F484635

General Info

Members Datasets Scaffolds Average Seq Length
884 527 630 454

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_007901|Ga0439438_007901_1478_2902
Length 474
Sequence MRRAPLMLAALSLKNLRRVRMTSNNPQTREWQTLSNDHHLAPFSDFKQLKEKGPRIITNAKGVYLWDSEGNKILDGMAGLWCVAIGYGRDELADAASKQMRELPYYNLFFQTAHPPVLELAKAISDIAPQGMNHVFFTGSGSEGNDTMLRMVRHYWAIKGQPKKKVIISRKNGYHGSTVAGASLGGMTYMHEQGDLPIPGIVHIAQPYWFAEGGEMTPEEFGVWAANQLEEKILEVGVDNVGAFIAEPIQGAGGVIIPPATYWPRIKEILAKYDILFVADEVICGFGRTGEWFGSDFYDLKPDMMTIAKGLTSGYIPMGGLIVRDEVVEVLNEGGDFNHGFTYSGHPVAAAVALENIRILREEKIIERVHAETAPYLQKRLRELSDHPLVGEVRGVGLLGAIELVQDKATRKRYEGKGAGMICRTFCFENGLIMRAVGDTMIIAPPLVITPAEIDELVTKARKCLDLTLSALQG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231024 Pseudomonas sp. GM84 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
24 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
25 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
26 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
27 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
28 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
29 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
30 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
31 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
32 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
33 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
34 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
35 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
36 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
37 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
38 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
39 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
40 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
41 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
42 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
43 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
44 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
45 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
46 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
47 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
48 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
49 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
50 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
51 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
52 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
53 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
54 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
55 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
56 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
57 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
58 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
59 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
60 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
61 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
62 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
63 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
64 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
65 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
66 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
67 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
68 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
69 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
70 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
71 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
72 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
73 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
74 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
75 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
76 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
77 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
78 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
79 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
80 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
81 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
82 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
83 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
84 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
85 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
86 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
87 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
88 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
89 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
90 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
91 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
92 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
93 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
94 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
95 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
96 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
97 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
98 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
99 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
100 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
101 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
102 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
103 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
104 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
105 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
106 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
107 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
108 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
109 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
110 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
111 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
112 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
113 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
114 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
115 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
116 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
117 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
118 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
119 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
120 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
121 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
122 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
123 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
124 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
125 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
126 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
127 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
128 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
129 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
130 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
131 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
132 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
133 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
134 2765235841 Pseudomonas putida AA7 Isolate Unclassified
135 2773857670 Pseudomonas sp. 478 Isolate Unclassified
136 2773857673 Pseudomonas sp. 443 Isolate Unclassified
137 2784132063 Pseudomonas sp. 424 Isolate Unclassified
138 2784132072 Pseudomonas sp. 460 Isolate Unclassified
139 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
140 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
141 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
142 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
143 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
144 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
145 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
146 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
147 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
148 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
149 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
150 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
151 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
152 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
153 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
154 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
155 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
156 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
157 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
158 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
159 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
160 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
161 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
162 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
163 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
164 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
165 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
166 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
167 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
168 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
169 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
170 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
171 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
172 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
173 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
174 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
175 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
176 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
177 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
178 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
179 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
180 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
181 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
182 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
183 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
184 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
185 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
186 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
187 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
188 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
189 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
190 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
191 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
192 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
193 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
194 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
195 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
196 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
197 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
198 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
199 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
200 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
201 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
202 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
203 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
204 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
205 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
206 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
207 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
208 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
209 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
210 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
211 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
212 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
213 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
214 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
215 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
216 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
217 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
218 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
219 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
220 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
221 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
222 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
223 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
224 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
225 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
226 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
227 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
228 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
229 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
230 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
231 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
232 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
233 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
234 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
235 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
236 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
237 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
238 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
239 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
240 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
241 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
242 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
243 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
244 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
245 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
246 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
247 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
248 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
249 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
250 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
251 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
252 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
253 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
254 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
255 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
256 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
257 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
258 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
259 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
260 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
261 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
262 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
263 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
264 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
265 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
266 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
267 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
268 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
269 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
270 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
271 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
272 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
273 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
274 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
275 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
276 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
277 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
278 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
279 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
280 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
281 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
282 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
283 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
284 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
285 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
286 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
287 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
288 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
289 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
290 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
291 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
292 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
293 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
294 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
295 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
296 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
297 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
298 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
299 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
300 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
301 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
302 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
303 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
304 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
305 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
306 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
312 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
313 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
315 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
316 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
318 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
319 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
321 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
322 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
353 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
354 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
356 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
357 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
358 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
359 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
360 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
361 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
362 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
363 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
364 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
365 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
366 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
367 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
368 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
369 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
370 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
371 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
372 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
373 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
374 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
375 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
376 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
377 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
378 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
379 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
380 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
381 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
382 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
383 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
384 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
385 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
386 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
387 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
388 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
389 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
390 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
391 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
392 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
393 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
394 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
395 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
396 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
397 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
398 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
399 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
400 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
401 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
402 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
403 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
404 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
405 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
406 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
407 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
408 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
409 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
410 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
411 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
412 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
413 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
414 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
415 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
416 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
417 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
418 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
419 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
420 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
421 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
422 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
423 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
424 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
425 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
426 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
427 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
428 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
429 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
430 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
431 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
432 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
433 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
434 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
435 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
436 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
437 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
438 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
439 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
440 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
441 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
442 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
443 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
444 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
445 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
446 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
447 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
448 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
449 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
450 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
451 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
452 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
453 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
454 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
455 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
456 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
457 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
458 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
459 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
460 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
461 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
462 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
463 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
464 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
465 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
466 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
467 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
468 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
469 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
470 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
471 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
472 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
473 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
474 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
475 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
476 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
477 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
478 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
479 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
480 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
481 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
486 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
487 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
488 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
489 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
490 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
491 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
492 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
493 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
494 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
495 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
496 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
497 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
498 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
499 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
500 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
501 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
502 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
503 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
504 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
505 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
506 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
507 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
508 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
509 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
510 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
511 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
512 8052494512 Pseudomonas putida LD6 Isolate Unclassified
513 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
514 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
515 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
516 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
517 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
518 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
519 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
520 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
521 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
522 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
523 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
524 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
525 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
526 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
527 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.27
Metatranscriptomes 0
Isolates 28.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.2
Nodule 3.73
Rhizoplane 8.48
Rhizosphere 60.63
Stem 0
Stem Tuber 0
Unclassified 15.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_136 2124908027 Bacteria 16261
2 SwRhRL2b_contig_180730 2162886007 Bacteria 3385
3 JGI24741J21665_1004873 3300001915 Bacteria 2898
4 JGI25156J39149_1000278 3300002705 Bacteria 34709
5 JGI25156J39149_1000973 3300002705 Bacteria 13642
6 JGI25156J39149_1009634 3300002705 Bacteria 2332
7 JGI25162J39368_1000505 3300002737 Bacteria 29260
8 JGI25162J39368_1000520 3300002737 Bacteria 28748
9 JGI25154J39366_1000221 3300002738 Bacteria 38916
10 JGI25157J39369_1000049 3300002741 Bacteria 115611
11 JGI25163J39215_1002359 3300002771 Bacteria 2003
12 JGI25164J39214_1000342 3300002772 Bacteria 29260
13 JGI25164J39214_1000350 3300002772 Bacteria 28748
14 JGI25165J46597_1000629 3300003214 Bacteria 29260
15 JGI25165J46597_1000645 3300003214 Bacteria 28748
16 rootH1_10025580 3300003323 Bacteria 2734
17 Ga0055538_1000007 3300003751 Bacteria 399715
18 Ga0055538_1000032 3300003751 Bacteria 199718
19 Ga0055539_1000043 3300003752 Bacteria 199718
20 Ga0055539_1000583 3300003752 Bacteria 10242
21 Ga0055539_1001782 3300003752 Bacteria 3705
22 Ga0055533_1000010 3300003756 Bacteria 491196
23 Ga0055533_1000052 3300003756 Bacteria 199718
24 Ga0055532_1000047 3300003758 Bacteria 179201
25 Ga0055525_1000062 3300003759 Bacteria 199718
26 Ga0055525_1000775 3300003759 Bacteria 10334
27 Ga0055535_1000607 3300003761 Bacteria 29519
28 Ga0055535_1000906 3300003761 Bacteria 20145
29 Ga0055535_1004623 3300003761 Bacteria 3274
30 Ga0055529_1000731 3300003763 Bacteria 21383
31 Ga0055536_1001013 3300003781 Bacteria 17859
32 Ga0055536_1004708 3300003781 Bacteria 6871
33 Ga0055536_1004755 3300003781 Bacteria 6817
34 Ga0055530_10000150 3300003791 Bacteria 63051
35 Ga0055530_10001395 3300003791 Bacteria 17859
36 Ga0055530_10004701 3300003791 Bacteria 6915
37 Ga0055530_10009077 3300003791 Bacteria 3872
38 Ga0055540_1000175 3300003792 Bacteria 63051
39 Ga0055540_1002862 3300003792 Bacteria 8769
40 Ga0055540_1003956 3300003792 Bacteria 6915
41 Ga0055540_1007251 3300003792 Bacteria 4230
42 Ga0055531_10008572 3300003794 Bacteria 5367
43 Ga0055541_1000030 3300003841 Bacteria 199616
44 Ga0058692_1001311 3300003856 Bacteria 9374
45 Ga0065165_1000774 3300005262 Bacteria 43046
46 Ga0065714_10003458 3300005288 Bacteria 7061
47 Ga0065714_10008011 3300005288 Bacteria 4309
48 Ga0065714_10019612 3300005288 Bacteria 1684
49 Ga0065704_10071473 3300005289 Bacteria 11003
50 Ga0065712_10000927 3300005290 Bacteria 7406
51 Ga0065712_10069335 3300005290 Bacteria 7506
52 Ga0065712_10072290 3300005290 Bacteria 4824
53 Ga0065715_10002954 3300005293 Bacteria 7366
54 Ga0070658_10136714 3300005327 Bacteria 2045
55 Ga0070670_100001953 3300005331 Bacteria 16902
56 Ga0070670_100210681 3300005331 Bacteria 1690
57 Ga0068869_100053998 3300005334 Bacteria 2923
58 Ga0070660_100097909 3300005339 Bacteria 2321
59 Ga0070661_100001640 3300005344 Bacteria 15489
60 Ga0070669_100002598 3300005353 Bacteria 13053
61 Ga0070669_100011283 3300005353 Bacteria 6344
62 Ga0070663_100034782 3300005455 Bacteria 3491
63 Ga0070662_100008312 3300005457 Bacteria 6763
64 Ga0070662_100078941 3300005457 Bacteria 2446
65 Ga0068853_100000187 3300005539 Bacteria 43749
66 Ga0070665_100078213 3300005548 Bacteria 3314
67 Ga0068855_100052495 3300005563 Bacteria 4799
68 Ga0070664_100001886 3300005564 Bacteria 16837
69 Ga0068857_100024975 3300005577 Bacteria 5263
70 Ga0068861_100040263 3300005719 Bacteria 3493
71 Ga0068851_10000007 3300005834 Bacteria 244101
72 Ga0075364_10154732 3300006051 Bacteria 1546
73 Ga0075432_10007217 3300006058 Bacteria 3782
74 Ga0075432_10009884 3300006058 Bacteria 3243
75 Ga0075432_10015661 3300006058 Bacteria 2587
76 Ga0075366_10001453 3300006195 Bacteria 11797
77 Ga0075366_10006476 3300006195 Bacteria 6421
78 Ga0075366_10006521 3300006195 Bacteria 6399
79 Ga0075370_10016883 3300006353 Bacteria 3936
80 Ga0075434_100203650 3300006871 Unclassified 1999
81 Ga0099823_1000043 3300006944 Bacteria 60786
82 Ga0099823_1000050 3300006944 Bacteria 57425
83 Ga0099823_1022982 3300006944 Bacteria 5739
84 Ga0099823_1063234 3300006944 Bacteria 1855
85 Ga0079104_1001103 3300006946 Bacteria 19997
86 Ga0079104_1003465 3300006946 Bacteria 7309
87 Ga0099826_10004877 3300006948 Bacteria 9495
88 Ga0105251_10000024 3300009011 Bacteria 133058
89 Ga0105251_10002156 3300009011 Bacteria 15794
90 Ga0105251_10004294 3300009011 Bacteria 9779
91 Ga0105251_10015050 3300009011 Bacteria 4243
92 Ga0105251_10018016 3300009011 Bacteria 3768
93 Ga0105251_10018659 3300009011 Bacteria 3681
94 Ga0105251_10054573 3300009011 Bacteria 1897
95 Ga0105244_10000265 3300009036 Bacteria 52791
96 Ga0105244_10000542 3300009036 Bacteria 33662
97 Ga0105244_10007755 3300009036 Bacteria 6793
98 Ga0105244_10014617 3300009036 Bacteria 4535
99 Ga0105244_10018100 3300009036 Bacteria 3963
100 Ga0105244_10025226 3300009036 Bacteria 3234
101 Ga0105244_10028356 3300009036 Bacteria 3005
102 Ga0105244_10080040 3300009036 Bacteria 1618
103 Ga0105250_10001113 3300009092 Bacteria 15161
104 Ga0105250_10012888 3300009092 Bacteria 3441
105 Ga0105240_10072481 3300009093 Bacteria 4257
106 Ga0111539_10344589 3300009094 Bacteria 1734
107 Ga0105243_10001572 3300009148 Bacteria 19964
108 Ga0105243_10001599 3300009148 Bacteria 19744
109 Ga0105243_10011620 3300009148 Bacteria 6660
110 Ga0105243_10052138 3300009148 Bacteria 3239
111 Ga0105243_10125045 3300009148 Bacteria 2174
112 Ga0105242_10001499 3300009176 Bacteria 18352
113 Ga0105242_10194169 3300009176 Bacteria 1799
114 Ga0105248_10007834 3300009177 Bacteria 11730
115 Ga0105237_10010598 3300009545 Bacteria 9791
116 Ga0105237_10111123 3300009545 Bacteria 2732
117 Ga0105238_10170899 3300009551 Bacteria 2150
118 Ga0105249_10007064 3300009553 Bacteria 9797
119 Ga0105239_10025926 3300010375 Bacteria 6455
120 Ga0105246_10002803 3300011119 Bacteria 10549
121 Ga0105246_10007983 3300011119 Bacteria 6497
122 Ga0105246_10011130 3300011119 Bacteria 5575
123 Ga0157337_1000729 3300012483 Bacteria 1562
124 Ga0157345_1000705 3300012498 Bacteria 2699
125 Ga0157373_10013919 3300013100 Bacteria 5900
126 Ga0157373_10033727 3300013100 Bacteria 3680
127 Ga0157373_10047177 3300013100 Bacteria 3073
128 Ga0157371_10001604 3300013102 Bacteria 23194
129 Ga0157371_10013168 3300013102 Bacteria 6296
130 Ga0157371_10013733 3300013102 Bacteria 6141
131 Ga0157371_10038069 3300013102 Bacteria 3442
132 Ga0157371_10043778 3300013102 Bacteria 3188
133 Ga0157370_10003242 3300013104 Bacteria 19198
134 Ga0157370_10003759 3300013104 Bacteria 17721
135 Ga0157370_10063716 3300013104 Bacteria 3491
136 Ga0157370_10069376 3300013104 Bacteria 3330
137 Ga0157370_10084960 3300013104 Bacteria 2973
138 Ga0157370_10135753 3300013104 Bacteria 2293
139 Ga0157369_10030463 3300013105 Bacteria 5950
140 Ga0157369_10043726 3300013105 Bacteria 4881
141 Ga0157369_10055802 3300013105 Bacteria 4263
142 Ga0157369_10122753 3300013105 Bacteria 2755
143 Ga0157369_10166556 3300013105 Bacteria 2324
144 Ga0157369_10301600 3300013105 Bacteria 1666
145 Ga0163162_10030569 3300013306 Bacteria 5337
146 Ga0157372_10015782 3300013307 Bacteria 8102
147 Ga0157375_10152615 3300013308 Bacteria 2446
148 Ga0157375_10256711 3300013308 Bacteria 1909
149 Ga0182008_10006484 3300014497 Bacteria 6535
150 Ga0182008_10007506 3300014497 Bacteria 6016
151 Ga0157379_10070294 3300014968 Bacteria 3132
152 Ga0182006_1003062 3300015261 Bacteria 8773
153 Ga0182006_1012007 3300015261 Bacteria 3794
154 Ga0182006_1030231 3300015261 Bacteria 2190
155 Ga0182006_1052089 3300015261 Bacteria 1573
156 Ga0182007_10002733 3300015262 Bacteria 8624
157 Ga0182005_1002836 3300015265 Bacteria 6038
158 Ga0182005_1003780 3300015265 Bacteria 5033
159 Ga0182005_1008200 3300015265 Bacteria 3090
160 Ga0163161_10089329 3300017792 Bacteria 2279
161 Ga0163161_10093556 3300017792 Bacteria 2227
162 Ga0213872_10000066 3300021361 Bacteria 93052
163 Ga0213872_10000187 3300021361 Bacteria 55101
164 Ga0213872_10062256 3300021361 Bacteria 1686
165 Ga0209760_100027 3300025207 Bacteria 153290
166 Ga0209760_100197 3300025207 Bacteria 29065
167 Ga0209784_100007 3300025224 Bacteria 747715
168 Ga0209566_100009 3300025225 Bacteria 554018
169 Ga0209674_100003 3300025226 Bacteria 2196646
170 Ga0209674_100021 3300025226 Bacteria 629811
171 Ga0209147_100009 3300025229 Bacteria 747409
172 Ga0209563_100018 3300025230 Bacteria 747850
173 Ga0209563_100049 3300025230 Bacteria 358472
174 Ga0209563_101931 3300025230 Bacteria 5007
175 Ga0207427_100005 3300025231 Bacteria 797999
176 Ga0207427_100006 3300025231 Bacteria 785415
177 Ga0207427_100280 3300025231 Bacteria 37213
178 Ga0209437_100013 3300025233 Bacteria 785457
179 Ga0209437_100018 3300025233 Bacteria 694400
180 Ga0209437_101479 3300025233 Bacteria 5645
181 Ga0209258_100163 3300025242 Bacteria 149677
182 Ga0209258_100169 3300025242 Bacteria 145227
183 Ga0209646_1000138 3300025246 Bacteria 114892
184 Ga0209646_1000184 3300025246 Bacteria 78423
185 Ga0209026_1000021 3300025250 Bacteria 375165
186 Ga0209677_100012 3300025253 Bacteria 554018
187 Ga0209677_100145 3300025253 Bacteria 65577
188 Ga0209677_100209 3300025253 Bacteria 45370
189 Ga0209677_107310 3300025253 Bacteria 2376
190 Ga0209759_1000025 3300025256 Bacteria 317082
191 Ga0209759_1001401 3300025256 Bacteria 13807
192 Ga0209759_1002119 3300025256 Bacteria 9190
193 Ga0209759_1010090 3300025256 Bacteria 2794
194 Ga0209759_1011333 3300025256 Bacteria 2542
195 Ga0209233_1000021 3300025261 Bacteria 798078
196 Ga0209233_1000022 3300025261 Bacteria 785415
197 Ga0209455_1000059 3300025272 Bacteria 339995
198 Ga0209673_1005874 3300025273 Bacteria 6071
199 Ga0209675_1002099 3300025291 Bacteria 10560
200 Ga0209676_1000015 3300025292 Bacteria 784458
201 Ga0209676_1000030 3300025292 Bacteria 506421
202 Ga0209676_1000041 3300025292 Bacteria 424583
203 Ga0209676_1000617 3300025292 Bacteria 51959
204 Ga0209676_1001192 3300025292 Bacteria 27932
205 Ga0209676_1005922 3300025292 Bacteria 6193
206 Ga0209676_1007365 3300025292 Bacteria 5181
207 Ga0209050_1000024 3300025298 Bacteria 533389
208 Ga0209050_1000030 3300025298 Bacteria 463381
209 Ga0209050_1000374 3300025298 Bacteria 85298
210 Ga0209050_1000518 3300025298 Bacteria 64332
211 Ga0209050_1000647 3300025298 Bacteria 54000
212 Ga0209051_1000012 3300025303 Bacteria 595474
213 Ga0209051_1000023 3300025303 Bacteria 437371
214 Ga0209051_1000881 3300025303 Bacteria 30220
215 Ga0209051_1003155 3300025303 Bacteria 11068
216 Ga0209051_1005236 3300025303 Bacteria 7659
217 Ga0209257_1000069 3300025304 Bacteria 339826
218 Ga0209257_1004945 3300025304 Bacteria 9776
219 Ga0207656_10000006 3300025321 Bacteria 395044
220 Ga0207696_1000031 3300025711 Bacteria 384169
221 Ga0207696_1000050 3300025711 Bacteria 276983
222 Ga0207696_1000105 3300025711 Bacteria 163421
223 Ga0207696_1000156 3300025711 Bacteria 112840
224 Ga0207696_1000541 3300025711 Bacteria 30663
225 Ga0207696_1008940 3300025711 Bacteria 3772
226 Ga0207696_1009541 3300025711 Bacteria 3614
227 Ga0207696_1013612 3300025711 Bacteria 2824
228 Ga0207655_1000014 3300025728 Bacteria 607124
229 Ga0207655_1000202 3300025728 Bacteria 103907
230 Ga0207655_1000216 3300025728 Bacteria 99551
231 Ga0207655_1000295 3300025728 Bacteria 75367
232 Ga0207655_1000388 3300025728 Bacteria 61513
233 Ga0207655_1001189 3300025728 Bacteria 25183
234 Ga0207655_1002393 3300025728 Bacteria 15296
235 Ga0207655_1002424 3300025728 Bacteria 15154
236 Ga0207655_1005954 3300025728 Bacteria 8168
237 Ga0207655_1007793 3300025728 Bacteria 6900
238 Ga0207655_1009633 3300025728 Bacteria 5976
239 Ga0207655_1012780 3300025728 Bacteria 4869
240 Ga0207655_1013044 3300025728 Bacteria 4798
241 Ga0207655_1020188 3300025728 Bacteria 3437
242 Ga0207655_1027790 3300025728 Bacteria 2684
243 Ga0207713_1000010 3300025735 Bacteria 528374
244 Ga0207713_1000077 3300025735 Bacteria 176517
245 Ga0207713_1001506 3300025735 Bacteria 18410
246 Ga0207713_1003359 3300025735 Bacteria 10976
247 Ga0207713_1003953 3300025735 Bacteria 9846
248 Ga0207713_1004110 3300025735 Bacteria 9590
249 Ga0207713_1004772 3300025735 Bacteria 8713
250 Ga0207713_1007874 3300025735 Bacteria 6211
251 Ga0207713_1009206 3300025735 Bacteria 5593
252 Ga0207713_1019128 3300025735 Bacteria 3363
253 Ga0207713_1028390 3300025735 Bacteria 2525
254 Ga0207705_10020837 3300025909 Bacteria 4680
255 Ga0207671_10000131 3300025914 Bacteria 116866
256 Ga0207657_10029841 3300025919 Bacteria 4957
257 Ga0207649_10000012 3300025920 Bacteria 265674
258 Ga0207681_10000099 3300025923 Bacteria 73220
259 Ga0207681_10008578 3300025923 Bacteria 6242
260 Ga0207650_10000157 3300025925 Bacteria 81959
261 Ga0207650_10000185 3300025925 Bacteria 72385
262 Ga0207650_10071195 3300025925 Bacteria 2615
263 Ga0207690_10070448 3300025932 Bacteria 2409
264 Ga0207706_10001069 3300025933 Bacteria 27808
265 Ga0207706_10009625 3300025933 Bacteria 8870
266 Ga0207686_10000319 3300025934 Bacteria 34615
267 Ga0207709_10000071 3300025935 Bacteria 181156
268 Ga0207709_10000337 3300025935 Bacteria 49221
269 Ga0207709_10045241 3300025935 Bacteria 2664
270 Ga0207709_10081986 3300025935 Bacteria 2081
271 Ga0207711_10056958 3300025941 Bacteria 3359
272 Ga0207689_10014227 3300025942 Bacteria 6771
273 Ga0207679_10000015 3300025945 Bacteria 265674
274 Ga0207667_10009539 3300025949 Bacteria 11420
275 Ga0207712_10004516 3300025961 Bacteria 8788
276 Ga0207640_10072216 3300025981 Bacteria 2327
277 Ga0207677_10180154 3300026023 Bacteria 1661
278 Ga0207639_10000775 3300026041 Bacteria 21763
279 Ga0207678_10015659 3300026067 Bacteria 6665
280 Ga0207702_10000800 3300026078 Bacteria 33369
281 Ga0207674_10043460 3300026116 Bacteria 4633
282 Ga0207675_100052490 3300026118 Bacteria 3804
283 Ga0209281_1000016 3300027111 Bacteria 588107
284 Ga0209281_1000019 3300027111 Bacteria 576164
285 Ga0209281_1001944 3300027111 Bacteria 9656
286 Ga0209389_1000017 3300027296 Bacteria 180543
287 Ga0209389_1000053 3300027296 Bacteria 108874
288 Ga0209389_1072180 3300027296 Bacteria 1862
289 Ga0209371_1000032 3300027312 Bacteria 392355
290 Ga0207428_10027106 3300027907 Bacteria 4772
291 Ga0207428_10111895 3300027907 Bacteria 2101
292 Ga0265336_10000006 3300028666 Bacteria 348453
293 Ga0307515_10023444 3300028794 Bacteria 10813
294 Ga0265324_10002529 3300029957 Bacteria 9267
295 Ga0268256_1000050 3300030500 Bacteria 300675
296 Ga0307511_10083198 3300030521 Bacteria 2231
297 Ga0314311_1099326 3300030733 Bacteria 5378
298 Ga0316178_1008333 3300030735 Bacteria 44288
299 Ga0307408_100000002 3300031548 Bacteria 827227
300 Ga0307408_100000077 3300031548 Bacteria 110022
301 Ga0307408_100022947 3300031548 Bacteria 4246
302 Ga0307408_100047222 3300031548 Bacteria 3082
303 Ga0307514_10001133 3300031649 Bacteria 36650
304 Ga0307516_10000878 3300031730 Bacteria 41335
305 Ga0307405_10024462 3300031731 Bacteria 3450
306 Ga0307409_100129357 3300031995 Bacteria 2154
307 Ga0307416_100206385 3300032002 Bacteria 1869
308 Ga0307414_10016650 3300032004 Bacteria 4475
309 Ga0307414_10026324 3300032004 Bacteria 3743
310 Ga0307411_10066333 3300032005 Bacteria 2424
311 Ga0307510_10122871 3300033180 Bacteria 2294
312 Ga0373937_0023779 3300036401 Bacteria 5524
313 Ga0373937_0119750 3300036401 Bacteria 2453
314 Ga0395905_0051786 3300037471 Bacteria 3845
315 Ga0395901_0014533 3300038443 Bacteria 8005
316 Ga0237819_01098 3300038705 Bacteria 7931
317 Ga0436361_0313405 3300039447 Bacteria 87904
318 Ga0436361_0525200 3300039447 Bacteria 11317
319 Ga0436361_0857598 3300039447 Bacteria 5129
320 Ga0436361_1024184 3300039447 Bacteria 85708
321 Ga0439438_004878 3300041405 Bacteria 5035
322 Ga0439438_006624 3300041405 Bacteria 4058
323 Ga0439438_007901 3300041405 Bacteria 3587
324 Ga0439447_003423 3300041407 Bacteria 5642
325 Ga0439447_003817 3300041407 Bacteria 5289
326 Ga0439447_008152 3300041407 Bacteria 3264
327 Ga0439466_0000466 3300041411 Bacteria 15422
328 Ga0439466_0002245 3300041411 Bacteria 7567
329 Ga0439466_0003958 3300041411 Bacteria 5714
330 Ga0439466_0017860 3300041411 Bacteria 2550
331 Ga0439432_001621 3300042006 Bacteria 8420
332 Ga0439432_005789 3300042006 Bacteria 4440
333 Ga0439432_011624 3300042006 Bacteria 3032
334 Ga0439432_019622 3300042006 Bacteria 2251
335 Ga0439452_003753 3300042010 Bacteria 5231
336 Ga0439452_004104 3300042010 Bacteria 4951
337 Ga0439452_004757 3300042010 Bacteria 4487
338 Ga0439452_005513 3300042010 Bacteria 4065
339 Ga0439456_003040 3300042013 Bacteria 3389
340 Ga0439456_010509 3300042013 Bacteria 1913
341 Ga0439463_002333 3300042016 Bacteria 4842
342 Ga0439463_002471 3300042016 Bacteria 4693
343 Ga0450911_000027 3300042115 Bacteria 82476
344 Ga0450911_000100 3300042115 Bacteria 34941
345 Ga0450911_002622 3300042115 Bacteria 3457
346 Ga0450890_000509 3300042127 Bacteria 5716
347 Ga0450905_004727 3300042142 Bacteria 1813
348 Ga0450907_001254 3300042146 Bacteria 5697
349 Ga0450907_003651 3300042146 Bacteria 2719
350 Ga0439446_0001826 3300042156 Bacteria 4980
351 Ga0439446_0017545 3300042156 Bacteria 2001
352 Ga0439434_0003416 3300042435 Bacteria 4641
353 Ga0439459_0012881 3300042438 Bacteria 1496
354 Ga0439464_0002231 3300042439 Bacteria 4739
355 Ga0439460_0000875 3300042461 Bacteria 6881
356 Ga0450916_000042 3300042530 Bacteria 6810
357 Ga0451577_0164037 3300042876 Bacteria 2002
358 Ga0466969_0009333 3300044656 Bacteria 5199
359 Ga0466965_0000692 3300044683 Bacteria 12482
360 Ga0466966_0005876 3300044684 Bacteria 8094
361 Ga0466961_0015298 3300044693 Bacteria 4927
362 Ga0466963_0057201 3300044694 Bacteria 2597
363 Ga0466964_0001646 3300044706 Bacteria 7720
364 Ga0453684_0012190 3300044712 Bacteria 14255
365 Ga0453684_0012554 3300044712 Bacteria 13945
366 Ga0466971_0006553 3300044719 Bacteria 5059
367 Ga0466957_0002678 3300044842 Bacteria 9618
368 Ga0466959_0003818 3300045049 Bacteria 9988
369 Ga0466958_0031576 3300045836 Bacteria 3148
370 Ga0466967_0058693 3300045976 Bacteria 3402
371 Ga0495617_003398 3300046452 Bacteria 5999
372 Ga0495617_019767 3300046452 Bacteria 2277
373 Ga0495627_000102 3300046453 Bacteria 104889
374 Ga0495627_004313 3300046453 Bacteria 5977
375 Ga0495627_012419 3300046453 Bacteria 3022
376 Ga0495590_0016101 3300046457 Bacteria 2704
377 Ga0495591_000105 3300046458 Bacteria 97199
378 Ga0495591_003166 3300046458 Bacteria 8682
379 Ga0495591_004534 3300046458 Bacteria 6746
380 Ga0495591_004959 3300046458 Bacteria 6303
381 Ga0495591_006424 3300046458 Bacteria 5196
382 Ga0495591_014983 3300046458 Bacteria 2757
383 Ga0495591_015401 3300046458 Bacteria 2703
384 Ga0495591_018892 3300046458 Bacteria 2324
385 Ga0495651_0146508 3300046462 Bacteria 1706
386 Ga0495653_0022923 3300046463 Bacteria 5049
387 Ga0495653_0040147 3300046463 Bacteria 3659
388 Ga0495653_0048713 3300046463 Bacteria 3269
389 Ga0495650_0000578 3300046471 Bacteria 51315
390 Ga0495650_0015211 3300046471 Bacteria 3956
391 Ga0495650_0030023 3300046471 Bacteria 2469
392 Ga0495650_0037793 3300046471 Bacteria 2097
393 Ga0495605_0000590 3300046474 Bacteria 28966
394 Ga0495605_0000625 3300046474 Bacteria 27283
395 Ga0495605_0001226 3300046474 Bacteria 17066
396 Ga0495605_0001398 3300046474 Bacteria 15876
397 Ga0495605_0010112 3300046474 Bacteria 5284
398 Ga0495605_0027479 3300046474 Bacteria 2947
399 Ga0495605_0067345 3300046474 Bacteria 1699
400 Ga0495639_0003111 3300046475 Bacteria 7214
401 Ga0495584_0009566 3300046491 Bacteria 4993
402 Ga0495584_0012700 3300046491 Bacteria 4298
403 Ga0495584_0093849 3300046491 Bacteria 1514
404 Ga0495585_0007063 3300046492 Bacteria 6904
405 Ga0495585_0010687 3300046492 Bacteria 5452
406 Ga0495585_0028569 3300046492 Bacteria 3180
407 Ga0495585_0047158 3300046492 Bacteria 2400
408 Ga0495596_0004395 3300046500 Bacteria 6880
409 Ga0495607_0001133 3300046501 Bacteria 24182
410 Ga0495607_0001267 3300046501 Bacteria 22574
411 Ga0495607_0004588 3300046501 Bacteria 10120
412 Ga0495607_0005049 3300046501 Bacteria 9572
413 Ga0495607_0013525 3300046501 Bacteria 5346
414 Ga0495607_0030626 3300046501 Bacteria 3302
415 Ga0495607_0039997 3300046501 Bacteria 2795
416 Ga0495607_0050428 3300046501 Bacteria 2422
417 Ga0495583_0000015 3300046506 Bacteria 316392
418 Ga0495583_0000927 3300046506 Bacteria 34448
419 Ga0495583_0004981 3300046506 Bacteria 9213
420 Ga0495583_0013180 3300046506 Bacteria 4627
421 Ga0495583_0016105 3300046506 Bacteria 4036
422 Ga0495583_0023578 3300046506 Bacteria 3110
423 Ga0495583_0062515 3300046506 Bacteria 1658
424 Ga0495606_0000083 3300046507 Bacteria 159263
425 Ga0495606_0003050 3300046507 Bacteria 18259
426 Ga0495606_0008185 3300046507 Bacteria 9147
427 Ga0495606_0015235 3300046507 Bacteria 5936
428 Ga0495606_0018166 3300046507 Bacteria 5285
429 Ga0495610_0009929 3300046512 Bacteria 5954
430 Ga0495610_0011079 3300046512 Bacteria 5538
431 Ga0495616_0014738 3300046513 Bacteria 4365
432 Ga0495620_0000171 3300046515 Bacteria 51260
433 Ga0495620_0000229 3300046515 Bacteria 41859
434 Ga0495620_0005486 3300046515 Bacteria 7069
435 Ga0495620_0014267 3300046515 Bacteria 4042
436 Ga0495631_0004242 3300046518 Bacteria 7670
437 Ga0495631_0017782 3300046518 Bacteria 3356
438 Ga0495632_0007443 3300046519 Bacteria 6876
439 Ga0495632_0008782 3300046519 Bacteria 6156
440 Ga0495632_0037321 3300046519 Bacteria 2466
441 Ga0495632_0088007 3300046519 Bacteria 1475
442 Ga0495637_0000271 3300046520 Bacteria 40891
443 Ga0495637_0002084 3300046520 Bacteria 11247
444 Ga0495637_0005947 3300046520 Bacteria 6169
445 Ga0495637_0015531 3300046520 Bacteria 3571
446 Ga0495637_0019714 3300046520 Bacteria 3114
447 Ga0495637_0027237 3300046520 Bacteria 2559
448 Ga0495643_0000345 3300046522 Bacteria 63090
449 Ga0495643_0000627 3300046522 Bacteria 41961
450 Ga0495643_0002030 3300046522 Bacteria 16840
451 Ga0495643_0007948 3300046522 Bacteria 6763
452 Ga0495643_0011277 3300046522 Bacteria 5453
453 Ga0495643_0012620 3300046522 Bacteria 5089
454 Ga0495643_0017811 3300046522 Bacteria 4143
455 Ga0495643_0039455 3300046522 Bacteria 2582
456 Ga0495644_0005075 3300046523 Bacteria 5152
457 Ga0495648_0013922 3300046524 Bacteria 5922
458 Ga0495648_0022554 3300046524 Bacteria 4331
459 Ga0495648_0023818 3300046524 Bacteria 4182
460 Ga0495648_0030158 3300046524 Bacteria 3590
461 Ga0495648_0059154 3300046524 Bacteria 2287
462 Ga0495642_0000631 3300046528 Bacteria 17653
463 Ga0495642_0024565 3300046528 Bacteria 2384
464 Ga0495654_0005941 3300046530 Bacteria 7014
465 Ga0495654_0006795 3300046530 Bacteria 6459
466 Ga0495654_0015100 3300046530 Bacteria 4104
467 Ga0495654_0021575 3300046530 Bacteria 3349
468 Ga0495586_0120780 3300046535 Bacteria 1464
469 Ga0495587_0015762 3300046536 Bacteria 4712
470 Ga0495609_0000023 3300046538 Bacteria 269702
471 Ga0495609_0000458 3300046538 Bacteria 33250
472 Ga0495609_0000759 3300046538 Bacteria 24242
473 Ga0495609_0003174 3300046538 Bacteria 9560
474 Ga0495597_0000221 3300046542 Bacteria 52360
475 Ga0495597_0005155 3300046542 Bacteria 6962
476 Ga0495622_0002873 3300046557 Bacteria 8224
477 Ga0495633_0000115 3300046558 Bacteria 108676
478 Ga0495656_0003150 3300046615 Bacteria 5551
479 Ga0495668_0009606 3300046616 Bacteria 5919
480 Ga0495668_0018591 3300046616 Bacteria 4015
481 Ga0495668_0058209 3300046616 Bacteria 2133
482 Ga0495668_0107117 3300046616 Bacteria 1528
483 Ga0495634_0019357 3300046642 Bacteria 4838
484 Ga0495611_0000749 3300046648 Bacteria 18315
485 Ga0495611_0003126 3300046648 Bacteria 7342
486 Ga0495611_0046839 3300046648 Bacteria 1939
487 Ga0495625_0000187 3300046660 Bacteria 97797
488 Ga0495635_0020678 3300046663 Bacteria 4584
489 Ga0495661_0000061 3300046665 Bacteria 130811
490 Ga0495661_0000865 3300046665 Bacteria 28200
491 Ga0495661_0002054 3300046665 Bacteria 15804
492 Ga0495661_0002403 3300046665 Bacteria 14449
493 Ga0495661_0019070 3300046665 Bacteria 4499
494 Ga0495661_0079958 3300046665 Bacteria 1888
495 Ga0495623_0022811 3300046679 Bacteria 4041
496 Ga0495670_0004412 3300046691 Bacteria 6902
497 Ga0495671_0005463 3300046692 Bacteria 7438
498 Ga0495671_0009031 3300046692 Bacteria 5594
499 Ga0495671_0011710 3300046692 Bacteria 4809
500 Ga0495671_0024764 3300046692 Bacteria 3122
501 Ga0495649_0000464 3300046694 Bacteria 34868
502 Ga0495649_0004778 3300046694 Bacteria 8776
503 Ga0495649_0008513 3300046694 Bacteria 6166
504 Ga0495649_0009795 3300046694 Bacteria 5673
505 Ga0495649_0023432 3300046694 Bacteria 3449
506 Ga0495589_0008703 3300046794 Bacteria 5286
507 Ga0495589_0010021 3300046794 Bacteria 4923
508 Ga0495589_0012850 3300046794 Bacteria 4328
509 Ga0495589_0052557 3300046794 Bacteria 2012
510 Ga0495600_0003343 3300046809 Bacteria 9426
511 Ga0495660_0000831 3300046810 Bacteria 22952
512 Ga0495660_0026271 3300046810 Bacteria 3301
513 Ga0495660_0045243 3300046810 Bacteria 2417
514 Ga0495636_0010451 3300047318 Bacteria 3666
515 Ga0495672_0012072 3300047320 Bacteria 6048
516 Ga0495672_0036083 3300047320 Bacteria 3038
517 Ga0495672_0036806 3300047320 Bacteria 3002
518 Ga0495672_0090366 3300047320 Bacteria 1683
519 Ga0495676_0000011 3300047321 Bacteria 242612
520 Ga0495676_0040008 3300047321 Bacteria 3874
521 Ga0495680_0014977 3300047322 Bacteria 6697
522 Ga0495680_0094802 3300047322 Bacteria 2232
523 Ga0495683_0000106 3300047323 Bacteria 86579
524 Ga0495683_0000207 3300047323 Bacteria 55998
525 Ga0495683_0007048 3300047323 Bacteria 6100
526 Ga0495683_0008997 3300047323 Bacteria 5328
527 Ga0495683_0012111 3300047323 Bacteria 4533
528 Ga0495687_007653 3300047443 Bacteria 6321
529 Ga0495679_000274 3300047446 Bacteria 43056
530 Ga0495679_000704 3300047446 Bacteria 21744
531 Ga0495673_0001682 3300047469 Bacteria 16994
532 Ga0495673_0005616 3300047469 Bacteria 7542
533 Ga0495673_0007829 3300047469 Bacteria 6080
534 Ga0495673_0010604 3300047469 Bacteria 5001
535 Ga0495673_0014010 3300047469 Bacteria 4185
536 Ga0495681_0012867 3300047470 Bacteria 4892
537 Ga0495681_0018926 3300047470 Bacteria 3777
538 Ga0495686_0003059 3300047472 Bacteria 14830
539 Ga0495686_0075073 3300047472 Bacteria 2073
540 Ga0495593_0014851 3300047673 Bacteria 4423
541 Ga0495626_0000068 3300048091 Bacteria 139126
542 Ga0495626_0005680 3300048091 Bacteria 7222
543 Ga0495626_0007093 3300048091 Bacteria 6278
544 Ga0495626_0008893 3300048091 Bacteria 5455
545 Ga0496102_0026312 3300048905 Bacteria 5188
546 Ga0496110_0019824 3300048913 Bacteria 5668
547 Ga0496114_0005705 3300048917 Bacteria 9760
548 Ga0496114_0103367 3300048917 Bacteria 2435
549 Ga0496116_0008830 3300048919 Bacteria 8682
550 Ga0496116_0018636 3300048919 Bacteria 5341
551 Ga0496116_0021869 3300048919 Bacteria 4811
552 Ga0496117_0000961 3300048920 Bacteria 44128
553 Ga0496117_0018385 3300048920 Bacteria 5789
554 Ga0496117_0038087 3300048920 Bacteria 3572
555 Ga0496117_0039315 3300048920 Bacteria 3493
556 Ga0496117_0060179 3300048920 Bacteria 2619
557 Ga0496118_0014197 3300048921 Bacteria 7469
558 Ga0496118_0016655 3300048921 Bacteria 6735
559 Ga0496118_0023180 3300048921 Bacteria 5400
560 Ga0496118_0068461 3300048921 Bacteria 2578
561 Ga0496119_0004034 3300048922 Bacteria 14828
562 Ga0496120_0003119 3300048923 Bacteria 15545
563 Ga0496121_0011294 3300048924 Bacteria 9945
564 Ga0496121_0013055 3300048924 Bacteria 8970
565 Ga0496121_0020706 3300048924 Bacteria 6490
566 Ga0496121_0021850 3300048924 Bacteria 6248
567 Ga0496122_0001707 3300048925 Bacteria 34056
568 Ga0496122_0002086 3300048925 Bacteria 29621
569 Ga0496122_0004723 3300048925 Bacteria 16722
570 Ga0496122_0006443 3300048925 Bacteria 13471
571 Ga0496122_0019987 3300048925 Bacteria 6087
572 Ga0496122_0074921 3300048925 Bacteria 2391
573 Ga0496123_0000178 3300048926 Bacteria 128587
574 Ga0496123_0000445 3300048926 Bacteria 74126
575 Ga0496123_0000607 3300048926 Bacteria 60365
576 Ga0496123_0037585 3300048926 Bacteria 3417
577 Ga0496123_0042041 3300048926 Bacteria 3160
578 Ga0496123_0057209 3300048926 Bacteria 2540
579 Ga0496124_0000073 3300048927 Bacteria 219306
580 Ga0496124_0004545 3300048927 Bacteria 16148
581 Ga0496124_0019279 3300048927 Bacteria 6356
582 Ga0496124_0022258 3300048927 Bacteria 5817
583 Ga0496124_0033513 3300048927 Bacteria 4518
584 Ga0496125_0011967 3300048928 Bacteria 8639
585 Ga0496125_0012388 3300048928 Bacteria 8469
586 Ga0496125_0103660 3300048928 Bacteria 2086
587 Ga0496125_0123922 3300048928 Bacteria 1836
588 Ga0496126_0039798 3300048929 Bacteria 4359
589 Ga0496126_0097773 3300048929 Bacteria 2572
590 Ga0496126_0178237 3300048929 Bacteria 1807
591 Ga0495678_000017 3300049459 Bacteria 282592
592 Ga0495678_000404 3300049459 Bacteria 43644
593 Ga0495678_006385 3300049459 Bacteria 6285
594 Ga0495678_015394 3300049459 Bacteria 3518
595 Ga0495678_015771 3300049459 Bacteria 3469
596 Ga0495682_0000054 3300049460 Bacteria 104787
597 Ga0495682_0000124 3300049460 Bacteria 67600
598 Ga0495682_0007005 3300049460 Bacteria 4518
599 Ga0501033_0073415 3300049570 Bacteria 2512
600 Ga0501034_0000143 3300049571 Bacteria 133317
601 Ga0501034_0000200 3300049571 Bacteria 113556
602 Ga0501039_0028547 3300049575 Bacteria 4295
603 Ga0501040_0027158 3300049576 Bacteria 3852
604 Ga0501072_0044165 3300049588 Bacteria 3504
605 Ga0501075_0010316 3300049591 Bacteria 6564
606 Ga0501076_0000757 3300049592 Bacteria 20885
607 Ga0501222_005362 3300049662 Bacteria 1732
608 Ga0501079_0001187 3300049741 Bacteria 18244
609 Ga0501080_0080217 3300049742 Bacteria 3033
610 Ga0501081_0000552 3300049743 Bacteria 21253
611 Ga0501083_0075748 3300049744 Bacteria 2234
612 Ga0501241_008201 3300049758 Bacteria 1910
613 Ga0501226_000001 3300049853 Bacteria 432595
614 nmdc:mga0k408_1301_c1 3300050493 Bacteria 13499
615 nmdc:mga0k408_41573_c1 3300050493 Bacteria 2647
616 nmdc:mga07m45_3438_c1 3300050496 Bacteria 3093
617 nmdc:mga07m45_4618_c1 3300050496 Bacteria 6752
618 nmdc:mga05p37_41370_c1 3300050507 Bacteria 5658
619 Ga0500635_0000017 3300053080 Bacteria 113720
620 Ga0500635_0013483 3300053080 Bacteria 2375
621 Ga0500578_0000683 3300053086 Bacteria 40592
622 Ga0500652_000930 3300053131 Bacteria 9670
623 Ga0500659_0003436 3300053135 Bacteria 9256
624 Ga0500559_0010928 3300053136 Bacteria 3889
625 Ga0500622_0000001 3300053156 Bacteria 657715
626 Ga0500622_0000028 3300053156 Bacteria 218994
627 Ga0500636_0045507 3300053177 Bacteria 2588
628 Ga0466962_0001425 3300061719 Bacteria 11134
629 Ga0530510_0009039 3300061734 Bacteria 6983
630 Ga0530510_0010256 3300061734 Bacteria 6564

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0120780 Ga0495586_0120780_290_1426 367
2 3300048928 Ga0496125_0103660 Ga0496125_0103660_641_1819 392
3 3300046491 Ga0495584_0093849 Ga0495584_0093849_296_1501 395
4 3300046506 Ga0495583_0023578 Ga0495583_0023578_1903_3099 398
5 3300006871 Ga0075434_100203650 Ga0075434_1002036502 435
6 3300039447 Ga0436361_0313405 Ga0436361_0313405_18332_19660 435
7 3300036401 Ga0373937_0119750 Ga0373937_0119750_409_1761 436
8 3300009094 Ga0111539_10344589 Ga0111539_103445892 443
9 3300050507 nmdc:mga05p37_41370_c1 nmdc:mga05p37_41370_c1_2576_3961 443
10 iso_pu_bacteria 2946006987 2946013297 443
11 iso_pu_bacteria 2923525760 2923526223 447
12 3300037471 Ga0395905_0051786 Ga0395905_0051786_69_1439 448
13 iso_pu_bacteria 2511231024 2511375692 448
14 iso_pu_bacteria 2554235231 2555245930 448
15 iso_pu_bacteria 2738543020 2739285133 448
16 iso_pu_bacteria 2738543021 2739290447 448
17 iso_pu_bacteria 2842805378 2842806224 448
18 iso_pu_bacteria 2912963787 2912968885 448
19 iso_pu_bacteria 2939651529 2939654226 448
20 iso_pu_bacteria 3007803356 3007803577 448
21 iso_pu_bacteria 8052494512 8052496366 448
22 iso_pu_bacteria 8056125926 8056131593 448
23 3300003751 Ga0055538_1000007 Ga0055538_1000007134 449
24 3300009011 Ga0105251_10002156 Ga0105251_100021569 449
25 3300048913 Ga0496110_0019824 Ga0496110_0019824_2483_3877 449
26 3300049570 Ga0501033_0073415 Ga0501033_0073415_35_1399 449
27 3300049575 Ga0501039_0028547 Ga0501039_0028547_496_1860 449
28 3300049576 Ga0501040_0027158 Ga0501040_0027158_2091_3455 449
29 3300049588 Ga0501072_0044165 Ga0501072_0044165_2103_3467 449
30 3300049591 Ga0501075_0010316 Ga0501075_0010316_4273_5637 449
31 3300049592 Ga0501076_0000757 Ga0501076_0000757_609_1973 449
32 3300049741 Ga0501079_0001187 Ga0501079_0001187_3715_5079 449
33 3300049742 Ga0501080_0080217 Ga0501080_0080217_1301_2665 449
34 3300049743 Ga0501081_0000552 Ga0501081_0000552_12659_14023 449
35 3300049744 Ga0501083_0075748 Ga0501083_0075748_401_1765 449
36 3300053156 Ga0500622_0000001 Ga0500622_0000001_272403_273797 449
37 3300061734 Ga0530510_0009039 Ga0530510_0009039_2895_4259 449
38 iso_pu_bacteria 2765235841 2765581401 449
39 iso_pu_bacteria 2919155634 2919155905 449
40 iso_pu_bacteria 2919501602 2919502463 449
41 iso_pu_bacteria 2926063275 2926064136 449
42 iso_pu_bacteria 8052494512 8052494845 449
43 3300005455 Ga0070663_100034782 Ga0070663_1000347822 450
44 3300026067 Ga0207678_10015659 Ga0207678_100156594 450
45 iso_pu_bacteria 2511231004 2511254009 450
46 iso_pu_bacteria 2511231006 2511266851 450
47 iso_pu_bacteria 2511231007 2511272443 450
48 iso_pu_bacteria 2511231008 2511275102 450
49 iso_pu_bacteria 2511231010 2511289394 450
50 iso_pu_bacteria 2511231011 2511297762 450
51 iso_pu_bacteria 2511231012 2511302826 450
52 iso_pu_bacteria 2511231014 2511314420 450
53 iso_pu_bacteria 2511231015 2511317222 450
54 iso_pu_bacteria 2511231016 2511328020 450
55 iso_pu_bacteria 2511231017 2511329659 450
56 iso_pu_bacteria 2511231018 2511336844 450
57 iso_pu_bacteria 2511231019 2511344807 450
58 iso_pu_bacteria 2511231020 2511349570 450
59 iso_pu_bacteria 2511231021 2511359298 450
60 iso_pu_bacteria 2511231022 2511360908 450
61 iso_pu_bacteria 2511231023 2511370984 450
62 iso_pu_bacteria 2511231031 2511413476 450
63 iso_pu_bacteria 2511231156 2511827624 450
64 iso_pu_bacteria 2512047018 2512329503 450
65 iso_pu_bacteria 2554235341 2555672825 450
66 iso_pu_bacteria 2582580891 2583795735 450
67 iso_pu_bacteria 2585428057 2587729511 450
68 iso_pu_bacteria 2585428058 2587733974 450
69 iso_pu_bacteria 2588253510 2588294591 450
70 iso_pu_bacteria 2597489887 2597860869 450
71 iso_pu_bacteria 2597489888 2597866619 450
72 iso_pu_bacteria 2597489889 2597872475 450
73 iso_pu_bacteria 2599185155 2599331154 450
74 iso_pu_bacteria 2599185160 2599355971 450
75 iso_pu_bacteria 2599185161 2599362627 450
76 iso_pu_bacteria 2599185162 2599369067 450
77 iso_pu_bacteria 2599185163 2599375736 450
78 iso_pu_bacteria 2599185164 2599381077 450
79 iso_pu_bacteria 2599185165 2599387407 450
80 iso_pu_bacteria 2599185166 2599394594 450
81 iso_pu_bacteria 2599185167 2599400550 450
82 iso_pu_bacteria 2599185168 2599406359 450
83 iso_pu_bacteria 2599185179 2599449874 450
84 iso_pu_bacteria 2599185181 2599462805 450
85 iso_pu_bacteria 2599185182 2599467772 450
86 iso_pu_bacteria 2599185185 2599485895 450
87 iso_pu_bacteria 2599185186 2599491822 450
88 iso_pu_bacteria 2599185188 2599500250 450
89 iso_pu_bacteria 2599185189 2599505741 450
90 iso_pu_bacteria 2599185190 2599511948 450
91 iso_pu_bacteria 2599185191 2599516932 450
92 iso_pu_bacteria 2599185212 2599614419 450
93 iso_pu_bacteria 2599185248 2599768162 450
94 iso_pu_bacteria 2599185257 2599804677 450
95 iso_pu_bacteria 2599185288 2599879026 450
96 iso_pu_bacteria 2599185289 2599885597 450
97 iso_pu_bacteria 2599185290 2599892690 450
98 iso_pu_bacteria 2599185291 2599897311 450
99 iso_pu_bacteria 2599185300 2599930720 450
100 iso_pu_bacteria 2599185302 2599942359 450
101 iso_pu_bacteria 2599185303 2599951440 450
102 iso_pu_bacteria 2599185304 2599954228 450
103 iso_pu_bacteria 2599185305 2599961901 450
104 iso_pu_bacteria 2599185306 2599965927 450
105 iso_pu_bacteria 2599185307 2599972217 450
106 iso_pu_bacteria 2599185308 2599980890 450
107 iso_pu_bacteria 2599185309 2599982929 450
108 iso_pu_bacteria 2599185310 2599988321 450
109 iso_pu_bacteria 2599185311 2599993980 450
110 iso_pu_bacteria 2599185312 2599999115 450
111 iso_pu_bacteria 2599185313 2600004325 450
112 iso_pu_bacteria 2599185314 2600014766 450
113 iso_pu_bacteria 2599185315 2600020386 450
114 iso_pu_bacteria 2599185316 2600026350 450
115 iso_pu_bacteria 2599185317 2600032100 450
116 iso_pu_bacteria 2599185318 2600035963 450
117 iso_pu_bacteria 2599185319 2600042327 450
118 iso_pu_bacteria 2599185320 2600046646 450
119 iso_pu_bacteria 2599185321 2600054936 450
120 iso_pu_bacteria 2599185322 2600061037 450
121 iso_pu_bacteria 2599185323 2600066379 450
122 iso_pu_bacteria 2599185324 2600074377 450
123 iso_pu_bacteria 2599185325 2600076549 450
124 iso_pu_bacteria 2599185356 2600215431 450
125 iso_pu_bacteria 2600254930 2600359003 450
126 iso_pu_bacteria 2600254931 2600363559 450
127 iso_pu_bacteria 2600255283 2601627300 450
128 iso_pu_bacteria 2600255296 2601693456 450
129 iso_pu_bacteria 2600255313 2601775597 450
130 iso_pu_bacteria 2600255318 2601798571 450
131 iso_pu_bacteria 2603880185 2606077465 450
132 iso_pu_bacteria 2603880199 2606129289 450
133 iso_pu_bacteria 2619619299 2621296857 450
134 iso_pu_bacteria 2623620443 2624483401 450
135 iso_pu_bacteria 2623620446 2624494921 450
136 iso_pu_bacteria 2643221565 2643842952 450
137 iso_pu_bacteria 2643221571 2643872253 450
138 iso_pu_bacteria 2643221589 2643955645 450
139 iso_pu_bacteria 2643221592 2643969636 450
140 iso_pu_bacteria 2643221602 2644020439 450
141 iso_pu_bacteria 2643221625 2644143936 450
142 iso_pu_bacteria 2643221633 2644184494 450
143 iso_pu_bacteria 2643221648 2644276357 450
144 iso_pu_bacteria 2643221650 2644283239 450
145 iso_pu_bacteria 2643221713 2644620156 450
146 iso_pu_bacteria 2651869719 2652544923 450
147 iso_pu_bacteria 2667528170 2671089539 450
148 iso_pu_bacteria 2667528171 2671099267 450
149 iso_pu_bacteria 2667528176 2671128595 450
150 iso_pu_bacteria 2671180172 2671771684 450
151 iso_pu_bacteria 2675903420 2677897119 450
152 iso_pu_bacteria 2675903515 2678266137 450
153 iso_pu_bacteria 2713897148 2715749842 450
154 iso_pu_bacteria 2713897149 2715754858 450
155 iso_pu_bacteria 2718217725 2718636602 450
156 iso_pu_bacteria 2721755607 2723251355 450
157 iso_pu_bacteria 2738541265 2738671677 450
158 iso_pu_bacteria 2738541271 2738691946 450
159 iso_pu_bacteria 2738541282 2738750071 450
160 iso_pu_bacteria 2738541294 2738807242 450
161 iso_pu_bacteria 2738541303 2738859111 450
162 iso_pu_bacteria 2738541309 2738894602 450
163 iso_pu_bacteria 2738543004 2739199047 450
164 iso_pu_bacteria 2738543015 2739258988 450
165 iso_pu_bacteria 2738543016 2739263304 450
166 iso_pu_bacteria 2738543020 2739289617 450
167 iso_pu_bacteria 2738543021 2739294929 450
168 iso_pu_bacteria 2738543025 2739312517 450
169 iso_pu_bacteria 2740892503 2743740411 450
170 iso_pu_bacteria 2744054620 2745007369 450
171 iso_pu_bacteria 2773857670 2774118389 450
172 iso_pu_bacteria 2773857673 2774135579 450
173 iso_pu_bacteria 2784132063 2784261830 450
174 iso_pu_bacteria 2784132072 2784313563 450
175 iso_pu_bacteria 2791355520 2794593850 450
176 iso_pu_bacteria 2808606361 2808855706 450
177 iso_pu_bacteria 2808606376 2808926499 450
178 iso_pu_bacteria 2808606377 2808928454 450
179 iso_pu_bacteria 2808606378 2808935457 450
180 iso_pu_bacteria 2808606380 2808948660 450
181 iso_pu_bacteria 2808606381 2808950363 450
182 iso_pu_bacteria 2808606382 2808959855 450
183 iso_pu_bacteria 2808606383 2808964065 450
184 iso_pu_bacteria 2808606385 2808976138 450
185 iso_pu_bacteria 2808606388 2808993238 450
186 iso_pu_bacteria 2808606389 2808999099 450
187 iso_pu_bacteria 2808606445 2809217174 450
188 iso_pu_bacteria 2816332298 2817494030 450
189 iso_pu_bacteria 2818991456 2819655119 450
190 iso_pu_bacteria 2818991464 2819704389 450
191 iso_pu_bacteria 2825651385 2825655106 450
192 iso_pu_bacteria 2834028612 2834030939 450
193 iso_pu_bacteria 2842805378 2842807777 450
194 iso_pu_bacteria 2842826826 2842831296 450
195 iso_pu_bacteria 2842832357 2842833449 450
196 iso_pu_bacteria 2842837860 2842837888 450
197 iso_pu_bacteria 2842843487 2842845679 450
198 iso_pu_bacteria 2842854478 2842855610 450
199 iso_pu_bacteria 2844665904 2844667076 450
200 iso_pu_bacteria 2852612431 2852616340 450
201 iso_pu_bacteria 2852657418 2852659666 450
202 iso_pu_bacteria 2852667396 2852671308 450
203 iso_pu_bacteria 2860339153 2860341702 450
204 iso_pu_bacteria 2860867994 2860873017 450
205 iso_pu_bacteria 2878029506 2878035343 450
206 iso_pu_bacteria 2880230671 2880235984 450
207 iso_pu_bacteria 2904518522 2904518968 450
208 iso_pu_bacteria 2904550169 2904551339 450
209 iso_pu_bacteria 2908446538 2908452570 450
210 iso_pu_bacteria 2913036834 2913042518 450
211 iso_pu_bacteria 2917070673 2917076721 450
212 iso_pu_bacteria 2919063839 2919065528 450
213 iso_pu_bacteria 2919385768 2919389200 450
214 iso_pu_bacteria 2919456309 2919457536 450
215 iso_pu_bacteria 2919481497 2919485645 450
216 iso_pu_bacteria 2919487758 2919488177 450
217 iso_pu_bacteria 2919697872 2919700587 450
218 iso_pu_bacteria 2923153595 2923159504 450
219 iso_pu_bacteria 2923586266 2923588988 450
220 iso_pu_bacteria 2929144301 2929149909 450
221 iso_pu_bacteria 2929189879 2929195139 450
222 iso_pu_bacteria 2931369376 2931372651 450
223 iso_pu_bacteria 2931390751 2931396399 450
224 iso_pu_bacteria 2931396565 2931398067 450
225 iso_pu_bacteria 2935353572 2935358312 450
226 iso_pu_bacteria 2939636861 2939640816 450
227 iso_pu_bacteria 2945928738 2945930920 450
228 iso_pu_bacteria 2945961074 2945966844 450
229 iso_pu_bacteria 2946027586 2946027892 450
230 iso_pu_bacteria 2947233263 2947234412 450
231 iso_pu_bacteria 2969304461 2969310163 450
232 iso_pu_bacteria 2974289157 2974294089 450
233 iso_pu_bacteria 2984286254 2984286612 450
234 iso_pu_bacteria 2988728565 2988731450 450
235 iso_pu_bacteria 2998139840 2998145386 450
236 iso_pu_bacteria 3007252601 3007255270 450
237 iso_pu_bacteria 3007315729 3007315928 450
238 iso_pu_bacteria 3007395558 3007399409 450
239 iso_pu_bacteria 3007419365 3007419828 450
240 iso_pu_bacteria 3007511990 3007517167 450
241 iso_pu_bacteria 3007614139 3007618520 450
242 iso_pu_bacteria 3007619802 3007622511 450
243 iso_pu_bacteria 3007718800 3007721744 450
244 iso_pu_bacteria 3007855910 3007859181 450
245 iso_pu_bacteria 3007861166 3007865113 450
246 iso_pu_bacteria 3007866637 3007866790 450
247 iso_pu_bacteria 637000220 637323262 450
248 iso_pu_bacteria 8015687852 8015693603 450
249 iso_pu_bacteria 8019769354 8019769781 450
250 iso_pu_bacteria 8019775933 8019777694 450
251 iso_pu_bacteria 8029995093 8029995515 450
252 iso_pu_bacteria 8054285046 8054287908 450
253 iso_pu_bacteria 8054347763 8054349593 450
254 iso_pu_bacteria 8054503363 8054508921 450
255 iso_pu_bacteria 8055770955 8055776849 450
256 iso_pu_bacteria 8055817908 8055823890 450
257 iso_pu_bacteria 8056131705 8056137297 450
258 iso_pu_bacteria 8056143049 8056148759 450
259 iso_pu_bacteria 8056148874 8056151505 450
260 iso_pu_bacteria 8056155041 8056160840 450
261 iso_pu_bacteria 8056161164 8056163621 450
262 iso_pu_bacteria 8056166840 8056171318 450
263 iso_pu_bacteria 8056172158 8056177420 450
264 iso_pu_bacteria 8056177738 8056181988 450
265 iso_pu_bacteria 8056569372 8056570454 450
266 3300005262 Ga0065165_1000774 Ga0065165_100077437 451
267 3300006195 Ga0075366_10001453 Ga0075366_100014536 451
268 3300006195 Ga0075366_10006476 Ga0075366_100064765 451
269 3300006195 Ga0075366_10006521 Ga0075366_100065216 451
270 3300013104 Ga0157370_10003759 Ga0157370_100037593 451
271 3300014968 Ga0157379_10070294 Ga0157379_100702942 451
272 3300025273 Ga0209673_1005874 Ga0209673_10058743 451
273 3300025298 Ga0209050_1000374 Ga0209050_100037423 451
274 3300025933 Ga0207706_10009625 Ga0207706_100096257 451
275 3300036401 Ga0373937_0023779 Ga0373937_0023779_3030_4430 451
276 3300039447 Ga0436361_0525200 Ga0436361_0525200_2072_3451 451
277 3300042115 Ga0450911_000100 Ga0450911_000100_22050_23432 451
278 3300042876 Ga0451577_0164037 Ga0451577_0164037_143_1540 451
279 3300044712 Ga0453684_0012190 Ga0453684_0012190_749_2149 451
280 3300046519 Ga0495632_0007443 Ga0495632_0007443_4990_6372 451
281 3300046522 Ga0495643_0000627 Ga0495643_0000627_24410_25783 451
282 3300046692 Ga0495671_0009031 Ga0495671_0009031_3701_5074 451
283 3300047472 Ga0495686_0003059 Ga0495686_0003059_1711_3096 451
284 3300050493 nmdc:mga0k408_1301_c1 nmdc:mga0k408_1301_c1_4801_6192 451
285 3300050493 nmdc:mga0k408_41573_c1 nmdc:mga0k408_41573_c1_1052_2434 451
286 3300053086 Ga0500578_0000683 Ga0500578_0000683_2518_3915 451
287 3300053131 Ga0500652_000930 Ga0500652_000930_5879_7261 451
288 3300053156 Ga0500622_0000028 Ga0500622_0000028_188729_190111 451
289 iso_pu_bacteria 2600254954 2600444088 451
290 iso_pu_bacteria 2600254954 2600445720 451
291 iso_pu_bacteria 2600255389 2602008427 451
292 iso_pu_bacteria 2600255389 2602012564 451
293 iso_pu_bacteria 2643221654 2644304782 451
294 iso_pu_bacteria 2808606373 2808905735 451
295 iso_pu_bacteria 2808606379 2808942154 451
296 iso_pu_bacteria 2808606379 2808942793 451
297 iso_pu_bacteria 2823421272 2823424048 451
298 iso_pu_bacteria 2823421272 2823425716 451
299 iso_pu_bacteria 2826581358 2826581927 451
300 iso_pu_bacteria 2842815866 2842816818 451
301 iso_pu_bacteria 2842849001 2842853967 451
302 iso_pu_bacteria 2919501602 2919503701 451
303 iso_pu_bacteria 2926063275 2926065727 451
304 iso_pu_bacteria 2990196909 2990199686 451
305 3300002705 JGI25156J39149_1000278 JGI25156J39149_100027826 452
306 3300002705 JGI25156J39149_1000973 JGI25156J39149_10009738 452
307 3300002705 JGI25156J39149_1009634 JGI25156J39149_10096342 452
308 3300002738 JGI25154J39366_1000221 JGI25154J39366_10002219 452
309 3300002741 JGI25157J39369_1000049 JGI25157J39369_100004933 452
310 3300003323 rootH1_10025580 rootH1_100255802 452
311 3300003752 Ga0055539_1000583 Ga0055539_10005838 452
312 3300003752 Ga0055539_1001782 Ga0055539_10017822 452
313 3300003756 Ga0055533_1000010 Ga0055533_1000010211 452
314 3300003759 Ga0055525_1000775 Ga0055525_10007752 452
315 3300003761 Ga0055535_1000607 Ga0055535_10006078 452
316 3300003761 Ga0055535_1000906 Ga0055535_100090610 452
317 3300003763 Ga0055529_1000731 Ga0055529_10007319 452
318 3300005327 Ga0070658_10136714 Ga0070658_101367142 452
319 3300005334 Ga0068869_100053998 Ga0068869_1000539981 452
320 3300005339 Ga0070660_100097909 Ga0070660_1000979092 452
321 3300005563 Ga0068855_100052495 Ga0068855_1000524953 452
322 3300005577 Ga0068857_100024975 Ga0068857_1000249755 452
323 3300005719 Ga0068861_100040263 Ga0068861_1000402633 452
324 3300006058 Ga0075432_10015661 Ga0075432_100156612 452
325 3300006353 Ga0075370_10016883 Ga0075370_100168833 452
326 3300006944 Ga0099823_1000043 Ga0099823_100004335 452
327 3300006944 Ga0099823_1000050 Ga0099823_100005034 452
328 3300006944 Ga0099823_1022982 Ga0099823_10229822 452
329 3300006944 Ga0099823_1063234 Ga0099823_10632341 452
330 3300009036 Ga0105244_10000265 Ga0105244_1000026528 452
331 3300009036 Ga0105244_10000542 Ga0105244_1000054222 452
332 3300009036 Ga0105244_10028356 Ga0105244_100283562 452
333 3300009093 Ga0105240_10072481 Ga0105240_100724814 452
334 3300009148 Ga0105243_10052138 Ga0105243_100521382 452
335 3300009176 Ga0105242_10194169 Ga0105242_101941691 452
336 3300009545 Ga0105237_10111123 Ga0105237_101111232 452
337 3300009551 Ga0105238_10170899 Ga0105238_101708992 452
338 3300010375 Ga0105239_10025926 Ga0105239_100259266 452
339 3300013105 Ga0157369_10043726 Ga0157369_100437264 452
340 3300013307 Ga0157372_10015782 Ga0157372_100157825 452
341 3300021361 Ga0213872_10000066 Ga0213872_1000006619 452
342 3300021361 Ga0213872_10000187 Ga0213872_100001876 452
343 3300021361 Ga0213872_10062256 Ga0213872_100622561 452
344 3300025226 Ga0209674_100003 Ga0209674_1000031547 452
345 3300025230 Ga0209563_100049 Ga0209563_1000499 452
346 3300025231 Ga0207427_100280 Ga0207427_10028021 452
347 3300025242 Ga0209258_100163 Ga0209258_1001639 452
348 3300025246 Ga0209646_1000138 Ga0209646_100013876 452
349 3300025250 Ga0209026_1000021 Ga0209026_1000021235 452
350 3300025253 Ga0209677_100145 Ga0209677_10014524 452
351 3300025253 Ga0209677_100209 Ga0209677_10020927 452
352 3300025253 Ga0209677_107310 Ga0209677_1073102 452
353 3300025256 Ga0209759_1000025 Ga0209759_1000025235 452
354 3300025256 Ga0209759_1001401 Ga0209759_10014016 452
355 3300025256 Ga0209759_1002119 Ga0209759_10021192 452
356 3300025256 Ga0209759_1011333 Ga0209759_10113332 452
357 3300025272 Ga0209455_1000059 Ga0209455_1000059285 452
358 3300025292 Ga0209676_1000617 Ga0209676_100061736 452
359 3300025292 Ga0209676_1001192 Ga0209676_10011922 452
360 3300025711 Ga0207696_1000050 Ga0207696_1000050100 452
361 3300025711 Ga0207696_1009541 Ga0207696_10095412 452
362 3300025728 Ga0207655_1000216 Ga0207655_100021647 452
363 3300025728 Ga0207655_1000295 Ga0207655_100029548 452
364 3300025728 Ga0207655_1002393 Ga0207655_10023933 452
365 3300025728 Ga0207655_1002424 Ga0207655_10024242 452
366 3300025728 Ga0207655_1012780 Ga0207655_10127803 452
367 3300025728 Ga0207655_1020188 Ga0207655_10201882 452
368 3300025735 Ga0207713_1003953 Ga0207713_10039533 452
369 3300025735 Ga0207713_1004110 Ga0207713_100411011 452
370 3300025735 Ga0207713_1004772 Ga0207713_10047725 452
371 3300025735 Ga0207713_1009206 Ga0207713_10092063 452
372 3300025909 Ga0207705_10020837 Ga0207705_100208374 452
373 3300025919 Ga0207657_10029841 Ga0207657_100298412 452
374 3300025925 Ga0207650_10071195 Ga0207650_100711952 452
375 3300025932 Ga0207690_10070448 Ga0207690_100704482 452
376 3300025935 Ga0207709_10045241 Ga0207709_100452411 452
377 3300025942 Ga0207689_10014227 Ga0207689_100142272 452
378 3300025949 Ga0207667_10009539 Ga0207667_100095398 452
379 3300026023 Ga0207677_10180154 Ga0207677_101801541 452
380 3300026078 Ga0207702_10000800 Ga0207702_100008003 452
381 3300026116 Ga0207674_10043460 Ga0207674_100434602 452
382 3300026118 Ga0207675_100052490 Ga0207675_1000524903 452
383 3300027296 Ga0209389_1000017 Ga0209389_100001755 452
384 3300027296 Ga0209389_1000053 Ga0209389_100005341 452
385 3300027296 Ga0209389_1072180 Ga0209389_10721802 452
386 3300028666 Ga0265336_10000006 Ga0265336_1000000639 452
387 3300028794 Ga0307515_10023444 Ga0307515_100234445 452
388 3300029957 Ga0265324_10002529 Ga0265324_100025292 452
389 3300031548 Ga0307408_100000002 Ga0307408_100000002402 452
390 3300031649 Ga0307514_10001133 Ga0307514_1000113313 452
391 3300031730 Ga0307516_10000878 Ga0307516_100008782 452
392 3300038443 Ga0395901_0014533 Ga0395901_0014533_295_1674 452
393 3300039447 Ga0436361_0857598 Ga0436361_0857598_420_1799 452
394 3300039447 Ga0436361_1024184 Ga0436361_1024184_82777_84159 452
395 3300041405 Ga0439438_006624 Ga0439438_006624_1945_3306 452
396 3300042006 Ga0439432_005789 Ga0439432_005789_817_2175 452
397 3300042006 Ga0439432_019622 Ga0439432_019622_347_1708 452
398 3300042142 Ga0450905_004727 Ga0450905_004727_38_1396 452
399 3300044656 Ga0466969_0009333 Ga0466969_0009333_3717_5093 452
400 3300044683 Ga0466965_0000692 Ga0466965_0000692_3893_5269 452
401 3300044684 Ga0466966_0005876 Ga0466966_0005876_133_1509 452
402 3300044693 Ga0466961_0015298 Ga0466961_0015298_3287_4663 452
403 3300044694 Ga0466963_0057201 Ga0466963_0057201_357_1733 452
404 3300044706 Ga0466964_0001646 Ga0466964_0001646_5858_7234 452
405 3300044719 Ga0466971_0006553 Ga0466971_0006553_2768_4144 452
406 3300044842 Ga0466957_0002678 Ga0466957_0002678_7297_8673 452
407 3300045049 Ga0466959_0003818 Ga0466959_0003818_8127_9503 452
408 3300045836 Ga0466958_0031576 Ga0466958_0031576_1698_3074 452
409 3300045976 Ga0466967_0058693 Ga0466967_0058693_1324_2700 452
410 3300046462 Ga0495651_0146508 Ga0495651_0146508_201_1580 452
411 3300046471 Ga0495650_0030023 Ga0495650_0030023_238_1617 452
412 3300046506 Ga0495583_0000927 Ga0495583_0000927_24542_25921 452
413 3300046507 Ga0495606_0003050 Ga0495606_0003050_7524_8903 452
414 3300046515 Ga0495620_0000229 Ga0495620_0000229_35999_37360 452
415 3300046519 Ga0495632_0008782 Ga0495632_0008782_4378_5739 452
416 3300046522 Ga0495643_0000345 Ga0495643_0000345_11609_12967 452
417 3300046522 Ga0495643_0002030 Ga0495643_0002030_15128_16489 452
418 3300046522 Ga0495643_0012620 Ga0495643_0012620_1751_3112 452
419 3300046524 Ga0495648_0013922 Ga0495648_0013922_4312_5673 452
420 3300046694 Ga0495649_0000464 Ga0495649_0000464_24967_26346 452
421 3300046794 Ga0495589_0012850 Ga0495589_0012850_13_1392 452
422 3300048917 Ga0496114_0005705 Ga0496114_0005705_239_1597 452
423 3300048917 Ga0496114_0103367 Ga0496114_0103367_578_1939 452
424 3300048920 Ga0496117_0000961 Ga0496117_0000961_12065_13423 452
425 3300048920 Ga0496117_0018385 Ga0496117_0018385_2367_3728 452
426 3300048920 Ga0496117_0038087 Ga0496117_0038087_510_1871 452
427 3300048920 Ga0496117_0039315 Ga0496117_0039315_1818_3179 452
428 3300048921 Ga0496118_0014197 Ga0496118_0014197_2034_3395 452
429 3300048921 Ga0496118_0016655 Ga0496118_0016655_2435_3796 452
430 3300048921 Ga0496118_0023180 Ga0496118_0023180_273_1631 452
431 3300048922 Ga0496119_0004034 Ga0496119_0004034_11329_12690 452
432 3300048923 Ga0496120_0003119 Ga0496120_0003119_12116_13477 452
433 3300048924 Ga0496121_0021850 Ga0496121_0021850_3324_4682 452
434 3300048925 Ga0496122_0002086 Ga0496122_0002086_26738_28099 452
435 3300048925 Ga0496122_0004723 Ga0496122_0004723_12037_13395 452
436 3300048926 Ga0496123_0000178 Ga0496123_0000178_5382_6743 452
437 3300048926 Ga0496123_0000445 Ga0496123_0000445_15285_16643 452
438 3300048926 Ga0496123_0037585 Ga0496123_0037585_932_2290 452
439 3300048927 Ga0496124_0004545 Ga0496124_0004545_14698_16056 452
440 3300048927 Ga0496124_0019279 Ga0496124_0019279_4497_5858 452
441 3300048927 Ga0496124_0022258 Ga0496124_0022258_2022_3395 452
442 3300048928 Ga0496125_0011967 Ga0496125_0011967_58_1416 452
443 3300048928 Ga0496125_0012388 Ga0496125_0012388_2062_3423 452
444 3300048928 Ga0496125_0123922 Ga0496125_0123922_161_1534 452
445 3300048929 Ga0496126_0039798 Ga0496126_0039798_1285_2658 452
446 3300048929 Ga0496126_0097773 Ga0496126_0097773_650_2011 452
447 3300048929 Ga0496126_0178237 Ga0496126_0178237_195_1556 452
448 3300049571 Ga0501034_0000143 Ga0501034_0000143_127238_128599 452
449 3300049571 Ga0501034_0000200 Ga0501034_0000200_69725_71083 452
450 3300049662 Ga0501222_005362 Ga0501222_005362_269_1678 452
451 3300050496 nmdc:mga07m45_3438_c1 nmdc:mga07m45_3438_c1_1591_3000 452
452 3300050496 nmdc:mga07m45_4618_c1 nmdc:mga07m45_4618_c1_817_2196 452
453 3300053080 Ga0500635_0000017 Ga0500635_0000017_92830_94209 452
454 3300053080 Ga0500635_0013483 Ga0500635_0013483_590_2032 452
455 3300053135 Ga0500659_0003436 Ga0500659_0003436_5510_6868 452
456 3300053136 Ga0500559_0010928 Ga0500559_0010928_1298_2677 452
457 3300053177 Ga0500636_0045507 Ga0500636_0045507_918_2360 452
458 3300061719 Ga0466962_0001425 Ga0466962_0001425_5503_6879 452
459 3300003792 Ga0055540_1007251 Ga0055540_10072512 453
460 3300003856 Ga0058692_1001311 Ga0058692_10013112 453
461 3300009011 Ga0105251_10000024 Ga0105251_100000244 453
462 3300009092 Ga0105250_10001113 Ga0105250_100011132 453
463 3300009148 Ga0105243_10125045 Ga0105243_101250452 453
464 3300013102 Ga0157371_10001604 Ga0157371_1000160416 453
465 3300013102 Ga0157371_10013733 Ga0157371_100137335 453
466 3300013104 Ga0157370_10003242 Ga0157370_1000324215 453
467 3300013104 Ga0157370_10135753 Ga0157370_101357532 453
468 3300015261 Ga0182006_1003062 Ga0182006_10030622 453
469 3300025303 Ga0209051_1005236 Ga0209051_10052362 453
470 3300025711 Ga0207696_1000156 Ga0207696_1000156108 453
471 3300025735 Ga0207713_1000010 Ga0207713_1000010301 453
472 3300025935 Ga0207709_10081986 Ga0207709_100819862 453
473 3300027312 Ga0209371_1000032 Ga0209371_1000032195 453
474 3300030500 Ga0268256_1000050 Ga0268256_1000050117 453
475 3300042156 Ga0439446_0001826 Ga0439446_0001826_847_2214 453
476 3300046492 Ga0495585_0047158 Ga0495585_0047158_321_1703 453
477 3300046522 Ga0495643_0007948 Ga0495643_0007948_2855_4222 453
478 3300046524 Ga0495648_0023818 Ga0495648_0023818_664_2025 453
479 3300046692 Ga0495671_0024764 Ga0495671_0024764_1003_2370 453
480 3300046694 Ga0495649_0008513 Ga0495649_0008513_3504_4871 453
481 3300049460 Ga0495682_0000054 Ga0495682_0000054_43878_45245 453
482 3300049460 Ga0495682_0000124 Ga0495682_0000124_5744_7108 453
483 3300061734 Ga0530510_0010256 Ga0530510_0010256_1958_3379 453
484 2124908027 MRS2a_Contig_136 MRS2a_00036460 454
485 2162886007 SwRhRL2b_contig_180730 SwRhRL2b_0225.00003570 454
486 3300001915 JGI24741J21665_1004873 JGI24741J21665_10048732 454
487 3300002737 JGI25162J39368_1000505 JGI25162J39368_100050526 454
488 3300002737 JGI25162J39368_1000520 JGI25162J39368_10005203 454
489 3300002771 JGI25163J39215_1002359 JGI25163J39215_10023591 454
490 3300002772 JGI25164J39214_1000342 JGI25164J39214_10003423 454
491 3300002772 JGI25164J39214_1000350 JGI25164J39214_10003503 454
492 3300003214 JGI25165J46597_1000629 JGI25165J46597_10006293 454
493 3300003214 JGI25165J46597_1000645 JGI25165J46597_10006453 454
494 3300003751 Ga0055538_1000032 Ga0055538_1000032125 454
495 3300003752 Ga0055539_1000043 Ga0055539_1000043125 454
496 3300003756 Ga0055533_1000052 Ga0055533_1000052125 454
497 3300003758 Ga0055532_1000047 Ga0055532_1000047105 454
498 3300003759 Ga0055525_1000062 Ga0055525_1000062125 454
499 3300003761 Ga0055535_1004623 Ga0055535_10046232 454
500 3300003781 Ga0055536_1001013 Ga0055536_100101315 454
501 3300003781 Ga0055536_1004708 Ga0055536_10047084 454
502 3300003781 Ga0055536_1004755 Ga0055536_10047554 454
503 3300003791 Ga0055530_10000150 Ga0055530_100001503 454
504 3300003791 Ga0055530_10001395 Ga0055530_1000139515 454
505 3300003791 Ga0055530_10004701 Ga0055530_100047014 454
506 3300003791 Ga0055530_10009077 Ga0055530_100090773 454
507 3300003792 Ga0055540_1000175 Ga0055540_10001753 454
508 3300003792 Ga0055540_1002862 Ga0055540_10028626 454
509 3300003792 Ga0055540_1003956 Ga0055540_10039564 454
510 3300003794 Ga0055531_10008572 Ga0055531_100085722 454
511 3300003841 Ga0055541_1000030 Ga0055541_1000030125 454
512 3300005288 Ga0065714_10003458 Ga0065714_100034583 454
513 3300005288 Ga0065714_10008011 Ga0065714_100080112 454
514 3300005288 Ga0065714_10019612 Ga0065714_100196121 454
515 3300005289 Ga0065704_10071473 Ga0065704_100714733 454
516 3300005290 Ga0065712_10000927 Ga0065712_100009272 454
517 3300005290 Ga0065712_10069335 Ga0065712_100693352 454
518 3300005290 Ga0065712_10072290 Ga0065712_100722904 454
519 3300005293 Ga0065715_10002954 Ga0065715_100029543 454
520 3300005331 Ga0070670_100001953 Ga0070670_1000019532 454
521 3300005331 Ga0070670_100210681 Ga0070670_1002106811 454
522 3300005344 Ga0070661_100001640 Ga0070661_1000016402 454
523 3300005353 Ga0070669_100002598 Ga0070669_1000025982 454
524 3300005353 Ga0070669_100011283 Ga0070669_1000112833 454
525 3300005457 Ga0070662_100008312 Ga0070662_1000083123 454
526 3300005457 Ga0070662_100078941 Ga0070662_1000789412 454
527 3300005539 Ga0068853_100000187 Ga0068853_10000018721 454
528 3300005548 Ga0070665_100078213 Ga0070665_1000782132 454
529 3300005564 Ga0070664_100001886 Ga0070664_10000188611 454
530 3300005834 Ga0068851_10000007 Ga0068851_1000000727 454
531 3300006051 Ga0075364_10154732 Ga0075364_101547321 454
532 3300006058 Ga0075432_10007217 Ga0075432_100072172 454
533 3300006058 Ga0075432_10009884 Ga0075432_100098842 454
534 3300006946 Ga0079104_1001103 Ga0079104_10011034 454
535 3300006946 Ga0079104_1003465 Ga0079104_10034654 454
536 3300006948 Ga0099826_10004877 Ga0099826_100048776 454
537 3300009011 Ga0105251_10004294 Ga0105251_100042946 454
538 3300009011 Ga0105251_10015050 Ga0105251_100150502 454
539 3300009011 Ga0105251_10018016 Ga0105251_100180163 454
540 3300009011 Ga0105251_10018659 Ga0105251_100186592 454
541 3300009011 Ga0105251_10054573 Ga0105251_100545731 454
542 3300009036 Ga0105244_10007755 Ga0105244_100077554 454
543 3300009036 Ga0105244_10014617 Ga0105244_100146172 454
544 3300009036 Ga0105244_10018100 Ga0105244_100181002 454
545 3300009036 Ga0105244_10025226 Ga0105244_100252262 454
546 3300009036 Ga0105244_10080040 Ga0105244_100800401 454
547 3300009092 Ga0105250_10012888 Ga0105250_100128883 454
548 3300009148 Ga0105243_10001572 Ga0105243_1000157219 454
549 3300009148 Ga0105243_10001599 Ga0105243_1000159917 454
550 3300009148 Ga0105243_10011620 Ga0105243_100116203 454
551 3300009176 Ga0105242_10001499 Ga0105242_100014997 454
552 3300009177 Ga0105248_10007834 Ga0105248_100078349 454
553 3300009545 Ga0105237_10010598 Ga0105237_100105987 454
554 3300009553 Ga0105249_10007064 Ga0105249_100070644 454
555 3300011119 Ga0105246_10002803 Ga0105246_100028032 454
556 3300011119 Ga0105246_10007983 Ga0105246_100079836 454
557 3300011119 Ga0105246_10011130 Ga0105246_100111302 454
558 3300012483 Ga0157337_1000729 Ga0157337_10007291 454
559 3300012498 Ga0157345_1000705 Ga0157345_10007052 454
560 3300013100 Ga0157373_10013919 Ga0157373_100139195 454
561 3300013100 Ga0157373_10033727 Ga0157373_100337271 454
562 3300013100 Ga0157373_10047177 Ga0157373_100471772 454
563 3300013102 Ga0157371_10013168 Ga0157371_100131685 454
564 3300013102 Ga0157371_10038069 Ga0157371_100380691 454
565 3300013102 Ga0157371_10043778 Ga0157371_100437781 454
566 3300013104 Ga0157370_10063716 Ga0157370_100637162 454
567 3300013104 Ga0157370_10069376 Ga0157370_100693763 454
568 3300013104 Ga0157370_10084960 Ga0157370_100849602 454
569 3300013105 Ga0157369_10030463 Ga0157369_100304634 454
570 3300013105 Ga0157369_10055802 Ga0157369_100558022 454
571 3300013105 Ga0157369_10122753 Ga0157369_101227531 454
572 3300013105 Ga0157369_10166556 Ga0157369_101665561 454
573 3300013105 Ga0157369_10301600 Ga0157369_103016001 454
574 3300013306 Ga0163162_10030569 Ga0163162_100305692 454
575 3300013308 Ga0157375_10152615 Ga0157375_101526152 454
576 3300013308 Ga0157375_10256711 Ga0157375_102567112 454
577 3300014497 Ga0182008_10006484 Ga0182008_100064842 454
578 3300014497 Ga0182008_10007506 Ga0182008_100075062 454
579 3300015261 Ga0182006_1012007 Ga0182006_10120073 454
580 3300015261 Ga0182006_1030231 Ga0182006_10302312 454
581 3300015261 Ga0182006_1052089 Ga0182006_10520892 454
582 3300015262 Ga0182007_10002733 Ga0182007_100027334 454
583 3300015265 Ga0182005_1002836 Ga0182005_10028362 454
584 3300015265 Ga0182005_1003780 Ga0182005_10037801 454
585 3300015265 Ga0182005_1008200 Ga0182005_10082002 454
586 3300017792 Ga0163161_10089329 Ga0163161_100893292 454
587 3300017792 Ga0163161_10093556 Ga0163161_100935562 454
588 3300025207 Ga0209760_100027 Ga0209760_100027119 454
589 3300025207 Ga0209760_100197 Ga0209760_1001973 454
590 3300025224 Ga0209784_100007 Ga0209784_100007391 454
591 3300025225 Ga0209566_100009 Ga0209566_100009391 454
592 3300025226 Ga0209674_100021 Ga0209674_100021391 454
593 3300025229 Ga0209147_100009 Ga0209147_100009391 454
594 3300025230 Ga0209563_100018 Ga0209563_100018391 454
595 3300025230 Ga0209563_101931 Ga0209563_1019312 454
596 3300025231 Ga0207427_100005 Ga0207427_100005320 454
597 3300025231 Ga0207427_100006 Ga0207427_100006451 454
598 3300025233 Ga0209437_100013 Ga0209437_100013451 454
599 3300025233 Ga0209437_100018 Ga0209437_100018230 454
600 3300025233 Ga0209437_101479 Ga0209437_1014794 454
601 3300025242 Ga0209258_100169 Ga0209258_10016993 454
602 3300025246 Ga0209646_1000184 Ga0209646_10001849 454
603 3300025253 Ga0209677_100012 Ga0209677_100012391 454
604 3300025256 Ga0209759_1010090 Ga0209759_10100902 454
605 3300025261 Ga0209233_1000021 Ga0209233_1000021320 454
606 3300025261 Ga0209233_1000022 Ga0209233_1000022451 454
607 3300025291 Ga0209675_1002099 Ga0209675_100209910 454
608 3300025292 Ga0209676_1000015 Ga0209676_1000015421 454
609 3300025292 Ga0209676_1000030 Ga0209676_1000030258 454
610 3300025292 Ga0209676_1000041 Ga0209676_1000041182 454
611 3300025292 Ga0209676_1005922 Ga0209676_10059222 454
612 3300025292 Ga0209676_1007365 Ga0209676_10073653 454
613 3300025298 Ga0209050_1000024 Ga0209050_1000024182 454
614 3300025298 Ga0209050_1000030 Ga0209050_100003017 454
615 3300025298 Ga0209050_1000518 Ga0209050_100051845 454
616 3300025298 Ga0209050_1000647 Ga0209050_100064715 454
617 3300025303 Ga0209051_1000012 Ga0209051_1000012259 454
618 3300025303 Ga0209051_1000023 Ga0209051_100002398 454
619 3300025303 Ga0209051_1000881 Ga0209051_100088126 454
620 3300025303 Ga0209051_1003155 Ga0209051_10031556 454
621 3300025304 Ga0209257_1000069 Ga0209257_10000694 454
622 3300025304 Ga0209257_1004945 Ga0209257_10049452 454
623 3300025321 Ga0207656_10000006 Ga0207656_1000000675 454
624 3300025711 Ga0207696_1000031 Ga0207696_1000031223 454
625 3300025711 Ga0207696_1000105 Ga0207696_10001053 454
626 3300025711 Ga0207696_1000541 Ga0207696_10005416 454
627 3300025711 Ga0207696_1008940 Ga0207696_10089403 454
628 3300025711 Ga0207696_1013612 Ga0207696_10136121 454
629 3300025728 Ga0207655_1000014 Ga0207655_1000014423 454
630 3300025728 Ga0207655_1000202 Ga0207655_100020252 454
631 3300025728 Ga0207655_1000388 Ga0207655_100038851 454
632 3300025728 Ga0207655_1001189 Ga0207655_10011892 454
633 3300025728 Ga0207655_1005954 Ga0207655_10059547 454
634 3300025728 Ga0207655_1007793 Ga0207655_10077933 454
635 3300025728 Ga0207655_1009633 Ga0207655_10096332 454
636 3300025728 Ga0207655_1013044 Ga0207655_10130441 454
637 3300025728 Ga0207655_1027790 Ga0207655_10277902 454
638 3300025735 Ga0207713_1000077 Ga0207713_100007742 454
639 3300025735 Ga0207713_1001506 Ga0207713_10015062 454
640 3300025735 Ga0207713_1003359 Ga0207713_10033597 454
641 3300025735 Ga0207713_1007874 Ga0207713_10078744 454
642 3300025735 Ga0207713_1019128 Ga0207713_10191283 454
643 3300025735 Ga0207713_1028390 Ga0207713_10283902 454
644 3300025914 Ga0207671_10000131 Ga0207671_1000013131 454
645 3300025920 Ga0207649_10000012 Ga0207649_1000001296 454
646 3300025923 Ga0207681_10000099 Ga0207681_1000009947 454
647 3300025923 Ga0207681_10008578 Ga0207681_100085784 454
648 3300025925 Ga0207650_10000157 Ga0207650_1000015778 454
649 3300025925 Ga0207650_10000185 Ga0207650_1000018566 454
650 3300025933 Ga0207706_10001069 Ga0207706_100010692 454
651 3300025934 Ga0207686_10000319 Ga0207686_1000031919 454
652 3300025935 Ga0207709_10000071 Ga0207709_1000007133 454
653 3300025935 Ga0207709_10000337 Ga0207709_1000033742 454
654 3300025941 Ga0207711_10056958 Ga0207711_100569582 454
655 3300025945 Ga0207679_10000015 Ga0207679_1000001596 454
656 3300025961 Ga0207712_10004516 Ga0207712_100045166 454
657 3300025981 Ga0207640_10072216 Ga0207640_100722162 454
658 3300026041 Ga0207639_10000775 Ga0207639_1000077517 454
659 3300027111 Ga0209281_1000016 Ga0209281_1000016302 454
660 3300027111 Ga0209281_1000019 Ga0209281_1000019234 454
661 3300027111 Ga0209281_1001944 Ga0209281_10019445 454
662 3300027907 Ga0207428_10027106 Ga0207428_100271062 454
663 3300027907 Ga0207428_10111895 Ga0207428_101118952 454
664 3300030521 Ga0307511_10083198 Ga0307511_100831981 454
665 3300030733 Ga0314311_1099326 Ga0314311_10993263 454
666 3300030735 Ga0316178_1008333 Ga0316178_10083336 454
667 3300031548 Ga0307408_100000077 Ga0307408_10000007799 454
668 3300031548 Ga0307408_100022947 Ga0307408_1000229472 454
669 3300031548 Ga0307408_100047222 Ga0307408_1000472222 454
670 3300031731 Ga0307405_10024462 Ga0307405_100244622 454
671 3300031995 Ga0307409_100129357 Ga0307409_1001293572 454
672 3300032002 Ga0307416_100206385 Ga0307416_1002063851 454
673 3300032004 Ga0307414_10016650 Ga0307414_100166502 454
674 3300032004 Ga0307414_10026324 Ga0307414_100263242 454
675 3300032005 Ga0307411_10066333 Ga0307411_100663332 454
676 3300033180 Ga0307510_10122871 Ga0307510_101228711 454
677 3300038705 Ga0237819_01098 Ga0237819_01098_2695_4059 454
678 3300041405 Ga0439438_004878 Ga0439438_004878_2132_3496 454
679 3300041405 Ga0439438_007901 Ga0439438_007901_1478_2902 454
680 3300041407 Ga0439447_003423 Ga0439447_003423_3529_4893 454
681 3300041407 Ga0439447_003817 Ga0439447_003817_675_2099 454
682 3300041407 Ga0439447_008152 Ga0439447_008152_580_1944 454
683 3300041411 Ga0439466_0000466 Ga0439466_0000466_2498_3862 454
684 3300041411 Ga0439466_0002245 Ga0439466_0002245_1954_3318 454
685 3300041411 Ga0439466_0003958 Ga0439466_0003958_3606_4970 454
686 3300041411 Ga0439466_0017860 Ga0439466_0017860_624_2048 454
687 3300042006 Ga0439432_001621 Ga0439432_001621_2542_3906 454
688 3300042006 Ga0439432_011624 Ga0439432_011624_669_2093 454
689 3300042010 Ga0439452_003753 Ga0439452_003753_47_1411 454
690 3300042010 Ga0439452_004104 Ga0439452_004104_2752_4116 454
691 3300042010 Ga0439452_004757 Ga0439452_004757_2374_3738 454
692 3300042010 Ga0439452_005513 Ga0439452_005513_808_2172 454
693 3300042013 Ga0439456_003040 Ga0439456_003040_669_2093 454
694 3300042013 Ga0439456_010509 Ga0439456_010509_530_1894 454
695 3300042016 Ga0439463_002333 Ga0439463_002333_2745_4109 454
696 3300042016 Ga0439463_002471 Ga0439463_002471_505_1881 454
697 3300042115 Ga0450911_000027 Ga0450911_000027_14943_16316 454
698 3300042115 Ga0450911_002622 Ga0450911_002622_52_1416 454
699 3300042127 Ga0450890_000509 Ga0450890_000509_769_2133 454
700 3300042146 Ga0450907_001254 Ga0450907_001254_436_1860 454
701 3300042146 Ga0450907_003651 Ga0450907_003651_578_1942 454
702 3300042156 Ga0439446_0017545 Ga0439446_0017545_508_1872 454
703 3300042435 Ga0439434_0003416 Ga0439434_0003416_469_1893 454
704 3300042438 Ga0439459_0012881 Ga0439459_0012881_65_1438 454
705 3300042439 Ga0439464_0002231 Ga0439464_0002231_3171_4544 454
706 3300042461 Ga0439460_0000875 Ga0439460_0000875_447_1871 454
707 3300042530 Ga0450916_000042 Ga0450916_000042_2528_3901 454
708 3300044712 Ga0453684_0012554 Ga0453684_0012554_5606_6991 454
709 3300046452 Ga0495617_003398 Ga0495617_003398_1268_2632 454
710 3300046452 Ga0495617_019767 Ga0495617_019767_81_1445 454
711 3300046453 Ga0495627_000102 Ga0495627_000102_84418_85782 454
712 3300046453 Ga0495627_004313 Ga0495627_004313_3009_4373 454
713 3300046453 Ga0495627_012419 Ga0495627_012419_958_2322 454
714 3300046457 Ga0495590_0016101 Ga0495590_0016101_817_2181 454
715 3300046458 Ga0495591_000105 Ga0495591_000105_27474_28850 454
716 3300046458 Ga0495591_003166 Ga0495591_003166_1552_2916 454
717 3300046458 Ga0495591_004534 Ga0495591_004534_2588_3952 454
718 3300046458 Ga0495591_004959 Ga0495591_004959_2128_3492 454
719 3300046458 Ga0495591_006424 Ga0495591_006424_1088_2452 454
720 3300046458 Ga0495591_014983 Ga0495591_014983_739_2103 454
721 3300046458 Ga0495591_015401 Ga0495591_015401_1095_2471 454
722 3300046458 Ga0495591_018892 Ga0495591_018892_66_1430 454
723 3300046463 Ga0495653_0022923 Ga0495653_0022923_2081_3445 454
724 3300046463 Ga0495653_0040147 Ga0495653_0040147_184_1548 454
725 3300046463 Ga0495653_0048713 Ga0495653_0048713_290_1654 454
726 3300046471 Ga0495650_0000578 Ga0495650_0000578_38372_39736 454
727 3300046471 Ga0495650_0015211 Ga0495650_0015211_388_1752 454
728 3300046471 Ga0495650_0037793 Ga0495650_0037793_64_1440 454
729 3300046474 Ga0495605_0000590 Ga0495605_0000590_25463_26827 454
730 3300046474 Ga0495605_0000625 Ga0495605_0000625_2606_3970 454
731 3300046474 Ga0495605_0001226 Ga0495605_0001226_15294_16658 454
732 3300046474 Ga0495605_0001398 Ga0495605_0001398_13744_15108 454
733 3300046474 Ga0495605_0010112 Ga0495605_0010112_1416_2780 454
734 3300046474 Ga0495605_0027479 Ga0495605_0027479_171_1535 454
735 3300046474 Ga0495605_0067345 Ga0495605_0067345_155_1519 454
736 3300046475 Ga0495639_0003111 Ga0495639_0003111_1265_2629 454
737 3300046491 Ga0495584_0009566 Ga0495584_0009566_3315_4679 454
738 3300046491 Ga0495584_0012700 Ga0495584_0012700_346_1710 454
739 3300046492 Ga0495585_0007063 Ga0495585_0007063_5236_6600 454
740 3300046492 Ga0495585_0010687 Ga0495585_0010687_2114_3478 454
741 3300046492 Ga0495585_0028569 Ga0495585_0028569_460_1824 454
742 3300046500 Ga0495596_0004395 Ga0495596_0004395_3387_4751 454
743 3300046501 Ga0495607_0001133 Ga0495607_0001133_20124_21488 454
744 3300046501 Ga0495607_0001267 Ga0495607_0001267_2704_4068 454
745 3300046501 Ga0495607_0004588 Ga0495607_0004588_4758_6122 454
746 3300046501 Ga0495607_0005049 Ga0495607_0005049_5194_6570 454
747 3300046501 Ga0495607_0013525 Ga0495607_0013525_1275_2639 454
748 3300046501 Ga0495607_0030626 Ga0495607_0030626_1654_3030 454
749 3300046501 Ga0495607_0039997 Ga0495607_0039997_900_2264 454
750 3300046501 Ga0495607_0050428 Ga0495607_0050428_190_1554 454
751 3300046506 Ga0495583_0000015 Ga0495583_0000015_37470_38834 454
752 3300046506 Ga0495583_0004981 Ga0495583_0004981_2780_4144 454
753 3300046506 Ga0495583_0013180 Ga0495583_0013180_782_2146 454
754 3300046506 Ga0495583_0016105 Ga0495583_0016105_117_1493 454
755 3300046506 Ga0495583_0062515 Ga0495583_0062515_281_1645 454
756 3300046507 Ga0495606_0000083 Ga0495606_0000083_136298_137662 454
757 3300046507 Ga0495606_0008185 Ga0495606_0008185_5196_6560 454
758 3300046507 Ga0495606_0015235 Ga0495606_0015235_3386_4753 454
759 3300046507 Ga0495606_0018166 Ga0495606_0018166_3574_4938 454
760 3300046512 Ga0495610_0009929 Ga0495610_0009929_374_1738 454
761 3300046512 Ga0495610_0011079 Ga0495610_0011079_1950_3314 454
762 3300046513 Ga0495616_0014738 Ga0495616_0014738_1967_3331 454
763 3300046515 Ga0495620_0000171 Ga0495620_0000171_47297_48661 454
764 3300046515 Ga0495620_0005486 Ga0495620_0005486_2613_3989 454
765 3300046515 Ga0495620_0014267 Ga0495620_0014267_842_2206 454
766 3300046518 Ga0495631_0004242 Ga0495631_0004242_2134_3498 454
767 3300046518 Ga0495631_0017782 Ga0495631_0017782_834_2198 454
768 3300046519 Ga0495632_0037321 Ga0495632_0037321_761_2137 454
769 3300046519 Ga0495632_0088007 Ga0495632_0088007_50_1414 454
770 3300046520 Ga0495637_0000271 Ga0495637_0000271_22823_24187 454
771 3300046520 Ga0495637_0002084 Ga0495637_0002084_9782_11158 454
772 3300046520 Ga0495637_0005947 Ga0495637_0005947_3363_4727 454
773 3300046520 Ga0495637_0015531 Ga0495637_0015531_731_2095 454
774 3300046520 Ga0495637_0019714 Ga0495637_0019714_990_2354 454
775 3300046520 Ga0495637_0027237 Ga0495637_0027237_1073_2437 454
776 3300046522 Ga0495643_0011277 Ga0495643_0011277_3842_5206 454
777 3300046522 Ga0495643_0017811 Ga0495643_0017811_563_1927 454
778 3300046522 Ga0495643_0039455 Ga0495643_0039455_202_1578 454
779 3300046523 Ga0495644_0005075 Ga0495644_0005075_2955_4319 454
780 3300046524 Ga0495648_0022554 Ga0495648_0022554_2707_4083 454
781 3300046524 Ga0495648_0030158 Ga0495648_0030158_1539_2903 454
782 3300046524 Ga0495648_0059154 Ga0495648_0059154_707_2071 454
783 3300046528 Ga0495642_0000631 Ga0495642_0000631_15547_16911 454
784 3300046528 Ga0495642_0024565 Ga0495642_0024565_757_2121 454
785 3300046530 Ga0495654_0005941 Ga0495654_0005941_3291_4655 454
786 3300046530 Ga0495654_0006795 Ga0495654_0006795_2599_3963 454
787 3300046530 Ga0495654_0015100 Ga0495654_0015100_461_1837 454
788 3300046530 Ga0495654_0021575 Ga0495654_0021575_46_1410 454
789 3300046536 Ga0495587_0015762 Ga0495587_0015762_1221_2585 454
790 3300046538 Ga0495609_0000023 Ga0495609_0000023_204698_206062 454
791 3300046538 Ga0495609_0000458 Ga0495609_0000458_29291_30655 454
792 3300046538 Ga0495609_0000759 Ga0495609_0000759_20253_21617 454
793 3300046538 Ga0495609_0003174 Ga0495609_0003174_7413_8777 454
794 3300046542 Ga0495597_0000221 Ga0495597_0000221_48276_49652 454
795 3300046542 Ga0495597_0005155 Ga0495597_0005155_2605_3969 454
796 3300046557 Ga0495622_0002873 Ga0495622_0002873_4587_5951 454
797 3300046558 Ga0495633_0000115 Ga0495633_0000115_104707_106071 454
798 3300046615 Ga0495656_0003150 Ga0495656_0003150_1152_2516 454
799 3300046616 Ga0495668_0009606 Ga0495668_0009606_3218_4594 454
800 3300046616 Ga0495668_0018591 Ga0495668_0018591_670_2034 454
801 3300046616 Ga0495668_0058209 Ga0495668_0058209_122_1486 454
802 3300046616 Ga0495668_0107117 Ga0495668_0107117_146_1510 454
803 3300046642 Ga0495634_0019357 Ga0495634_0019357_783_2147 454
804 3300046648 Ga0495611_0000749 Ga0495611_0000749_1206_2570 454
805 3300046648 Ga0495611_0003126 Ga0495611_0003126_3374_4738 454
806 3300046648 Ga0495611_0046839 Ga0495611_0046839_167_1531 454
807 3300046660 Ga0495625_0000187 Ga0495625_0000187_43158_44522 454
808 3300046663 Ga0495635_0020678 Ga0495635_0020678_2644_4008 454
809 3300046665 Ga0495661_0000061 Ga0495661_0000061_69332_70699 454
810 3300046665 Ga0495661_0000865 Ga0495661_0000865_24211_25575 454
811 3300046665 Ga0495661_0002054 Ga0495661_0002054_2599_3975 454
812 3300046665 Ga0495661_0002403 Ga0495661_0002403_2605_3969 454
813 3300046665 Ga0495661_0019070 Ga0495661_0019070_949_2313 454
814 3300046665 Ga0495661_0079958 Ga0495661_0079958_351_1727 454
815 3300046679 Ga0495623_0022811 Ga0495623_0022811_528_1892 454
816 3300046691 Ga0495670_0004412 Ga0495670_0004412_2891_4255 454
817 3300046692 Ga0495671_0005463 Ga0495671_0005463_5593_6957 454
818 3300046692 Ga0495671_0011710 Ga0495671_0011710_822_2198 454
819 3300046694 Ga0495649_0004778 Ga0495649_0004778_1165_2529 454
820 3300046694 Ga0495649_0009795 Ga0495649_0009795_4059_5423 454
821 3300046694 Ga0495649_0023432 Ga0495649_0023432_375_1739 454
822 3300046794 Ga0495589_0008703 Ga0495589_0008703_2654_4018 454
823 3300046794 Ga0495589_0010021 Ga0495589_0010021_2931_4295 454
824 3300046794 Ga0495589_0052557 Ga0495589_0052557_295_1659 454
825 3300046809 Ga0495600_0003343 Ga0495600_0003343_1277_2641 454
826 3300046810 Ga0495660_0000831 Ga0495660_0000831_1359_2735 454
827 3300046810 Ga0495660_0026271 Ga0495660_0026271_1228_2592 454
828 3300046810 Ga0495660_0045243 Ga0495660_0045243_115_1491 454
829 3300047318 Ga0495636_0010451 Ga0495636_0010451_1506_2870 454
830 3300047320 Ga0495672_0012072 Ga0495672_0012072_1292_2656 454
831 3300047320 Ga0495672_0036083 Ga0495672_0036083_1268_2632 454
832 3300047320 Ga0495672_0036806 Ga0495672_0036806_647_2053 454
833 3300047320 Ga0495672_0090366 Ga0495672_0090366_273_1649 454
834 3300047321 Ga0495676_0000011 Ga0495676_0000011_220902_222266 454
835 3300047321 Ga0495676_0040008 Ga0495676_0040008_869_2233 454
836 3300047322 Ga0495680_0014977 Ga0495680_0014977_1401_2765 454
837 3300047322 Ga0495680_0094802 Ga0495680_0094802_848_2212 454
838 3300047323 Ga0495683_0000106 Ga0495683_0000106_47269_48633 454
839 3300047323 Ga0495683_0000207 Ga0495683_0000207_39861_41228 454
840 3300047323 Ga0495683_0007048 Ga0495683_0007048_2126_3490 454
841 3300047323 Ga0495683_0008997 Ga0495683_0008997_605_1969 454
842 3300047323 Ga0495683_0012111 Ga0495683_0012111_1235_2599 454
843 3300047443 Ga0495687_007653 Ga0495687_007653_3840_5204 454
844 3300047446 Ga0495679_000274 Ga0495679_000274_23760_25124 454
845 3300047446 Ga0495679_000704 Ga0495679_000704_19488_20852 454
846 3300047469 Ga0495673_0001682 Ga0495673_0001682_1031_2407 454
847 3300047469 Ga0495673_0005616 Ga0495673_0005616_1424_2800 454
848 3300047469 Ga0495673_0007829 Ga0495673_0007829_2130_3494 454
849 3300047469 Ga0495673_0010604 Ga0495673_0010604_2274_3638 454
850 3300047469 Ga0495673_0014010 Ga0495673_0014010_1758_3122 454
851 3300047470 Ga0495681_0012867 Ga0495681_0012867_2773_4137 454
852 3300047470 Ga0495681_0018926 Ga0495681_0018926_370_1734 454
853 3300047472 Ga0495686_0075073 Ga0495686_0075073_236_1600 454
854 3300047673 Ga0495593_0014851 Ga0495593_0014851_1472_2836 454
855 3300048091 Ga0495626_0000068 Ga0495626_0000068_128449_129813 454
856 3300048091 Ga0495626_0005680 Ga0495626_0005680_1276_2640 454
857 3300048091 Ga0495626_0007093 Ga0495626_0007093_1900_3264 454
858 3300048091 Ga0495626_0008893 Ga0495626_0008893_748_2112 454
859 3300048905 Ga0496102_0026312 Ga0496102_0026312_2747_4111 454
860 3300048919 Ga0496116_0008830 Ga0496116_0008830_4767_6131 454
861 3300048919 Ga0496116_0018636 Ga0496116_0018636_1124_2488 454
862 3300048919 Ga0496116_0021869 Ga0496116_0021869_1287_2651 454
863 3300048920 Ga0496117_0060179 Ga0496117_0060179_658_2022 454
864 3300048921 Ga0496118_0068461 Ga0496118_0068461_444_1808 454
865 3300048924 Ga0496121_0011294 Ga0496121_0011294_2603_3967 454
866 3300048924 Ga0496121_0013055 Ga0496121_0013055_5003_6379 454
867 3300048924 Ga0496121_0020706 Ga0496121_0020706_669_2033 454
868 3300048925 Ga0496122_0001707 Ga0496122_0001707_27432_28808 454
869 3300048925 Ga0496122_0006443 Ga0496122_0006443_2568_3932 454
870 3300048925 Ga0496122_0019987 Ga0496122_0019987_3465_4829 454
871 3300048925 Ga0496122_0074921 Ga0496122_0074921_632_1996 454
872 3300048926 Ga0496123_0000607 Ga0496123_0000607_28685_30061 454
873 3300048926 Ga0496123_0042041 Ga0496123_0042041_389_1753 454
874 3300048926 Ga0496123_0057209 Ga0496123_0057209_637_2001 454
875 3300048927 Ga0496124_0000073 Ga0496124_0000073_12498_13862 454
876 3300048927 Ga0496124_0033513 Ga0496124_0033513_309_1673 454
877 3300049459 Ga0495678_000017 Ga0495678_000017_2606_3970 454
878 3300049459 Ga0495678_000404 Ga0495678_000404_11223_12599 454
879 3300049459 Ga0495678_006385 Ga0495678_006385_2215_3579 454
880 3300049459 Ga0495678_015394 Ga0495678_015394_60_1424 454
881 3300049459 Ga0495678_015771 Ga0495678_015771_1204_2580 454
882 3300049460 Ga0495682_0007005 Ga0495682_0007005_2973_4337 454
883 3300049758 Ga0501241_008201 Ga0501241_008201_95_1459 454
884 3300049853 Ga0501226_000001 Ga0501226_000001_307039_308412 454

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

47

465

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gwi-assembly1.cif.gz_A the crystal structure of halomonas elongata amino-transferase 0.9855 7 431
7q9x-assembly1.cif.gz_AAA crystal structure of chromobacterium violaceum aminotransferase in complex with plp-pyruvate adduct 0.9823 9 432
4a72-assembly2.cif.gz_C crystal structure of the omega transaminase from chromobacterium violaceum in a mixture of apo and plp-bound states 0.9799 9 432
6snu-assembly1.cif.gz_B crystal structure of the w60c mutant of the (s)-selective transaminase from chromobacterium violaceum 0.9793 5 432
7ypm-assembly2.cif.gz_D crystal structure of transaminase cc1012 complexed with plp and l-alanine 0.9704 5 432
ID Description Score Start End Superfamily
5ti8B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9967 323 430 3.90.1150.10
3hmuB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9747 64 321 3.40.640.10
af_Q59ZF3_365_473_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9632 333 422 3.90.1150.10
5kquA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9612 64 319 3.40.640.10
af_Q58696_369_458_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9599 339 425 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A3C1AN13-F1-model_v4 deleted 0.9988 350 430
AF-A0A355R1U6-F1-model_v4 Aspartate aminotransferase family protein 0.9935 178 431 GO:0005829
GO:0008483
GO:0030170
AF-A0A1G3EAD8-F1-model_v4 Aminotransferase 0.9873 1 393 GO:0005829
GO:0008483
GO:0030170
AF-A0A355R1U6-F1-model_v4 Aspartate aminotransferase family protein 0.9858 178 431 GO:0005829
GO:0008483
GO:0030170
AF-A0A354FKU3-F1-model_v4 Aspartate aminotransferase family protein 0.9842 43 432 GO:0005829
GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
94.74 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map