F484505

General Info

Members Datasets Scaffolds Average Seq Length
880 399 872 158

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2881927736|2881929864
Length 186
Sequence KTDFWVGLFVVLGAMALVFLALQAGNMNSFSFAPTYKVQAHFDNLGGLKVRAPVKSSGVVVGRVASIGFDNERFQAVATLELEQQYNFPSDSSASILTSGLLGEQYIGLTPGGEDKMLEQNSEIQYTQSAVVLEELISKFLYSSASNQGTASSDPAAAPPVSTEHNSIKPDVTAGPESIPAPASKP

Samples

Sample ID Description Type Environment
1 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
2 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
3 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
4 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
5 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
6 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
7 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
8 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
155 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
158 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
229 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
238 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
239 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
240 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
241 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
242 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
243 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
249 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
250 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
251 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
275 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
276 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
277 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
278 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
279 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
280 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
281 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
284 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
285 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
286 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
287 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
288 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
289 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
301 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
302 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
303 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
304 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
305 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
308 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
316 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
317 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
359 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
365 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
366 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
367 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
368 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
372 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
373 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
374 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
379 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
386 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
387 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
393 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
394 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
395 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
396 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0.34
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5
Nodule 0.11
Rhizoplane 3.07
Rhizosphere 88.64
Stem 0
Stem Tuber 0
Unclassified 3.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000325 3300001979 Bacteria 20261
2 JGI25156J39149_1003651 3300002705 Bacteria 4951
3 JGI25154J39366_1002218 3300002738 Bacteria 5353
4 JGI25157J39369_1013572 3300002741 Bacteria 1023
5 Ga0055538_1005033 3300003751 Bacteria 1411
6 Ga0055539_1011770 3300003752 Bacteria 1076
7 Ga0055533_1002375 3300003756 Bacteria 4306
8 Ga0055542_1000632 3300003762 Bacteria 29602
9 Ga0055541_1000952 3300003841 Bacteria 6828
10 Ga0065704_10543945 3300005289 Bacteria 639
11 Ga0065712_10114968 3300005290 Unclassified 1759
12 Ga0065715_10198640 3300005293 Bacteria 1374
13 Ga0065715_10216561 3300005293 Bacteria 1290
14 Ga0065707_10083651 3300005295 Bacteria 8537
15 Ga0065707_10541434 3300005295 Bacteria 727
16 Ga0065707_10643680 3300005295 Bacteria 667
17 Ga0070658_10497416 3300005327 Bacteria 1053
18 Ga0070676_10004210 3300005328 Bacteria 7558
19 Ga0070676_10309308 3300005328 Bacteria 1074
20 Ga0070690_100003769 3300005330 Bacteria 8351
21 Ga0070690_100229321 3300005330 Bacteria 1305
22 Ga0070670_100013210 3300005331 Bacteria 7073
23 Ga0070670_100014420 3300005331 Bacteria 6782
24 Ga0070670_100125706 3300005331 Bacteria 2213
25 Ga0070670_100206893 3300005331 Bacteria 1706
26 Ga0070670_100280835 3300005331 Bacteria 1454
27 Ga0070670_100327517 3300005331 Bacteria 1343
28 Ga0070677_10020266 3300005333 Bacteria 2420
29 Ga0070677_10050860 3300005333 Bacteria 1675
30 Ga0070677_10053359 3300005333 Bacteria 1643
31 Ga0068869_100000356 3300005334 Bacteria 24579
32 Ga0068869_100084360 3300005334 Bacteria 2377
33 Ga0068869_100093325 3300005334 Bacteria 2267
34 Ga0068869_100478168 3300005334 Bacteria 1037
35 Ga0070666_10006099 3300005335 Bacteria 7408
36 Ga0070666_10032196 3300005335 Bacteria 3462
37 Ga0070666_10909983 3300005335 Bacteria 651
38 Ga0070680_100289763 3300005336 Bacteria 1387
39 Ga0070682_100080768 3300005337 Bacteria 2103
40 Ga0068868_100008239 3300005338 Bacteria 7460
41 Ga0068868_100021435 3300005338 Bacteria 4865
42 Ga0068868_100044231 3300005338 Bacteria 3481
43 Ga0070660_100278067 3300005339 Bacteria 1369
44 Ga0070660_100365428 3300005339 Bacteria 1190
45 Ga0070689_100000418 3300005340 Bacteria 25038
46 Ga0070689_100364738 3300005340 Bacteria 1214
47 Ga0070691_10224301 3300005341 Bacteria 997
48 Ga0070691_10267840 3300005341 Bacteria 922
49 Ga0070661_100262318 3300005344 Bacteria 1336
50 Ga0070661_100838493 3300005344 Bacteria 756
51 Ga0070692_10011872 3300005345 Bacteria 4016
52 Ga0070668_100008431 3300005347 Bacteria 7654
53 Ga0070668_100025855 3300005347 Bacteria 4452
54 Ga0070668_100060850 3300005347 Bacteria 2925
55 Ga0070668_100088308 3300005347 Bacteria 2440
56 Ga0070668_100162744 3300005347 Bacteria 1811
57 Ga0070669_100015544 3300005353 Bacteria 5426
58 Ga0070669_100016089 3300005353 Bacteria 5335
59 Ga0070675_100014034 3300005354 Bacteria 6309
60 Ga0070675_100355068 3300005354 Bacteria 1301
61 Ga0070675_100906411 3300005354 Bacteria 808
62 Ga0070671_100053947 3300005355 Bacteria 3341
63 Ga0070671_100093539 3300005355 Bacteria 2519
64 Ga0070671_100181219 3300005355 Bacteria 1783
65 Ga0070671_100205370 3300005355 Bacteria 1671
66 Ga0070671_100686455 3300005355 Bacteria 888
