673_0010604_2274_3638 | 454 |
| 850 | 3300047469 | Ga0495673_0014010 | Ga0495673_0014010_1758_3122 | 454 |
| 851 | 3300047470 | Ga0495681_0012867 | Ga0495681_0012867_2773_4137 | 454 |
| 852 | 3300047470 | Ga0495681_0018926 | Ga0495681_0018926_370_1734 | 454 |
| 853 | 3300047472 | Ga0495686_0075073 | Ga0495686_0075073_236_1600 | 454 |
| 854 | 3300047673 | Ga0495593_0014851 | Ga0495593_0014851_1472_2836 | 454 |
| 855 | 3300048091 | Ga0495626_0000068 | Ga0495626_0000068_128449_129813 | 454 |
| 856 | 3300048091 | Ga0495626_0005680 | Ga0495626_0005680_1276_2640 | 454 |
| 857 | 3300048091 | Ga0495626_0007093 | Ga0495626_0007093_1900_3264 | 454 |
| 858 | 3300048091 | Ga0495626_0008893 | Ga0495626_0008893_748_2112 | 454 |
| 859 | 3300048905 | Ga0496102_0026312 | Ga0496102_0026312_2747_4111 | 454 |
| 860 | 3300048919 | Ga0496116_0008830 | Ga0496116_0008830_4767_6131 | 454 |
| 861 | 3300048919 | Ga0496116_0018636 | Ga0496116_0018636_1124_2488 | 454 |
| 862 | 3300048919 | Ga0496116_0021869 | Ga0496116_0021869_1287_2651 | 454 |
| 863 | 3300048920 | Ga0496117_0060179 | Ga0496117_0060179_658_2022 | 454 |
| 864 | 3300048921 | Ga0496118_0068461 | Ga0496118_0068461_444_1808 | 454 |
| 865 | 3300048924 | Ga0496121_0011294 | Ga0496121_0011294_2603_3967 | 454 |
| 866 | 3300048924 | Ga0496121_0013055 | Ga0496121_0013055_5003_6379 | 454 |
| 867 | 3300048924 | Ga0496121_0020706 | Ga0496121_0020706_669_2033 | 454 |
| 868 | 3300048925 | Ga0496122_0001707 | Ga0496122_0001707_27432_28808 | 454 |
| 869 | 3300048925 | Ga0496122_0006443 | Ga0496122_0006443_2568_3932 | 454 |
| 870 | 3300048925 | Ga0496122_0019987 | Ga0496122_0019987_3465_4829 | 454 |
| 871 | 3300048925 | Ga0496122_0074921 | Ga0496122_0074921_632_1996 | 454 |
| 872 | 3300048926 | Ga0496123_0000607 | Ga0496123_0000607_28685_30061 | 454 |
| 873 | 3300048926 | Ga0496123_0042041 | Ga0496123_0042041_389_1753 | 454 |
| 874 | 3300048926 | Ga0496123_0057209 | Ga0496123_0057209_637_2001 | 454 |
| 875 | 3300048927 | Ga0496124_0000073 | Ga0496124_0000073_12498_13862 | 454 |
| 876 | 3300048927 | Ga0496124_0033513 | Ga0496124_0033513_309_1673 | 454 |
| 877 | 3300049459 | Ga0495678_000017 | Ga0495678_000017_2606_3970 | 454 |
| 878 | 3300049459 | Ga0495678_000404 | Ga0495678_000404_11223_12599 | 454 |
| 879 | 3300049459 | Ga0495678_006385 | Ga0495678_006385_2215_3579 | 454 |
| 880 | 3300049459 | Ga0495678_015394 | Ga0495678_015394_60_1424 | 454 |
| 881 | 3300049459 | Ga0495678_015771 | Ga0495678_015771_1204_2580 | 454 |
| 882 | 3300049460 | Ga0495682_0007005 | Ga0495682_0007005_2973_4337 | 454 |
| 883 | 3300049758 | Ga0501241_008201 | Ga0501241_008201_95_1459 | 454 |
| 884 | 3300049853 | Ga0501226_000001 | Ga0501226_000001_307039_308412 | 454 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gwi-assembly1.cif.gz_A | the crystal structure of halomonas elongata amino-transferase | 0.9855 | 7 | 431 |
| 7q9x-assembly1.cif.gz_AAA | crystal structure of chromobacterium violaceum aminotransferase in complex with plp-pyruvate adduct | 0.9823 | 9 | 432 |
| 4a72-assembly2.cif.gz_C | crystal structure of the omega transaminase from chromobacterium violaceum in a mixture of apo and plp-bound states | 0.9799 | 9 | 432 |
| 6snu-assembly1.cif.gz_B | crystal structure of the w60c mutant of the (s)-selective transaminase from chromobacterium violaceum | 0.9793 | 5 | 432 |
| 7ypm-assembly2.cif.gz_D | crystal structure of transaminase cc1012 complexed with plp and l-alanine | 0.9704 | 5 | 432 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ti8B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9967 | 323 | 430 | 3.90.1150.10 |
| 3hmuB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9747 | 64 | 321 | 3.40.640.10 |
| af_Q59ZF3_365_473_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9632 | 333 | 422 | 3.90.1150.10 |
| 5kquA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9612 | 64 | 319 | 3.40.640.10 |
| af_Q58696_369_458_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9599 | 339 | 425 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1AN13-F1-model_v4 | deleted | 0.9988 | 350 | 430 |
|
| AF-A0A355R1U6-F1-model_v4 | Aspartate aminotransferase family protein | 0.9935 | 178 | 431 |
GO:0005829
GO:0008483 GO:0030170 |
| AF-A0A1G3EAD8-F1-model_v4 | Aminotransferase | 0.9873 | 1 | 393 |
GO:0005829
GO:0008483 GO:0030170 |
| AF-A0A355R1U6-F1-model_v4 | Aspartate aminotransferase family protein | 0.9858 | 178 | 431 |
GO:0005829
GO:0008483 GO:0030170 |
| AF-A0A354FKU3-F1-model_v4 | Aspartate aminotransferase family protein | 0.9842 | 43 | 432 |
GO:0005829
GO:0008483 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar