F484603
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 883 | 397 | 1766 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0427115|Ga0496104_0427115_321_842 |
| Length | 163 |
| Sequence | MTIKAHYLGMPLDISELDAENLQYFGYCAEHDFRLQACARCGLLRYPPTTACPWCAEPDARWVAVEGRGTVHSYVEVHHAIQPAFRDHVPYLVLLVDLDTQKGVPTEDEALRVVGNLTTARKVGIGTRMRMTFTDVAPGLALPQWTFDEAAQQPATVWRYPQE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 130 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 247 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 250 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 251 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 252 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 253 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 336 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 337 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 379 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 380 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 381 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 382 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 383 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 384 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 386 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 388 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 390 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.09 |
| Metatranscriptomes | 0.91 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.78 |
| Nodule | 0 |
| Rhizoplane | 5.66 |
| Rhizosphere | 84.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496104_0427115 | 3300048907 | Bacteria | 1237 |
| 2 | CNAas_1001530 | 3300000532 | Unclassified | 1917 |
| 3 | JGI25404J52841_10000466 | 3300003659 | Bacteria | 5792 |
| 4 | JGI25404J52841_10006563 | 3300003659 | Bacteria | 2441 |
| 5 | JGI25405J52794_10115262 | 3300003911 | Bacteria | 604 |
| 6 | Ga0058861_11906857 | 3300004800 | Bacteria | 963 |
| 7 | Ga0058862_10041450 | 3300004803 | Bacteria | 1648 |
| 8 | Ga0065712_10182422 | 3300005290 | Unclassified | 1175 |
| 9 | Ga0065715_10150791 | 3300005293 | Bacteria | 1731 |
| 10 | Ga0070676_10124676 | 3300005328 | Bacteria | 1621 |
| 11 | Ga0070676_10153915 | 3300005328 | Bacteria | 1474 |
| 12 | Ga0070683_100051245 | 3300005329 | Bacteria | 3821 |
| 13 | Ga0070683_100844517 | 3300005329 | Unclassified | 878 |
| 14 | Ga0070683_100941322 | 3300005329 | Bacteria | 829 |
| 15 | Ga0070683_101185709 | 3300005329 | Bacteria | 734 |
| 16 | Ga0070690_100438998 | 3300005330 | Bacteria | 966 |
| 17 | Ga0070670_100007655 | 3300005331 | Bacteria | 9178 |
| 18 | Ga0070677_10139910 | 3300005333 | Bacteria | 1115 |
| 19 | Ga0068869_100101135 | 3300005334 | Bacteria | 2180 |
| 20 | Ga0070666_10515431 | 3300005335 | Unclassified | 868 |
| 21 | Ga0070680_100015192 | 3300005336 | Bacteria | 6031 |
| 22 | Ga0070680_100307752 | 3300005336 | Bacteria | 1344 |
| 23 | Ga0068868_100042945 | 3300005338 | Unclassified | 3531 |
| 24 | Ga0068868_100447879 | 3300005338 | Bacteria | 1122 |
| 25 | Ga0070689_100091378 | 3300005340 | Bacteria | 2400 |
| 26 | Ga0070689_100136362 | 3300005340 | Bacteria | 1971 |
| 27 | Ga0070689_100187803 | 3300005340 | Bacteria | 1682 |
| 28 | Ga0070691_10024133 | 3300005341 | Bacteria | 2826 |
| 29 | Ga0070687_100428064 | 3300005343 | Bacteria | 875 |
| 30 | Ga0070687_100869263 | 3300005343 | Unclassified | 644 |
| 31 | Ga0070661_100043848 | 3300005344 | Bacteria | 3267 |
| 32 | Ga0070692_10005584 | 3300005345 | Bacteria | 5381 |
| 33 | Ga0070692_10189109 | 3300005345 | Bacteria | 1198 |
| 34 | Ga0070668_101602249 | 3300005347 | Unclassified | 596 |
| 35 | Ga0070669_100071994 | 3300005353 | Bacteria | 2558 |
| 36 | Ga0070675_100064979 | 3300005354 | Bacteria | 3016 |
| 37 | Ga0070675_100399720 | 3300005354 | Bacteria | 1226 |
| 38 | Ga0070671_100041542 | 3300005355 | Bacteria | 3822 |
| 39 | Ga0070673_100034196 | 3300005364 | Bacteria | 3843 |
| 40 | Ga0070673_100301730 | 3300005364 | Bacteria | 1410 |
| 41 | Ga0070688_100429541 | 3300005365 | Bacteria | 983 |
| 42 | Ga0070659_100342177 | 3300005366 | Bacteria | 1253 |
| 43 | Ga0070659_100518914 | 3300005366 | Bacteria | 1017 |
| 44 | Ga0070703_10024420 | 3300005406 | Bacteria | 1786 |
| 45 | Ga0070703_10142651 | 3300005406 | Unclassified | 892 |
| 46 | Ga0070709_10083411 | 3300005434 | Bacteria | 2091 |
| 47 | Ga0070709_10218377 | 3300005434 | Bacteria | 1358 |
| 48 | Ga0070709_10577555 | 3300005434 | Bacteria | 863 |
| 49 | Ga0070714_100280625 | 3300005435 | Bacteria | 1547 |
| 50 | Ga0070714_100509942 | 3300005435 | Bacteria | 1148 |
| 51 | Ga0070714_100999566 | 3300005435 | Bacteria | 814 |
| 52 | Ga0070714_101021676 | 3300005435 | Bacteria | 805 |
| 53 | Ga0070714_102113984 | 3300005435 | Unclassified | 549 |
| 54 | Ga0070713_100019113 | 3300005436 | Bacteria | 5221 |
| 55 | Ga0070713_100048845 | 3300005436 | Bacteria | 3487 |
| 56 | Ga0070713_100079021 | 3300005436 | Bacteria | 2801 |
| 57 | Ga0070713_100089973 | 3300005436 | Bacteria | 2638 |
| 58 | Ga0070713_100111229 | 3300005436 | Bacteria | 2388 |
| 59 | Ga0070713_100184070 | 3300005436 | Bacteria | 1879 |
| 60 | Ga0070713_100218331 | 3300005436 | Bacteria | 1729 |
| 61 | Ga0070713_101496012 | 3300005436 | Unclassified | 655 |
| 62 | Ga0070710_10031505 | 3300005437 | Bacteria | 2864 |
| 63 | Ga0070710_10040953 | 3300005437 | Bacteria | 2555 |
| 64 | Ga0070710_10191370 | 3300005437 | Bacteria | 1287 |
| 65 | Ga0070710_10267733 | 3300005437 | Bacteria | 1104 |
| 66 | Ga0070701_10045555 | 3300005438 | Bacteria | 2251 |
| 67 | Ga0070711_100130049 | 3300005439 | Bacteria | 1874 |
| 68 | Ga0070711_100231451 | 3300005439 | Bacteria | 1441 |
| 69 | Ga0070711_100350488 | 3300005439 | Bacteria | 1187 |
| 70 | Ga0070711_100740908 | 3300005439 | Bacteria | 830 |
| 71 | Ga0070705_100000027 | 3300005440 | Bacteria | 77032 |
| 72 | Ga0070700_100005070 | 3300005441 | Bacteria | 6944 |
| 73 | Ga0070700_100038619 | 3300005441 | Bacteria | 2911 |
| 74 | Ga0070700_100078777 | 3300005441 | Bacteria | 2122 |
| 75 | Ga0070700_100715643 | 3300005441 | Bacteria | 798 |
| 76 | Ga0070694_100003970 | 3300005444 | Bacteria | 8848 |
| 77 | Ga0070694_100100445 | 3300005444 | Bacteria | 2046 |
| 78 | Ga0070708_100007134 | 3300005445 | Bacteria | 8916 |
| 79 | Ga0070663_100017270 | 3300005455 | Bacteria | 4706 |
| 80 | Ga0070663_100116542 | 3300005455 | Unclassified | 2013 |
| 81 | Ga0070663_100303877 | 3300005455 | Bacteria | 1278 |
| 82 | Ga0070663_100418071 | 3300005455 | Bacteria | 1099 |
| 83 | Ga0070678_100033423 | 3300005456 | Bacteria | 3571 |
| 84 | Ga0070678_100292185 | 3300005456 | Bacteria | 1382 |
| 85 | Ga0070678_100545222 | 3300005456 | Unclassified | 1029 |
| 86 | Ga0070662_100196891 | 3300005457 | Bacteria | 1596 |
| 87 | Ga0070681_10026594 | 3300005458 | Bacteria | 5816 |
| 88 | Ga0070681_10089272 | 3300005458 | Bacteria | 3034 |
| 89 | Ga0070681_10244173 | 3300005458 | Bacteria | 1709 |
| 90 | Ga0070681_10686205 | 3300005458 | Unclassified | 940 |
| 91 | Ga0070681_11544961 | 3300005458 | Unclassified | 589 |
| 92 | Ga0068867_100242418 | 3300005459 | Bacteria | 1462 |
| 93 | Ga0068867_100738935 | 3300005459 | Bacteria | 872 |
| 94 | Ga0070706_100109120 | 3300005467 | Bacteria | 2575 |
| 95 | Ga0070706_100532594 | 3300005467 | Bacteria | 1093 |
| 96 | Ga0070706_100629173 | 3300005467 | Unclassified | 997 |
| 97 | Ga0070707_100157450 | 3300005468 | Bacteria | 2213 |
| 98 | Ga0070698_100000373 | 3300005471 | Bacteria | 46692 |
| 99 | Ga0070698_100064657 | 3300005471 | Bacteria | 3685 |
| 100 | Ga0070698_100281442 | 3300005471 | Bacteria | 1595 |
| 101 | Ga0070699_100003114 | 3300005518 | Bacteria | 14673 |
| 102 | Ga0070699_100036258 | 3300005518 | Bacteria | 4266 |
| 103 | Ga0070699_100425250 | 3300005518 | Bacteria | 1202 |
| 104 | Ga0070699_100849866 | 3300005518 | Bacteria | 835 |
| 105 | Ga0070679_100079875 | 3300005530 | Bacteria | 3260 |
| 106 | Ga0070679_100299212 | 3300005530 | Bacteria | 1560 |
| 107 | Ga0070679_100887734 | 3300005530 | Bacteria | 835 |
| 108 | Ga0070684_100032472 | 3300005535 | Bacteria | 4449 |
| 109 | Ga0070684_100035776 | 3300005535 | Bacteria | 4252 |
| 110 | Ga0070684_101089033 | 3300005535 | Bacteria | 751 |
| 111 | Ga0070697_100008988 | 3300005536 | Bacteria | 7806 |
| 112 | Ga0070697_100090869 | 3300005536 | Bacteria | 2524 |
| 113 | Ga0070697_100224007 | 3300005536 | Bacteria | 1603 |
| 114 | Ga0070697_100374211 | 3300005536 | Bacteria | 1233 |
| 115 | Ga0070672_100215414 | 3300005543 | Bacteria | 1610 |
| 116 | Ga0070672_100233960 | 3300005543 | Bacteria | 1544 |
| 117 | Ga0070672_101018425 | 3300005543 | Unclassified | 734 |
| 118 | Ga0070686_100936976 | 3300005544 | Unclassified | 707 |
| 119 | Ga0070695_100000215 | 3300005545 | Bacteria | 28071 |
| 120 | Ga0070695_100014268 | 3300005545 | Bacteria | 4789 |
| 121 | Ga0070696_100000671 | 3300005546 | Bacteria | 21891 |
| 122 | Ga0070696_100782884 | 3300005546 | Unclassified | 784 |
| 123 | Ga0070665_100012234 | 3300005548 | Bacteria | 8650 |
| 124 | Ga0070665_100069091 | 3300005548 | Bacteria | 3541 |
| 125 | Ga0070665_100095281 | 3300005548 | Bacteria | 2981 |
| 126 | Ga0070665_100118851 | 3300005548 | Bacteria | 2645 |
| 127 | Ga0070665_100149830 | 3300005548 | Bacteria | 2335 |
| 128 | Ga0070704_100000121 | 3300005549 | Bacteria | 28186 |
| 129 | Ga0070704_100797213 | 3300005549 | Bacteria | 844 |
| 130 | Ga0068855_100729337 | 3300005563 | Bacteria | 1058 |
| 131 | Ga0068855_101213271 | 3300005563 | Unclassified | 784 |
| 132 | Ga0070664_100008442 | 3300005564 | Bacteria | 8331 |
| 133 | Ga0070664_101015197 | 3300005564 | Unclassified | 780 |
| 134 | Ga0068857_100039871 | 3300005577 | Bacteria | 4163 |
| 135 | Ga0068854_100046583 | 3300005578 | Bacteria | 3087 |
| 136 | Ga0068854_100358469 | 3300005578 | Bacteria | 1196 |
| 137 | Ga0068856_100053811 | 3300005614 | Bacteria | 3969 |
| 138 | Ga0068856_100138976 | 3300005614 | Bacteria | 2436 |
| 139 | Ga0068856_100260925 | 3300005614 | Bacteria | 1748 |
| 140 | Ga0068856_100276183 | 3300005614 | Bacteria | 1697 |
| 141 | Ga0068856_100300078 | 3300005614 | Bacteria | 1624 |
| 142 | Ga0068856_100333895 | 3300005614 | Bacteria | 1534 |
| 143 | Ga0070702_100031173 | 3300005615 | Bacteria | 2915 |
| 144 | Ga0070702_100276900 | 3300005615 | Bacteria | 1150 |
| 145 | Ga0068852_100003470 | 3300005616 | Bacteria | 11025 |
| 146 | Ga0068852_100532173 | 3300005616 | Bacteria | 1174 |
| 147 | Ga0068852_100654177 | 3300005616 | Bacteria | 1059 |
| 148 | Ga0068859_100004939 | 3300005617 | Bacteria | 13552 |
| 149 | Ga0068859_101459599 | 3300005617 | Unclassified | 755 |
| 150 | Ga0068859_101819349 | 3300005617 | Bacteria | 673 |
| 151 | Ga0068864_100003765 | 3300005618 | Bacteria | 12513 |
| 152 | Ga0068864_100690796 | 3300005618 | Bacteria | 996 |
| 153 | Ga0068861_100021812 | 3300005719 | Bacteria | 4606 |
| 154 | Ga0068861_100029739 | 3300005719 | Plasmid | 3998 |
| 155 | Ga0068861_100040462 | 3300005719 | Bacteria | 3487 |
| 156 | Ga0068851_10140322 | 3300005834 | Bacteria | 1314 |
| 157 | Ga0068863_100521831 | 3300005841 | Bacteria | 1171 |
| 158 | Ga0068858_100123668 | 3300005842 | Bacteria | 2421 |
| 159 | Ga0068858_100216552 | 3300005842 | Bacteria | 1813 |
| 160 | Ga0068860_100001599 | 3300005843 | Bacteria | 24324 |
| 161 | Ga0068860_100021198 | 3300005843 | Bacteria | 6295 |
| 162 | Ga0068860_100095774 | 3300005843 | Bacteria | 2829 |
| 163 | Ga0068860_101201082 | 3300005843 | Bacteria | 779 |
| 164 | Ga0068862_100004275 | 3300005844 | Bacteria | 12082 |
| 165 | Ga0068862_100019083 | 3300005844 | Bacteria | 5717 |
| 166 | Ga0068862_100164047 | 3300005844 | Bacteria | 1985 |
| 167 | Ga0081455_10000170 | 3300005937 | Bacteria | 80847 |
| 168 | Ga0081455_10003896 | 3300005937 | Bacteria | 16993 |
| 169 | Ga0081455_10026928 | 3300005937 | Bacteria | 5276 |
| 170 | Ga0081455_10125231 | 3300005937 | Bacteria | 2018 |
| 171 | Ga0081540_1000165 | 3300005983 | Bacteria | 68435 |
| 172 | Ga0081540_1003588 | 3300005983 | Bacteria | 12193 |
| 173 | Ga0081540_1005450 | 3300005983 | Bacteria | 9494 |
| 174 | Ga0081540_1060948 | 3300005983 | Bacteria | 1801 |
| 175 | Ga0081539_10016609 | 3300005985 | Bacteria | 5238 |
| 176 | Ga0081539_10035864 | 3300005985 | Bacteria | 2974 |
| 177 | Ga0070717_10021763 | 3300006028 | Bacteria | 5057 |
| 178 | Ga0070717_10032696 | 3300006028 | Bacteria | 4194 |
| 179 | Ga0070717_10216357 | 3300006028 | Bacteria | 1683 |
| 180 | Ga0070717_10230532 | 3300006028 | Bacteria | 1630 |
| 181 | Ga0070717_10230936 | 3300006028 | Bacteria | 1629 |
| 182 | Ga0070717_10343288 | 3300006028 | Bacteria | 1334 |
| 183 | Ga0070717_10544176 | 3300006028 | Bacteria | 1051 |
| 184 | Ga0075365_10052430 | 3300006038 | Bacteria | 2698 |
| 185 | Ga0075365_10079521 | 3300006038 | Bacteria | 2218 |
| 186 | Ga0075365_10495330 | 3300006038 | Bacteria | 863 |
| 187 | Ga0075363_100044996 | 3300006048 | Bacteria | 2340 |
| 188 | Ga0070715_10264778 | 3300006163 | Bacteria | 904 |
| 189 | Ga0070716_100655424 | 3300006173 | Unclassified | 797 |
| 190 | Ga0070712_100171707 | 3300006175 | Bacteria | 1683 |
| 191 | Ga0070712_100251408 | 3300006175 | Bacteria | 1413 |
| 192 | Ga0070712_100479641 | 3300006175 | Bacteria | 1040 |
| 193 | Ga0075362_10057223 | 3300006177 | Bacteria | 1757 |
| 194 | Ga0075362_10302023 | 3300006177 | Bacteria | 794 |
| 195 | Ga0075367_10122437 | 3300006178 | Bacteria | 1603 |
| 196 | Ga0075367_10322755 | 3300006178 | Bacteria | 973 |
| 197 | Ga0075369_10036540 | 3300006186 | Bacteria | 2090 |
| 198 | Ga0075369_10047875 | 3300006186 | Bacteria | 1844 |
| 199 | Ga0075369_10235874 | 3300006186 | Bacteria | 848 |
| 200 | Ga0097621_100209963 | 3300006237 | Unclassified | 1694 |
| 201 | Ga0075370_10041208 | 3300006353 | Bacteria | 2606 |
| 202 | Ga0075370_10081961 | 3300006353 | Bacteria | 1854 |
| 203 | Ga0075370_10684351 | 3300006353 | Unclassified | 623 |
| 204 | Ga0068871_100109858 | 3300006358 | Bacteria | 2319 |
| 205 | Ga0068871_100695985 | 3300006358 | Bacteria | 931 |
| 206 | Ga0075428_100232419 | 3300006844 | Bacteria | 1990 |
| 207 | Ga0075428_100870678 | 3300006844 | Bacteria | 956 |
| 208 | Ga0075431_100067472 | 3300006847 | Unclassified | 3692 |
| 209 | Ga0075431_100303050 | 3300006847 | Bacteria | 1614 |
| 210 | Ga0075431_100332465 | 3300006847 | Bacteria | 1530 |
| 211 | Ga0075431_100407634 | 3300006847 | Bacteria | 1360 |
| 212 | Ga0075434_100015055 | 3300006871 | Bacteria | 7406 |
| 213 | Ga0075434_100046302 | 3300006871 | Bacteria | 4316 |
| 214 | Ga0075434_100663337 | 3300006871 | Bacteria | 1061 |
| 215 | Ga0068865_100138439 | 3300006881 | Bacteria | 1832 |
| 216 | Ga0097620_100004939 | 3300006931 | Bacteria | 13552 |
| 217 | Ga0097620_101459357 | 3300006931 | Unclassified | 755 |
| 218 | Ga0097620_101819313 | 3300006931 | Bacteria | 673 |
| 219 | Ga0099794_10089898 | 3300007265 | Bacteria | 1523 |
| 220 | Ga0099795_10446390 | 3300007788 | Bacteria | 595 |
| 221 | Ga0105250_10037562 | 3300009092 | Bacteria | 1944 |
| 222 | Ga0105240_10945515 | 3300009093 | Bacteria | 925 |
| 223 | Ga0111539_10038895 | 3300009094 | Bacteria | 5737 |
| 224 | Ga0111539_10083887 | 3300009094 | Bacteria | 3747 |
| 225 | Ga0111539_10522553 | 3300009094 | Unclassified | 1383 |
| 226 | Ga0111539_10702296 | 3300009094 | Unclassified | 1177 |
| 227 | Ga0111539_10983068 | 3300009094 | Bacteria | 981 |
| 228 | Ga0105245_10076632 | 3300009098 | Bacteria | 3047 |
| 229 | Ga0105245_10304050 | 3300009098 | Bacteria | 1566 |
| 230 | Ga0105245_10463529 | 3300009098 | Bacteria | 1278 |
| 231 | Ga0105245_10955718 | 3300009098 | Bacteria | 900 |
| 232 | Ga0105245_11518769 | 3300009098 | Bacteria | 721 |
| 233 | Ga0105247_10134638 | 3300009101 | Bacteria | 1613 |
| 234 | Ga0105247_10177323 | 3300009101 | Bacteria | 1420 |
| 235 | Ga0105247_10316621 | 3300009101 | Bacteria | 1087 |
| 236 | Ga0114129_10194576 | 3300009147 | Bacteria | 2751 |
| 237 | Ga0114129_10735183 | 3300009147 | Bacteria | 1265 |
| 238 | Ga0105243_11163207 | 3300009148 | Unclassified | 783 |
| 239 | Ga0105241_11073820 | 3300009174 | Bacteria | 757 |
| 240 | Ga0105242_10381570 | 3300009176 | Bacteria | 1310 |
| 241 | Ga0105242_10988112 | 3300009176 | Unclassified | 848 |
| 242 | Ga0105248_10013866 | 3300009177 | Bacteria | 8868 |
| 243 | Ga0105248_10128204 | 3300009177 | Bacteria | 2862 |
| 244 | Ga0105248_10354981 | 3300009177 | Bacteria | 1651 |
| 245 | Ga0105248_11235694 | 3300009177 | Bacteria | 845 |
| 246 | Ga0105248_11708310 | 3300009177 | Unclassified | 714 |
| 247 | Ga0105238_10017243 | 3300009551 | Bacteria | 7337 |
| 248 | Ga0105238_10101554 | 3300009551 | Bacteria | 2858 |
| 249 | Ga0105238_10253526 | 3300009551 | Bacteria | 1738 |
| 250 | Ga0105238_10435904 | 3300009551 | Bacteria | 1306 |
| 251 | Ga0105238_10877399 | 3300009551 | Bacteria | 915 |
| 252 | Ga0105238_11077524 | 3300009551 | Bacteria | 826 |
| 253 | Ga0105238_11635770 | 3300009551 | Unclassified | 674 |
| 254 | Ga0105249_10007364 | 3300009553 | Bacteria | 9596 |
| 255 | Ga0105249_10672116 | 3300009553 | Unclassified | 1094 |
| 256 | Ga0105249_10941853 | 3300009553 | Unclassified | 931 |
| 257 | Ga0105239_10027217 | 3300010375 | Bacteria | 6294 |
| 258 | Ga0105239_10041704 | 3300010375 | Bacteria | 5029 |
| 259 | Ga0105239_10172087 | 3300010375 | Bacteria | 2422 |
| 260 | Ga0105239_10186584 | 3300010375 | Bacteria | 2321 |
| 261 | Ga0105239_10592344 | 3300010375 | Bacteria | 1264 |
| 262 | Ga0105239_11369901 | 3300010375 | Unclassified | 816 |
| 263 | Ga0105239_12046198 | 3300010375 | Bacteria | 665 |
| 264 | Ga0105246_10007852 | 3300011119 | Bacteria | 6547 |
| 265 | Ga0105246_10348575 | 3300011119 | Bacteria | 1212 |
| 266 | Ga0157319_1006823 | 3300012497 | Unclassified | 830 |
| 267 | Ga0157370_10286009 | 3300013104 | Bacteria | 1523 |
| 268 | Ga0157369_10191033 | 3300013105 | Bacteria | 2152 |
| 269 | Ga0157369_10347994 | 3300013105 | Bacteria | 1539 |
| 270 | Ga0157369_10476681 | 3300013105 | Bacteria | 1291 |
| 271 | Ga0157374_10238597 | 3300013296 | Bacteria | 1787 |
| 272 | Ga0157374_10349751 | 3300013296 | Bacteria | 1468 |
| 273 | Ga0157374_11142970 | 3300013296 | Bacteria | 799 |
| 274 | Ga0157378_10510313 | 3300013297 | Unclassified | 1202 |
| 275 | Ga0157378_10887569 | 3300013297 | Unclassified | 922 |
| 276 | Ga0157378_11447679 | 3300013297 | Bacteria | 731 |
| 277 | Ga0163162_10124587 | 3300013306 | Bacteria | 2682 |
| 278 | Ga0163162_10329489 | 3300013306 | Bacteria | 1659 |
| 279 | Ga0163162_11134194 | 3300013306 | Unclassified | 886 |
| 280 | Ga0157372_10160722 | 3300013307 | Bacteria | 2596 |
| 281 | Ga0157372_11527680 | 3300013307 | Unclassified | 769 |
| 282 | Ga0157372_12143610 | 3300013307 | Bacteria | 642 |
| 283 | Ga0157375_10047640 | 3300013308 | Bacteria | 4187 |
| 284 | Ga0163163_10038268 | 3300014325 | Bacteria | 4674 |
| 285 | Ga0163163_10168230 | 3300014325 | Bacteria | 2238 |
| 286 | Ga0163163_10407766 | 3300014325 | Bacteria | 1418 |
| 287 | Ga0163163_10677294 | 3300014325 | Bacteria | 1095 |
| 288 | Ga0163163_10968529 | 3300014325 | Unclassified | 914 |
| 289 | Ga0163163_11948114 | 3300014325 | Unclassified | 647 |
| 290 | Ga0157380_10018015 | 3300014326 | Bacteria | 5238 |
| 291 | Ga0182008_10046982 | 3300014497 | Bacteria | 2145 |
| 292 | Ga0157379_10100729 | 3300014968 | Bacteria | 2593 |
| 293 | Ga0157376_10040344 | 3300014969 | Bacteria | 3815 |
| 294 | Ga0157376_10244867 | 3300014969 | Bacteria | 1672 |
| 295 | Ga0206354_11337313 | 3300020081 | Bacteria | 1017 |
| 296 | Ga0213872_10087805 | 3300021361 | Bacteria | 1393 |
| 297 | Ga0213876_10206758 | 3300021384 | Bacteria | 1043 |
| 298 | Ga0213875_10000025 | 3300021388 | Bacteria | 197787 |
| 299 | Ga0213875_10002700 | 3300021388 | Bacteria | 10476 |
| 300 | Ga0213875_10060708 | 3300021388 | Bacteria | 1768 |
| 301 | Ga0213875_10174665 | 3300021388 | Bacteria | 1009 |
| 302 | Ga0213871_10014807 | 3300021441 | Bacteria | 1856 |
| 303 | Ga0224712_10201090 | 3300022467 | Unclassified | 906 |
| 304 | Ga0228598_1007055 | 3300024227 | Bacteria | 2305 |
| 305 | Ga0207426_1011906 | 3300025302 | Bacteria | 3291 |
| 306 | Ga0207656_10061786 | 3300025321 | Bacteria | 1645 |
| 307 | Ga0207696_1028797 | 3300025711 | Bacteria | 1701 |
| 308 | Ga0207653_10002213 | 3300025885 | Bacteria | 6198 |
| 309 | Ga0207682_10047564 | 3300025893 | Bacteria | 1766 |
| 310 | Ga0207692_10026131 | 3300025898 | Bacteria | 2736 |
| 311 | Ga0207692_10208636 | 3300025898 | Bacteria | 1152 |
| 312 | Ga0207692_10277500 | 3300025898 | Bacteria | 1013 |
| 313 | Ga0207642_10099470 | 3300025899 | Unclassified | 1456 |
| 314 | Ga0207710_10419415 | 3300025900 | Unclassified | 688 |
| 315 | Ga0207710_10618864 | 3300025900 | Bacteria | 566 |
| 316 | Ga0207688_10059732 | 3300025901 | Bacteria | 2147 |
| 317 | Ga0207680_10403252 | 3300025903 | Unclassified | 966 |
| 318 | Ga0207680_10432307 | 3300025903 | Bacteria | 933 |
| 319 | Ga0207647_10106921 | 3300025904 | Bacteria | 1656 |
| 320 | Ga0207685_10010772 | 3300025905 | Bacteria | 2718 |
| 321 | Ga0207685_10103326 | 3300025905 | Bacteria | 1222 |
| 322 | Ga0207685_10116913 | 3300025905 | Bacteria | 1165 |
| 323 | Ga0207685_10338300 | 3300025905 | Bacteria | 755 |
| 324 | Ga0207699_10038389 | 3300025906 | Bacteria | 2744 |
| 325 | Ga0207699_10169974 | 3300025906 | Bacteria | 1458 |
| 326 | Ga0207699_10208951 | 3300025906 | Bacteria | 1327 |
| 327 | Ga0207699_10262496 | 3300025906 | Bacteria | 1194 |
| 328 | Ga0207699_10293593 | 3300025906 | Unclassified | 1133 |
| 329 | Ga0207643_10280213 | 3300025908 | Bacteria | 1034 |
| 330 | Ga0207684_10171388 | 3300025910 | Bacteria | 1871 |
| 331 | Ga0207684_10198243 | 3300025910 | Bacteria | 1732 |
| 332 | Ga0207684_10612030 | 3300025910 | Unclassified | 930 |
| 333 | Ga0207684_10940156 | 3300025910 | Bacteria | 725 |
| 334 | Ga0207654_10454830 | 3300025911 | Bacteria | 898 |
| 335 | Ga0207707_10011837 | 3300025912 | Bacteria | 7587 |
| 336 | Ga0207707_10126208 | 3300025912 | Bacteria | 2238 |
| 337 | Ga0207707_10153390 | 3300025912 | Bacteria | 2014 |
| 338 | Ga0207707_10241296 | 3300025912 | Bacteria | 1571 |
| 339 | Ga0207707_10292693 | 3300025912 | Bacteria | 1409 |
| 340 | Ga0207695_10289793 | 3300025913 | Bacteria | 1529 |
| 341 | Ga0207671_10076135 | 3300025914 | Bacteria | 2510 |
| 342 | Ga0207671_10219121 | 3300025914 | Bacteria | 1490 |
| 343 | Ga0207693_10080551 | 3300025915 | Bacteria | 2549 |
| 344 | Ga0207693_10158434 | 3300025915 | Bacteria | 1781 |
| 345 | Ga0207693_10496183 | 3300025915 | Bacteria | 953 |
| 346 | Ga0207693_10589366 | 3300025915 | Bacteria | 866 |
| 347 | Ga0207693_10610467 | 3300025915 | Bacteria | 849 |
| 348 | Ga0207663_10015354 | 3300025916 | Bacteria | 4223 |
| 349 | Ga0207663_10036361 | 3300025916 | Unclassified | 2962 |
| 350 | Ga0207663_10064605 | 3300025916 | Bacteria | 2336 |
| 351 | Ga0207663_11178346 | 3300025916 | Bacteria | 617 |
| 352 | Ga0207660_10193063 | 3300025917 | Bacteria | 1587 |
| 353 | Ga0207660_10379360 | 3300025917 | Unclassified | 1136 |
| 354 | Ga0207660_10463044 | 3300025917 | Bacteria | 1026 |
| 355 | Ga0207662_10164196 | 3300025918 | Bacteria | 1421 |
| 356 | Ga0207662_10236333 | 3300025918 | Bacteria | 1195 |
| 357 | Ga0207662_10447473 | 3300025918 | Bacteria | 883 |
| 358 | Ga0207649_10065610 | 3300025920 | Bacteria | 2298 |
| 359 | Ga0207652_10101638 | 3300025921 | Bacteria | 2540 |
| 360 | Ga0207652_10224324 | 3300025921 | Bacteria | 1693 |
| 361 | Ga0207652_10478713 | 3300025921 | Bacteria | 1121 |
| 362 | Ga0207694_10082349 | 3300025924 | Bacteria | 2529 |
| 363 | Ga0207694_10270389 | 3300025924 | Bacteria | 1394 |
| 364 | Ga0207650_10054682 | 3300025925 | Bacteria | 2962 |
| 365 | Ga0207650_10194767 | 3300025925 | Bacteria | 1621 |
| 366 | Ga0207659_10241137 | 3300025926 | Bacteria | 1462 |
| 367 | Ga0207659_10643339 | 3300025926 | Bacteria | 906 |
| 368 | Ga0207700_10046275 | 3300025928 | Bacteria | 3216 |
| 369 | Ga0207700_10049398 | 3300025928 | Bacteria | 3129 |
| 370 | Ga0207700_10069119 | 3300025928 | Unclassified | 2710 |
| 371 | Ga0207700_10105240 | 3300025928 | Bacteria | 2259 |
| 372 | Ga0207700_10679492 | 3300025928 | Unclassified | 918 |
| 373 | Ga0207664_10185630 | 3300025929 | Bacteria | 1788 |
| 374 | Ga0207664_10276773 | 3300025929 | Bacteria | 1472 |
| 375 | Ga0207644_10034506 | 3300025931 | Bacteria | 3540 |
| 376 | Ga0207690_10435426 | 3300025932 | Bacteria | 1051 |
| 377 | Ga0207706_10268567 | 3300025933 | Bacteria | 1489 |
| 378 | Ga0207706_10602813 | 3300025933 | Unclassified | 943 |
| 379 | Ga0207686_10131524 | 3300025934 | Bacteria | 1717 |
| 380 | Ga0207709_10046875 | 3300025935 | Bacteria | 2625 |
| 381 | Ga0207709_10171567 | 3300025935 | Bacteria | 1523 |
| 382 | Ga0207709_10181108 | 3300025935 | Bacteria | 1488 |
| 383 | Ga0207670_10062510 | 3300025936 | Bacteria | 2545 |
| 384 | Ga0207670_10116426 | 3300025936 | Bacteria | 1935 |
| 385 | Ga0207669_10118606 | 3300025937 | Bacteria | 1791 |
| 386 | Ga0207669_10303098 | 3300025937 | Unclassified | 1215 |
| 387 | Ga0207704_10234331 | 3300025938 | Bacteria | 1367 |
| 388 | Ga0207665_10151104 | 3300025939 | Unclassified | 1663 |
| 389 | Ga0207665_10485370 | 3300025939 | Bacteria | 953 |
| 390 | Ga0207691_10161154 | 3300025940 | Bacteria | 1968 |
| 391 | Ga0207691_10170728 | 3300025940 | Bacteria | 1904 |
| 392 | Ga0207691_10379451 | 3300025940 | Bacteria | 1207 |
| 393 | Ga0207691_10868242 | 3300025940 | Unclassified | 756 |
| 394 | Ga0207711_10088480 | 3300025941 | Bacteria | 2719 |
| 395 | Ga0207711_10226758 | 3300025941 | Bacteria | 1711 |
| 396 | Ga0207689_10024946 | 3300025942 | Bacteria | 5012 |
| 397 | Ga0207689_11117895 | 3300025942 | Bacteria | 664 |
| 398 | Ga0207661_10018382 | 3300025944 | Bacteria | 5192 |
| 399 | Ga0207661_10138068 | 3300025944 | Bacteria | 2095 |
| 400 | Ga0207679_10324187 | 3300025945 | Bacteria | 1335 |
| 401 | Ga0207679_10425154 | 3300025945 | Bacteria | 1173 |
| 402 | Ga0207667_10107494 | 3300025949 | Bacteria | 2878 |
| 403 | Ga0207667_10130780 | 3300025949 | Bacteria | 2585 |
| 404 | Ga0207667_10648277 | 3300025949 | Bacteria | 1062 |
| 405 | Ga0207667_11057937 | 3300025949 | Unclassified | 796 |
| 406 | Ga0207651_10004925 | 3300025960 | Bacteria | 6812 |
| 407 | Ga0207712_10003012 | 3300025961 | Bacteria | 10757 |
| 408 | Ga0207712_10215606 | 3300025961 | Unclassified | 1532 |
| 409 | Ga0207668_10004203 | 3300025972 | Bacteria | 8444 |
| 410 | Ga0207668_10020969 | 3300025972 | Bacteria | 4161 |
| 411 | Ga0207668_10590246 | 3300025972 | Bacteria | 967 |
| 412 | Ga0207668_10790183 | 3300025972 | Unclassified | 839 |
| 413 | Ga0207668_10916359 | 3300025972 | Unclassified | 781 |
| 414 | Ga0207640_10358798 | 3300025981 | Bacteria | 1174 |
| 415 | Ga0207640_10870486 | 3300025981 | Bacteria | 785 |
| 416 | Ga0207658_10670582 | 3300025986 | Bacteria | 936 |
| 417 | Ga0207703_10041514 | 3300026035 | Bacteria | 3686 |
| 418 | Ga0207703_10186569 | 3300026035 | Bacteria | 1834 |
| 419 | Ga0207639_10339504 | 3300026041 | Bacteria | 1339 |
| 420 | Ga0207678_10030428 | 3300026067 | Bacteria | 4713 |
| 421 | Ga0207678_10341606 | 3300026067 | Unclassified | 1290 |
| 422 | Ga0207678_10437839 | 3300026067 | Bacteria | 1135 |
| 423 | Ga0207708_10001123 | 3300026075 | Bacteria | 20119 |
| 424 | Ga0207708_10024330 | 3300026075 | Bacteria | 4581 |
| 425 | Ga0207708_10163414 | 3300026075 | Bacteria | 1759 |
| 426 | Ga0207708_10910213 | 3300026075 | Bacteria | 761 |
| 427 | Ga0207702_10053564 | 3300026078 | Bacteria | 3416 |
| 428 | Ga0207702_10369572 | 3300026078 | Bacteria | 1377 |
| 429 | Ga0207702_10390928 | 3300026078 | Bacteria | 1339 |
| 430 | Ga0207702_10400797 | 3300026078 | Bacteria | 1323 |
| 431 | Ga0207641_10315541 | 3300026088 | Bacteria | 1481 |
| 432 | Ga0207641_10897597 | 3300026088 | Bacteria | 880 |
| 433 | Ga0207648_10170786 | 3300026089 | Bacteria | 1922 |
| 434 | Ga0207648_10544210 | 3300026089 | Unclassified | 1066 |
| 435 | Ga0207676_10004150 | 3300026095 | Bacteria | 10230 |
| 436 | Ga0207676_10587087 | 3300026095 | Bacteria | 1069 |
| 437 | Ga0207676_10604854 | 3300026095 | Bacteria | 1053 |
| 438 | Ga0207676_11276578 | 3300026095 | Bacteria | 729 |
| 439 | Ga0207674_10003474 | 3300026116 | Bacteria | 19275 |
| 440 | Ga0207674_10038401 | 3300026116 | Bacteria | 4970 |
| 441 | Ga0207674_10405626 | 3300026116 | Bacteria | 1317 |
| 442 | Ga0207675_100059002 | 3300026118 | Bacteria | 3581 |
| 443 | Ga0207675_100234285 | 3300026118 | Bacteria | 1772 |
| 444 | Ga0207675_101034633 | 3300026118 | Bacteria | 840 |
| 445 | Ga0207683_10022141 | 3300026121 | Bacteria | 5453 |
| 446 | Ga0207683_10054350 | 3300026121 | Unclassified | 3512 |
| 447 | Ga0207683_10069804 | 3300026121 | Bacteria | 3103 |
| 448 | Ga0207683_10339465 | 3300026121 | Unclassified | 1378 |
| 449 | Ga0207683_10384192 | 3300026121 | Bacteria | 1291 |
| 450 | Ga0207683_10684216 | 3300026121 | Unclassified | 951 |
| 451 | Ga0207698_10015975 | 3300026142 | Bacteria | 5048 |
| 452 | Ga0207698_10511404 | 3300026142 | Bacteria | 1170 |
| 453 | Ga0207698_10984857 | 3300026142 | Bacteria | 853 |
| 454 | Ga0207698_12157136 | 3300026142 | Unclassified | 570 |
| 455 | Ga0209813_10161242 | 3300027866 | Bacteria | 809 |
| 456 | Ga0207428_10068914 | 3300027907 | Bacteria | 2782 |
| 457 | Ga0207428_10333382 | 3300027907 | Bacteria | 1118 |
| 458 | Ga0268266_10010517 | 3300028379 | Bacteria | 8079 |
| 459 | Ga0268266_10056769 | 3300028379 | Bacteria | 3368 |
| 460 | Ga0268266_10069677 | 3300028379 | Bacteria | 3048 |
| 461 | Ga0268266_10121417 | 3300028379 | Bacteria | 2326 |
| 462 | Ga0268266_10126023 | 3300028379 | Bacteria | 2285 |
| 463 | Ga0268265_10047475 | 3300028380 | Bacteria | 3217 |
| 464 | Ga0268265_10178240 | 3300028380 | Bacteria | 1823 |
| 465 | Ga0268264_10003345 | 3300028381 | Bacteria | 13859 |
| 466 | Ga0268264_10032061 | 3300028381 | Bacteria | 4311 |
| 467 | Ga0268264_10061662 | 3300028381 | Bacteria | 3147 |
| 468 | Ga0265337_1128329 | 3300028556 | Bacteria | 688 |
| 469 | Ga0307517_10245824 | 3300028786 | Unclassified | 1056 |
| 470 | Ga0265332_10097303 | 3300031238 | Bacteria | 1243 |
| 471 | Ga0265320_10427980 | 3300031240 | Bacteria | 584 |
| 472 | Ga0265325_10000945 | 3300031241 | Bacteria | 20995 |
| 473 | Ga0307513_10745820 | 3300031456 | Bacteria | 685 |
| 474 | Ga0307509_10016846 | 3300031507 | Bacteria | 8436 |
| 475 | Ga0307508_10529694 | 3300031616 | Unclassified | 775 |
| 476 | Ga0265314_10485339 | 3300031711 | Unclassified | 653 |
| 477 | Ga0265342_10156959 | 3300031712 | Bacteria | 1260 |
| 478 | Ga0307516_10033866 | 3300031730 | Bacteria | 5139 |
| 479 | Ga0307510_10002894 | 3300033180 | Bacteria | 19752 |
| 480 | Ga0373958_0031649 | 3300034819 | Bacteria | 1041 |
| 481 | Ga0373958_0127713 | 3300034819 | Unclassified | 620 |
| 482 | Ga0373926_0105849 | 3300035083 | Bacteria | 1055 |
| 483 | Ga0373929_0034946 | 3300035085 | Bacteria | 1092 |
| 484 | Ga0373934_0062522 | 3300035086 | Bacteria | 1484 |
| 485 | Ga0373934_0092290 | 3300035086 | Bacteria | 1221 |
| 486 | Ga0373934_0183260 | 3300035086 | Unclassified | 861 |
| 487 | Ga0373952_0013387 | 3300035092 | Unclassified | 1626 |
| 488 | Ga0373952_0028420 | 3300035092 | Bacteria | 1226 |
| 489 | Ga0373923_0026296 | 3300035111 | Bacteria | 2315 |
| 490 | Ga0373923_0055512 | 3300035111 | Bacteria | 1670 |
| 491 | Ga0373923_0114480 | 3300035111 | Bacteria | 1200 |
| 492 | Ga0373923_0116567 | 3300035111 | Bacteria | 1190 |
| 493 | Ga0373923_0118279 | 3300035111 | Bacteria | 1182 |
| 494 | Ga0373936_0039672 | 3300035113 | Bacteria | 1885 |
| 495 | Ga0373936_0059607 | 3300035113 | Bacteria | 1556 |
| 496 | Ga0373936_0087185 | 3300035113 | Bacteria | 1305 |
| 497 | Ga0373939_0019806 | 3300035114 | Bacteria | 1819 |
| 498 | Ga0373941_0003957 | 3300035115 | Bacteria | 3393 |
| 499 | Ga0373945_0003765 | 3300035116 | Bacteria | 4788 |
| 500 | Ga0373945_0088846 | 3300035116 | Bacteria | 1194 |
| 501 | Ga0373945_0136807 | 3300035116 | Unclassified | 985 |
| 502 | Ga0373945_0366768 | 3300035116 | Unclassified | 627 |
| 503 | Ga0373945_0457781 | 3300035116 | Unclassified | 565 |
| 504 | Ga0373953_0002118 | 3300035117 | Bacteria | 5932 |
| 505 | Ga0373953_0011679 | 3300035117 | Bacteria | 3091 |
| 506 | Ga0373953_0060338 | 3300035117 | Bacteria | 1550 |
| 507 | Ga0373954_0074055 | 3300035118 | Bacteria | 1621 |
| 508 | Ga0373954_0263485 | 3300035118 | Unclassified | 849 |
| 509 | Ga0373956_0110441 | 3300035119 | Bacteria | 1280 |
| 510 | Ga0373957_0042465 | 3300035120 | Bacteria | 1716 |
| 511 | Ga0373957_0059147 | 3300035120 | Bacteria | 1481 |
| 512 | Ga0373960_0189678 | 3300035121 | Unclassified | 722 |
| 513 | Ga0373943_0093912 | 3300035170 | Bacteria | 1558 |
| 514 | Ga0373943_0210354 | 3300035170 | Unclassified | 1080 |
| 515 | Ga0373946_0252283 | 3300035171 | Unclassified | 861 |
| 516 | Ga0373955_0051812 | 3300035172 | Bacteria | 2237 |
| 517 | Ga0373955_0109814 | 3300035172 | Bacteria | 1594 |
| 518 | Ga0373942_0037748 | 3300035207 | Bacteria | 1307 |
| 519 | Ga0373961_0023611 | 3300035241 | Bacteria | 1656 |
| 520 | Ga0373962_0020089 | 3300035242 | Bacteria | 1751 |
| 521 | Ga0373924_0002935 | 3300035410 | Bacteria | 5790 |
| 522 | Ga0373924_0056344 | 3300035410 | Bacteria | 1637 |
| 523 | Ga0373924_0072595 | 3300035410 | Bacteria | 1454 |
| 524 | Ga0373931_0000190 | 3300035691 | Bacteria | 26391 |
| 525 | Ga0373931_0017526 | 3300035691 | Unclassified | 3545 |
| 526 | Ga0373931_0661146 | 3300035691 | Bacteria | 687 |
| 527 | Ga0373935_0001072 | 3300035692 | Bacteria | 14919 |
| 528 | Ga0373935_0125709 | 3300035692 | Bacteria | 1718 |
| 529 | Ga0373935_0194909 | 3300035692 | Bacteria | 1397 |
| 530 | Ga0373927_0007687 | 3300035695 | Bacteria | 7295 |
| 531 | Ga0373927_0022003 | 3300035695 | Bacteria | 4178 |
| 532 | Ga0373927_0088135 | 3300035695 | Bacteria | 2014 |
| 533 | Ga0373927_0218665 | 3300035695 | Bacteria | 1251 |
| 534 | Ga0373927_0374128 | 3300035695 | Bacteria | 939 |
| 535 | Ga0373927_0411013 | 3300035695 | Bacteria | 893 |
| 536 | Ga0373927_0426491 | 3300035695 | Bacteria | 875 |
| 537 | Ga0373933_0007920 | 3300035724 | Bacteria | 5798 |
| 538 | Ga0373933_0024476 | 3300035724 | Bacteria | 3456 |
| 539 | Ga0373947_0003022 | 3300035725 | Bacteria | 10027 |
| 540 | Ga0373947_0014841 | 3300035725 | Bacteria | 4470 |
| 541 | Ga0373947_0041396 | 3300035725 | Bacteria | 2747 |
| 542 | Ga0373947_0064871 | 3300035725 | Bacteria | 2227 |
| 543 | Ga0373947_0076370 | 3300035725 | Bacteria | 2065 |
| 544 | Ga0373947_0267536 | 3300035725 | Bacteria | 1134 |
| 545 | Ga0373947_0736859 | 3300035725 | Bacteria | 672 |
| 546 | Ga0373937_0031497 | 3300036401 | Bacteria | 4806 |
| 547 | Ga0373937_0068542 | 3300036401 | Bacteria | 3271 |
| 548 | Ga0373937_0135301 | 3300036401 | Unclassified | 2304 |
| 549 | Ga0373937_0257236 | 3300036401 | Bacteria | 1646 |
| 550 | Ga0373937_0291241 | 3300036401 | Bacteria | 1542 |
| 551 | Ga0373937_0480345 | 3300036401 | Bacteria | 1180 |
| 552 | Ga0373937_0698584 | 3300036401 | Bacteria | 961 |
| 553 | Ga0372808_003711 | 3300036459 | Bacteria | 1899 |
| 554 | Ga0373925_0008562 | 3300037068 | Bacteria | 7455 |
| 555 | Ga0373925_0092306 | 3300037068 | Bacteria | 2316 |
| 556 | Ga0373925_0157366 | 3300037068 | Bacteria | 1788 |
| 557 | Ga0373925_0223653 | 3300037068 | Bacteria | 1503 |
| 558 | Ga0373925_0381838 | 3300037068 | Bacteria | 1147 |
| 559 | Ga0373925_1161929 | 3300037068 | Unclassified | 635 |
| 560 | Ga0395899_0008802 | 3300037312 | Bacteria | 7767 |
| 561 | Ga0395899_0042787 | 3300037312 | Bacteria | 3380 |
| 562 | Ga0395900_0022683 | 3300037418 | Bacteria | 6424 |
| 563 | Ga0395900_0118377 | 3300037418 | Bacteria | 2718 |
| 564 | Ga0395898_0022154 | 3300037466 | Bacteria | 6436 |
| 565 | Ga0395905_0724296 | 3300037471 | Bacteria | 897 |
| 566 | Ga0436364_0318172 | 3300037853 | Bacteria | 79481 |
| 567 | Ga0436364_0380413 | 3300037853 | Bacteria | 67254 |
| 568 | Ga0436364_0743460 | 3300037853 | Bacteria | 2340 |
| 569 | Ga0436364_0869355 | 3300037853 | Bacteria | 1011 |
| 570 | Ga0436364_0890876 | 3300037853 | Bacteria | 3344 |
| 571 | Ga0436364_0952428 | 3300037853 | Bacteria | 1049 |
| 572 | Ga0436364_1315834 | 3300037853 | Bacteria | 777 |
| 573 | Ga0436364_1475265 | 3300037853 | Bacteria | 2821 |
| 574 | Ga0436364_1505524 | 3300037853 | Bacteria | 6283 |
| 575 | Ga0395901_0002997 | 3300038443 | Bacteria | 17031 |
| 576 | Ga0395901_0046168 | 3300038443 | Bacteria | 4524 |
| 577 | Ga0395901_0978848 | 3300038443 | Bacteria | 823 |
| 578 | Ga0436365_0010204 | 3300039437 | Bacteria | 8365 |
| 579 | Ga0436365_0234591 | 3300039437 | Bacteria | 1324 |
| 580 | Ga0436365_0288774 | 3300039437 | Bacteria | 823 |
| 581 | Ga0436365_0537494 | 3300039437 | Bacteria | 2717 |
| 582 | Ga0436365_1140272 | 3300039437 | Bacteria | 662 |
| 583 | Ga0436360_0331427 | 3300039438 | Unclassified | 584 |
| 584 | Ga0436360_0675523 | 3300039438 | Bacteria | 729 |
| 585 | Ga0436360_0979552 | 3300039438 | Bacteria | 8781 |
| 586 | Ga0436361_0378589 | 3300039447 | Bacteria | 3727 |
| 587 | Ga0436361_0687925 | 3300039447 | Bacteria | 1184 |
| 588 | Ga0436361_1013634 | 3300039447 | Bacteria | 4392 |
| 589 | Ga0436363_0049181 | 3300039450 | Bacteria | 664 |
| 590 | Ga0436363_0709777 | 3300039450 | Bacteria | 962 |
| 591 | Ga0436363_1523833 | 3300039450 | Bacteria | 1044 |
| 592 | Ga0436363_1624602 | 3300039450 | Bacteria | 2560 |
| 593 | Ga0436362_0268644 | 3300039453 | Bacteria | 3918 |
| 594 | Ga0436362_0896088 | 3300039453 | Bacteria | 1050 |
| 595 | Ga0466966_0116799 | 3300044684 | Bacteria | 1642 |
| 596 | Ga0466971_0417601 | 3300044719 | Bacteria | 655 |
| 597 | Ga0466968_0319583 | 3300044735 | Bacteria | 750 |
| 598 | Ga0466970_0409523 | 3300044765 | Bacteria | 774 |
| 599 | Ga0466957_1161730 | 3300044842 | Unclassified | 558 |
| 600 | Ga0466959_0043253 | 3300045049 | Bacteria | 3321 |
| 601 | Ga0451576_0067510 | 3300045051 | Bacteria | 3723 |
| 602 | Ga0466967_0137014 | 3300045976 | Bacteria | 2277 |
| 603 | Ga0466967_0383220 | 3300045976 | Bacteria | 1365 |
| 604 | Ga0466967_1545232 | 3300045976 | Bacteria | 661 |
| 605 | Ga0466967_2052499 | 3300045976 | Bacteria | 568 |
| 606 | Ga0495617_033637 | 3300046452 | Bacteria | 1720 |
| 607 | Ga0495592_0019808 | 3300046454 | Bacteria | 5116 |
| 608 | Ga0495592_0042883 | 3300046454 | Bacteria | 3387 |
| 609 | Ga0495592_0455579 | 3300046454 | Unclassified | 801 |
| 610 | Ga0495603_0000777 | 3300046455 | Bacteria | 18238 |
| 611 | Ga0495603_0517540 | 3300046455 | Unclassified | 683 |
| 612 | Ga0495603_0724360 | 3300046455 | Unclassified | 568 |
| 613 | Ga0495629_0000601 | 3300046459 | Bacteria | 29283 |
| 614 | Ga0495629_0188711 | 3300046459 | Bacteria | 1427 |
| 615 | Ga0495629_0237586 | 3300046459 | Bacteria | 1255 |
| 616 | Ga0495629_0300625 | 3300046459 | Bacteria | 1099 |
| 617 | Ga0495629_0462494 | 3300046459 | Bacteria | 858 |
| 618 | Ga0495638_0015815 | 3300046460 | Bacteria | 5055 |
| 619 | Ga0495641_0003737 | 3300046461 | Bacteria | 11193 |
| 620 | Ga0495651_0052339 | 3300046462 | Bacteria | 3145 |
| 621 | Ga0495651_0192493 | 3300046462 | Bacteria | 1434 |
| 622 | Ga0495651_0302368 | 3300046462 | Bacteria | 1072 |
| 623 | Ga0495651_0421887 | 3300046462 | Bacteria | 867 |
| 624 | Ga0495653_0225905 | 3300046463 | Bacteria | 1256 |
| 625 | Ga0495580_0004904 | 3300046472 | Bacteria | 11188 |
| 626 | Ga0495580_0687648 | 3300046472 | Bacteria | 670 |
| 627 | Ga0495582_0000756 | 3300046473 | Bacteria | 17834 |
| 628 | Ga0495639_0001642 | 3300046475 | Bacteria | 9961 |
| 629 | Ga0495639_0242726 | 3300046475 | Unclassified | 889 |
| 630 | Ga0495662_0000177 | 3300046476 | Bacteria | 25523 |
| 631 | Ga0495664_0003827 | 3300046477 | Bacteria | 8213 |
| 632 | Ga0495664_0049731 | 3300046477 | Bacteria | 2489 |
| 633 | Ga0495664_0049752 | 3300046477 | Bacteria | 2488 |
| 634 | Ga0495585_0321422 | 3300046492 | Unclassified | 757 |
| 635 | Ga0495585_0446605 | 3300046492 | Unclassified | 619 |
| 636 | Ga0495594_0002412 | 3300046499 | Bacteria | 9730 |
| 637 | Ga0495608_0050964 | 3300046511 | Bacteria | 2745 |
| 638 | Ga0495608_0085609 | 3300046511 | Bacteria | 2043 |
| 639 | Ga0495608_0188382 | 3300046511 | Bacteria | 1303 |
| 640 | Ga0495610_0218465 | 3300046512 | Unclassified | 771 |
| 641 | Ga0495628_0078853 | 3300046516 | Bacteria | 2561 |
| 642 | Ga0495628_0183692 | 3300046516 | Bacteria | 1581 |
| 643 | Ga0495628_0223494 | 3300046516 | Unclassified | 1413 |
| 644 | Ga0495628_0242199 | 3300046516 | Bacteria | 1349 |
| 645 | Ga0495628_0816788 | 3300046516 | Unclassified | 651 |
| 646 | Ga0495630_0002970 | 3300046517 | Bacteria | 11772 |
| 647 | Ga0495631_0057018 | 3300046518 | Bacteria | 1700 |
| 648 | Ga0495631_0113710 | 3300046518 | Unclassified | 1164 |
| 649 | Ga0495631_0175563 | 3300046518 | Unclassified | 918 |
| 650 | Ga0495632_0114589 | 3300046519 | Bacteria | 1263 |
| 651 | Ga0495632_0131107 | 3300046519 | Unclassified | 1166 |
| 652 | Ga0495643_0264161 | 3300046522 | Unclassified | 798 |
| 653 | Ga0495666_0074598 | 3300046526 | Bacteria | 1609 |
| 654 | Ga0495666_0131448 | 3300046526 | Bacteria | 1170 |
| 655 | Ga0495652_0006853 | 3300046529 | Bacteria | 10550 |
| 656 | Ga0495652_0086442 | 3300046529 | Bacteria | 2574 |
| 657 | Ga0495652_0182666 | 3300046529 | Bacteria | 1608 |
| 658 | Ga0495652_0569907 | 3300046529 | Unclassified | 776 |
| 659 | Ga0495654_0117188 | 3300046530 | Unclassified | 1209 |
| 660 | Ga0495665_0001551 | 3300046531 | Bacteria | 12262 |
| 661 | Ga0495640_0013390 | 3300046533 | Bacteria | 6231 |
| 662 | Ga0495640_0168032 | 3300046533 | Bacteria | 1402 |
| 663 | Ga0495587_0093470 | 3300046536 | Unclassified | 1736 |
| 664 | Ga0495587_0149659 | 3300046536 | Bacteria | 1330 |
| 665 | Ga0495587_0617916 | 3300046536 | Unclassified | 596 |
| 666 | Ga0495597_0155743 | 3300046542 | Unclassified | 935 |
| 667 | Ga0495645_0005851 | 3300046543 | Bacteria | 8489 |
| 668 | Ga0495622_0009676 | 3300046557 | Bacteria | 4457 |
| 669 | Ga0495667_0035207 | 3300046559 | Bacteria | 3347 |
| 670 | Ga0495667_0301330 | 3300046559 | Bacteria | 1015 |
| 671 | Ga0495667_0342244 | 3300046559 | Bacteria | 945 |
| 672 | Ga0495667_0740253 | 3300046559 | Unclassified | 608 |
| 673 | Ga0495656_0247581 | 3300046615 | Bacteria | 899 |
| 674 | Ga0495668_0206542 | 3300046616 | Unclassified | 1075 |
| 675 | Ga0495634_0001062 | 3300046642 | Bacteria | 25776 |
| 676 | Ga0495634_0490518 | 3300046642 | Unclassified | 721 |
| 677 | Ga0495611_0073592 | 3300046648 | Archaea | 1564 |
| 678 | Ga0495625_0300036 | 3300046660 | Bacteria | 1028 |
| 679 | Ga0495635_0007202 | 3300046663 | Bacteria | 7771 |
| 680 | Ga0495635_0399706 | 3300046663 | Bacteria | 913 |
| 681 | Ga0495588_0012586 | 3300046674 | Bacteria | 4004 |
| 682 | Ga0495657_0605488 | 3300046675 | Unclassified | 634 |
| 683 | Ga0495599_0027095 | 3300046678 | Bacteria | 3592 |
| 684 | Ga0495599_0028676 | 3300046678 | Bacteria | 3488 |
| 685 | Ga0495623_0098623 | 3300046679 | Bacteria | 1783 |
| 686 | Ga0495623_0287447 | 3300046679 | Bacteria | 912 |
| 687 | Ga0495623_0629269 | 3300046679 | Unclassified | 555 |
| 688 | Ga0495646_0056493 | 3300046680 | Bacteria | 2353 |
| 689 | Ga0495646_0176417 | 3300046680 | Bacteria | 1175 |
| 690 | Ga0495647_0001165 | 3300046681 | Bacteria | 8086 |
| 691 | Ga0495658_0001008 | 3300046683 | Bacteria | 14877 |
| 692 | Ga0495658_0375673 | 3300046683 | Unclassified | 905 |
| 693 | Ga0495613_0009874 | 3300046689 | Bacteria | 7098 |
| 694 | Ga0495613_0166334 | 3300046689 | Bacteria | 1567 |
| 695 | Ga0495613_0223073 | 3300046689 | Bacteria | 1323 |
| 696 | Ga0495624_0000680 | 3300046690 | Bacteria | 26668 |
| 697 | Ga0495624_0677651 | 3300046690 | Bacteria | 613 |
| 698 | Ga0495624_0822978 | 3300046690 | Unclassified | 548 |
| 699 | Ga0495670_0183420 | 3300046691 | Bacteria | 1106 |
| 700 | Ga0495671_0123739 | 3300046692 | Bacteria | 1261 |
| 701 | Ga0495671_0214553 | 3300046692 | Bacteria | 932 |
| 702 | Ga0495671_0253719 | 3300046692 | Bacteria | 849 |
| 703 | Ga0495649_0031953 | 3300046694 | Bacteria | 2902 |
| 704 | Ga0495600_0043070 | 3300046809 | Bacteria | 2943 |
| 705 | Ga0495600_0071988 | 3300046809 | Bacteria | 2259 |
| 706 | Ga0495600_0199237 | 3300046809 | Bacteria | 1286 |
| 707 | Ga0495581_0000236 | 3300047315 | Bacteria | 26189 |
| 708 | Ga0495604_0088748 | 3300047317 | Bacteria | 2300 |
| 709 | Ga0495604_0270102 | 3300047317 | Bacteria | 1152 |
| 710 | Ga0495674_0001320 | 3300047319 | Bacteria | 24154 |
| 711 | Ga0495674_0008101 | 3300047319 | Bacteria | 10027 |
| 712 | Ga0495674_0162822 | 3300047319 | Bacteria | 1866 |
| 713 | Ga0495674_0181795 | 3300047319 | Bacteria | 1751 |
| 714 | Ga0495676_0197734 | 3300047321 | Bacteria | 1398 |
| 715 | Ga0495680_0033419 | 3300047322 | Bacteria | 4165 |
| 716 | Ga0495680_0102054 | 3300047322 | Bacteria | 2136 |
| 717 | Ga0495680_0413086 | 3300047322 | Bacteria | 930 |
| 718 | Ga0495680_0454202 | 3300047322 | Bacteria | 876 |
| 719 | Ga0495680_0542743 | 3300047322 | Unclassified | 784 |
| 720 | Ga0495675_0022022 | 3300047444 | Bacteria | 4061 |
| 721 | Ga0495675_0065587 | 3300047444 | Unclassified | 2296 |
| 722 | Ga0495675_0244669 | 3300047444 | Bacteria | 1079 |
| 723 | Ga0495673_0203505 | 3300047469 | Unclassified | 739 |
| 724 | Ga0495684_0010549 | 3300047471 | Bacteria | 7141 |
| 725 | Ga0495684_0245333 | 3300047471 | Bacteria | 1305 |
| 726 | Ga0495593_0001094 | 3300047673 | Bacteria | 15828 |
| 727 | Ga0495593_0441761 | 3300047673 | Bacteria | 651 |
| 728 | Ga0495602_0005484 | 3300048088 | Bacteria | 13305 |
| 729 | Ga0495602_0063699 | 3300048088 | Bacteria | 3193 |
| 730 | Ga0495602_0135505 | 3300048088 | Bacteria | 1957 |
| 731 | Ga0495614_0045273 | 3300048089 | Bacteria | 1887 |
| 732 | Ga0495626_0063267 | 3300048091 | Unclassified | 1679 |
| 733 | Ga0496100_0070926 | 3300048903 | Unclassified | 2325 |
| 734 | Ga0496100_0318705 | 3300048903 | Bacteria | 1167 |
| 735 | Ga0496100_0860615 | 3300048903 | Bacteria | 711 |
| 736 | Ga0496101_0393970 | 3300048904 | Bacteria | 1090 |
| 737 | Ga0496102_0001867 | 3300048905 | Bacteria | 18145 |
| 738 | Ga0496102_0065550 | 3300048905 | Bacteria | 3329 |
| 739 | Ga0496102_0072124 | 3300048905 | Bacteria | 3172 |
| 740 | Ga0496102_0115222 | 3300048905 | Bacteria | 2508 |
| 741 | Ga0496102_0527196 | 3300048905 | Bacteria | 1104 |
| 742 | Ga0496103_0030114 | 3300048906 | Bacteria | 3301 |
| 743 | Ga0496103_0193811 | 3300048906 | Bacteria | 1306 |
| 744 | Ga0496103_0263389 | 3300048906 | Bacteria | 1109 |
| 745 | Ga0496104_0037271 | 3300048907 | Bacteria | 4548 |
| 746 | Ga0496104_0038787 | 3300048907 | Bacteria | 4458 |
| 747 | Ga0496104_0292423 | 3300048907 | Bacteria | 1541 |
| 748 | Ga0496105_0069969 | 3300048908 | Bacteria | 2901 |
| 749 | Ga0496105_0142135 | 3300048908 | Unclassified | 1975 |
| 750 | Ga0496106_0000132 | 3300048909 | Bacteria | 56128 |
| 751 | Ga0496106_0011787 | 3300048909 | Bacteria | 6453 |
| 752 | Ga0496106_0427534 | 3300048909 | Bacteria | 1064 |
| 753 | Ga0496106_0540976 | 3300048909 | Bacteria | 935 |
| 754 | Ga0496106_0638766 | 3300048909 | Bacteria | 851 |
| 755 | Ga0496107_0025036 | 3300048910 | Bacteria | 4224 |
| 756 | Ga0496107_0067066 | 3300048910 | Bacteria | 2603 |
| 757 | Ga0496107_0861303 | 3300048910 | Unclassified | 662 |
| 758 | Ga0496108_0033486 | 3300048911 | Bacteria | 4269 |
| 759 | Ga0496108_0053893 | 3300048911 | Bacteria | 3374 |
| 760 | Ga0496108_0110816 | 3300048911 | Bacteria | 2347 |
| 761 | Ga0496108_0397476 | 3300048911 | Unclassified | 1204 |
| 762 | Ga0496109_0014967 | 3300048912 | Bacteria | 6752 |
| 763 | Ga0496109_0040696 | 3300048912 | Bacteria | 4209 |
| 764 | Ga0496109_0295911 | 3300048912 | Bacteria | 1526 |
| 765 | Ga0496109_0552048 | 3300048912 | Bacteria | 1087 |
| 766 | Ga0496110_0002086 | 3300048913 | Bacteria | 14892 |
| 767 | Ga0496110_0173753 | 3300048913 | Bacteria | 1955 |
| 768 | Ga0496110_0652729 | 3300048913 | Bacteria | 952 |
| 769 | Ga0496110_0875467 | 3300048913 | Bacteria | 804 |
| 770 | Ga0496111_0182992 | 3300048914 | Bacteria | 1558 |
| 771 | Ga0496112_0008448 | 3300048915 | Bacteria | 9225 |
| 772 | Ga0496112_0052205 | 3300048915 | Bacteria | 4012 |
| 773 | Ga0496112_0058032 | 3300048915 | Unclassified | 3811 |
| 774 | Ga0496112_0288871 | 3300048915 | Bacteria | 1586 |
| 775 | Ga0496114_0126929 | 3300048917 | Bacteria | 2200 |
| 776 | Ga0496114_0978334 | 3300048917 | Bacteria | 729 |
| 777 | Ga0496115_0027102 | 3300048918 | Bacteria | 4479 |
| 778 | Ga0496115_0043073 | 3300048918 | Bacteria | 3599 |
| 779 | Ga0496115_0487641 | 3300048918 | Bacteria | 992 |
| 780 | Ga0496115_0570700 | 3300048918 | Bacteria | 902 |
| 781 | Ga0496115_0757831 | 3300048918 | Bacteria | 759 |
| 782 | Ga0496119_0210492 | 3300048922 | Bacteria | 1001 |
| 783 | Ga0496126_0076603 | 3300048929 | Bacteria | 2967 |
| 784 | Ga0496126_0338942 | 3300048929 | Unclassified | 1232 |
| 785 | Ga0495678_261942 | 3300049459 | Unclassified | 511 |
| 786 | Ga0501033_0398186 | 3300049570 | Bacteria | 961 |
| 787 | Ga0501033_0603315 | 3300049570 | Bacteria | 753 |
| 788 | Ga0501033_0758039 | 3300049570 | Bacteria | 658 |
| 789 | Ga0501034_0370186 | 3300049571 | Bacteria | 1359 |
| 790 | Ga0501034_1096112 | 3300049571 | Bacteria | 677 |
| 791 | Ga0501036_0648753 | 3300049572 | Bacteria | 874 |
| 792 | Ga0501038_0913469 | 3300049574 | Bacteria | 648 |
| 793 | Ga0501039_1204265 | 3300049575 | Bacteria | 586 |
| 794 | Ga0501040_0091999 | 3300049576 | Bacteria | 2109 |
| 795 | Ga0501043_0306295 | 3300049579 | Bacteria | 1213 |
| 796 | Ga0501043_0707780 | 3300049579 | Bacteria | 735 |
| 797 | Ga0501046_0436971 | 3300049580 | Bacteria | 942 |
| 798 | Ga0501047_0925166 | 3300049581 | Bacteria | 685 |
| 799 | Ga0501070_0147679 | 3300049586 | Bacteria | 1940 |
| 800 | Ga0501070_0186176 | 3300049586 | Bacteria | 1708 |
| 801 | Ga0501073_0393738 | 3300049589 | Bacteria | 957 |
| 802 | Ga0501073_0631427 | 3300049589 | Bacteria | 739 |
| 803 | Ga0501075_0955678 | 3300049591 | Bacteria | 651 |
| 804 | Ga0501076_1025006 | 3300049592 | Bacteria | 680 |
| 805 | Ga0501076_1032793 | 3300049592 | Bacteria | 677 |
| 806 | Ga0501077_0132760 | 3300049593 | Bacteria | 1579 |
| 807 | Ga0501079_0555179 | 3300049741 | Unclassified | 903 |
| 808 | Ga0501081_0262999 | 3300049743 | Bacteria | 1261 |
| 809 | Ga0501083_0270453 | 3300049744 | Bacteria | 1106 |
| 810 | Ga0501044_0172946 | 3300049823 | Bacteria | 2130 |
| 811 | Ga0501044_0656156 | 3300049823 | Bacteria | 938 |
| 812 | Ga0501045_0175787 | 3300049824 | Bacteria | 1595 |
| 813 | nmdc:mga03683_124300_c1 | 3300050489 | Unclassified | 1149 |
| 814 | nmdc:mga03683_136521_c1 | 3300050489 | Unclassified | 1100 |
| 815 | nmdc:mga03683_272928_c1 | 3300050489 | Bacteria | 789 |
| 816 | nmdc:mga03683_5126_c2 | 3300050489 | Bacteria | 2784 |
| 817 | nmdc:mga03683_65434_c1 | 3300050489 | Bacteria | 1544 |
| 818 | nmdc:mga03n38_30002_c1 | 3300050490 | Bacteria | 2282 |
| 819 | nmdc:mga0yw44_128109_c1 | 3300050492 | Bacteria | 1641 |
| 820 | nmdc:mga0yw44_169367_c1 | 3300050492 | Bacteria | 1433 |
| 821 | nmdc:mga0yw44_5245_c1 | 3300050492 | Bacteria | 6078 |
| 822 | nmdc:mga06z11_117476_c1 | 3300050494 | Bacteria | 1480 |
| 823 | nmdc:mga06z11_13804_c1 | 3300050494 | Unclassified | 3560 |
| 824 | nmdc:mga06z11_6557_c1 | 3300050494 | Bacteria | 4746 |
| 825 | nmdc:mga06z11_667255_c1 | 3300050494 | Unclassified | 633 |
| 826 | nmdc:mga04h51_186614_c1 | 3300050495 | Unclassified | 809 |
| 827 | nmdc:mga07m45_105018_c1 | 3300050496 | Bacteria | 1624 |
| 828 | nmdc:mga07m45_543514_c1 | 3300050496 | Bacteria | 672 |
| 829 | nmdc:mga05p37_247845_c1 | 3300050507 | Bacteria | 2138 |
| 830 | nmdc:mga05p37_436219_c1 | 3300050507 | Bacteria | 1520 |
| 831 | nmdc:mga09592_40700_c1 | 3300050508 | Bacteria | 3905 |
| 832 | nmdc:mga0qj67_48686_c1 | 3300050509 | Bacteria | 3348 |
| 833 | nmdc:mga06r32_306214_c1 | 3300050510 | Bacteria | 1574 |
| 834 | nmdc:mga06r32_817049_c1 | 3300050510 | Bacteria | 892 |
| 835 | nmdc:mga06r32_848609_c1 | 3300050510 | Unclassified | 872 |
| 836 | nmdc:mga08y16_13244_c1 | 3300050511 | Bacteria | 8672 |
| 837 | nmdc:mga08y16_27067_c1 | 3300050511 | Bacteria | 6043 |
| 838 | nmdc:mga08y16_86314_c1 | 3300050511 | Bacteria | 3270 |
| 839 | nmdc:mga0n895_1065461_c1 | 3300050512 | Unclassified | 787 |
| 840 | nmdc:mga0n895_1315673_c1 | 3300050512 | Bacteria | 693 |
| 841 | nmdc:mga0n895_197712_c1 | 3300050512 | Bacteria | 2042 |
| 842 | nmdc:mga0n895_8320_c1 | 3300050512 | Bacteria | 8975 |
| 843 | nmdc:mga0rr50_58246_c1 | 3300050513 | Bacteria | 2894 |
| 844 | nmdc:mga0a205_276803_c1 | 3300050515 | Bacteria | 1554 |
| 845 | nmdc:mga0a205_339372_c1 | 3300050515 | Bacteria | 1371 |
| 846 | nmdc:mga0sz30_2678_c1 | 3300050516 | Bacteria | 6347 |
| 847 | nmdc:mga0sz30_331934_c1 | 3300050516 | Bacteria | 679 |
| 848 | nmdc:mga0sz30_69537_c1 | 3300050516 | Bacteria | 1514 |
| 849 | Ga0495601_0010158 | 3300053077 | Bacteria | 5594 |
| 850 | Ga0495612_0016130 | 3300053078 | Bacteria | 2993 |
| 851 | Ga0495612_0137755 | 3300053078 | Bacteria | 1057 |
| 852 | Ga0495612_0236945 | 3300053078 | Bacteria | 810 |
| 853 | Ga0495655_0214346 | 3300053083 | Unclassified | 635 |
| 854 | Ga0495595_0033884 | 3300053084 | Bacteria | 2307 |
| 855 | Ga0495595_0137564 | 3300053084 | Bacteria | 1197 |
| 856 | Ga0495619_0189443 | 3300053085 | Bacteria | 1424 |
| 857 | Ga0495619_0304333 | 3300053085 | Bacteria | 1104 |
| 858 | Ga0495619_0551689 | 3300053085 | Unclassified | 790 |
| 859 | Ga0495619_0605278 | 3300053085 | Unclassified | 749 |
| 860 | Ga0500644_0192320 | 3300053088 | Bacteria | 840 |
| 861 | Ga0500583_0370285 | 3300053092 | Bacteria | 691 |
| 862 | Ga0500555_099858 | 3300053103 | Unclassified | 738 |
| 863 | Ga0500562_049797 | 3300053108 | Bacteria | 1120 |
| 864 | Ga0500595_011289 | 3300053119 | Bacteria | 3503 |
| 865 | Ga0500642_0112328 | 3300053130 | Bacteria | 1273 |
| 866 | Ga0500655_011111 | 3300053133 | Bacteria | 1629 |
| 867 | Ga0500658_0236280 | 3300053134 | Bacteria | 839 |
| 868 | Ga0500658_0367189 | 3300053134 | Unclassified | 660 |
| 869 | Ga0500568_0027985 | 3300053139 | Bacteria | 2353 |
| 870 | Ga0500616_0042713 | 3300053153 | Bacteria | 2426 |
| 871 | Ga0500616_0079012 | 3300053153 | Bacteria | 1658 |
| 872 | Ga0500637_0053928 | 3300053178 | Bacteria | 2295 |
| 873 | Ga0500645_008052 | 3300053730 | Bacteria | 3627 |
| 874 | Ga0500609_030639 | 3300053731 | Bacteria | 739 |
| 875 | Ga0500552_000860 | 3300053733 | Bacteria | 2863 |
| 876 | Ga0501084_0289138 | 3300054114 | Bacteria | 1384 |
| 877 | Ga0501084_0711958 | 3300054114 | Bacteria | 846 |
| 878 | Ga0587085_005510 | 3300059506 | Bacteria | 1494 |
| 879 | Ga0587075_034168 | 3300059644 | Bacteria | 824 |
| 880 | Ga0587079_048623 | 3300059647 | Bacteria | 883 |
| 881 | Ga0501082_0449598 | 3300060353 | Bacteria | 1126 |
| 882 | Ga0466962_0188154 | 3300061719 | Bacteria | 1007 |
| 883 | Ga0530510_0188964 | 3300061734 | Bacteria | 1529 |
| 884 | Ga0496104_0427115 | |||
| 885 | CNAas_1001530 | |||
| 886 | JGI25404J52841_10000466 | |||
| 887 | JGI25404J52841_10006563 | |||
| 888 | JGI25405J52794_10115262 | |||
| 889 | Ga0058861_11906857 | |||
| 890 | Ga0058862_10041450 | |||
| 891 | Ga0065712_10182422 | |||
| 892 | Ga0065715_10150791 | |||
| 893 | Ga0070676_10124676 | |||
| 894 | Ga0070676_10153915 | |||
| 895 | Ga0070683_100051245 | |||
| 896 | Ga0070683_100844517 | |||
| 897 | Ga0070683_100941322 | |||
| 898 | Ga0070683_101185709 | |||
| 899 | Ga0070690_100438998 | |||
| 900 | Ga0070670_100007655 | |||
| 901 | Ga0070677_10139910 | |||
| 902 | Ga0068869_100101135 | |||
| 903 | Ga0070666_10515431 | |||
| 904 | Ga0070680_100015192 | |||
| 905 | Ga0070680_100307752 | |||
| 906 | Ga0068868_100042945 | |||
| 907 | Ga0068868_100447879 | |||
| 908 | Ga0070689_100091378 | |||
| 909 | Ga0070689_100136362 | |||
| 910 | Ga0070689_100187803 | |||
| 911 | Ga0070691_10024133 | |||
| 912 | Ga0070687_100428064 | |||
| 913 | Ga0070687_100869263 | |||
| 914 | Ga0070661_100043848 | |||
| 915 | Ga0070692_10005584 | |||
| 916 | Ga0070692_10189109 | |||
| 917 | Ga0070668_101602249 | |||
| 918 | Ga0070669_100071994 | |||
| 919 | Ga0070675_100064979 | |||
| 920 | Ga0070675_100399720 | |||
| 921 | Ga0070671_100041542 | |||
| 922 | Ga0070673_100034196 | |||
| 923 | Ga0070673_100301730 | |||
| 924 | Ga0070688_100429541 | |||
| 925 | Ga0070659_100342177 | |||
| 926 | Ga0070659_100518914 | |||
| 927 | Ga0070703_10024420 | |||
| 928 | Ga0070703_10142651 | |||
| 929 | Ga0070709_10083411 | |||
| 930 | Ga0070709_10218377 | |||
| 931 | Ga0070709_10577555 | |||
| 932 | Ga0070714_100280625 | |||
| 933 | Ga0070714_100509942 | |||
| 934 | Ga0070714_100999566 | |||
| 935 | Ga0070714_101021676 | |||
| 936 | Ga0070714_102113984 | |||
| 937 | Ga0070713_100019113 | |||
| 938 | Ga0070713_100048845 | |||
| 939 | Ga0070713_100079021 | |||
| 940 | Ga0070713_100089973 | |||
| 941 | Ga0070713_100111229 | |||
| 942 | Ga0070713_100184070 | |||
| 943 | Ga0070713_100218331 | |||
| 944 | Ga0070713_101496012 | |||
| 945 | Ga0070710_10031505 | |||
| 946 | Ga0070710_10040953 | |||
| 947 | Ga0070710_10191370 | |||
| 948 | Ga0070710_10267733 | |||
| 949 | Ga0070701_10045555 | |||
| 950 | Ga0070711_100130049 | |||
| 951 | Ga0070711_100231451 | |||
| 952 | Ga0070711_100350488 | |||
| 953 | Ga0070711_100740908 | |||
| 954 | Ga0070705_100000027 | |||
| 955 | Ga0070700_100005070 | |||
| 956 | Ga0070700_100038619 | |||
| 957 | Ga0070700_100078777 | |||
| 958 | Ga0070700_100715643 | |||
| 959 | Ga0070694_100003970 | |||
| 960 | Ga0070694_100100445 | |||
| 961 | Ga0070708_100007134 | |||
| 962 | Ga0070663_100017270 | |||
| 963 | Ga0070663_100116542 | |||
| 964 | Ga0070663_100303877 | |||
| 965 | Ga0070663_100418071 | |||
| 966 | Ga0070678_100033423 | |||
| 967 | Ga0070678_100292185 | |||
| 968 | Ga0070678_100545222 | |||
| 969 | Ga0070662_100196891 | |||
| 970 | Ga0070681_10026594 | |||
| 971 | Ga0070681_10089272 | |||
| 972 | Ga0070681_10244173 | |||
| 973 | Ga0070681_10686205 | |||
| 974 | Ga0070681_11544961 | |||
| 975 | Ga0068867_100242418 | |||
| 976 | Ga0068867_100738935 | |||
| 977 | Ga0070706_100109120 | |||
| 978 | Ga0070706_100532594 | |||
| 979 | Ga0070706_100629173 | |||
| 980 | Ga0070707_100157450 | |||
| 981 | Ga0070698_100000373 | |||
| 982 | Ga0070698_100064657 | |||
| 983 | Ga0070698_100281442 | |||
| 984 | Ga0070699_100003114 | |||
| 985 | Ga0070699_100036258 | |||
| 986 | Ga0070699_100425250 | |||
| 987 | Ga0070699_100849866 | |||
| 988 | Ga0070679_100079875 | |||
| 989 | Ga0070679_100299212 | |||
| 990 | Ga0070679_100887734 | |||
| 991 | Ga0070684_100032472 | |||
| 992 | Ga0070684_100035776 | |||
| 993 | Ga0070684_101089033 | |||
| 994 | Ga0070697_100008988 | |||
| 995 | Ga0070697_100090869 | |||
| 996 | Ga0070697_100224007 | |||
| 997 | Ga0070697_100374211 | |||
| 998 | Ga0070672_100215414 | |||
| 999 | Ga0070672_100233960 | |||
| 1000 | Ga0070672_101018425 | |||
| 1001 | Ga0070686_100936976 | |||
| 1002 | Ga0070695_100000215 | |||
| 1003 | Ga0070695_100014268 | |||
| 1004 | Ga0070696_100000671 | |||
| 1005 | Ga0070696_100782884 | |||
| 1006 | Ga0070665_100012234 | |||
| 1007 | Ga0070665_100069091 | |||
| 1008 | Ga0070665_100095281 | |||
| 1009 | Ga0070665_100118851 | |||
| 1010 | Ga0070665_100149830 | |||
| 1011 | Ga0070704_100000121 | |||
| 1012 | Ga0070704_100797213 | |||
| 1013 | Ga0068855_100729337 | |||
| 1014 | Ga0068855_101213271 | |||
| 1015 | Ga0070664_100008442 | |||
| 1016 | Ga0070664_101015197 | |||
| 1017 | Ga0068857_100039871 | |||
| 1018 | Ga0068854_100046583 | |||
| 1019 | Ga0068854_100358469 | |||
| 1020 | Ga0068856_100053811 | |||
| 1021 | Ga0068856_100138976 | |||
| 1022 | Ga0068856_100260925 | |||
| 1023 | Ga0068856_100276183 | |||
| 1024 | Ga0068856_100300078 | |||
| 1025 | Ga0068856_100333895 | |||
| 1026 | Ga0070702_100031173 | |||
| 1027 | Ga0070702_100276900 | |||
| 1028 | Ga0068852_100003470 | |||
| 1029 | Ga0068852_100532173 | |||
| 1030 | Ga0068852_100654177 | |||
| 1031 | Ga0068859_100004939 | |||
| 1032 | Ga0068859_101459599 | |||
| 1033 | Ga0068859_101819349 | |||
| 1034 | Ga0068864_100003765 | |||
| 1035 | Ga0068864_100690796 | |||
| 1036 | Ga0068861_100021812 | |||
| 1037 | Ga0068861_100029739 | |||
| 1038 | Ga0068861_100040462 | |||
| 1039 | Ga0068851_10140322 | |||
| 1040 | Ga0068863_100521831 | |||
| 1041 | Ga0068858_100123668 | |||
| 1042 | Ga0068858_100216552 | |||
| 1043 | Ga0068860_100001599 | |||
| 1044 | Ga0068860_100021198 | |||
| 1045 | Ga0068860_100095774 | |||
| 1046 | Ga0068860_101201082 | |||
| 1047 | Ga0068862_100004275 | |||
| 1048 | Ga0068862_100019083 | |||
| 1049 | Ga0068862_100164047 | |||
| 1050 | Ga0081455_10000170 | |||
| 1051 | Ga0081455_10003896 | |||
| 1052 | Ga0081455_10026928 | |||
| 1053 | Ga0081455_10125231 | |||
| 1054 | Ga0081540_1000165 | |||
| 1055 | Ga0081540_1003588 | |||
| 1056 | Ga0081540_1005450 | |||
| 1057 | Ga0081540_1060948 | |||
| 1058 | Ga0081539_10016609 | |||
| 1059 | Ga0081539_10035864 | |||
| 1060 | Ga0070717_10021763 | |||
| 1061 | Ga0070717_10032696 | |||
| 1062 | Ga0070717_10216357 | |||
| 1063 | Ga0070717_10230532 | |||
| 1064 | Ga0070717_10230936 | |||
| 1065 | Ga0070717_10343288 | |||
| 1066 | Ga0070717_10544176 | |||
| 1067 | Ga0075365_10052430 | |||
| 1068 | Ga0075365_10079521 | |||
| 1069 | Ga0075365_10495330 | |||
| 1070 | Ga0075363_100044996 | |||
| 1071 | Ga0070715_10264778 | |||
| 1072 | Ga0070716_100655424 | |||
| 1073 | Ga0070712_100171707 | |||
| 1074 | Ga0070712_100251408 | |||
| 1075 | Ga0070712_100479641 | |||
| 1076 | Ga0075362_10057223 | |||
| 1077 | Ga0075362_10302023 | |||
| 1078 | Ga0075367_10122437 | |||
| 1079 | Ga0075367_10322755 | |||
| 1080 | Ga0075369_10036540 | |||
| 1081 | Ga0075369_10047875 | |||
| 1082 | Ga0075369_10235874 | |||
| 1083 | Ga0097621_100209963 | |||
| 1084 | Ga0075370_10041208 | |||
| 1085 | Ga0075370_10081961 | |||
| 1086 | Ga0075370_10684351 | |||
| 1087 | Ga0068871_100109858 | |||
| 1088 | Ga0068871_100695985 | |||
| 1089 | Ga0075428_100232419 | |||
| 1090 | Ga0075428_100870678 | |||
| 1091 | Ga0075431_100067472 | |||
| 1092 | Ga0075431_100303050 | |||
| 1093 | Ga0075431_100332465 | |||
| 1094 | Ga0075431_100407634 | |||
| 1095 | Ga0075434_100015055 | |||
| 1096 | Ga0075434_100046302 | |||
| 1097 | Ga0075434_100663337 | |||
| 1098 | Ga0068865_100138439 | |||
| 1099 | Ga0097620_100004939 | |||
| 1100 | Ga0097620_101459357 | |||
| 1101 | Ga0097620_101819313 | |||
| 1102 | Ga0099794_10089898 | |||
| 1103 | Ga0099795_10446390 | |||
| 1104 | Ga0105250_10037562 | |||
| 1105 | Ga0105240_10945515 | |||
| 1106 | Ga0111539_10038895 | |||
| 1107 | Ga0111539_10083887 | |||
| 1108 | Ga0111539_10522553 | |||
| 1109 | Ga0111539_10702296 | |||
| 1110 | Ga0111539_10983068 | |||
| 1111 | Ga0105245_10076632 | |||
| 1112 | Ga0105245_10304050 | |||
| 1113 | Ga0105245_10463529 | |||
| 1114 | Ga0105245_10955718 | |||
| 1115 | Ga0105245_11518769 | |||
| 1116 | Ga0105247_10134638 | |||
| 1117 | Ga0105247_10177323 | |||
| 1118 | Ga0105247_10316621 | |||
| 1119 | Ga0114129_10194576 | |||
| 1120 | Ga0114129_10735183 | |||
| 1121 | Ga0105243_11163207 | |||
| 1122 | Ga0105241_11073820 | |||
| 1123 | Ga0105242_10381570 | |||
| 1124 | Ga0105242_10988112 | |||
| 1125 | Ga0105248_10013866 | |||
| 1126 | Ga0105248_10128204 | |||
| 1127 | Ga0105248_10354981 | |||
| 1128 | Ga0105248_11235694 | |||
| 1129 | Ga0105248_11708310 | |||
| 1130 | Ga0105238_10017243 | |||
| 1131 | Ga0105238_10101554 | |||
| 1132 | Ga0105238_10253526 | |||
| 1133 | Ga0105238_10435904 | |||
| 1134 | Ga0105238_10877399 | |||
| 1135 | Ga0105238_11077524 | |||
| 1136 | Ga0105238_11635770 | |||
| 1137 | Ga0105249_10007364 | |||
| 1138 | Ga0105249_10672116 | |||
| 1139 | Ga0105249_10941853 | |||
| 1140 | Ga0105239_10027217 | |||
| 1141 | Ga0105239_10041704 | |||
| 1142 | Ga0105239_10172087 | |||
| 1143 | Ga0105239_10186584 | |||
| 1144 | Ga0105239_10592344 | |||
| 1145 | Ga0105239_11369901 | |||
| 1146 | Ga0105239_12046198 | |||
| 1147 | Ga0105246_10007852 | |||
| 1148 | Ga0105246_10348575 | |||
| 1149 | Ga0157319_1006823 | |||
| 1150 | Ga0157370_10286009 | |||
| 1151 | Ga0157369_10191033 | |||
| 1152 | Ga0157369_10347994 | |||
| 1153 | Ga0157369_10476681 | |||
| 1154 | Ga0157374_10238597 | |||
| 1155 | Ga0157374_10349751 | |||
| 1156 | Ga0157374_11142970 | |||
| 1157 | Ga0157378_10510313 | |||
| 1158 | Ga0157378_10887569 | |||
| 1159 | Ga0157378_11447679 | |||
| 1160 | Ga0163162_10124587 | |||
| 1161 | Ga0163162_10329489 | |||
| 1162 | Ga0163162_11134194 | |||
| 1163 | Ga0157372_10160722 | |||
| 1164 | Ga0157372_11527680 | |||
| 1165 | Ga0157372_12143610 | |||
| 1166 | Ga0157375_10047640 | |||
| 1167 | Ga0163163_10038268 | |||
| 1168 | Ga0163163_10168230 | |||
| 1169 | Ga0163163_10407766 | |||
| 1170 | Ga0163163_10677294 | |||
| 1171 | Ga0163163_10968529 | |||
| 1172 | Ga0163163_11948114 | |||
| 1173 | Ga0157380_10018015 | |||
| 1174 | Ga0182008_10046982 | |||
| 1175 | Ga0157379_10100729 | |||
| 1176 | Ga0157376_10040344 | |||
| 1177 | Ga0157376_10244867 | |||
| 1178 | Ga0206354_11337313 | |||
| 1179 | Ga0213872_10087805 | |||
| 1180 | Ga0213876_10206758 | |||
| 1181 | Ga0213875_10000025 | |||
| 1182 | Ga0213875_10002700 | |||
| 1183 | Ga0213875_10060708 | |||
| 1184 | Ga0213875_10174665 | |||
| 1185 | Ga0213871_10014807 | |||
| 1186 | Ga0224712_10201090 | |||
| 1187 | Ga0228598_1007055 | |||
| 1188 | Ga0207426_1011906 | |||
| 1189 | Ga0207656_10061786 | |||
| 1190 | Ga0207696_1028797 | |||
| 1191 | Ga0207653_10002213 | |||
| 1192 | Ga0207682_10047564 | |||
| 1193 | Ga0207692_10026131 | |||
| 1194 | Ga0207692_10208636 | |||
| 1195 | Ga0207692_10277500 | |||
| 1196 | Ga0207642_10099470 | |||
| 1197 | Ga0207710_10419415 | |||
| 1198 | Ga0207710_10618864 | |||
| 1199 | Ga0207688_10059732 | |||
| 1200 | Ga0207680_10403252 | |||
| 1201 | Ga0207680_10432307 | |||
| 1202 | Ga0207647_10106921 | |||
| 1203 | Ga0207685_10010772 | |||
| 1204 | Ga0207685_10103326 | |||
| 1205 | Ga0207685_10116913 | |||
| 1206 | Ga0207685_10338300 | |||
| 1207 | Ga0207699_10038389 | |||
| 1208 | Ga0207699_10169974 | |||
| 1209 | Ga0207699_10208951 | |||
| 1210 | Ga0207699_10262496 | |||
| 1211 | Ga0207699_10293593 | |||
| 1212 | Ga0207643_10280213 | |||
| 1213 | Ga0207684_10171388 | |||
| 1214 | Ga0207684_10198243 | |||
| 1215 | Ga0207684_10612030 | |||
| 1216 | Ga0207684_10940156 | |||
| 1217 | Ga0207654_10454830 | |||
| 1218 | Ga0207707_10011837 | |||
| 1219 | Ga0207707_10126208 | |||
| 1220 | Ga0207707_10153390 | |||
| 1221 | Ga0207707_10241296 | |||
| 1222 | Ga0207707_10292693 | |||
| 1223 | Ga0207695_10289793 | |||
| 1224 | Ga0207671_10076135 | |||
| 1225 | Ga0207671_10219121 | |||
| 1226 | Ga0207693_10080551 | |||
| 1227 | Ga0207693_10158434 | |||
| 1228 | Ga0207693_10496183 | |||
| 1229 | Ga0207693_10589366 | |||
| 1230 | Ga0207693_10610467 | |||
| 1231 | Ga0207663_10015354 | |||
| 1232 | Ga0207663_10036361 | |||
| 1233 | Ga0207663_10064605 | |||
| 1234 | Ga0207663_11178346 | |||
| 1235 | Ga0207660_10193063 | |||
| 1236 | Ga0207660_10379360 | |||
| 1237 | Ga0207660_10463044 | |||
| 1238 | Ga0207662_10164196 | |||
| 1239 | Ga0207662_10236333 | |||
| 1240 | Ga0207662_10447473 | |||
| 1241 | Ga0207649_10065610 | |||
| 1242 | Ga0207652_10101638 | |||
| 1243 | Ga0207652_10224324 | |||
| 1244 | Ga0207652_10478713 | |||
| 1245 | Ga0207694_10082349 | |||
| 1246 | Ga0207694_10270389 | |||
| 1247 | Ga0207650_10054682 | |||
| 1248 | Ga0207650_10194767 | |||
| 1249 | Ga0207659_10241137 | |||
| 1250 | Ga0207659_10643339 | |||
| 1251 | Ga0207700_10046275 | |||
| 1252 | Ga0207700_10049398 | |||
| 1253 | Ga0207700_10069119 | |||
| 1254 | Ga0207700_10105240 | |||
| 1255 | Ga0207700_10679492 | |||
| 1256 | Ga0207664_10185630 | |||
| 1257 | Ga0207664_10276773 | |||
| 1258 | Ga0207644_10034506 | |||
| 1259 | Ga0207690_10435426 | |||
| 1260 | Ga0207706_10268567 | |||
| 1261 | Ga0207706_10602813 | |||
| 1262 | Ga0207686_10131524 | |||
| 1263 | Ga0207709_10046875 | |||
| 1264 | Ga0207709_10171567 | |||
| 1265 | Ga0207709_10181108 | |||
| 1266 | Ga0207670_10062510 | |||
| 1267 | Ga0207670_10116426 | |||
| 1268 | Ga0207669_10118606 | |||
| 1269 | Ga0207669_10303098 | |||
| 1270 | Ga0207704_10234331 | |||
| 1271 | Ga0207665_10151104 | |||
| 1272 | Ga0207665_10485370 | |||
| 1273 | Ga0207691_10161154 | |||
| 1274 | Ga0207691_10170728 | |||
| 1275 | Ga0207691_10379451 | |||
| 1276 | Ga0207691_10868242 | |||
| 1277 | Ga0207711_10088480 | |||
| 1278 | Ga0207711_10226758 | |||
| 1279 | Ga0207689_10024946 | |||
| 1280 | Ga0207689_11117895 | |||
| 1281 | Ga0207661_10018382 | |||
| 1282 | Ga0207661_10138068 | |||
| 1283 | Ga0207679_10324187 | |||
| 1284 | Ga0207679_10425154 | |||
| 1285 | Ga0207667_10107494 | |||
| 1286 | Ga0207667_10130780 | |||
| 1287 | Ga0207667_10648277 | |||
| 1288 | Ga0207667_11057937 | |||
| 1289 | Ga0207651_10004925 | |||
| 1290 | Ga0207712_10003012 | |||
| 1291 | Ga0207712_10215606 | |||
| 1292 | Ga0207668_10004203 | |||
| 1293 | Ga0207668_10020969 | |||
| 1294 | Ga0207668_10590246 | |||
| 1295 | Ga0207668_10790183 | |||
| 1296 | Ga0207668_10916359 | |||
| 1297 | Ga0207640_10358798 | |||
| 1298 | Ga0207640_10870486 | |||
| 1299 | Ga0207658_10670582 | |||
| 1300 | Ga0207703_10041514 | |||
| 1301 | Ga0207703_10186569 | |||
| 1302 | Ga0207639_10339504 | |||
| 1303 | Ga0207678_10030428 | |||
| 1304 | Ga0207678_10341606 | |||
| 1305 | Ga0207678_10437839 | |||
| 1306 | Ga0207708_10001123 | |||
| 1307 | Ga0207708_10024330 | |||
| 1308 | Ga0207708_10163414 | |||
| 1309 | Ga0207708_10910213 | |||
| 1310 | Ga0207702_10053564 | |||
| 1311 | Ga0207702_10369572 | |||
| 1312 | Ga0207702_10390928 | |||
| 1313 | Ga0207702_10400797 | |||
| 1314 | Ga0207641_10315541 | |||
| 1315 | Ga0207641_10897597 | |||
| 1316 | Ga0207648_10170786 | |||
| 1317 | Ga0207648_10544210 | |||
| 1318 | Ga0207676_10004150 | |||
| 1319 | Ga0207676_10587087 | |||
| 1320 | Ga0207676_10604854 | |||
| 1321 | Ga0207676_11276578 | |||
| 1322 | Ga0207674_10003474 | |||
| 1323 | Ga0207674_10038401 | |||
| 1324 | Ga0207674_10405626 | |||
| 1325 | Ga0207675_100059002 | |||
| 1326 | Ga0207675_100234285 | |||
| 1327 | Ga0207675_101034633 | |||
| 1328 | Ga0207683_10022141 | |||
| 1329 | Ga0207683_10054350 | |||
| 1330 | Ga0207683_10069804 | |||
| 1331 | Ga0207683_10339465 | |||
| 1332 | Ga0207683_10384192 | |||
| 1333 | Ga0207683_10684216 | |||
| 1334 | Ga0207698_10015975 | |||
| 1335 | Ga0207698_10511404 | |||
| 1336 | Ga0207698_10984857 | |||
| 1337 | Ga0207698_12157136 | |||
| 1338 | Ga0209813_10161242 | |||
| 1339 | Ga0207428_10068914 | |||
| 1340 | Ga0207428_10333382 | |||
| 1341 | Ga0268266_10010517 | |||
| 1342 | Ga0268266_10056769 | |||
| 1343 | Ga0268266_10069677 | |||
| 1344 | Ga0268266_10121417 | |||
| 1345 | Ga0268266_10126023 | |||
| 1346 | Ga0268265_10047475 | |||
| 1347 | Ga0268265_10178240 | |||
| 1348 | Ga0268264_10003345 | |||
| 1349 | Ga0268264_10032061 | |||
| 1350 | Ga0268264_10061662 | |||
| 1351 | Ga0265337_1128329 | |||
| 1352 | Ga0307517_10245824 | |||
| 1353 | Ga0265332_10097303 | |||
| 1354 | Ga0265320_10427980 | |||
| 1355 | Ga0265325_10000945 | |||
| 1356 | Ga0307513_10745820 | |||
| 1357 | Ga0307509_10016846 | |||
| 1358 | Ga0307508_10529694 | |||
| 1359 | Ga0265314_10485339 | |||
| 1360 | Ga0265342_10156959 | |||
| 1361 | Ga0307516_10033866 | |||
| 1362 | Ga0307510_10002894 | |||
| 1363 | Ga0373958_0031649 | |||
| 1364 | Ga0373958_0127713 | |||
| 1365 | Ga0373926_0105849 | |||
| 1366 | Ga0373929_0034946 | |||
| 1367 | Ga0373934_0062522 | |||
| 1368 | Ga0373934_0092290 | |||
| 1369 | Ga0373934_0183260 | |||
| 1370 | Ga0373952_0013387 | |||
| 1371 | Ga0373952_0028420 | |||
| 1372 | Ga0373923_0026296 | |||
| 1373 | Ga0373923_0055512 | |||
| 1374 | Ga0373923_0114480 | |||
| 1375 | Ga0373923_0116567 | |||
| 1376 | Ga0373923_0118279 | |||
| 1377 | Ga0373936_0039672 | |||
| 1378 | Ga0373936_0059607 | |||
| 1379 | Ga0373936_0087185 | |||
| 1380 | Ga0373939_0019806 | |||
| 1381 | Ga0373941_0003957 | |||
| 1382 | Ga0373945_0003765 | |||
| 1383 | Ga0373945_0088846 | |||
| 1384 | Ga0373945_0136807 | |||
| 1385 | Ga0373945_0366768 | |||
| 1386 | Ga0373945_0457781 | |||
| 1387 | Ga0373953_0002118 | |||
| 1388 | Ga0373953_0011679 | |||
| 1389 | Ga0373953_0060338 | |||
| 1390 | Ga0373954_0074055 | |||
| 1391 | Ga0373954_0263485 | |||
| 1392 | Ga0373956_0110441 | |||
| 1393 | Ga0373957_0042465 | |||
| 1394 | Ga0373957_0059147 | |||
| 1395 | Ga0373960_0189678 | |||
| 1396 | Ga0373943_0093912 | |||
| 1397 | Ga0373943_0210354 | |||
| 1398 | Ga0373946_0252283 | |||
| 1399 | Ga0373955_0051812 | |||
| 1400 | Ga0373955_0109814 | |||
| 1401 | Ga0373942_0037748 | |||
| 1402 | Ga0373961_0023611 | |||
| 1403 | Ga0373962_0020089 | |||
| 1404 | Ga0373924_0002935 | |||
| 1405 | Ga0373924_0056344 | |||
| 1406 | Ga0373924_0072595 | |||
| 1407 | Ga0373931_0000190 | |||
| 1408 | Ga0373931_0017526 | |||
| 1409 | Ga0373931_0661146 | |||
| 1410 | Ga0373935_0001072 | |||
| 1411 | Ga0373935_0125709 | |||
| 1412 | Ga0373935_0194909 | |||
| 1413 | Ga0373927_0007687 | |||
| 1414 | Ga0373927_0022003 | |||
| 1415 | Ga0373927_0088135 | |||
| 1416 | Ga0373927_0218665 | |||
| 1417 | Ga0373927_0374128 | |||
| 1418 | Ga0373927_0411013 | |||
| 1419 | Ga0373927_0426491 | |||
| 1420 | Ga0373933_0007920 | |||
| 1421 | Ga0373933_0024476 | |||
| 1422 | Ga0373947_0003022 | |||
| 1423 | Ga0373947_0014841 | |||
| 1424 | Ga0373947_0041396 | |||
| 1425 | Ga0373947_0064871 | |||
| 1426 | Ga0373947_0076370 | |||
| 1427 | Ga0373947_0267536 | |||
| 1428 | Ga0373947_0736859 | |||
| 1429 | Ga0373937_0031497 | |||
| 1430 | Ga0373937_0068542 | |||
| 1431 | Ga0373937_0135301 | |||
| 1432 | Ga0373937_0257236 | |||
| 1433 | Ga0373937_0291241 | |||
| 1434 | Ga0373937_0480345 | |||
| 1435 | Ga0373937_0698584 | |||
| 1436 | Ga0372808_003711 | |||
| 1437 | Ga0373925_0008562 | |||
| 1438 | Ga0373925_0092306 | |||
| 1439 | Ga0373925_0157366 | |||
| 1440 | Ga0373925_0223653 | |||
| 1441 | Ga0373925_0381838 | |||
| 1442 | Ga0373925_1161929 | |||
| 1443 | Ga0395899_0008802 | |||
| 1444 | Ga0395899_0042787 | |||
| 1445 | Ga0395900_0022683 | |||
| 1446 | Ga0395900_0118377 | |||
| 1447 | Ga0395898_0022154 | |||
| 1448 | Ga0395905_0724296 | |||
| 1449 | Ga0436364_0318172 | |||
| 1450 | Ga0436364_0380413 | |||
| 1451 | Ga0436364_0743460 | |||
| 1452 | Ga0436364_0869355 | |||
| 1453 | Ga0436364_0890876 | |||
| 1454 | Ga0436364_0952428 | |||
| 1455 | Ga0436364_1315834 | |||
| 1456 | Ga0436364_1475265 | |||
| 1457 | Ga0436364_1505524 | |||
| 1458 | Ga0395901_0002997 | |||
| 1459 | Ga0395901_0046168 | |||
| 1460 | Ga0395901_0978848 | |||
| 1461 | Ga0436365_0010204 | |||
| 1462 | Ga0436365_0234591 | |||
| 1463 | Ga0436365_0288774 | |||
| 1464 | Ga0436365_0537494 | |||
| 1465 | Ga0436365_1140272 | |||
| 1466 | Ga0436360_0331427 | |||
| 1467 | Ga0436360_0675523 | |||
| 1468 | Ga0436360_0979552 | |||
| 1469 | Ga0436361_0378589 | |||
| 1470 | Ga0436361_0687925 | |||
| 1471 | Ga0436361_1013634 | |||
| 1472 | Ga0436363_0049181 | |||
| 1473 | Ga0436363_0709777 | |||
| 1474 | Ga0436363_1523833 | |||
| 1475 | Ga0436363_1624602 | |||
| 1476 | Ga0436362_0268644 | |||
| 1477 | Ga0436362_0896088 | |||
| 1478 | Ga0466966_0116799 | |||
| 1479 | Ga0466971_0417601 | |||
| 1480 | Ga0466968_0319583 | |||
| 1481 | Ga0466970_0409523 | |||
| 1482 | Ga0466957_1161730 | |||
| 1483 | Ga0466959_0043253 | |||
| 1484 | Ga0451576_0067510 | |||
| 1485 | Ga0466967_0137014 | |||
| 1486 | Ga0466967_0383220 | |||
| 1487 | Ga0466967_1545232 | |||
| 1488 | Ga0466967_2052499 | |||
| 1489 | Ga0495617_033637 | |||
| 1490 | Ga0495592_0019808 | |||
| 1491 | Ga0495592_0042883 | |||
| 1492 | Ga0495592_0455579 | |||
| 1493 | Ga0495603_0000777 | |||
| 1494 | Ga0495603_0517540 | |||
| 1495 | Ga0495603_0724360 | |||
| 1496 | Ga0495629_0000601 | |||
| 1497 | Ga0495629_0188711 | |||
| 1498 | Ga0495629_0237586 | |||
| 1499 | Ga0495629_0300625 | |||
| 1500 | Ga0495629_0462494 | |||
| 1501 | Ga0495638_0015815 | |||
| 1502 | Ga0495641_0003737 | |||
| 1503 | Ga0495651_0052339 | |||
| 1504 | Ga0495651_0192493 | |||
| 1505 | Ga0495651_0302368 | |||
| 1506 | Ga0495651_0421887 | |||
| 1507 | Ga0495653_0225905 | |||
| 1508 | Ga0495580_0004904 | |||
| 1509 | Ga0495580_0687648 | |||
| 1510 | Ga0495582_0000756 | |||
| 1511 | Ga0495639_0001642 | |||
| 1512 | Ga0495639_0242726 | |||
| 1513 | Ga0495662_0000177 | |||
| 1514 | Ga0495664_0003827 | |||
| 1515 | Ga0495664_0049731 | |||
| 1516 | Ga0495664_0049752 | |||
| 1517 | Ga0495585_0321422 | |||
| 1518 | Ga0495585_0446605 | |||
| 1519 | Ga0495594_0002412 | |||
| 1520 | Ga0495608_0050964 | |||
| 1521 | Ga0495608_0085609 | |||
| 1522 | Ga0495608_0188382 | |||
| 1523 | Ga0495610_0218465 | |||
| 1524 | Ga0495628_0078853 | |||
| 1525 | Ga0495628_0183692 | |||
| 1526 | Ga0495628_0223494 | |||
| 1527 | Ga0495628_0242199 | |||
| 1528 | Ga0495628_0816788 | |||
| 1529 | Ga0495630_0002970 | |||
| 1530 | Ga0495631_0057018 | |||
| 1531 | Ga0495631_0113710 | |||
| 1532 | Ga0495631_0175563 | |||
| 1533 | Ga0495632_0114589 | |||
| 1534 | Ga0495632_0131107 | |||
| 1535 | Ga0495643_0264161 | |||
| 1536 | Ga0495666_0074598 | |||
| 1537 | Ga0495666_0131448 | |||
| 1538 | Ga0495652_0006853 | |||
| 1539 | Ga0495652_0086442 | |||
| 1540 | Ga0495652_0182666 | |||
| 1541 | Ga0495652_0569907 | |||
| 1542 | Ga0495654_0117188 | |||
| 1543 | Ga0495665_0001551 | |||
| 1544 | Ga0495640_0013390 | |||
| 1545 | Ga0495640_0168032 | |||
| 1546 | Ga0495587_0093470 | |||
| 1547 | Ga0495587_0149659 | |||
| 1548 | Ga0495587_0617916 | |||
| 1549 | Ga0495597_0155743 | |||
| 1550 | Ga0495645_0005851 | |||
| 1551 | Ga0495622_0009676 | |||
| 1552 | Ga0495667_0035207 | |||
| 1553 | Ga0495667_0301330 | |||
| 1554 | Ga0495667_0342244 | |||
| 1555 | Ga0495667_0740253 | |||
| 1556 | Ga0495656_0247581 | |||
| 1557 | Ga0495668_0206542 | |||
| 1558 | Ga0495634_0001062 | |||
| 1559 | Ga0495634_0490518 | |||
| 1560 | Ga0495611_0073592 | |||
| 1561 | Ga0495625_0300036 | |||
| 1562 | Ga0495635_0007202 | |||
| 1563 | Ga0495635_0399706 | |||
| 1564 | Ga0495588_0012586 | |||
| 1565 | Ga0495657_0605488 | |||
| 1566 | Ga0495599_0027095 | |||
| 1567 | Ga0495599_0028676 | |||
| 1568 | Ga0495623_0098623 | |||
| 1569 | Ga0495623_0287447 | |||
| 1570 | Ga0495623_0629269 | |||
| 1571 | Ga0495646_0056493 | |||
| 1572 | Ga0495646_0176417 | |||
| 1573 | Ga0495647_0001165 | |||
| 1574 | Ga0495658_0001008 | |||
| 1575 | Ga0495658_0375673 | |||
| 1576 | Ga0495613_0009874 | |||
| 1577 | Ga0495613_0166334 | |||
| 1578 | Ga0495613_0223073 | |||
| 1579 | Ga0495624_0000680 | |||
| 1580 | Ga0495624_0677651 | |||
| 1581 | Ga0495624_0822978 | |||
| 1582 | Ga0495670_0183420 | |||
| 1583 | Ga0495671_0123739 | |||
| 1584 | Ga0495671_0214553 | |||
| 1585 | Ga0495671_0253719 | |||
| 1586 | Ga0495649_0031953 | |||
| 1587 | Ga0495600_0043070 | |||
| 1588 | Ga0495600_0071988 | |||
| 1589 | Ga0495600_0199237 | |||
| 1590 | Ga0495581_0000236 | |||
| 1591 | Ga0495604_0088748 | |||
| 1592 | Ga0495604_0270102 | |||
| 1593 | Ga0495674_0001320 | |||
| 1594 | Ga0495674_0008101 | |||
| 1595 | Ga0495674_0162822 | |||
| 1596 | Ga0495674_0181795 | |||
| 1597 | Ga0495676_0197734 | |||
| 1598 | Ga0495680_0033419 | |||
| 1599 | Ga0495680_0102054 | |||
| 1600 | Ga0495680_0413086 | |||
| 1601 | Ga0495680_0454202 | |||
| 1602 | Ga0495680_0542743 | |||
| 1603 | Ga0495675_0022022 | |||
| 1604 | Ga0495675_0065587 | |||
| 1605 | Ga0495675_0244669 | |||
| 1606 | Ga0495673_0203505 | |||
| 1607 | Ga0495684_0010549 | |||
| 1608 | Ga0495684_0245333 | |||
| 1609 | Ga0495593_0001094 | |||
| 1610 | Ga0495593_0441761 | |||
| 1611 | Ga0495602_0005484 | |||
| 1612 | Ga0495602_0063699 | |||
| 1613 | Ga0495602_0135505 | |||
| 1614 | Ga0495614_0045273 | |||
| 1615 | Ga0495626_0063267 | |||
| 1616 | Ga0496100_0070926 | |||
| 1617 | Ga0496100_0318705 | |||
| 1618 | Ga0496100_0860615 | |||
| 1619 | Ga0496101_0393970 | |||
| 1620 | Ga0496102_0001867 | |||
| 1621 | Ga0496102_0065550 | |||
| 1622 | Ga0496102_0072124 | |||
| 1623 | Ga0496102_0115222 | |||
| 1624 | Ga0496102_0527196 | |||
| 1625 | Ga0496103_0030114 | |||
| 1626 | Ga0496103_0193811 | |||
| 1627 | Ga0496103_0263389 | |||
| 1628 | Ga0496104_0037271 | |||
| 1629 | Ga0496104_0038787 | |||
| 1630 | Ga0496104_0292423 | |||
| 1631 | Ga0496105_0069969 | |||
| 1632 | Ga0496105_0142135 | |||
| 1633 | Ga0496106_0000132 | |||
| 1634 | Ga0496106_0011787 | |||
| 1635 | Ga0496106_0427534 | |||
| 1636 | Ga0496106_0540976 | |||
| 1637 | Ga0496106_0638766 | |||
| 1638 | Ga0496107_0025036 | |||
| 1639 | Ga0496107_0067066 | |||
| 1640 | Ga0496107_0861303 | |||
| 1641 | Ga0496108_0033486 | |||
| 1642 | Ga0496108_0053893 | |||
| 1643 | Ga0496108_0110816 | |||
| 1644 | Ga0496108_0397476 | |||
| 1645 | Ga0496109_0014967 | |||
| 1646 | Ga0496109_0040696 | |||
| 1647 | Ga0496109_0295911 | |||
| 1648 | Ga0496109_0552048 | |||
| 1649 | Ga0496110_0002086 | |||
| 1650 | Ga0496110_0173753 | |||
| 1651 | Ga0496110_0652729 | |||
| 1652 | Ga0496110_0875467 | |||
| 1653 | Ga0496111_0182992 | |||
| 1654 | Ga0496112_0008448 | |||
| 1655 | Ga0496112_0052205 | |||
| 1656 | Ga0496112_0058032 | |||
| 1657 | Ga0496112_0288871 | |||
| 1658 | Ga0496114_0126929 | |||
| 1659 | Ga0496114_0978334 | |||
| 1660 | Ga0496115_0027102 | |||
| 1661 | Ga0496115_0043073 | |||
| 1662 | Ga0496115_0487641 | |||
| 1663 | Ga0496115_0570700 | |||
| 1664 | Ga0496115_0757831 | |||
| 1665 | Ga0496119_0210492 | |||
| 1666 | Ga0496126_0076603 | |||
| 1667 | Ga0496126_0338942 | |||
| 1668 | Ga0495678_261942 | |||
| 1669 | Ga0501033_0398186 | |||
| 1670 | Ga0501033_0603315 | |||
| 1671 | Ga0501033_0758039 | |||
| 1672 | Ga0501034_0370186 | |||
| 1673 | Ga0501034_1096112 | |||
| 1674 | Ga0501036_0648753 | |||
| 1675 | Ga0501038_0913469 | |||
| 1676 | Ga0501039_1204265 | |||
| 1677 | Ga0501040_0091999 | |||
| 1678 | Ga0501043_0306295 | |||
| 1679 | Ga0501043_0707780 | |||
| 1680 | Ga0501046_0436971 | |||
| 1681 | Ga0501047_0925166 | |||
| 1682 | Ga0501070_0147679 | |||
| 1683 | Ga0501070_0186176 | |||
| 1684 | Ga0501073_0393738 | |||
| 1685 | Ga0501073_0631427 | |||
| 1686 | Ga0501075_0955678 | |||
| 1687 | Ga0501076_1025006 | |||
| 1688 | Ga0501076_1032793 | |||
| 1689 | Ga0501077_0132760 | |||
| 1690 | Ga0501079_0555179 | |||
| 1691 | Ga0501081_0262999 | |||
| 1692 | Ga0501083_0270453 | |||
| 1693 | Ga0501044_0172946 | |||
| 1694 | Ga0501044_0656156 | |||
| 1695 | Ga0501045_0175787 | |||
| 1696 | nmdc:mga03683_124300_c1 | |||
| 1697 | nmdc:mga03683_136521_c1 | |||
| 1698 | nmdc:mga03683_272928_c1 | |||
| 1699 | nmdc:mga03683_5126_c2 | |||
| 1700 | nmdc:mga03683_65434_c1 | |||
| 1701 | nmdc:mga03n38_30002_c1 | |||
| 1702 | nmdc:mga0yw44_128109_c1 | |||
| 1703 | nmdc:mga0yw44_169367_c1 | |||
| 1704 | nmdc:mga0yw44_5245_c1 | |||
| 1705 | nmdc:mga06z11_117476_c1 | |||
| 1706 | nmdc:mga06z11_13804_c1 | |||
| 1707 | nmdc:mga06z11_6557_c1 | |||
| 1708 | nmdc:mga06z11_667255_c1 | |||
| 1709 | nmdc:mga04h51_186614_c1 | |||
| 1710 | nmdc:mga07m45_105018_c1 | |||
| 1711 | nmdc:mga07m45_543514_c1 | |||
| 1712 | nmdc:mga05p37_247845_c1 | |||
| 1713 | nmdc:mga05p37_436219_c1 | |||
| 1714 | nmdc:mga09592_40700_c1 | |||
| 1715 | nmdc:mga0qj67_48686_c1 | |||
| 1716 | nmdc:mga06r32_306214_c1 | |||
| 1717 | nmdc:mga06r32_817049_c1 | |||
| 1718 | nmdc:mga06r32_848609_c1 | |||
| 1719 | nmdc:mga08y16_13244_c1 | |||
| 1720 | nmdc:mga08y16_27067_c1 | |||
| 1721 | nmdc:mga08y16_86314_c1 | |||
| 1722 | nmdc:mga0n895_1065461_c1 | |||
| 1723 | nmdc:mga0n895_1315673_c1 | |||
| 1724 | nmdc:mga0n895_197712_c1 | |||
| 1725 | nmdc:mga0n895_8320_c1 | |||
| 1726 | nmdc:mga0rr50_58246_c1 | |||
| 1727 | nmdc:mga0a205_276803_c1 | |||
| 1728 | nmdc:mga0a205_339372_c1 | |||
| 1729 | nmdc:mga0sz30_2678_c1 | |||
| 1730 | nmdc:mga0sz30_331934_c1 | |||
| 1731 | nmdc:mga0sz30_69537_c1 | |||
| 1732 | Ga0495601_0010158 | |||
| 1733 | Ga0495612_0016130 | |||
| 1734 | Ga0495612_0137755 | |||
| 1735 | Ga0495612_0236945 | |||
| 1736 | Ga0495655_0214346 | |||
| 1737 | Ga0495595_0033884 | |||
| 1738 | Ga0495595_0137564 | |||
| 1739 | Ga0495619_0189443 | |||
| 1740 | Ga0495619_0304333 | |||
| 1741 | Ga0495619_0551689 | |||
| 1742 | Ga0495619_0605278 | |||
| 1743 | Ga0500644_0192320 | |||
| 1744 | Ga0500583_0370285 | |||
| 1745 | Ga0500555_099858 | |||
| 1746 | Ga0500562_049797 | |||
| 1747 | Ga0500595_011289 | |||
| 1748 | Ga0500642_0112328 | |||
| 1749 | Ga0500655_011111 | |||
| 1750 | Ga0500658_0236280 | |||
| 1751 | Ga0500658_0367189 | |||
| 1752 | Ga0500568_0027985 | |||
| 1753 | Ga0500616_0042713 | |||
| 1754 | Ga0500616_0079012 | |||
| 1755 | Ga0500637_0053928 | |||
| 1756 | Ga0500645_008052 | |||
| 1757 | Ga0500609_030639 | |||
| 1758 | Ga0500552_000860 | |||
| 1759 | Ga0501084_0289138 | |||
| 1760 | Ga0501084_0711958 | |||
| 1761 | Ga0587085_005510 | |||
| 1762 | Ga0587075_034168 | |||
| 1763 | Ga0587079_048623 | |||
| 1764 | Ga0501082_0449598 | |||
| 1765 | Ga0466962_0188154 | |||
| 1766 | Ga0530510_0188964 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7fsf-assembly1.cif.gz_A | crystal structure of t. maritima reverse gyrase active site variant y851f | 0.8874 | 34 | 61 |
| 8ofb-assembly1.cif.gz_A | crystal structure of t. maritima reverse gyrase with a minimal latch, hexagonal form | 0.8712 | 34 | 61 |
| 2wx0-assembly2.cif.gz_G | tab2 nzf domain in complex with lys63-linked di-ubiquitin, p21 | 0.8492 | 34 | 57 |
| 6htj-assembly1.cif.gz_B | crystal structure of the translation recovery factor trf from sulfolobus solfataricus | 0.8475 | 17 | 157 |
| 4ddx-assembly2.cif.gz_B | thermotoga maritima reverse gyrase, primitive monoclinic form | 0.8403 | 34 | 61 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3irbB01 | Special;Helix non-globular;Lyase 2-enoyl-coa Hydratase; Chain; | 0.8403 | 22 | 64 | 6.10.30.10 |
| 2ayjA00 | Few Secondary Structures;Irregular;ZNF265 like; | 0.7841 | 34 | 61 | 4.10.1060.50 |
| 1ltlA03 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2; | 0.7838 | 33 | 64 | 2.20.28.10 |
| 4xxbB00 | Mainly Beta;Roll;SH3 type barrels.;Zn-finger domain of Sec23/24 | 0.7768 | 36 | 57 | 2.30.30.380 |
| af_Q57859_1_190_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.7561 | 36 | 58 | 1.25.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537NBG3-F1-model_v4 | DUF35 domain-containing protein | 0.9779 | 2 | 170 |
|
| AF-A0A5C8P7R6-F1-model_v4 | DUF35 domain-containing protein | 0.9769 | 2 | 170 |
|
| AF-A0A2E5M5Z2-F1-model_v4 | DUF35 domain-containing protein | 0.9764 | 2 | 168 |
|
| AF-A0A537URG0-F1-model_v4 | DUF35 domain-containing protein | 0.9743 | 2 | 170 |
|
| AF-A0A2D9SSH7-F1-model_v4 | DUF35 domain-containing protein | 0.9738 | 4 | 168 |
|