67 Ga0070674_100007493 3300005356 Bacteria 6439
68 Ga0070674_100036516 3300005356 Bacteria 3299
69 Ga0070674_100140661 3300005356 Bacteria 1811
70 Ga0070673_100003912 3300005364 Bacteria 9359
71 Ga0070673_100006782 3300005364 Bacteria 7476
72 Ga0070673_100038869 3300005364 Bacteria 3637
73 Ga0070673_100407036 3300005364 Bacteria 1217
74 Ga0070673_100418069 3300005364 Bacteria 1201
75 Ga0070688_100020748 3300005365 Bacteria 3826
76 Ga0070688_100114945 3300005365 Bacteria 1795
77 Ga0070688_100133890 3300005365 Unclassified 1675
78 Ga0070688_100586219 3300005365 Bacteria 852
79 Ga0070659_100100299 3300005366 Bacteria 2330
80 Ga0070659_100208654 3300005366 Bacteria 1609
81 Ga0070659_100554551 3300005366 Bacteria 984
82 Ga0070659_100608504 3300005366 Unclassified 939
83 Ga0070667_100001403 3300005367 Bacteria 21557
84 Ga0070667_100002052 3300005367 Bacteria 17830
85 Ga0070667_100113710 3300005367 Bacteria 2349
86 Ga0070667_100173446 3300005367 Bacteria 1905
87 Ga0070667_100219123 3300005367 Bacteria 1693
88 Ga0070667_100353905 3300005367 Bacteria 1330
89 Ga0070714_100000984 3300005435 Bacteria 20360
90 Ga0070714_100044899 3300005435 Bacteria 3743
91 Ga0070713_100009007 3300005436 Bacteria 7114
92 Ga0070713_100051287 3300005436 Bacteria 3411
93 Ga0070710_10008238 3300005437 Bacteria 5072
94 Ga0070701_10166103 3300005438 Bacteria 1282
95 Ga0070711_100000407 3300005439 Bacteria 22299
96 Ga0070711_100429435 3300005439 Bacteria 1078
97 Ga0070705_100020267 3300005440 Bacteria 3515
98 Ga0070705_100296477 3300005440 Bacteria 1157
99 Ga0070700_100432683 3300005441 Bacteria 997
100 Ga0070700_100536992 3300005441 Bacteria 906
101 Ga0070700_100938336 3300005441 Bacteria 707
102 Ga0070694_100012031 3300005444 Bacteria 5372
103 Ga0070694_100033886 3300005444 Bacteria 3365
104 Ga0070694_100167543 3300005444 Bacteria 1616
105 Ga0070694_100306660 3300005444 Bacteria 1218
106 Ga0070708_100153791 3300005445 Bacteria 2140
107 Ga0070663_100097236 3300005455 Bacteria 2192
108 Ga0070678_100007067 3300005456 Bacteria 6635
109 Ga0070678_100068344 3300005456 Bacteria 2648
110 Ga0070678_100133070 3300005456 Bacteria 1979
111 Ga0070678_100927774 3300005456 Bacteria 797
112 Ga0070678_101146787 3300005456 Bacteria 719
113 Ga0070662_100028893 3300005457 Bacteria 3865
114 Ga0070662_100299094 3300005457 Bacteria 1307
115 Ga0068867_100007434 3300005459 Bacteria 7747
116 Ga0068867_100014508 3300005459 Bacteria 5585
117 Ga0068867_100027509 3300005459 Bacteria 4087
118 Ga0068867_100172174 3300005459 Bacteria 1715
119 Ga0068867_100210028 3300005459 Bacteria 1563
120 Ga0068867_100271461 3300005459 Bacteria 1387
121 Ga0068867_102149421 3300005459 Bacteria 529
122 Ga0070685_10005507 3300005466 Bacteria 6417
123 Ga0070685_10229917 3300005466 Bacteria 1219
124 Ga0070706_100023284 3300005467 Bacteria 5706
125 Ga0070706_100032816 3300005467 Bacteria 4790
126 Ga0070706_100097029 3300005467 Bacteria 2737
127 Ga0070707_100059646 3300005468 Bacteria 3659
128 Ga0070707_100197706 3300005468 Bacteria 1960
129 Ga0070707_100310245 3300005468 Bacteria 1533
130 Ga0070698_100009607 3300005471 Bacteria 10348
131 Ga0070699_100007236 3300005518 Bacteria 9655
132 Ga0070699_100063681 3300005518 Bacteria 3197
133 Ga0070679_100116684 3300005530 Bacteria 2654
134 Ga0070684_100066692 3300005535 Bacteria 3159
135 Ga0070697_100019753 3300005536 Bacteria 5323
136 Ga0070697_100079832 3300005536 Bacteria 2694
137 Ga0068853_100086673 3300005539 Bacteria 2746
138 Ga0068853_100404684 3300005539 Bacteria 1278
139 Ga0068853_100849380 3300005539 Bacteria 876
140 Ga0070672_100012906 3300005543 Bacteria 5887
141 Ga0070672_100062364 3300005543 Bacteria 2942
142 Ga0070672_100177390 3300005543 Bacteria 1774
143 Ga0070672_100276586 3300005543 Bacteria 1418
144 Ga0070672_100363412 3300005543 Bacteria 1236
145 Ga0070672_100650613 3300005543 Bacteria 920
146 Ga0070686_100005296 3300005544 Bacteria 7129
147 Ga0070695_100042420 3300005545 Bacteria 2888
148 Ga0070695_100380437 3300005545 Bacteria 1065
149 Ga0070696_100114013 3300005546 Bacteria 1949
150 Ga0070696_100142851 3300005546 Bacteria 1751
151 Ga0070696_100240205 3300005546 Bacteria 1366
152 Ga0070693_100003898 3300005547 Bacteria 6999
153 Ga0070693_100337781 3300005547 Bacteria 1027
154 Ga0070693_100430502 3300005547 Bacteria 921
155 Ga0070693_100576214 3300005547 Bacteria 809
156 Ga0070665_100003736 3300005548 Bacteria 16125
157 Ga0070665_100164457 3300005548 Bacteria 2221
158 Ga0070665_100357321 3300005548 Bacteria 1467
159 Ga0070665_100574790 3300005548 Bacteria 1140
160 Ga0070665_101240370 3300005548 Bacteria 756
161 Ga0070704_100001376 3300005549 Bacteria 12909
162 Ga0070704_100056923 3300005549 Bacteria 2778
163 Ga0070704_100286482 3300005549 Bacteria 1367
164 Ga0068855_100025951 3300005563 Bacteria 7010
165 Ga0068855_100162956 3300005563 Bacteria 2530
166 Ga0068855_100293384 3300005563 Bacteria 1802
167 Ga0068855_101078131 3300005563 Bacteria 841
168 Ga0070664_100112625 3300005564 Bacteria 2376
169 Ga0070664_100121912 3300005564 Unclassified 2283
170 Ga0070664_101051011 3300005564 Bacteria 766
171 Ga0068857_100020112 3300005577 Bacteria 5868
172 Ga0068854_100001272 3300005578 Bacteria 15149
173 Ga0068854_100178024 3300005578 Bacteria 1659
174 Ga0068856_100082809 3300005614 Bacteria 3184
175 Ga0070702_100035387 3300005615 Bacteria 2759
176 Ga0070702_100150253 3300005615 Bacteria 1494
177 Ga0070702_100767191 3300005615 Bacteria 742
178 Ga0070702_101072560 3300005615 Bacteria 642
179 Ga0068852_100079984 3300005616 Bacteria 2896
180 Ga0068852_100201586 3300005616 Bacteria 1883
181 Ga0068852_100331746 3300005616 Bacteria 1480
182 Ga0068852_100606319 3300005616 Bacteria 1099
183 Ga0068859_100010525 3300005617 Bacteria 9308
184 Ga0068859_100014353 3300005617 Bacteria 7946
185 Ga0068859_100021791 3300005617 Bacteria 6426
186 Ga0068859_100041934 3300005617 Bacteria 4597
187 Ga0068859_100208857 3300005617 Bacteria 2038
188 Ga0068859_100306328 3300005617 Bacteria 1682
189 Ga0068859_100427382 3300005617 Bacteria 1421
190 Ga0068859_100672288 3300005617 Bacteria 1127
191 Ga0068864_100000981 3300005618 Bacteria 23881
192 Ga0068864_100013356 3300005618 Bacteria 6805
193 Ga0068864_100283523 3300005618 Bacteria 1547
194 Ga0068864_100347913 3300005618 Bacteria 1398
195 Ga0068864_100568174 3300005618 Bacteria 1098
196 Ga0068864_102304084 3300005618 Bacteria 545
197 Ga0068866_10002776 3300005718 Bacteria 7222
198 Ga0068866_10118829 3300005718 Bacteria 1486
199 Ga0068866_10128000 3300005718 Bacteria 1440
200 Ga0068866_10174039 3300005718 Bacteria 1266
201 Ga0068861_100013391 3300005719 Bacteria 5740
202 Ga0068861_100037180 3300005719 Bacteria 3619
203 Ga0068861_100541876 3300005719 Bacteria 1059
204 Ga0068861_100825390 3300005719 Bacteria 872
205 Ga0068851_10027126 3300005834 Bacteria 2821
206 Ga0068851_10230248 3300005834 Bacteria 1044
207 Ga0068851_10333592 3300005834 Bacteria 879
208 Ga0068851_10493754 3300005834 Unclassified 733
209 Ga0068870_10078729 3300005840 Bacteria 1816
210 Ga0068870_10095225 3300005840 Unclassified 1672
211 Ga0068863_100000366 3300005841 Bacteria 45953
212 Ga0068863_100004419 3300005841 Bacteria 13865
213 Ga0068863_100059799 3300005841 Bacteria 3605
214 Ga0068863_100107136 3300005841 Bacteria 2659
215 Ga0068863_100242118 3300005841 Bacteria 1741
216 Ga0068863_100361631 3300005841 Bacteria 1415
217 Ga0068863_100534223 3300005841 Bacteria 1157
218 Ga0068863_100742635 3300005841 Bacteria 977
219 Ga0068858_100001946 3300005842 Bacteria 21056
220 Ga0068858_100003588 3300005842 Bacteria 15356
221 Ga0068858_100058632 3300005842 Bacteria 3560
222 Ga0068858_100474109 3300005842 Bacteria 1207
223 Ga0068860_100019348 3300005843 Bacteria 6605
224 Ga0068860_100023185 3300005843 Bacteria 6001
225 Ga0068860_100046386 3300005843 Bacteria 4143
226 Ga0068860_100060219 3300005843 Bacteria 3608
227 Ga0068860_100077510 3300005843 Bacteria 3161
228 Ga0068860_100290492 3300005843 Bacteria 1600
229 Ga0068860_100415583 3300005843 Bacteria 1333
230 Ga0068860_100486307 3300005843 Bacteria 1231
231 Ga0068862_100007718 3300005844 Bacteria 8898
232 Ga0068862_100011362 3300005844 Bacteria 7352
233 Ga0068862_100144386 3300005844 Bacteria 2114
234 Ga0068862_100736020 3300005844 Bacteria 958
235 Ga0075365_10048297 3300006038 Bacteria 2801
236 Ga0075368_10001442 3300006042 Bacteria 7605
237 Ga0075363_100023850 3300006048 Bacteria 3105
238 Ga0075364_10117245 3300006051 Bacteria 1780
239 Ga0075364_10305782 3300006051 Bacteria 1083
240 Ga0070715_10004958 3300006163 Bacteria 4410
241 Ga0070716_100039004 3300006173 Bacteria 2633
242 Ga0070712_100010551 3300006175 Bacteria 5832
243 Ga0070712_100057954 3300006175 Bacteria 2723
244 Ga0070712_100447972 3300006175 Bacteria 1074
245 Ga0075362_10002143 3300006177 Bacteria 6529
246 Ga0075367_10004080 3300006178 Bacteria 7068
247 Ga0075369_10030786 3300006186 Bacteria 2261
248 Ga0075366_10023129 3300006195 Bacteria 3620
249 Ga0075366_10028375 3300006195 Bacteria 3285
250 Ga0075366_10041538 3300006195 Bacteria 2723
251 Ga0097621_100029232 3300006237 Bacteria 4351
252 Ga0097621_100037348 3300006237 Bacteria 3891
253 Ga0097621_100198099 3300006237 Bacteria 1742
254 Ga0097621_100672600 3300006237 Bacteria 951
255 Ga0075370_10000354 3300006353 Bacteria 16716
256 Ga0075370_10090545 3300006353 Bacteria 1764
257 Ga0068871_100014108 3300006358 Bacteria 5944
258 Ga0068871_100028930 3300006358 Bacteria 4349
259 Ga0068871_100132647 3300006358 Bacteria 2113
260 Ga0068871_101738792 3300006358 Bacteria 592
261 Ga0075428_100000089 3300006844 Bacteria 75097
262 Ga0075428_100324335 3300006844 Bacteria 1655
263 Ga0075433_10037026 3300006852 Bacteria 4206
264 Ga0075433_10103037 3300006852 Bacteria 2528
265 Ga0075434_100072309 3300006871 Bacteria 3441
266 Ga0075434_100222563 3300006871 Bacteria 1907
267 Ga0075434_100724688 3300006871 Bacteria 1012
268 Ga0075429_100004777 3300006880 Bacteria 11670
269 Ga0068865_100049867 3300006881 Bacteria 2889
270 Ga0068865_100067648 3300006881 Bacteria 2524
271 Ga0068865_100138902 3300006881 Bacteria 1830
272 Ga0068865_100379199 3300006881 Bacteria 1153
273 Ga0075436_100091180 3300006914 Bacteria 2119
274 Ga0097620_100010526 3300006931 Bacteria 9308
275 Ga0097620_100014355 3300006931 Bacteria 7946
276 Ga0097620_100021791 3300006931 Bacteria 6426
277 Ga0097620_100041932 3300006931 Bacteria 4597
278 Ga0097620_100208869 3300006931 Bacteria 2038
279 Ga0097620_100306314 3300006931 Bacteria 1682
280 Ga0097620_100427365 3300006931 Bacteria 1421
281 Ga0097620_100672185 3300006931 Bacteria 1127
282 Ga0075435_100019130 3300007076 Bacteria 5221
283 Ga0099794_10047706 3300007265 Bacteria 2054
284 Ga0099795_10002497 3300007788 Bacteria 4344
285 Ga0105251_10033989 3300009011 Bacteria 2527
286 Ga0105240_10035226 3300009093 Bacteria 6452
287 Ga0111539_10040592 3300009094 Bacteria 5601
288 Ga0105245_10015183 3300009098 Bacteria 6709
289 Ga0105245_10029140 3300009098 Bacteria 4875
290 Ga0105245_10061915 3300009098 Bacteria 3375
291 Ga0105245_10086123 3300009098 Bacteria 2881
292 Ga0105247_10003683 3300009101 Bacteria 9946
293 Ga0105247_10064056 3300009101 Bacteria 2283
294 Ga0114129_11487541 3300009147 Bacteria 833
295 Ga0105243_10120724 3300009148 Bacteria 2209
296 Ga0105243_10129173 3300009148 Bacteria 2141
297 Ga0105243_10392432 3300009148 Bacteria 1287
298 Ga0105243_10401412 3300009148 Bacteria 1273
299 Ga0105243_11261580 3300009148 Bacteria 755
300 Ga0105241_10007877 3300009174 Bacteria 7832
301 Ga0105241_10125568 3300009174 Bacteria 2071
302 Ga0105241_10612110 3300009174 Bacteria 985
303 Ga0105241_11493905 3300009174 Unclassified 650
304 Ga0105242_10012139 3300009176 Bacteria 6627
305 Ga0105242_10428098 3300009176 Unclassified 1242
306 Ga0105242_10571916 3300009176 Bacteria 1087
307 Ga0105242_10775587 3300009176 Bacteria 946
308 Ga0105248_10001115 3300009177 Bacteria 29857
309 Ga0105248_10021616 3300009177 Bacteria 7126
310 Ga0105248_10053576 3300009177 Bacteria 4526
311 Ga0105248_10220165 3300009177 Bacteria 2137
312 Ga0105248_10358060 3300009177 Bacteria 1643
313 Ga0105248_12172557 3300009177 Bacteria 631
314 Ga0105237_10184058 3300009545 Unclassified 2089
315 Ga0105237_11456812 3300009545 Bacteria 691
316 Ga0105238_10094474 3300009551 Bacteria 2978
317 Ga0105238_10394548 3300009551 Bacteria 1376
318 Ga0105238_10847307 3300009551 Bacteria 931
319 Ga0105238_10871567 3300009551 Bacteria 918
320 Ga0105249_10055830 3300009553 Bacteria 3615
321 Ga0105249_10136486 3300009553 Bacteria 2348
322 Ga0105239_10064179 3300010375 Bacteria 4031
323 Ga0105246_10004097 3300011119 Bacteria 8848
324 Ga0105246_10065272 3300011119 Bacteria 2545
325 Ga0157373_10112346 3300013100 Bacteria 1915
326 Ga0157371_10157396 3300013102 Bacteria 1622
327 Ga0157370_10014165 3300013104 Bacteria 8175
328 Ga0157370_10050446 3300013104 Bacteria 3977
329 Ga0157374_10005148 3300013296 Bacteria 10967
330 Ga0157374_10008385 3300013296 Bacteria 8826
331 Ga0157374_10159531 3300013296 Bacteria 2197
332 Ga0157374_11216300 3300013296 Bacteria 775
333 Ga0157378_10005782 3300013297 Bacteria 10838
334 Ga0157378_10050737 3300013297 Bacteria 3692
335 Ga0157378_10174332 3300013297 Bacteria 2019
336 Ga0157378_10504597 3300013297 Bacteria 1209
337 Ga0157378_10582368 3300013297 Unclassified 1128
338 Ga0157378_11221893 3300013297 Bacteria 791
339 Ga0163162_10025069 3300013306 Bacteria 5893
340 Ga0163162_10064590 3300013306 Bacteria 3705
341 Ga0163162_10289469 3300013306 Bacteria 1770
342 Ga0163162_10863084 3300013306 Bacteria 1020
343 Ga0163162_11546927 3300013306 Bacteria 756
344 Ga0157372_10006135 3300013307 Bacteria 12775
345 Ga0157372_10285662 3300013307 Bacteria 1919
346 Ga0157372_10316358 3300013307 Bacteria 1817
347 Ga0157375_10140435 3300013308 Bacteria 2542
348 Ga0157375_10147814 3300013308 Bacteria 2482
349 Ga0157375_10209481 3300013308 Bacteria 2106
350 Ga0157375_10415281 3300013308 Bacteria 1512
351 Ga0157375_10547847 3300013308 Bacteria 1319
352 Ga0157375_10834489 3300013308 Bacteria 1069
353 Ga0157375_11907163 3300013308 Bacteria 705
354 Ga0163163_10018601 3300014325 Bacteria 6508
355 Ga0163163_10019473 3300014325 Bacteria 6374
356 Ga0163163_12036552 3300014325 Bacteria 634
357 Ga0157380_10414690 3300014326 Bacteria 1282
358 Ga0157380_10889781 3300014326 Bacteria 916
359 Ga0182008_10028058 3300014497 Bacteria 2848
360 Ga0182008_10271996 3300014497 Bacteria 879
361 Ga0157377_10003422 3300014745 Bacteria 7181
362 Ga0157377_10143062 3300014745 Bacteria 1472
363 Ga0157377_10456856 3300014745 Bacteria 883
364 Ga0157379_10009459 3300014968 Bacteria 8495
365 Ga0157379_10019451 3300014968 Bacteria 5998
366 Ga0157379_10029211 3300014968 Bacteria 4903
367 Ga0157379_10094019 3300014968 Bacteria 2690
368 Ga0157379_12026818 3300014968 Bacteria 569
369 Ga0157379_12512901 3300014968 Bacteria 515
370 Ga0157376_10026475 3300014969 Bacteria 4584
371 Ga0157376_10028239 3300014969 Bacteria 4457
372 Ga0157376_10093390 3300014969 Bacteria 2612
373 Ga0157376_10435394 3300014969 Bacteria 1275
374 Ga0157376_10478940 3300014969 Bacteria 1219
375 Ga0163161_10012976 3300017792 Bacteria 5789
376 Ga0163161_10575871 3300017792 Bacteria 925
377 Ga0163161_10976560 3300017792 Bacteria 722
378 Ga0213872_10000532 3300021361 Bacteria 29832
379 Ga0213872_10004390 3300021361 Bacteria 7506
380 Ga0213872_10005558 3300021361 Bacteria 6455
381 Ga0213876_10266176 3300021384 Bacteria 911
382 Ga0209784_100537 3300025224 Bacteria 13956
383 Ga0209566_100235 3300025225 Bacteria 53611
384 Ga0209674_100250 3300025226 Bacteria 45155
385 Ga0209563_103766 3300025230 Bacteria 3049
386 Ga0209258_106236 3300025242 Bacteria 1896
387 Ga0209646_1000119 3300025246 Bacteria 147427
388 Ga0209026_1004177 3300025250 Bacteria 4415
389 Ga0209677_102981 3300025253 Bacteria 5871
390 Ga0209148_1000451 3300025254 Bacteria 45012
391 Ga0209759_1006344 3300025256 Bacteria 3989
392 Ga0209455_1000447 3300025272 Bacteria 31733
393 Ga0209051_1101526 3300025303 Bacteria 772
394 Ga0207697_10014624 3300025315 Bacteria 3253
395 Ga0207656_10042160 3300025321 Bacteria 1941
396 Ga0207656_10082720 3300025321 Bacteria 1445
397 Ga0207656_10276276 3300025321 Bacteria 828
398 Ga0207713_1036244 3300025735 Bacteria 2118
399 Ga0207682_10019707 3300025893 Bacteria 2643
400 Ga0207682_10065180 3300025893 Bacteria 1533
401 Ga0207682_10072956 3300025893 Bacteria 1457
402 Ga0207692_10009535 3300025898 Bacteria 4060
403 Ga0207692_10111139 3300025898 Bacteria 1520
404 Ga0207692_10142830 3300025898 Bacteria 1363
405 Ga0207642_10000532 3300025899 Bacteria 11649
406 Ga0207642_10380857 3300025899 Bacteria 840
407 Ga0207710_10006893 3300025900 Bacteria 4836
408 Ga0207710_10042261 3300025900 Bacteria 2024
409 Ga0207688_10174679 3300025901 Bacteria 1279
410 Ga0207680_10004492 3300025903 Bacteria 6621
411 Ga0207680_10047845 3300025903 Bacteria 2536
412 Ga0207680_10168460 3300025903 Bacteria 1474
413 Ga0207680_10499031 3300025903 Bacteria 867
414 Ga0207680_10815704 3300025903 Bacteria 669
415 Ga0207699_10262319 3300025906 Bacteria 1194
416 Ga0207699_10270118 3300025906 Bacteria 1178
417 Ga0207645_10000353 3300025907 Bacteria 38206
418 Ga0207645_10063743 3300025907 Bacteria 2355
419 Ga0207645_10114291 3300025907 Bacteria 1749
420 Ga0207645_10201921 3300025907 Unclassified 1308
421 Ga0207645_10352083 3300025907 Bacteria 986
422 Ga0207645_10373452 3300025907 Bacteria 956
423 Ga0207643_10040823 3300025908 Bacteria 2613
424 Ga0207643_10681271 3300025908 Unclassified 664
425 Ga0207684_10037180 3300025910 Bacteria 4131
426 Ga0207684_10140723 3300025910 Bacteria 2074
