F484603

General Info

Members Datasets Scaffolds Average Seq Length
883 397 1766 171

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0427115|Ga0496104_0427115_321_842
Length 163
Sequence MTIKAHYLGMPLDISELDAENLQYFGYCAEHDFRLQACARCGLLRYPPTTACPWCAEPDARWVAVEGRGTVHSYVEVHHAIQPAFRDHVPYLVLLVDLDTQKGVPTEDEALRVVGNLTTARKVGIGTRMRMTFTDVAPGLALPQWTFDEAAQQPATVWRYPQE

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
229 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
291 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
349 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
350 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
351 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
352 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
378 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
379 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
380 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
381 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
382 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
383 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
384 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
386 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
387 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
388 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
389 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
390 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.78
Nodule 0
Rhizoplane 5.66
Rhizosphere 84.82
Stem 0
Stem Tuber 0
Unclassified 15.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0427115 3300048907 Bacteria 1237
2 CNAas_1001530 3300000532 Unclassified 1917
3 JGI25404J52841_10000466 3300003659 Bacteria 5792
4 JGI25404J52841_10006563 3300003659 Bacteria 2441
5 JGI25405J52794_10115262 3300003911 Bacteria 604
6 Ga0058861_11906857 3300004800 Bacteria 963
7 Ga0058862_10041450 3300004803 Bacteria 1648
8 Ga0065712_10182422 3300005290 Unclassified 1175
9 Ga0065715_10150791 3300005293 Bacteria 1731
10 Ga0070676_10124676 3300005328 Bacteria 1621
11 Ga0070676_10153915 3300005328 Bacteria 1474
12 Ga0070683_100051245 3300005329 Bacteria 3821
13 Ga0070683_100844517 3300005329 Unclassified 878
14 Ga0070683_100941322 3300005329 Bacteria 829
15 Ga0070683_101185709 3300005329 Bacteria 734
16 Ga0070690_100438998 3300005330 Bacteria 966
17 Ga0070670_100007655 3300005331 Bacteria 9178
18 Ga0070677_10139910 3300005333 Bacteria 1115
19 Ga0068869_100101135 3300005334 Bacteria 2180
20 Ga0070666_10515431 3300005335 Unclassified 868
21 Ga0070680_100015192 3300005336 Bacteria 6031
22 Ga0070680_100307752 3300005336 Bacteria 1344
23 Ga0068868_100042945 3300005338 Unclassified 3531
24 Ga0068868_100447879 3300005338 Bacteria 1122
25 Ga0070689_100091378 3300005340 Bacteria 2400
26 Ga0070689_100136362 3300005340 Bacteria 1971
27 Ga0070689_100187803 3300005340 Bacteria 1682
28 Ga0070691_10024133 3300005341 Bacteria 2826
29 Ga0070687_100428064 3300005343 Bacteria 875
30 Ga0070687_100869263 3300005343 Unclassified 644
31 Ga0070661_100043848 3300005344 Bacteria 3267
32 Ga0070692_10005584 3300005345 Bacteria 5381
33 Ga0070692_10189109 3300005345 Bacteria 1198
34 Ga0070668_101602249 3300005347 Unclassified 596
35 Ga0070669_100071994 3300005353 Bacteria 2558
36 Ga0070675_100064979 3300005354 Bacteria 3016
37 Ga0070675_100399720 3300005354 Bacteria 1226
38 Ga0070671_100041542 3300005355 Bacteria 3822
39 Ga0070673_100034196 3300005364 Bacteria 3843
40 Ga0070673_100301730 3300005364 Bacteria 1410
41 Ga0070688_100429541 3300005365 Bacteria 983
42 Ga0070659_100342177 3300005366 Bacteria 1253
43 Ga0070659_100518914 3300005366 Bacteria 1017
44 Ga0070703_10024420 3300005406 Bacteria 1786
45 Ga0070703_10142651 3300005406 Unclassified 892
46 Ga0070709_10083411 3300005434 Bacteria 2091
47 Ga0070709_10218377 3300005434 Bacteria 1358
48 Ga0070709_10577555 3300005434 Bacteria 863
49 Ga0070714_100280625 3300005435 Bacteria 1547
50 Ga0070714_100509942 3300005435 Bacteria 1148
51 Ga0070714_100999566 3300005435 Bacteria 814
52 Ga0070714_101021676 3300005435 Bacteria 805
53 Ga0070714_102113984 3300005435 Unclassified 549
54 Ga0070713_100019113 3300005436 Bacteria 5221
55 Ga0070713_100048845 3300005436 Bacteria 3487
56 Ga0070713_100079021 3300005436 Bacteria 2801
57 Ga0070713_100089973 3300005436 Bacteria 2638
58 Ga0070713_100111229 3300005436 Bacteria 2388
59 Ga0070713_100184070 3300005436 Bacteria 1879
60 Ga0070713_100218331 3300005436 Bacteria 1729
61 Ga0070713_101496012 3300005436 Unclassified 655
62 Ga0070710_10031505 3300005437 Bacteria 2864
63 Ga0070710_10040953 3300005437 Bacteria 2555
64 Ga0070710_10191370 3300005437 Bacteria 1287
65 Ga0070710_10267733 3300005437 Bacteria 1104
66 Ga0070701_10045555 3300005438 Bacteria 2251
67 Ga0070711_100130049 3300005439 Bacteria 1874
68 Ga0070711_100231451 3300005439 Bacteria 1441
69 Ga0070711_100350488 3300005439 Bacteria 1187
70 Ga0070711_100740908 3300005439 Bacteria 830
71 Ga0070705_100000027 3300005440 Bacteria 77032
72 Ga0070700_100005070 3300005441 Bacteria 6944
73 Ga0070700_100038619 3300005441 Bacteria 2911
74 Ga0070700_100078777 3300005441 Bacteria 2122
75 Ga0070700_100715643 3300005441 Bacteria 798
76 Ga0070694_100003970 3300005444 Bacteria 8848
77 Ga0070694_100100445 3300005444 Bacteria 2046
78 Ga0070708_100007134 3300005445 Bacteria 8916
79 Ga0070663_100017270 3300005455 Bacteria 4706
80 Ga0070663_100116542 3300005455 Unclassified 2013
81 Ga0070663_100303877 3300005455 Bacteria 1278
82 Ga0070663_100418071 3300005455 Bacteria 1099
83 Ga0070678_100033423 3300005456 Bacteria 3571
84 Ga0070678_100292185 3300005456 Bacteria 1382
85 Ga0070678_100545222 3300005456 Unclassified 1029
86 Ga0070662_100196891 3300005457 Bacteria 1596
87 Ga0070681_10026594 3300005458 Bacteria 5816
88 Ga0070681_10089272 3300005458 Bacteria 3034
89 Ga0070681_10244173 3300005458 Bacteria 1709
90 Ga0070681_10686205 3300005458 Unclassified 940
91 Ga0070681_11544961 3300005458 Unclassified 589
92 Ga0068867_100242418 3300005459 Bacteria 1462
93 Ga0068867_100738935 3300005459 Bacteria 872
94 Ga0070706_100109120 3300005467 Bacteria 2575
95 Ga0070706_100532594 3300005467 Bacteria 1093
96 Ga0070706_100629173 3300005467 Unclassified 997
97 Ga0070707_100157450 3300005468 Bacteria 2213
98 Ga0070698_100000373 3300005471 Bacteria 46692
99 Ga0070698_100064657 3300005471 Bacteria 3685
100 Ga0070698_100281442 3300005471 Bacteria 1595
101 Ga0070699_100003114 3300005518 Bacteria 14673
102 Ga0070699_100036258 3300005518 Bacteria 4266
103 Ga0070699_100425250 3300005518 Bacteria 1202
104 Ga0070699_100849866 3300005518 Bacteria 835
105 Ga0070679_100079875 3300005530 Bacteria 3260
106 Ga0070679_100299212 3300005530 Bacteria 1560
107 Ga0070679_100887734 3300005530 Bacteria 835
108 Ga0070684_100032472 3300005535 Bacteria 4449
109 Ga0070684_100035776 3300005535 Bacteria 4252
110 Ga0070684_101089033 3300005535 Bacteria 751
111 Ga0070697_100008988 3300005536 Bacteria 7806
112 Ga0070697_100090869 3300005536 Bacteria 2524
113 Ga0070697_100224007 3300005536 Bacteria 1603
114 Ga0070697_100374211 3300005536 Bacteria 1233
115 Ga0070672_100215414 3300005543 Bacteria 1610
116 Ga0070672_100233960 3300005543 Bacteria 1544
117 Ga0070672_101018425 3300005543 Unclassified 734
118 Ga0070686_100936976 3300005544 Unclassified 707
119 Ga0070695_100000215 3300005545 Bacteria 28071
120 Ga0070695_100014268 3300005545 Bacteria 4789
121 Ga0070696_100000671 3300005546 Bacteria 21891
122 Ga0070696_100782884 3300005546 Unclassified 784
123 Ga0070665_100012234 3300005548 Bacteria 8650
124 Ga0070665_100069091 3300005548 Bacteria 3541
125 Ga0070665_100095281 3300005548 Bacteria 2981
126 Ga0070665_100118851 3300005548 Bacteria 2645
127 Ga0070665_100149830 3300005548 Bacteria 2335
128 Ga0070704_100000121 3300005549 Bacteria 28186
129 Ga0070704_100797213 3300005549 Bacteria 844
130 Ga0068855_100729337 3300005563 Bacteria 1058
131 Ga0068855_101213271 3300005563 Unclassified 784
132 Ga0070664_100008442 3300005564 Bacteria 8331
133 Ga0070664_101015197 3300005564 Unclassified 780
134 Ga0068857_100039871 3300005577 Bacteria 4163
135 Ga0068854_100046583 3300005578 Bacteria 3087
136 Ga0068854_100358469 3300005578 Bacteria 1196
137 Ga0068856_100053811 3300005614 Bacteria 3969
138 Ga0068856_100138976 3300005614 Bacteria 2436
139 Ga0068856_100260925 3300005614 Bacteria 1748
140 Ga0068856_100276183 3300005614 Bacteria 1697
141 Ga0068856_100300078 3300005614 Bacteria 1624
142 Ga0068856_100333895 3300005614 Bacteria 1534
143 Ga0070702_100031173 3300005615 Bacteria 2915
144 Ga0070702_100276900 3300005615 Bacteria 1150
145 Ga0068852_100003470 3300005616 Bacteria 11025
146 Ga0068852_100532173 3300005616 Bacteria 1174
147 Ga0068852_100654177 3300005616 Bacteria 1059
148 Ga0068859_100004939 3300005617 Bacteria 13552
149 Ga0068859_101459599 3300005617 Unclassified 755
150 Ga0068859_101819349 3300005617 Bacteria 673
151 Ga0068864_100003765 3300005618 Bacteria 12513
152 Ga0068864_100690796 3300005618 Bacteria 996
153 Ga0068861_100021812 3300005719 Bacteria 4606
154 Ga0068861_100029739 3300005719 Plasmid 3998
155 Ga0068861_100040462 3300005719 Bacteria 3487
156 Ga0068851_10140322 3300005834 Bacteria 1314
157 Ga0068863_100521831 3300005841 Bacteria 1171
158 Ga0068858_100123668 3300005842 Bacteria 2421
159 Ga0068858_100216552 3300005842 Bacteria 1813
160 Ga0068860_100001599 3300005843 Bacteria 24324
161 Ga0068860_100021198 3300005843 Bacteria 6295
162 Ga0068860_100095774 3300005843 Bacteria 2829
163 Ga0068860_101201082 3300005843 Bacteria 779
164 Ga0068862_100004275 3300005844 Bacteria 12082
165 Ga0068862_100019083 3300005844 Bacteria 5717
166 Ga0068862_100164047 3300005844 Bacteria 1985
167 Ga0081455_10000170 3300005937 Bacteria 80847
168 Ga0081455_10003896 3300005937 Bacteria 16993
169 Ga0081455_10026928 3300005937 Bacteria 5276
170 Ga0081455_10125231 3300005937 Bacteria 2018
171 Ga0081540_1000165 3300005983 Bacteria 68435
172 Ga0081540_1003588 3300005983 Bacteria 12193
173 Ga0081540_1005450 3300005983 Bacteria 9494
174 Ga0081540_1060948 3300005983 Bacteria 1801
175 Ga0081539_10016609 3300005985 Bacteria 5238
176 Ga0081539_10035864 3300005985 Bacteria 2974
177 Ga0070717_10021763 3300006028 Bacteria 5057
178 Ga0070717_10032696 3300006028 Bacteria 4194
179 Ga0070717_10216357 3300006028 Bacteria 1683
180 Ga0070717_10230532 3300006028 Bacteria 1630
181 Ga0070717_10230936 3300006028 Bacteria 1629
182 Ga0070717_10343288 3300006028 Bacteria 1334
183 Ga0070717_10544176 3300006028 Bacteria 1051
184 Ga0075365_10052430 3300006038 Bacteria 2698
185 Ga0075365_10079521 3300006038 Bacteria 2218
186 Ga0075365_10495330 3300006038 Bacteria 863
187 Ga0075363_100044996 3300006048 Bacteria 2340
188 Ga0070715_10264778 3300006163 Bacteria 904
189 Ga0070716_100655424 3300006173 Unclassified 797
190 Ga0070712_100171707 3300006175 Bacteria 1683
191 Ga0070712_100251408 3300006175 Bacteria 1413
192 Ga0070712_100479641 3300006175 Bacteria 1040
193 Ga0075362_10057223 3300006177 Bacteria 1757
194 Ga0075362_10302023 3300006177 Bacteria 794
195 Ga0075367_10122437 3300006178 Bacteria 1603
196 Ga0075367_10322755 3300006178 Bacteria 973
197 Ga0075369_10036540 3300006186 Bacteria 2090
198 Ga0075369_10047875 3300006186 Bacteria 1844
199 Ga0075369_10235874 3300006186 Bacteria 848
200 Ga0097621_100209963 3300006237 Unclassified 1694
201 Ga0075370_10041208 3300006353 Bacteria 2606
202 Ga0075370_10081961 3300006353 Bacteria 1854
203 Ga0075370_10684351 3300006353 Unclassified 623
204 Ga0068871_100109858 3300006358 Bacteria 2319
205 Ga0068871_100695985 3300006358 Bacteria 931
206 Ga0075428_100232419 3300006844 Bacteria 1990
207 Ga0075428_100870678 3300006844 Bacteria 956
208 Ga0075431_100067472 3300006847 Unclassified 3692
209 Ga0075431_100303050 3300006847 Bacteria 1614
210 Ga0075431_100332465 3300006847 Bacteria 1530
211 Ga0075431_100407634 3300006847 Bacteria 1360
212 Ga0075434_100015055 3300006871 Bacteria 7406
213 Ga0075434_100046302 3300006871 Bacteria 4316
214 Ga0075434_100663337 3300006871 Bacteria 1061
215 Ga0068865_100138439 3300006881 Bacteria 1832
216 Ga0097620_100004939 3300006931 Bacteria 13552
217 Ga0097620_101459357 3300006931 Unclassified 755
218 Ga0097620_101819313 3300006931 Bacteria 673
219 Ga0099794_10089898 3300007265 Bacteria 1523
220 Ga0099795_10446390 3300007788 Bacteria 595
221 Ga0105250_10037562 3300009092 Bacteria 1944
222 Ga0105240_10945515 3300009093 Bacteria 925
223 Ga0111539_10038895 3300009094 Bacteria 5737
224 Ga0111539_10083887 3300009094 Bacteria 3747
225 Ga0111539_10522553 3300009094 Unclassified 1383
226 Ga0111539_10702296 3300009094 Unclassified 1177
227 Ga0111539_10983068 3300009094 Bacteria 981
228 Ga0105245_10076632 3300009098 Bacteria 3047
229 Ga0105245_10304050 3300009098 Bacteria 1566
230 Ga0105245_10463529 3300009098 Bacteria 1278
231 Ga0105245_10955718 3300009098 Bacteria 900
232 Ga0105245_11518769 3300009098 Bacteria 721
233 Ga0105247_10134638 3300009101 Bacteria 1613
234 Ga0105247_10177323 3300009101 Bacteria 1420
235 Ga0105247_10316621 3300009101 Bacteria 1087
236 Ga0114129_10194576 3300009147 Bacteria 2751
237 Ga0114129_10735183 3300009147 Bacteria 1265
238 Ga0105243_11163207 3300009148 Unclassified 783
239 Ga0105241_11073820 3300009174 Bacteria 757
240 Ga0105242_10381570 3300009176 Bacteria 1310
241 Ga0105242_10988112 3300009176 Unclassified 848
242 Ga0105248_10013866 3300009177 Bacteria 8868
243 Ga0105248_10128204 3300009177 Bacteria 2862
244 Ga0105248_10354981 3300009177 Bacteria 1651
245 Ga0105248_11235694 3300009177 Bacteria 845
246 Ga0105248_11708310 3300009177 Unclassified 714
247 Ga0105238_10017243 3300009551 Bacteria 7337
248 Ga0105238_10101554 3300009551 Bacteria 2858
249 Ga0105238_10253526 3300009551 Bacteria 1738
250 Ga0105238_10435904 3300009551 Bacteria 1306
251 Ga0105238_10877399 3300009551 Bacteria 915
252 Ga0105238_11077524 3300009551 Bacteria 826
253 Ga0105238_11635770 3300009551 Unclassified 674
254 Ga0105249_10007364 3300009553 Bacteria 9596
255 Ga0105249_10672116 3300009553 Unclassified 1094
256 Ga0105249_10941853 3300009553 Unclassified 931
257 Ga0105239_10027217 3300010375 Bacteria 6294
258 Ga0105239_10041704 3300010375 Bacteria 5029
259 Ga0105239_10172087 3300010375 Bacteria 2422
260 Ga0105239_10186584 3300010375 Bacteria 2321
261 Ga0105239_10592344 3300010375 Bacteria 1264
262 Ga0105239_11369901 3300010375 Unclassified 816
263 Ga0105239_12046198 3300010375 Bacteria 665
264 Ga0105246_10007852 3300011119 Bacteria 6547
265 Ga0105246_10348575 3300011119 Bacteria 1212
266 Ga0157319_1006823 3300012497 Unclassified 830
267 Ga0157370_10286009 3300013104 Bacteria 1523
268 Ga0157369_10191033 3300013105 Bacteria 2152
269 Ga0157369_10347994 3300013105 Bacteria 1539
270 Ga0157369_10476681 3300013105 Bacteria 1291
271 Ga0157374_10238597 3300013296 Bacteria 1787
272 Ga0157374_10349751 3300013296 Bacteria 1468
273 Ga0157374_11142970 3300013296 Bacteria 799
274 Ga0157378_10510313 3300013297 Unclassified 1202
275 Ga0157378_10887569 3300013297 Unclassified 922
276 Ga0157378_11447679 3300013297 Bacteria 731
277 Ga0163162_10124587 3300013306 Bacteria 2682
278 Ga0163162_10329489 3300013306 Bacteria 1659
279 Ga0163162_11134194 3300013306 Unclassified 886
280 Ga0157372_10160722 3300013307 Bacteria 2596
281 Ga0157372_11527680 3300013307 Unclassified 769
282 Ga0157372_12143610 3300013307 Bacteria 642
283 Ga0157375_10047640 3300013308 Bacteria 4187
284 Ga0163163_10038268 3300014325 Bacteria 4674
285 Ga0163163_10168230 3300014325 Bacteria 2238
286 Ga0163163_10407766 3300014325 Bacteria 1418
287 Ga0163163_10677294 3300014325 Bacteria 1095
288 Ga0163163_10968529 3300014325 Unclassified 914
289 Ga0163163_11948114 3300014325 Unclassified 647
290 Ga0157380_10018015 3300014326 Bacteria 5238
291 Ga0182008_10046982 3300014497 Bacteria 2145
292 Ga0157379_10100729 3300014968 Bacteria 2593
293 Ga0157376_10040344 3300014969 Bacteria 3815
294 Ga0157376_10244867 3300014969 Bacteria 1672
295 Ga0206354_11337313 3300020081 Bacteria 1017
296 Ga0213872_10087805 3300021361 Bacteria 1393
297 Ga0213876_10206758 3300021384 Bacteria 1043
298 Ga0213875_10000025 3300021388 Bacteria 197787
299 Ga0213875_10002700 3300021388 Bacteria 10476
300 Ga0213875_10060708 3300021388 Bacteria 1768
301 Ga0213875_10174665 3300021388 Bacteria 1009
302 Ga0213871_10014807 3300021441 Bacteria 1856
303 Ga0224712_10201090 3300022467 Unclassified 906
304 Ga0228598_1007055 3300024227 Bacteria 2305
305 Ga0207426_1011906 3300025302 Bacteria 3291
306 Ga0207656_10061786 3300025321 Bacteria 1645
307 Ga0207696_1028797 3300025711 Bacteria 1701
308 Ga0207653_10002213 3300025885 Bacteria 6198
309 Ga0207682_10047564 3300025893 Bacteria 1766
310 Ga0207692_10026131 3300025898 Bacteria 2736
311 Ga0207692_10208636 3300025898 Bacteria 1152
312 Ga0207692_10277500 3300025898 Bacteria 1013
313 Ga0207642_10099470 3300025899 Unclassified 1456
314 Ga0207710_10419415 3300025900 Unclassified 688
315 Ga0207710_10618864 3300025900 Bacteria 566
316 Ga0207688_10059732 3300025901 Bacteria 2147
317 Ga0207680_10403252 3300025903 Unclassified 966
318 Ga0207680_10432307 3300025903 Bacteria 933
319 Ga0207647_10106921 3300025904 Bacteria 1656
320 Ga0207685_10010772 3300025905 Bacteria 2718
321 Ga0207685_10103326 3300025905 Bacteria 1222
322 Ga0207685_10116913 3300025905 Bacteria 1165
323 Ga0207685_10338300 3300025905 Bacteria 755
324 Ga0207699_10038389 3300025906 Bacteria 2744
325 Ga0207699_10169974 3300025906 Bacteria 1458
326 Ga0207699_10208951 3300025906 Bacteria 1327
327 Ga0207699_10262496 3300025906 Bacteria 1194
328 Ga0207699_10293593 3300025906 Unclassified 1133
329 Ga0207643_10280213 3300025908 Bacteria 1034
330 Ga0207684_10171388 3300025910 Bacteria 1871
331 Ga0207684_10198243 3300025910 Bacteria 1732
332 Ga0207684_10612030 3300025910 Unclassified 930
333 Ga0207684_10940156 3300025910 Bacteria 725
334 Ga0207654_10454830 3300025911 Bacteria 898
335 Ga0207707_10011837 3300025912 Bacteria 7587
336 Ga0207707_10126208 3300025912 Bacteria 2238
337 Ga0207707_10153390 3300025912 Bacteria 2014
338 Ga0207707_10241296 3300025912 Bacteria 1571
339 Ga0207707_10292693 3300025912 Bacteria 1409
340 Ga0207695_10289793 3300025913 Bacteria 1529
341 Ga0207671_10076135 3300025914 Bacteria 2510
342 Ga0207671_10219121 3300025914 Bacteria 1490
343 Ga0207693_10080551 3300025915 Bacteria 2549
344 Ga0207693_10158434 3300025915 Bacteria 1781
345 Ga0207693_10496183 3300025915 Bacteria 953
346 Ga0207693_10589366 3300025915 Bacteria 866
347 Ga0207693_10610467 3300025915 Bacteria 849
348 Ga0207663_10015354 3300025916 Bacteria 4223
349 Ga0207663_10036361 3300025916 Unclassified 2962
350 Ga0207663_10064605 3300025916 Bacteria 2336
351 Ga0207663_11178346 3300025916 Bacteria 617
352 Ga0207660_10193063 3300025917 Bacteria 1587
353 Ga0207660_10379360 3300025917 Unclassified 1136
354 Ga0207660_10463044 3300025917 Bacteria 1026
355 Ga0207662_10164196 3300025918 Bacteria 1421
356 Ga0207662_10236333 3300025918 Bacteria 1195
357 Ga0207662_10447473 3300025918 Bacteria 883
358 Ga0207649_10065610 3300025920 Bacteria 2298
359 Ga0207652_10101638 3300025921 Bacteria 2540
360 Ga0207652_10224324 3300025921 Bacteria 1693
361 Ga0207652_10478713 3300025921 Bacteria 1121
362 Ga0207694_10082349 3300025924 Bacteria 2529
363 Ga0207694_10270389 3300025924 Bacteria 1394
364 Ga0207650_10054682 3300025925 Bacteria 2962
365 Ga0207650_10194767 3300025925 Bacteria 1621
366 Ga0207659_10241137 3300025926 Bacteria 1462
367 Ga0207659_10643339 3300025926 Bacteria 906
368 Ga0207700_10046275 3300025928 Bacteria 3216
369 Ga0207700_10049398 3300025928 Bacteria 3129
370 Ga0207700_10069119 3300025928 Unclassified 2710
371 Ga0207700_10105240 3300025928 Bacteria 2259
372 Ga0207700_10679492 3300025928 Unclassified 918
373 Ga0207664_10185630 3300025929 Bacteria 1788
374 Ga0207664_10276773 3300025929 Bacteria 1472
375 Ga0207644_10034506 3300025931 Bacteria 3540
376 Ga0207690_10435426 3300025932 Bacteria 1051
377 Ga0207706_10268567 3300025933 Bacteria 1489
378 Ga0207706_10602813 3300025933 Unclassified 943
379 Ga0207686_10131524 3300025934 Bacteria 1717
380 Ga0207709_10046875 3300025935 Bacteria 2625
381 Ga0207709_10171567 3300025935 Bacteria 1523
382 Ga0207709_10181108 3300025935 Bacteria 1488
383 Ga0207670_10062510 3300025936 Bacteria 2545
384 Ga0207670_10116426 3300025936 Bacteria 1935
385 Ga0207669_10118606 3300025937 Bacteria 1791
386 Ga0207669_10303098 3300025937 Unclassified 1215
387 Ga0207704_10234331 3300025938 Bacteria 1367
388 Ga0207665_10151104 3300025939 Unclassified 1663
389 Ga0207665_10485370 3300025939 Bacteria 953
390 Ga0207691_10161154 3300025940 Bacteria 1968
391 Ga0207691_10170728 3300025940 Bacteria 1904
392 Ga0207691_10379451 3300025940 Bacteria 1207
393 Ga0207691_10868242 3300025940 Unclassified 756
394 Ga0207711_10088480 3300025941 Bacteria 2719
395 Ga0207711_10226758 3300025941 Bacteria 1711
396 Ga0207689_10024946 3300025942 Bacteria 5012
397 Ga0207689_11117895 3300025942 Bacteria 664
398 Ga0207661_10018382 3300025944 Bacteria 5192
399 Ga0207661_10138068 3300025944 Bacteria 2095
400 Ga0207679_10324187 3300025945 Bacteria 1335
401 Ga0207679_10425154 3300025945 Bacteria 1173
402 Ga0207667_10107494 3300025949 Bacteria 2878
403 Ga0207667_10130780 3300025949 Bacteria 2585
404 Ga0207667_10648277 3300025949 Bacteria 1062
405 Ga0207667_11057937 3300025949 Unclassified 796
406 Ga0207651_10004925 3300025960 Bacteria 6812
407 Ga0207712_10003012 3300025961 Bacteria 10757
408 Ga0207712_10215606 3300025961 Unclassified 1532
409 Ga0207668_10004203 3300025972 Bacteria 8444
410 Ga0207668_10020969 3300025972 Bacteria 4161
411 Ga0207668_10590246 3300025972 Bacteria 967
412 Ga0207668_10790183 3300025972 Unclassified 839
413 Ga0207668_10916359 3300025972 Unclassified 781
414 Ga0207640_10358798 3300025981 Bacteria 1174
415 Ga0207640_10870486 3300025981 Bacteria 785
416 Ga0207658_10670582 3300025986 Bacteria 936
417 Ga0207703_10041514 3300026035 Bacteria 3686
418 Ga0207703_10186569 3300026035 Bacteria 1834
419 Ga0207639_10339504 3300026041 Bacteria 1339
420 Ga0207678_10030428 3300026067 Bacteria 4713
421 Ga0207678_10341606 3300026067 Unclassified 1290
422 Ga0207678_10437839 3300026067 Bacteria 1135
423 Ga0207708_10001123 3300026075 Bacteria 20119
424 Ga0207708_10024330 3300026075 Bacteria 4581
425 Ga0207708_10163414 3300026075 Bacteria 1759
426 Ga0207708_10910213 3300026075 Bacteria 761
427 Ga0207702_10053564 3300026078 Bacteria 3416
428 Ga0207702_10369572 3300026078 Bacteria 1377
429 Ga0207702_10390928 3300026078 Bacteria 1339
430 Ga0207702_10400797 3300026078 Bacteria 1323
431 Ga0207641_10315541 3300026088 Bacteria 1481
432 Ga0207641_10897597 3300026088 Bacteria 880
433 Ga0207648_10170786 3300026089 Bacteria 1922
434 Ga0207648_10544210 3300026089 Unclassified 1066
435 Ga0207676_10004150 3300026095 Bacteria 10230
436 Ga0207676_10587087 3300026095 Bacteria 1069
437 Ga0207676_10604854 3300026095 Bacteria 1053
438 Ga0207676_11276578 3300026095 Bacteria 729
439 Ga0207674_10003474 3300026116 Bacteria 19275
440 Ga0207674_10038401 3300026116 Bacteria 4970
441 Ga0207674_10405626 3300026116 Bacteria 1317
442 Ga0207675_100059002 3300026118 Bacteria 3581
443 Ga0207675_100234285 3300026118 Bacteria 1772
444 Ga0207675_101034633 3300026118 Bacteria 840
445 Ga0207683_10022141 3300026121 Bacteria 5453
446 Ga0207683_10054350 3300026121 Unclassified 3512
447 Ga0207683_10069804 3300026121 Bacteria 3103
448 Ga0207683_10339465 3300026121 Unclassified 1378
449 Ga0207683_10384192 3300026121 Bacteria 1291
450 Ga0207683_10684216 3300026121 Unclassified 951
451 Ga0207698_10015975 3300026142 Bacteria 5048
452 Ga0207698_10511404 3300026142 Bacteria 1170
453 Ga0207698_10984857 3300026142 Bacteria 853
454 Ga0207698_12157136 3300026142 Unclassified 570
455 Ga0209813_10161242 3300027866 Bacteria 809
456 Ga0207428_10068914 3300027907 Bacteria 2782
457 Ga0207428_10333382 3300027907 Bacteria 1118
458 Ga0268266_10010517 3300028379 Bacteria 8079
459 Ga0268266_10056769 3300028379 Bacteria 3368
460 Ga0268266_10069677 3300028379 Bacteria 3048
461 Ga0268266_10121417 3300028379 Bacteria 2326
462 Ga0268266_10126023 3300028379 Bacteria 2285
463 Ga0268265_10047475 3300028380 Bacteria 3217
464 Ga0268265_10178240 3300028380 Bacteria 1823
465 Ga0268264_10003345 3300028381 Bacteria 13859
466 Ga0268264_10032061 3300028381 Bacteria 4311
467 Ga0268264_10061662 3300028381 Bacteria 3147
468 Ga0265337_1128329 3300028556 Bacteria 688
469 Ga0307517_10245824 3300028786 Unclassified 1056
470 Ga0265332_10097303 3300031238 Bacteria 1243
471 Ga0265320_10427980 3300031240 Bacteria 584
472 Ga0265325_10000945 3300031241 Bacteria 20995
473 Ga0307513_10745820 3300031456 Bacteria 685
474 Ga0307509_10016846 3300031507 Bacteria 8436
475 Ga0307508_10529694 3300031616 Unclassified 775
476 Ga0265314_10485339 3300031711 Unclassified 653
477 Ga0265342_10156959 3300031712 Bacteria 1260
478 Ga0307516_10033866 3300031730 Bacteria 5139
479 Ga0307510_10002894 3300033180 Bacteria 19752
480 Ga0373958_0031649 3300034819 Bacteria 1041
481 Ga0373958_0127713 3300034819 Unclassified 620
482 Ga0373926_0105849 3300035083 Bacteria 1055
483 Ga0373929_0034946 3300035085 Bacteria 1092
484 Ga0373934_0062522 3300035086 Bacteria 1484
485 Ga0373934_0092290 3300035086 Bacteria 1221
486 Ga0373934_0183260 3300035086 Unclassified 861
487 Ga0373952_0013387 3300035092 Unclassified 1626
488 Ga0373952_0028420 3300035092 Bacteria 1226
489 Ga0373923_0026296 3300035111 Bacteria 2315
490 Ga0373923_0055512 3300035111 Bacteria 1670
491 Ga0373923_0114480 3300035111 Bacteria 1200
492 Ga0373923_0116567 3300035111 Bacteria 1190
493 Ga0373923_0118279 3300035111 Bacteria 1182
494 Ga0373936_0039672 3300035113 Bacteria 1885
495 Ga0373936_0059607 3300035113 Bacteria 1556
496 Ga0373936_0087185 3300035113 Bacteria 1305
497 Ga0373939_0019806 3300035114 Bacteria 1819
498 Ga0373941_0003957 3300035115 Bacteria 3393
499 Ga0373945_0003765 3300035116 Bacteria 4788
500 Ga0373945_0088846 3300035116 Bacteria 1194
501 Ga0373945_0136807 3300035116 Unclassified 985
502 Ga0373945_0366768 3300035116 Unclassified 627
503 Ga0373945_0457781 3300035116 Unclassified 565
504 Ga0373953_0002118 3300035117 Bacteria 5932
505 Ga0373953_0011679 3300035117 Bacteria 3091
506 Ga0373953_0060338 3300035117 Bacteria 1550
507 Ga0373954_0074055 3300035118 Bacteria 1621
508 Ga0373954_0263485 3300035118 Unclassified 849
509 Ga0373956_0110441 3300035119 Bacteria 1280
510 Ga0373957_0042465 3300035120 Bacteria 1716
511 Ga0373957_0059147 3300035120 Bacteria 1481
512 Ga0373960_0189678 3300035121 Unclassified 722
513 Ga0373943_0093912 3300035170 Bacteria 1558
514 Ga0373943_0210354 3300035170 Unclassified 1080
515 Ga0373946_0252283 3300035171 Unclassified 861
516 Ga0373955_0051812 3300035172 Bacteria 2237
517 Ga0373955_0109814 3300035172 Bacteria 1594
518 Ga0373942_0037748 3300035207 Bacteria 1307
519 Ga0373961_0023611 3300035241 Bacteria 1656
520 Ga0373962_0020089 3300035242 Bacteria 1751
521 Ga0373924_0002935 3300035410 Bacteria 5790
522 Ga0373924_0056344 3300035410 Bacteria 1637
523 Ga0373924_0072595 3300035410 Bacteria 1454
524 Ga0373931_0000190 3300035691 Bacteria 26391
525 Ga0373931_0017526 3300035691 Unclassified 3545
526 Ga0373931_0661146 3300035691 Bacteria 687
527 Ga0373935_0001072 3300035692 Bacteria 14919
528 Ga0373935_0125709 3300035692 Bacteria 1718
529 Ga0373935_0194909 3300035692 Bacteria 1397
530 Ga0373927_0007687 3300035695 Bacteria 7295
531 Ga0373927_0022003 3300035695 Bacteria 4178
532 Ga0373927_0088135 3300035695 Bacteria 2014
533 Ga0373927_0218665 3300035695 Bacteria 1251
534 Ga0373927_0374128 3300035695 Bacteria 939
535 Ga0373927_0411013 3300035695 Bacteria 893
536 Ga0373927_0426491 3300035695 Bacteria 875
537 Ga0373933_0007920 3300035724 Bacteria 5798
538 Ga0373933_0024476 3300035724 Bacteria 3456
539 Ga0373947_0003022 3300035725 Bacteria 10027
540 Ga0373947_0014841 3300035725 Bacteria 4470
541 Ga0373947_0041396 3300035725 Bacteria 2747
542 Ga0373947_0064871 3300035725 Bacteria 2227
543 Ga0373947_0076370 3300035725 Bacteria 2065
544 Ga0373947_0267536 3300035725 Bacteria 1134
545 Ga0373947_0736859 3300035725 Bacteria 672
546 Ga0373937_0031497 3300036401 Bacteria 4806
547 Ga0373937_0068542 3300036401 Bacteria 3271
548 Ga0373937_0135301 3300036401 Unclassified 2304
549 Ga0373937_0257236 3300036401 Bacteria 1646
550 Ga0373937_0291241 3300036401 Bacteria 1542
551 Ga0373937_0480345 3300036401 Bacteria 1180
552 Ga0373937_0698584 3300036401 Bacteria 961
553 Ga0372808_003711 3300036459 Bacteria 1899
554 Ga0373925_0008562 3300037068 Bacteria 7455
555 Ga0373925_0092306 3300037068 Bacteria 2316
556 Ga0373925_0157366 3300037068 Bacteria 1788
557 Ga0373925_0223653 3300037068 Bacteria 1503
558 Ga0373925_0381838 3300037068 Bacteria 1147
559 Ga0373925_1161929 3300037068 Unclassified 635
560 Ga0395899_0008802 3300037312 Bacteria 7767
561 Ga0395899_0042787 3300037312 Bacteria 3380
562 Ga0395900_0022683 3300037418 Bacteria 6424
563 Ga0395900_0118377 3300037418 Bacteria 2718
564 Ga0395898_0022154 3300037466 Bacteria 6436
565 Ga0395905_0724296 3300037471 Bacteria 897
566 Ga0436364_0318172 3300037853 Bacteria 79481
567 Ga0436364_0380413 3300037853 Bacteria 67254
568 Ga0436364_0743460 3300037853 Bacteria 2340
569 Ga0436364_0869355 3300037853 Bacteria 1011
570 Ga0436364_0890876 3300037853 Bacteria 3344
571 Ga0436364_0952428 3300037853 Bacteria 1049
572 Ga0436364_1315834 3300037853 Bacteria 777
573 Ga0436364_1475265 3300037853 Bacteria 2821
574 Ga0436364_1505524 3300037853 Bacteria 6283
575 Ga0395901_0002997 3300038443 Bacteria 17031
576 Ga0395901_0046168 3300038443 Bacteria 4524
577 Ga0395901_0978848 3300038443 Bacteria 823
578 Ga0436365_0010204 3300039437 Bacteria 8365
579 Ga0436365_0234591 3300039437 Bacteria 1324
580 Ga0436365_0288774 3300039437 Bacteria 823
581 Ga0436365_0537494 3300039437 Bacteria 2717
582 Ga0436365_1140272 3300039437 Bacteria 662
583 Ga0436360_0331427 3300039438 Unclassified 584
584 Ga0436360_0675523 3300039438 Bacteria 729
585 Ga0436360_0979552 3300039438 Bacteria 8781
586 Ga0436361_0378589 3300039447 Bacteria 3727
587 Ga0436361_0687925 3300039447 Bacteria 1184
588 Ga0436361_1013634 3300039447 Bacteria 4392
589 Ga0436363_0049181 3300039450 Bacteria 664
590 Ga0436363_0709777 3300039450 Bacteria 962
591 Ga0436363_1523833 3300039450 Bacteria 1044
592 Ga0436363_1624602 3300039450 Bacteria 2560
593 Ga0436362_0268644 3300039453 Bacteria 3918
594 Ga0436362_0896088 3300039453 Bacteria 1050
595 Ga0466966_0116799 3300044684 Bacteria 1642
596 Ga0466971_0417601 3300044719 Bacteria 655
597 Ga0466968_0319583 3300044735 Bacteria 750
598 Ga0466970_0409523 3300044765 Bacteria 774
599 Ga0466957_1161730 3300044842 Unclassified 558
600 Ga0466959_0043253 3300045049 Bacteria 3321
601 Ga0451576_0067510 3300045051 Bacteria 3723
602 Ga0466967_0137014 3300045976 Bacteria 2277
603 Ga0466967_0383220 3300045976 Bacteria 1365
604 Ga0466967_1545232 3300045976 Bacteria 661
605 Ga0466967_2052499 3300045976 Bacteria 568
606 Ga0495617_033637 3300046452 Bacteria 1720
607 Ga0495592_0019808 3300046454 Bacteria 5116
608 Ga0495592_0042883 3300046454 Bacteria 3387
609 Ga0495592_0455579 3300046454 Unclassified 801
610 Ga0495603_0000777 3300046455 Bacteria 18238
611 Ga0495603_0517540 3300046455 Unclassified 683
612 Ga0495603_0724360 3300046455 Unclassified 568
613 Ga0495629_0000601 3300046459 Bacteria 29283
614 Ga0495629_0188711 3300046459 Bacteria 1427
615 Ga0495629_0237586 3300046459 Bacteria 1255
616 Ga0495629_0300625 3300046459 Bacteria 1099
617 Ga0495629_0462494 3300046459 Bacteria 858
618 Ga0495638_0015815 3300046460 Bacteria 5055
619 Ga0495641_0003737 3300046461 Bacteria 11193
620 Ga0495651_0052339 3300046462 Bacteria 3145
621 Ga0495651_0192493 3300046462 Bacteria 1434
622 Ga0495651_0302368 3300046462 Bacteria 1072
623 Ga0495651_0421887 3300046462 Bacteria 867
624 Ga0495653_0225905 3300046463 Bacteria 1256
625 Ga0495580_0004904 3300046472 Bacteria 11188
626 Ga0495580_0687648 3300046472 Bacteria 670
627 Ga0495582_0000756 3300046473 Bacteria 17834
628 Ga0495639_0001642 3300046475 Bacteria 9961
629 Ga0495639_0242726 3300046475 Unclassified 889
630 Ga0495662_0000177 3300046476 Bacteria 25523
631 Ga0495664_0003827 3300046477 Bacteria 8213
632 Ga0495664_0049731 3300046477 Bacteria 2489
633 Ga0495664_0049752 3300046477 Bacteria 2488
634 Ga0495585_0321422 3300046492 Unclassified 757
635 Ga0495585_0446605 3300046492 Unclassified 619
636 Ga0495594_0002412 3300046499 Bacteria 9730
637 Ga0495608_0050964 3300046511 Bacteria 2745
638 Ga0495608_0085609 3300046511 Bacteria 2043
639 Ga0495608_0188382 3300046511 Bacteria 1303
640 Ga0495610_0218465 3300046512 Unclassified 771
641 Ga0495628_0078853 3300046516 Bacteria 2561
642 Ga0495628_0183692 3300046516 Bacteria 1581
643 Ga0495628_0223494 3300046516 Unclassified 1413
644 Ga0495628_0242199 3300046516 Bacteria 1349
645 Ga0495628_0816788 3300046516 Unclassified 651
646 Ga0495630_0002970 3300046517 Bacteria 11772
647 Ga0495631_0057018 3300046518 Bacteria 1700
648 Ga0495631_0113710 3300046518 Unclassified 1164
649 Ga0495631_0175563 3300046518 Unclassified 918
650 Ga0495632_0114589 3300046519 Bacteria 1263
651 Ga0495632_0131107 3300046519 Unclassified 1166
652 Ga0495643_0264161 3300046522 Unclassified 798
653 Ga0495666_0074598 3300046526 Bacteria 1609
654 Ga0495666_0131448 3300046526 Bacteria 1170
655 Ga0495652_0006853 3300046529 Bacteria 10550
656 Ga0495652_0086442 3300046529 Bacteria 2574
657 Ga0495652_0182666 3300046529 Bacteria 1608
658 Ga0495652_0569907 3300046529 Unclassified 776
659 Ga0495654_0117188 3300046530 Unclassified 1209
660 Ga0495665_0001551 3300046531 Bacteria 12262
661 Ga0495640_0013390 3300046533 Bacteria 6231
662 Ga0495640_0168032 3300046533 Bacteria 1402
663 Ga0495587_0093470 3300046536 Unclassified 1736
664 Ga0495587_0149659 3300046536 Bacteria 1330
665 Ga0495587_0617916 3300046536 Unclassified 596
666 Ga0495597_0155743 3300046542 Unclassified 935
667 Ga0495645_0005851 3300046543 Bacteria 8489
668 Ga0495622_0009676 3300046557 Bacteria 4457
669 Ga0495667_0035207 3300046559 Bacteria 3347
670 Ga0495667_0301330 3300046559 Bacteria 1015
671 Ga0495667_0342244 3300046559 Bacteria 945
672 Ga0495667_0740253 3300046559 Unclassified 608
673 Ga0495656_0247581 3300046615 Bacteria 899
674 Ga0495668_0206542 3300046616 Unclassified 1075
675 Ga0495634_0001062 3300046642 Bacteria 25776
676 Ga0495634_0490518 3300046642 Unclassified 721
677 Ga0495611_0073592 3300046648 Archaea 1564
678 Ga0495625_0300036 3300046660 Bacteria 1028
679 Ga0495635_0007202 3300046663 Bacteria 7771
680 Ga0495635_0399706 3300046663 Bacteria 913
681 Ga0495588_0012586 3300046674 Bacteria 4004
682 Ga0495657_0605488 3300046675 Unclassified 634
683 Ga0495599_0027095 3300046678 Bacteria 3592
684 Ga0495599_0028676 3300046678 Bacteria 3488
685 Ga0495623_0098623 3300046679 Bacteria 1783
686 Ga0495623_0287447 3300046679 Bacteria 912
687 Ga0495623_0629269 3300046679 Unclassified 555
688 Ga0495646_0056493 3300046680 Bacteria 2353
689 Ga0495646_0176417 3300046680 Bacteria 1175
690 Ga0495647_0001165 3300046681 Bacteria 8086
691 Ga0495658_0001008 3300046683 Bacteria 14877
692 Ga0495658_0375673 3300046683 Unclassified 905
693 Ga0495613_0009874 3300046689 Bacteria 7098
694 Ga0495613_0166334 3300046689 Bacteria 1567
695 Ga0495613_0223073 3300046689 Bacteria 1323
696 Ga0495624_0000680 3300046690 Bacteria 26668
697 Ga0495624_0677651 3300046690 Bacteria 613
698 Ga0495624_0822978 3300046690 Unclassified 548
699 Ga0495670_0183420 3300046691 Bacteria 1106
700 Ga0495671_0123739 3300046692 Bacteria 1261
701 Ga0495671_0214553 3300046692 Bacteria 932
702 Ga0495671_0253719 3300046692 Bacteria 849
703 Ga0495649_0031953 3300046694 Bacteria 2902
704 Ga0495600_0043070 3300046809 Bacteria 2943
705 Ga0495600_0071988 3300046809 Bacteria 2259
706 Ga0495600_0199237 3300046809 Bacteria 1286
707 Ga0495581_0000236 3300047315 Bacteria 26189
708 Ga0495604_0088748 3300047317 Bacteria 2300
709 Ga0495604_0270102 3300047317 Bacteria 1152
710 Ga0495674_0001320 3300047319 Bacteria 24154
711 Ga0495674_0008101 3300047319 Bacteria 10027
712 Ga0495674_0162822 3300047319 Bacteria 1866
713 Ga0495674_0181795 3300047319 Bacteria 1751
714 Ga0495676_0197734 3300047321 Bacteria 1398
715 Ga0495680_0033419 3300047322 Bacteria 4165
716 Ga0495680_0102054 3300047322 Bacteria 2136
717 Ga0495680_0413086 3300047322 Bacteria 930
718 Ga0495680_0454202 3300047322 Bacteria 876
719 Ga0495680_0542743 3300047322 Unclassified 784
720 Ga0495675_0022022 3300047444 Bacteria 4061
721 Ga0495675_0065587 3300047444 Unclassified 2296
722 Ga0495675_0244669 3300047444 Bacteria 1079
723 Ga0495673_0203505 3300047469 Unclassified 739
724 Ga0495684_0010549 3300047471 Bacteria 7141
725 Ga0495684_0245333 3300047471 Bacteria 1305
726 Ga0495593_0001094 3300047673 Bacteria 15828
727 Ga0495593_0441761 3300047673 Bacteria 651
728 Ga0495602_0005484 3300048088 Bacteria 13305
729 Ga0495602_0063699 3300048088 Bacteria 3193
730 Ga0495602_0135505 3300048088 Bacteria 1957
731 Ga0495614_0045273 3300048089 Bacteria 1887
732 Ga0495626_0063267 3300048091 Unclassified 1679
733 Ga0496100_0070926 3300048903 Unclassified 2325
734 Ga0496100_0318705 3300048903 Bacteria 1167
735 Ga0496100_0860615 3300048903 Bacteria 711
736 Ga0496101_0393970 3300048904 Bacteria 1090
737 Ga0496102_0001867 3300048905 Bacteria 18145
738 Ga0496102_0065550 3300048905 Bacteria 3329
739 Ga0496102_0072124 3300048905 Bacteria 3172
740 Ga0496102_0115222 3300048905 Bacteria 2508
741 Ga0496102_0527196 3300048905 Bacteria 1104
742 Ga0496103_0030114 3300048906 Bacteria 3301
743 Ga0496103_0193811 3300048906 Bacteria 1306
744 Ga0496103_0263389 3300048906 Bacteria 1109
745 Ga0496104_0037271 3300048907 Bacteria 4548
746 Ga0496104_0038787 3300048907 Bacteria 4458
747 Ga0496104_0292423 3300048907 Bacteria 1541
748 Ga0496105_0069969 3300048908 Bacteria 2901
749 Ga0496105_0142135 3300048908 Unclassified 1975
750 Ga0496106_0000132 3300048909 Bacteria 56128
751 Ga0496106_0011787 3300048909 Bacteria 6453
752 Ga0496106_0427534 3300048909 Bacteria 1064
753 Ga0496106_0540976 3300048909 Bacteria 935
754 Ga0496106_0638766 3300048909 Bacteria 851
755 Ga0496107_0025036 3300048910 Bacteria 4224
756 Ga0496107_0067066 3300048910 Bacteria 2603
757 Ga0496107_0861303 3300048910 Unclassified 662
758 Ga0496108_0033486 3300048911 Bacteria 4269
759 Ga0496108_0053893 3300048911 Bacteria 3374
760 Ga0496108_0110816 3300048911 Bacteria 2347
761 Ga0496108_0397476 3300048911 Unclassified 1204
762 Ga0496109_0014967 3300048912 Bacteria 6752
763 Ga0496109_0040696 3300048912 Bacteria 4209
764 Ga0496109_0295911 3300048912 Bacteria 1526
765 Ga0496109_0552048 3300048912 Bacteria 1087
766 Ga0496110_0002086 3300048913 Bacteria 14892
767 Ga0496110_0173753 3300048913 Bacteria 1955
768 Ga0496110_0652729 3300048913 Bacteria 952
769 Ga0496110_0875467 3300048913 Bacteria 804
770 Ga0496111_0182992 3300048914 Bacteria 1558
771 Ga0496112_0008448 3300048915 Bacteria 9225
772 Ga0496112_0052205 3300048915 Bacteria 4012
773 Ga0496112_0058032 3300048915 Unclassified 3811
774 Ga0496112_0288871 3300048915 Bacteria 1586
775 Ga0496114_0126929 3300048917 Bacteria 2200
776 Ga0496114_0978334 3300048917 Bacteria 729
777 Ga0496115_0027102 3300048918 Bacteria 4479
778 Ga0496115_0043073 3300048918 Bacteria 3599
779 Ga0496115_0487641 3300048918 Bacteria 992
780 Ga0496115_0570700 3300048918 Bacteria 902
781 Ga0496115_0757831 3300048918 Bacteria 759
782 Ga0496119_0210492 3300048922 Bacteria 1001
783 Ga0496126_0076603 3300048929 Bacteria 2967
784 Ga0496126_0338942 3300048929 Unclassified 1232
785 Ga0495678_261942 3300049459 Unclassified 511
786 Ga0501033_0398186 3300049570 Bacteria 961
787 Ga0501033_0603315 3300049570 Bacteria 753
788 Ga0501033_0758039 3300049570 Bacteria 658
789 Ga0501034_0370186 3300049571 Bacteria 1359
790 Ga0501034_1096112 3300049571 Bacteria 677
791 Ga0501036_0648753 3300049572 Bacteria 874
792 Ga0501038_0913469 3300049574 Bacteria 648
793 Ga0501039_1204265 3300049575 Bacteria 586
794 Ga0501040_0091999 3300049576 Bacteria 2109
795 Ga0501043_0306295 3300049579 Bacteria 1213
796 Ga0501043_0707780 3300049579 Bacteria 735
797 Ga0501046_0436971 3300049580 Bacteria 942
798 Ga0501047_0925166 3300049581 Bacteria 685
799 Ga0501070_0147679 3300049586 Bacteria 1940
800 Ga0501070_0186176 3300049586 Bacteria 1708
801 Ga0501073_0393738 3300049589 Bacteria 957
802 Ga0501073_0631427 3300049589 Bacteria 739
803 Ga0501075_0955678 3300049591 Bacteria 651
804 Ga0501076_1025006 3300049592 Bacteria 680
805 Ga0501076_1032793 3300049592 Bacteria 677
806 Ga0501077_0132760 3300049593 Bacteria 1579
807 Ga0501079_0555179 3300049741 Unclassified 903
808 Ga0501081_0262999 3300049743 Bacteria 1261
809 Ga0501083_0270453 3300049744 Bacteria 1106
810 Ga0501044_0172946 3300049823 Bacteria 2130
811 Ga0501044_0656156 3300049823 Bacteria 938
812 Ga0501045_0175787 3300049824 Bacteria 1595
813 nmdc:mga03683_124300_c1 3300050489 Unclassified 1149
814 nmdc:mga03683_136521_c1 3300050489 Unclassified 1100
815 nmdc:mga03683_272928_c1 3300050489 Bacteria 789
816 nmdc:mga03683_5126_c2 3300050489 Bacteria 2784
817 nmdc:mga03683_65434_c1 3300050489 Bacteria 1544
818 nmdc:mga03n38_30002_c1 3300050490 Bacteria 2282
819 nmdc:mga0yw44_128109_c1 3300050492 Bacteria 1641
820 nmdc:mga0yw44_169367_c1 3300050492 Bacteria 1433
821 nmdc:mga0yw44_5245_c1 3300050492 Bacteria 6078
822 nmdc:mga06z11_117476_c1 3300050494 Bacteria 1480
823 nmdc:mga06z11_13804_c1 3300050494 Unclassified 3560
824 nmdc:mga06z11_6557_c1 3300050494 Bacteria 4746
825 nmdc:mga06z11_667255_c1 3300050494 Unclassified 633
826 nmdc:mga04h51_186614_c1 3300050495 Unclassified 809
827 nmdc:mga07m45_105018_c1 3300050496 Bacteria 1624
828 nmdc:mga07m45_543514_c1 3300050496 Bacteria 672
829 nmdc:mga05p37_247845_c1 3300050507 Bacteria 2138
830 nmdc:mga05p37_436219_c1 3300050507 Bacteria 1520
831 nmdc:mga09592_40700_c1 3300050508 Bacteria 3905
832 nmdc:mga0qj67_48686_c1 3300050509 Bacteria 3348
833 nmdc:mga06r32_306214_c1 3300050510 Bacteria 1574
834 nmdc:mga06r32_817049_c1 3300050510 Bacteria 892
835 nmdc:mga06r32_848609_c1 3300050510 Unclassified 872
836 nmdc:mga08y16_13244_c1 3300050511 Bacteria 8672
837 nmdc:mga08y16_27067_c1 3300050511 Bacteria 6043
838 nmdc:mga08y16_86314_c1 3300050511 Bacteria 3270
839 nmdc:mga0n895_1065461_c1 3300050512 Unclassified 787
840 nmdc:mga0n895_1315673_c1 3300050512 Bacteria 693
841 nmdc:mga0n895_197712_c1 3300050512 Bacteria 2042
842 nmdc:mga0n895_8320_c1 3300050512 Bacteria 8975
843 nmdc:mga0rr50_58246_c1 3300050513 Bacteria 2894
844 nmdc:mga0a205_276803_c1 3300050515 Bacteria 1554
845 nmdc:mga0a205_339372_c1 3300050515 Bacteria 1371
846 nmdc:mga0sz30_2678_c1 3300050516 Bacteria 6347
847 nmdc:mga0sz30_331934_c1 3300050516 Bacteria 679
848 nmdc:mga0sz30_69537_c1 3300050516 Bacteria 1514
849 Ga0495601_0010158 3300053077 Bacteria 5594
850 Ga0495612_0016130 3300053078 Bacteria 2993
851 Ga0495612_0137755 3300053078 Bacteria 1057
852 Ga0495612_0236945 3300053078 Bacteria 810
853 Ga0495655_0214346 3300053083 Unclassified 635
854 Ga0495595_0033884 3300053084 Bacteria 2307
855 Ga0495595_0137564 3300053084 Bacteria 1197
856 Ga0495619_0189443 3300053085 Bacteria 1424
857 Ga0495619_0304333 3300053085 Bacteria 1104
858 Ga0495619_0551689 3300053085 Unclassified 790
859 Ga0495619_0605278 3300053085 Unclassified 749
860 Ga0500644_0192320 3300053088 Bacteria 840
861 Ga0500583_0370285 3300053092 Bacteria 691
862 Ga0500555_099858 3300053103 Unclassified 738
863 Ga0500562_049797 3300053108 Bacteria 1120
864 Ga0500595_011289 3300053119 Bacteria 3503
865 Ga0500642_0112328 3300053130 Bacteria 1273
866 Ga0500655_011111 3300053133 Bacteria 1629
867 Ga0500658_0236280 3300053134 Bacteria 839
868 Ga0500658_0367189 3300053134 Unclassified 660
869 Ga0500568_0027985 3300053139 Bacteria 2353
870 Ga0500616_0042713 3300053153 Bacteria 2426
871 Ga0500616_0079012 3300053153 Bacteria 1658
872 Ga0500637_0053928 3300053178 Bacteria 2295
873 Ga0500645_008052 3300053730 Bacteria 3627
874 Ga0500609_030639 3300053731 Bacteria 739
875 Ga0500552_000860 3300053733 Bacteria 2863
876 Ga0501084_0289138 3300054114 Bacteria 1384
877 Ga0501084_0711958 3300054114 Bacteria 846
878 Ga0587085_005510 3300059506 Bacteria 1494
879 Ga0587075_034168 3300059644 Bacteria 824
880 Ga0587079_048623 3300059647 Bacteria 883
881 Ga0501082_0449598 3300060353 Bacteria 1126
882 Ga0466962_0188154 3300061719 Bacteria 1007
883 Ga0530510_0188964 3300061734 Bacteria 1529
884 Ga0496104_0427115
885 CNAas_1001530
886 JGI25404J52841_10000466
887 JGI25404J52841_10006563
888 JGI25405J52794_10115262
889 Ga0058861_11906857
890 Ga0058862_10041450
891 Ga0065712_10182422
892 Ga0065715_10150791
893 Ga0070676_10124676
894 Ga0070676_10153915
895 Ga0070683_100051245
896 Ga0070683_100844517
897 Ga0070683_100941322
898 Ga0070683_101185709
899 Ga0070690_100438998
900 Ga0070670_100007655
901 Ga0070677_10139910
902 Ga0068869_100101135
903 Ga0070666_10515431
904 Ga0070680_100015192
905 Ga0070680_100307752
906 Ga0068868_100042945
907 Ga0068868_100447879
908 Ga0070689_100091378
909 Ga0070689_100136362
910 Ga0070689_100187803
911 Ga0070691_10024133
912 Ga0070687_100428064
913 Ga0070687_100869263
914 Ga0070661_100043848
915 Ga0070692_10005584
916 Ga0070692_10189109
917 Ga0070668_101602249
918 Ga0070669_100071994
919 Ga0070675_100064979
920 Ga0070675_100399720
921 Ga0070671_100041542
922 Ga0070673_100034196
923 Ga0070673_100301730
924 Ga0070688_100429541
925 Ga0070659_100342177
926 Ga0070659_100518914
927 Ga0070703_10024420
928 Ga0070703_10142651
929 Ga0070709_10083411
930 Ga0070709_10218377
931 Ga0070709_10577555
932 Ga0070714_100280625
933 Ga0070714_100509942
934 Ga0070714_100999566
935 Ga0070714_101021676
936 Ga0070714_102113984
937 Ga0070713_100019113
938 Ga0070713_100048845
939 Ga0070713_100079021
940 Ga0070713_100089973
941 Ga0070713_100111229
942 Ga0070713_100184070
943 Ga0070713_100218331
944 Ga0070713_101496012
945 Ga0070710_10031505
946 Ga0070710_10040953
947 Ga0070710_10191370
948 Ga0070710_10267733
949 Ga0070701_10045555
950 Ga0070711_100130049
951 Ga0070711_100231451
952 Ga0070711_100350488
953 Ga0070711_100740908
954 Ga0070705_100000027
955 Ga0070700_100005070
956 Ga0070700_100038619
957 Ga0070700_100078777
958 Ga0070700_100715643
959 Ga0070694_100003970
960 Ga0070694_100100445
961 Ga0070708_100007134
962 Ga0070663_100017270
963 Ga0070663_100116542
964 Ga0070663_100303877
965 Ga0070663_100418071
966 Ga0070678_100033423
967 Ga0070678_100292185
968 Ga0070678_100545222
969 Ga0070662_100196891
970 Ga0070681_10026594
971 Ga0070681_10089272
972 Ga0070681_10244173
973 Ga0070681_10686205
974 Ga0070681_11544961
975 Ga0068867_100242418
976 Ga0068867_100738935
977 Ga0070706_100109120
978 Ga0070706_100532594
979 Ga0070706_100629173
980 Ga0070707_100157450
981 Ga0070698_100000373
982 Ga0070698_100064657
983 Ga0070698_100281442
984 Ga0070699_100003114
985 Ga0070699_100036258
986 Ga0070699_100425250
987 Ga0070699_100849866
988 Ga0070679_100079875
989 Ga0070679_100299212
990 Ga0070679_100887734
991 Ga0070684_100032472
992 Ga0070684_100035776
993 Ga0070684_101089033
994 Ga0070697_100008988
995 Ga0070697_100090869
996 Ga0070697_100224007
997 Ga0070697_100374211
998 Ga0070672_100215414
999 Ga0070672_100233960
1000 Ga0070672_101018425
1001 Ga0070686_100936976
1002 Ga0070695_100000215
1003 Ga0070695_100014268
1004 Ga0070696_100000671
1005 Ga0070696_100782884
1006 Ga0070665_100012234
1007 Ga0070665_100069091
1008 Ga0070665_100095281
1009 Ga0070665_100118851
1010 Ga0070665_100149830
1011 Ga0070704_100000121
1012 Ga0070704_100797213
1013 Ga0068855_100729337
1014 Ga0068855_101213271
1015 Ga0070664_100008442
1016 Ga0070664_101015197
1017 Ga0068857_100039871
1018 Ga0068854_100046583
1019 Ga0068854_100358469
1020 Ga0068856_100053811
1021 Ga0068856_100138976
1022 Ga0068856_100260925
1023 Ga0068856_100276183
1024 Ga0068856_100300078
1025 Ga0068856_100333895
1026 Ga0070702_100031173
1027 Ga0070702_100276900
1028 Ga0068852_100003470
1029 Ga0068852_100532173
1030 Ga0068852_100654177
1031 Ga0068859_100004939
1032 Ga0068859_101459599
1033 Ga0068859_101819349
1034 Ga0068864_100003765
1035 Ga0068864_100690796
1036 Ga0068861_100021812
1037 Ga0068861_100029739
1038 Ga0068861_100040462
1039 Ga0068851_10140322
1040 Ga0068863_100521831
1041 Ga0068858_100123668
1042 Ga0068858_100216552
1043 Ga0068860_100001599
1044 Ga0068860_100021198
1045 Ga0068860_100095774
1046 Ga0068860_101201082
1047 Ga0068862_100004275
1048 Ga0068862_100019083
1049 Ga0068862_100164047
1050 Ga0081455_10000170
1051 Ga0081455_10003896
1052 Ga0081455_10026928
1053 Ga0081455_10125231
1054 Ga0081540_1000165
1055 Ga0081540_1003588
1056 Ga0081540_1005450
1057 Ga0081540_1060948
1058 Ga0081539_10016609
1059 Ga0081539_10035864
1060 Ga0070717_10021763
1061 Ga0070717_10032696
1062 Ga0070717_10216357
1063 Ga0070717_10230532
1064 Ga0070717_10230936
1065 Ga0070717_10343288
1066 Ga0070717_10544176
1067 Ga0075365_10052430
1068 Ga0075365_10079521
1069 Ga0075365_10495330
1070 Ga0075363_100044996
1071 Ga0070715_10264778
1072 Ga0070716_100655424
1073 Ga0070712_100171707
1074 Ga0070712_100251408
1075 Ga0070712_100479641
1076 Ga0075362_10057223
1077 Ga0075362_10302023
1078 Ga0075367_10122437
1079 Ga0075367_10322755
1080 Ga0075369_10036540
1081 Ga0075369_10047875
1082 Ga0075369_10235874
1083 Ga0097621_100209963
1084 Ga0075370_10041208
1085 Ga0075370_10081961
1086 Ga0075370_10684351
1087 Ga0068871_100109858
1088 Ga0068871_100695985
1089 Ga0075428_100232419
1090 Ga0075428_100870678
1091 Ga0075431_100067472
1092 Ga0075431_100303050
1093 Ga0075431_100332465
1094 Ga0075431_100407634
1095 Ga0075434_100015055
1096 Ga0075434_100046302
1097 Ga0075434_100663337
1098 Ga0068865_100138439
1099 Ga0097620_100004939
1100 Ga0097620_101459357
1101 Ga0097620_101819313
1102 Ga0099794_10089898
1103 Ga0099795_10446390
1104 Ga0105250_10037562
1105 Ga0105240_10945515
1106 Ga0111539_10038895
1107 Ga0111539_10083887
1108 Ga0111539_10522553
1109 Ga0111539_10702296
1110 Ga0111539_10983068
1111 Ga0105245_10076632
1112 Ga0105245_10304050
1113 Ga0105245_10463529
1114 Ga0105245_10955718
1115 Ga0105245_11518769
1116 Ga0105247_10134638
1117 Ga0105247_10177323
1118 Ga0105247_10316621
1119 Ga0114129_10194576
1120 Ga0114129_10735183
1121 Ga0105243_11163207
1122 Ga0105241_11073820
1123 Ga0105242_10381570
1124 Ga0105242_10988112
1125 Ga0105248_10013866
1126 Ga0105248_10128204
1127 Ga0105248_10354981
1128 Ga0105248_11235694
1129 Ga0105248_11708310
1130 Ga0105238_10017243
1131 Ga0105238_10101554
1132 Ga0105238_10253526
1133 Ga0105238_10435904
1134 Ga0105238_10877399
1135 Ga0105238_11077524
1136 Ga0105238_11635770
1137 Ga0105249_10007364
1138 Ga0105249_10672116
1139 Ga0105249_10941853
1140 Ga0105239_10027217
1141 Ga0105239_10041704
1142 Ga0105239_10172087
1143 Ga0105239_10186584
1144 Ga0105239_10592344
1145 Ga0105239_11369901
1146 Ga0105239_12046198
1147 Ga0105246_10007852
1148 Ga0105246_10348575
1149 Ga0157319_1006823
1150 Ga0157370_10286009
1151 Ga0157369_10191033
1152 Ga0157369_10347994
1153 Ga0157369_10476681
1154 Ga0157374_10238597
1155 Ga0157374_10349751
1156 Ga0157374_11142970
1157 Ga0157378_10510313
1158 Ga0157378_10887569
1159 Ga0157378_11447679
1160 Ga0163162_10124587
1161 Ga0163162_10329489
1162 Ga0163162_11134194
1163 Ga0157372_10160722
1164 Ga0157372_11527680
1165 Ga0157372_12143610
1166 Ga0157375_10047640
1167 Ga0163163_10038268
1168 Ga0163163_10168230
1169 Ga0163163_10407766
1170 Ga0163163_10677294
1171 Ga0163163_10968529
1172 Ga0163163_11948114
1173 Ga0157380_10018015
1174 Ga0182008_10046982
1175 Ga0157379_10100729
1176 Ga0157376_10040344
1177 Ga0157376_10244867
1178 Ga0206354_11337313
1179 Ga0213872_10087805
1180 Ga0213876_10206758
1181 Ga0213875_10000025
1182 Ga0213875_10002700
1183 Ga0213875_10060708
1184 Ga0213875_10174665
1185 Ga0213871_10014807
1186 Ga0224712_10201090
1187 Ga0228598_1007055
1188 Ga0207426_1011906
1189 Ga0207656_10061786
1190 Ga0207696_1028797
1191 Ga0207653_10002213
1192 Ga0207682_10047564
1193 Ga0207692_10026131
1194 Ga0207692_10208636
1195 Ga0207692_10277500
1196 Ga0207642_10099470
1197 Ga0207710_10419415
1198 Ga0207710_10618864
1199 Ga0207688_10059732
1200 Ga0207680_10403252
1201 Ga0207680_10432307
1202 Ga0207647_10106921
1203 Ga0207685_10010772
1204 Ga0207685_10103326
1205 Ga0207685_10116913
1206 Ga0207685_10338300
1207 Ga0207699_10038389
1208 Ga0207699_10169974
1209 Ga0207699_10208951
1210 Ga0207699_10262496
1211 Ga0207699_10293593
1212 Ga0207643_10280213
1213 Ga0207684_10171388
1214 Ga0207684_10198243
1215 Ga0207684_10612030
1216 Ga0207684_10940156
1217 Ga0207654_10454830
1218 Ga0207707_10011837
1219 Ga0207707_10126208
1220 Ga0207707_10153390
1221 Ga0207707_10241296
1222 Ga0207707_10292693
1223 Ga0207695_10289793
1224 Ga0207671_10076135
1225 Ga0207671_10219121
1226 Ga0207693_10080551
1227 Ga0207693_10158434
1228 Ga0207693_10496183
1229 Ga0207693_10589366
1230 Ga0207693_10610467
1231 Ga0207663_10015354
1232 Ga0207663_10036361
1233 Ga0207663_10064605
1234 Ga0207663_11178346
1235 Ga0207660_10193063
1236 Ga0207660_10379360
1237 Ga0207660_10463044
1238 Ga0207662_10164196
1239 Ga0207662_10236333
1240 Ga0207662_10447473
1241 Ga0207649_10065610
1242 Ga0207652_10101638
1243 Ga0207652_10224324
1244 Ga0207652_10478713
1245 Ga0207694_10082349
1246 Ga0207694_10270389
1247 Ga0207650_10054682
1248 Ga0207650_10194767
1249 Ga0207659_10241137
1250 Ga0207659_10643339
1251 Ga0207700_10046275
1252 Ga0207700_10049398
1253 Ga0207700_10069119
1254 Ga0207700_10105240
1255 Ga0207700_10679492
1256 Ga0207664_10185630
1257 Ga0207664_10276773
1258 Ga0207644_10034506
1259 Ga0207690_10435426
1260 Ga0207706_10268567
1261 Ga0207706_10602813
1262 Ga0207686_10131524
1263 Ga0207709_10046875
1264 Ga0207709_10171567
1265 Ga0207709_10181108
1266 Ga0207670_10062510
1267 Ga0207670_10116426
1268 Ga0207669_10118606
1269 Ga0207669_10303098
1270 Ga0207704_10234331
1271 Ga0207665_10151104
1272 Ga0207665_10485370
1273 Ga0207691_10161154
1274 Ga0207691_10170728
1275 Ga0207691_10379451
1276 Ga0207691_10868242
1277 Ga0207711_10088480
1278 Ga0207711_10226758
1279 Ga0207689_10024946
1280 Ga0207689_11117895
1281 Ga0207661_10018382
1282 Ga0207661_10138068
1283 Ga0207679_10324187
1284 Ga0207679_10425154
1285 Ga0207667_10107494
1286 Ga0207667_10130780
1287 Ga0207667_10648277
1288 Ga0207667_11057937
1289 Ga0207651_10004925
1290 Ga0207712_10003012
1291 Ga0207712_10215606
1292 Ga0207668_10004203
1293 Ga0207668_10020969
1294 Ga0207668_10590246
1295 Ga0207668_10790183
1296 Ga0207668_10916359
1297 Ga0207640_10358798
1298 Ga0207640_10870486
1299 Ga0207658_10670582
1300 Ga0207703_10041514
1301 Ga0207703_10186569
1302 Ga0207639_10339504
1303 Ga0207678_10030428
1304 Ga0207678_10341606
1305 Ga0207678_10437839
1306 Ga0207708_10001123
1307 Ga0207708_10024330
1308 Ga0207708_10163414
1309 Ga0207708_10910213
1310 Ga0207702_10053564
1311 Ga0207702_10369572
1312 Ga0207702_10390928
1313 Ga0207702_10400797
1314 Ga0207641_10315541
1315 Ga0207641_10897597
1316 Ga0207648_10170786
1317 Ga0207648_10544210
1318 Ga0207676_10004150
1319 Ga0207676_10587087
1320 Ga0207676_10604854
1321 Ga0207676_11276578
1322 Ga0207674_10003474
1323 Ga0207674_10038401
1324 Ga0207674_10405626
1325 Ga0207675_100059002
1326 Ga0207675_100234285
1327 Ga0207675_101034633
1328 Ga0207683_10022141
1329 Ga0207683_10054350
1330 Ga0207683_10069804
1331 Ga0207683_10339465
1332 Ga0207683_10384192
1333 Ga0207683_10684216
1334 Ga0207698_10015975
1335 Ga0207698_10511404
1336 Ga0207698_10984857
1337 Ga0207698_12157136
1338 Ga0209813_10161242
1339 Ga0207428_10068914
1340 Ga0207428_10333382
1341 Ga0268266_10010517
1342 Ga0268266_10056769
1343 Ga0268266_10069677
1344 Ga0268266_10121417
1345 Ga0268266_10126023
1346 Ga0268265_10047475
1347 Ga0268265_10178240
1348 Ga0268264_10003345
1349 Ga0268264_10032061
1350 Ga0268264_10061662
1351 Ga0265337_1128329
1352 Ga0307517_10245824
1353 Ga0265332_10097303
1354 Ga0265320_10427980
1355 Ga0265325_10000945
1356 Ga0307513_10745820
1357 Ga0307509_10016846
1358 Ga0307508_10529694
1359 Ga0265314_10485339
1360 Ga0265342_10156959
1361 Ga0307516_10033866
1362 Ga0307510_10002894
1363 Ga0373958_0031649
1364 Ga0373958_0127713
1365 Ga0373926_0105849
1366 Ga0373929_0034946
1367 Ga0373934_0062522
1368 Ga0373934_0092290
1369 Ga0373934_0183260
1370 Ga0373952_0013387
1371 Ga0373952_0028420
1372 Ga0373923_0026296
1373 Ga0373923_0055512
1374 Ga0373923_0114480
1375 Ga0373923_0116567
1376 Ga0373923_0118279
1377 Ga0373936_0039672
1378 Ga0373936_0059607
1379 Ga0373936_0087185
1380 Ga0373939_0019806
1381 Ga0373941_0003957
1382 Ga0373945_0003765
1383 Ga0373945_0088846
1384 Ga0373945_0136807
1385 Ga0373945_0366768
1386 Ga0373945_0457781
1387 Ga0373953_0002118
1388 Ga0373953_0011679
1389 Ga0373953_0060338
1390 Ga0373954_0074055
1391 Ga0373954_0263485
1392 Ga0373956_0110441
1393 Ga0373957_0042465
1394 Ga0373957_0059147
1395 Ga0373960_0189678
1396 Ga0373943_0093912
1397 Ga0373943_0210354
1398 Ga0373946_0252283
1399 Ga0373955_0051812
1400 Ga0373955_0109814
1401 Ga0373942_0037748
1402 Ga0373961_0023611
1403 Ga0373962_0020089
1404 Ga0373924_0002935
1405 Ga0373924_0056344
1406 Ga0373924_0072595
1407 Ga0373931_0000190
1408 Ga0373931_0017526
1409 Ga0373931_0661146
1410 Ga0373935_0001072
1411 Ga0373935_0125709
1412 Ga0373935_0194909
1413 Ga0373927_0007687
1414 Ga0373927_0022003
1415 Ga0373927_0088135
1416 Ga0373927_0218665
1417 Ga0373927_0374128
1418 Ga0373927_0411013
1419 Ga0373927_0426491
1420 Ga0373933_0007920
1421 Ga0373933_0024476
1422 Ga0373947_0003022
1423 Ga0373947_0014841
1424 Ga0373947_0041396
1425 Ga0373947_0064871
1426 Ga0373947_0076370
1427 Ga0373947_0267536
1428 Ga0373947_0736859
1429 Ga0373937_0031497
1430 Ga0373937_0068542
1431 Ga0373937_0135301
1432 Ga0373937_0257236
1433 Ga0373937_0291241
1434 Ga0373937_0480345
1435 Ga0373937_0698584
1436 Ga0372808_003711
1437 Ga0373925_0008562
1438 Ga0373925_0092306
1439 Ga0373925_0157366
1440 Ga0373925_0223653
1441 Ga0373925_0381838
1442 Ga0373925_1161929
1443 Ga0395899_0008802
1444 Ga0395899_0042787
1445 Ga0395900_0022683
1446 Ga0395900_0118377
1447 Ga0395898_0022154
1448 Ga0395905_0724296
1449 Ga0436364_0318172
1450 Ga0436364_0380413
1451 Ga0436364_0743460
1452 Ga0436364_0869355
1453 Ga0436364_0890876
1454 Ga0436364_0952428
1455 Ga0436364_1315834
1456 Ga0436364_1475265
1457 Ga0436364_1505524
1458 Ga0395901_0002997
1459 Ga0395901_0046168
1460 Ga0395901_0978848
1461 Ga0436365_0010204
1462 Ga0436365_0234591
1463 Ga0436365_0288774
1464 Ga0436365_0537494
1465 Ga0436365_1140272
1466 Ga0436360_0331427
1467 Ga0436360_0675523
1468 Ga0436360_0979552
1469 Ga0436361_0378589
1470 Ga0436361_0687925
1471 Ga0436361_1013634
1472 Ga0436363_0049181
1473 Ga0436363_0709777
1474 Ga0436363_1523833
1475 Ga0436363_1624602
1476 Ga0436362_0268644
1477 Ga0436362_0896088
1478 Ga0466966_0116799
1479 Ga0466971_0417601
1480 Ga0466968_0319583
1481 Ga0466970_0409523
1482 Ga0466957_1161730
1483 Ga0466959_0043253
1484 Ga0451576_0067510
1485 Ga0466967_0137014
1486 Ga0466967_0383220
1487 Ga0466967_1545232
1488 Ga0466967_2052499
1489 Ga0495617_033637
1490 Ga0495592_0019808
1491 Ga0495592_0042883
1492 Ga0495592_0455579
1493 Ga0495603_0000777
1494 Ga0495603_0517540
1495 Ga0495603_0724360
1496 Ga0495629_0000601
1497 Ga0495629_0188711
1498 Ga0495629_0237586
1499 Ga0495629_0300625
1500 Ga0495629_0462494
1501 Ga0495638_0015815
1502 Ga0495641_0003737
1503 Ga0495651_0052339
1504 Ga0495651_0192493
1505 Ga0495651_0302368
1506 Ga0495651_0421887
1507 Ga0495653_0225905
1508 Ga0495580_0004904
1509 Ga0495580_0687648
1510 Ga0495582_0000756
1511 Ga0495639_0001642
1512 Ga0495639_0242726
1513 Ga0495662_0000177
1514 Ga0495664_0003827
1515 Ga0495664_0049731
1516 Ga0495664_0049752
1517 Ga0495585_0321422
1518 Ga0495585_0446605
1519 Ga0495594_0002412
1520 Ga0495608_0050964
1521 Ga0495608_0085609
1522 Ga0495608_0188382
1523 Ga0495610_0218465
1524 Ga0495628_0078853
1525 Ga0495628_0183692
1526 Ga0495628_0223494
1527 Ga0495628_0242199
1528 Ga0495628_0816788
1529 Ga0495630_0002970
1530 Ga0495631_0057018
1531 Ga0495631_0113710
1532 Ga0495631_0175563
1533 Ga0495632_0114589
1534 Ga0495632_0131107
1535 Ga0495643_0264161
1536 Ga0495666_0074598
1537 Ga0495666_0131448
1538 Ga0495652_0006853
1539 Ga0495652_0086442
1540 Ga0495652_0182666
1541 Ga0495652_0569907
1542 Ga0495654_0117188
1543 Ga0495665_0001551
1544 Ga0495640_0013390
1545 Ga0495640_0168032
1546 Ga0495587_0093470
1547 Ga0495587_0149659
1548 Ga0495587_0617916
1549 Ga0495597_0155743
1550 Ga0495645_0005851
1551 Ga0495622_0009676
1552 Ga0495667_0035207
1553 Ga0495667_0301330
1554 Ga0495667_0342244
1555 Ga0495667_0740253
1556 Ga0495656_0247581
1557 Ga0495668_0206542
1558 Ga0495634_0001062
1559 Ga0495634_0490518
1560 Ga0495611_0073592
1561 Ga0495625_0300036
1562 Ga0495635_0007202
1563 Ga0495635_0399706
1564 Ga0495588_0012586
1565 Ga0495657_0605488
1566 Ga0495599_0027095
1567 Ga0495599_0028676
1568 Ga0495623_0098623
1569 Ga0495623_0287447
1570 Ga0495623_0629269
1571 Ga0495646_0056493
1572 Ga0495646_0176417
1573 Ga0495647_0001165
1574 Ga0495658_0001008
1575 Ga0495658_0375673
1576 Ga0495613_0009874
1577 Ga0495613_0166334
1578 Ga0495613_0223073
1579 Ga0495624_0000680
1580 Ga0495624_0677651
1581 Ga0495624_0822978
1582 Ga0495670_0183420
1583 Ga0495671_0123739
1584 Ga0495671_0214553
1585 Ga0495671_0253719
1586 Ga0495649_0031953
1587 Ga0495600_0043070
1588 Ga0495600_0071988
1589 Ga0495600_0199237
1590 Ga0495581_0000236
1591 Ga0495604_0088748
1592 Ga0495604_0270102
1593 Ga0495674_0001320
1594 Ga0495674_0008101
1595 Ga0495674_0162822
1596 Ga0495674_0181795
1597 Ga0495676_0197734
1598 Ga0495680_0033419
1599 Ga0495680_0102054
1600 Ga0495680_0413086
1601 Ga0495680_0454202
1602 Ga0495680_0542743
1603 Ga0495675_0022022
1604 Ga0495675_0065587
1605 Ga0495675_0244669
1606 Ga0495673_0203505
1607 Ga0495684_0010549
1608 Ga0495684_0245333
1609 Ga0495593_0001094
1610 Ga0495593_0441761
1611 Ga0495602_0005484
1612 Ga0495602_0063699
1613 Ga0495602_0135505
1614 Ga0495614_0045273
1615 Ga0495626_0063267
1616 Ga0496100_0070926
1617 Ga0496100_0318705
1618 Ga0496100_0860615
1619 Ga0496101_0393970
1620 Ga0496102_0001867
1621 Ga0496102_0065550
1622 Ga0496102_0072124
1623 Ga0496102_0115222
1624 Ga0496102_0527196
1625 Ga0496103_0030114
1626 Ga0496103_0193811
1627 Ga0496103_0263389
1628 Ga0496104_0037271
1629 Ga0496104_0038787
1630 Ga0496104_0292423
1631 Ga0496105_0069969
1632 Ga0496105_0142135
1633 Ga0496106_0000132
1634 Ga0496106_0011787
1635 Ga0496106_0427534
1636 Ga0496106_0540976
1637 Ga0496106_0638766
1638 Ga0496107_0025036
1639 Ga0496107_0067066
1640 Ga0496107_0861303
1641 Ga0496108_0033486
1642 Ga0496108_0053893
1643 Ga0496108_0110816
1644 Ga0496108_0397476
1645 Ga0496109_0014967
1646 Ga0496109_0040696
1647 Ga0496109_0295911
1648 Ga0496109_0552048
1649 Ga0496110_0002086
1650 Ga0496110_0173753
1651 Ga0496110_0652729
1652 Ga0496110_0875467
1653 Ga0496111_0182992
1654 Ga0496112_0008448
1655 Ga0496112_0052205
1656 Ga0496112_0058032
1657 Ga0496112_0288871
1658 Ga0496114_0126929
1659 Ga0496114_0978334
1660 Ga0496115_0027102
1661 Ga0496115_0043073
1662 Ga0496115_0487641
1663 Ga0496115_0570700
1664 Ga0496115_0757831
1665 Ga0496119_0210492
1666 Ga0496126_0076603
1667 Ga0496126_0338942
1668 Ga0495678_261942
1669 Ga0501033_0398186
1670 Ga0501033_0603315
1671 Ga0501033_0758039
1672 Ga0501034_0370186
1673 Ga0501034_1096112
1674 Ga0501036_0648753
1675 Ga0501038_0913469
1676 Ga0501039_1204265
1677 Ga0501040_0091999
1678 Ga0501043_0306295
1679 Ga0501043_0707780
1680 Ga0501046_0436971
1681 Ga0501047_0925166
1682 Ga0501070_0147679
1683 Ga0501070_0186176
1684 Ga0501073_0393738
1685 Ga0501073_0631427
1686 Ga0501075_0955678
1687 Ga0501076_1025006
1688 Ga0501076_1032793
1689 Ga0501077_0132760
1690 Ga0501079_0555179
1691 Ga0501081_0262999
1692 Ga0501083_0270453
1693 Ga0501044_0172946
1694 Ga0501044_0656156
1695 Ga0501045_0175787
1696 nmdc:mga03683_124300_c1
1697 nmdc:mga03683_136521_c1
1698 nmdc:mga03683_272928_c1
1699 nmdc:mga03683_5126_c2
1700 nmdc:mga03683_65434_c1
1701 nmdc:mga03n38_30002_c1
1702 nmdc:mga0yw44_128109_c1
1703 nmdc:mga0yw44_169367_c1
1704 nmdc:mga0yw44_5245_c1
1705 nmdc:mga06z11_117476_c1
1706 nmdc:mga06z11_13804_c1
1707 nmdc:mga06z11_6557_c1
1708 nmdc:mga06z11_667255_c1
1709 nmdc:mga04h51_186614_c1
1710 nmdc:mga07m45_105018_c1
1711 nmdc:mga07m45_543514_c1
1712 nmdc:mga05p37_247845_c1
1713 nmdc:mga05p37_436219_c1
1714 nmdc:mga09592_40700_c1
1715 nmdc:mga0qj67_48686_c1
1716 nmdc:mga06r32_306214_c1
1717 nmdc:mga06r32_817049_c1
1718 nmdc:mga06r32_848609_c1
1719 nmdc:mga08y16_13244_c1
1720 nmdc:mga08y16_27067_c1
1721 nmdc:mga08y16_86314_c1
1722 nmdc:mga0n895_1065461_c1
1723 nmdc:mga0n895_1315673_c1
1724 nmdc:mga0n895_197712_c1
1725 nmdc:mga0n895_8320_c1
1726 nmdc:mga0rr50_58246_c1
1727 nmdc:mga0a205_276803_c1
1728 nmdc:mga0a205_339372_c1
1729 nmdc:mga0sz30_2678_c1
1730 nmdc:mga0sz30_331934_c1
1731 nmdc:mga0sz30_69537_c1
1732 Ga0495601_0010158
1733 Ga0495612_0016130
1734 Ga0495612_0137755
1735 Ga0495612_0236945
1736 Ga0495655_0214346
1737 Ga0495595_0033884
1738 Ga0495595_0137564
1739 Ga0495619_0189443
1740 Ga0495619_0304333
1741 Ga0495619_0551689
1742 Ga0495619_0605278
1743 Ga0500644_0192320
1744 Ga0500583_0370285
1745 Ga0500555_099858
1746 Ga0500562_049797
1747 Ga0500595_011289
1748 Ga0500642_0112328
1749 Ga0500655_011111
1750 Ga0500658_0236280
1751 Ga0500658_0367189
1752 Ga0500568_0027985
1753 Ga0500616_0042713
1754 Ga0500616_0079012
1755 Ga0500637_0053928
1756 Ga0500645_008052
1757 Ga0500609_030639
1758 Ga0500552_000860
1759 Ga0501084_0289138
1760 Ga0501084_0711958
1761 Ga0587085_005510
1762 Ga0587075_034168
1763 Ga0587079_048623
1764 Ga0501082_0449598
1765 Ga0466962_0188154
1766 Ga0530510_0188964

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

62

134

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fsf-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase active site variant y851f 0.8874 34 61
8ofb-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase with a minimal latch, hexagonal form 0.8712 34 61
2wx0-assembly2.cif.gz_G tab2 nzf domain in complex with lys63-linked di-ubiquitin, p21 0.8492 34 57
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.8475 17 157
4ddx-assembly2.cif.gz_B thermotoga maritima reverse gyrase, primitive monoclinic form 0.8403 34 61
ID Description Score Start End Superfamily
3irbB01 Special;Helix non-globular;Lyase 2-enoyl-coa Hydratase; Chain; 0.8403 22 64 6.10.30.10
2ayjA00 Few Secondary Structures;Irregular;ZNF265 like; 0.7841 34 61 4.10.1060.50
1ltlA03 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.7838 33 64 2.20.28.10
4xxbB00 Mainly Beta;Roll;SH3 type barrels.;Zn-finger domain of Sec23/24 0.7768 36 57 2.30.30.380
af_Q57859_1_190_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7561 36 58 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A537NBG3-F1-model_v4 DUF35 domain-containing protein 0.9779 2 170
AF-A0A5C8P7R6-F1-model_v4 DUF35 domain-containing protein 0.9769 2 170
AF-A0A2E5M5Z2-F1-model_v4 DUF35 domain-containing protein 0.9764 2 168
AF-A0A537URG0-F1-model_v4 DUF35 domain-containing protein 0.9743 2 170
AF-A0A2D9SSH7-F1-model_v4 DUF35 domain-containing protein 0.9738 4 168

Map