427 Ga0207684_10400161 3300025910 Bacteria 1180
428 Ga0207654_10031392 3300025911 Bacteria 2925
429 Ga0207654_10236136 3300025911 Bacteria 1220
430 Ga0207654_10540660 3300025911 Bacteria 826
431 Ga0207707_10126797 3300025912 Bacteria 2232
432 Ga0207695_10054177 3300025913 Bacteria 4191
433 Ga0207693_10072939 3300025915 Bacteria 2687
434 Ga0207663_10004116 3300025916 Bacteria 7208
435 Ga0207662_10105993 3300025918 Bacteria 1747
436 Ga0207662_10128207 3300025918 Unclassified 1597
437 Ga0207662_10836794 3300025918 Bacteria 650
438 Ga0207657_10000469 3300025919 Bacteria 42688
439 Ga0207657_10214022 3300025919 Bacteria 1546
440 Ga0207649_10378732 3300025920 Bacteria 1054
441 Ga0207646_10039160 3300025922 Bacteria 4266
442 Ga0207646_10076372 3300025922 Bacteria 2993
443 Ga0207646_11085319 3300025922 Bacteria 705
444 Ga0207681_10053876 3300025923 Bacteria 2732
445 Ga0207681_10063520 3300025923 Bacteria 2546
446 Ga0207681_10090251 3300025923 Bacteria 2187
447 Ga0207694_10284818 3300025924 Bacteria 1358
448 Ga0207694_10334152 3300025924 Bacteria 1252
449 Ga0207694_11191781 3300025924 Unclassified 644
450 Ga0207650_10008205 3300025925 Bacteria 7124
451 Ga0207650_10008238 3300025925 Bacteria 7115
452 Ga0207650_10048413 3300025925 Bacteria 3135
453 Ga0207650_10381382 3300025925 Bacteria 1164
454 Ga0207650_10511382 3300025925 Unclassified 1004
455 Ga0207659_10008089 3300025926 Bacteria 6509
456 Ga0207659_10038925 3300025926 Bacteria 3311
457 Ga0207659_10735570 3300025926 Bacteria 846
458 Ga0207687_10003673 3300025927 Bacteria 10333
459 Ga0207687_10021201 3300025927 Bacteria 4316
460 Ga0207687_10069916 3300025927 Bacteria 2505
461 Ga0207687_10422575 3300025927 Bacteria 1100
462 Ga0207700_10000023 3300025928 Bacteria 152285
463 Ga0207700_10011674 3300025928 Bacteria 5615
464 Ga0207700_10022931 3300025928 Bacteria 4292
465 Ga0207700_10149973 3300025928 Bacteria 1926
466 Ga0207664_10007905 3300025929 Bacteria 7387
467 Ga0207664_10156786 3300025929 Bacteria 1939
468 Ga0207664_10165695 3300025929 Bacteria 1888
469 Ga0207644_10042177 3300025931 Bacteria 3232
470 Ga0207644_10074912 3300025931 Bacteria 2485
471 Ga0207644_10406898 3300025931 Bacteria 1113
472 Ga0207644_10776377 3300025931 Unclassified 801
473 Ga0207690_10025592 3300025932 Bacteria 3708
474 Ga0207690_10667290 3300025932 Bacteria 853
475 Ga0207706_10003781 3300025933 Bacteria 14439
476 Ga0207706_10452991 3300025933 Bacteria 1110
477 Ga0207706_10534172 3300025933 Bacteria 1011
478 Ga0207706_10726527 3300025933 Bacteria 847
479 Ga0207686_10000387 3300025934 Bacteria 30664
480 Ga0207686_10165567 3300025934 Bacteria 1554
481 Ga0207686_10620895 3300025934 Bacteria 853
482 Ga0207686_10693757 3300025934 Bacteria 809
483 Ga0207709_10110266 3300025935 Bacteria 1838
484 Ga0207709_10163629 3300025935 Bacteria 1554
485 Ga0207709_10198069 3300025935 Bacteria 1432
486 Ga0207709_10330897 3300025935 Bacteria 1143
487 Ga0207670_10014520 3300025936 Bacteria 4678
488 Ga0207669_10034539 3300025937 Bacteria 2866
489 Ga0207669_10124311 3300025937 Bacteria 1759
490 Ga0207669_10144995 3300025937 Bacteria 1654
491 Ga0207669_10191869 3300025937 Bacteria 1474
492 Ga0207704_10072045 3300025938 Bacteria 2195
493 Ga0207704_10430602 3300025938 Bacteria 1048
494 Ga0207704_10821377 3300025938 Bacteria 777
495 Ga0207704_10870953 3300025938 Unclassified 756
496 Ga0207665_10006073 3300025939 Bacteria 8020
497 Ga0207665_10434857 3300025939 Bacteria 1004
498 Ga0207691_10000663 3300025940 Bacteria 33984
499 Ga0207691_10040229 3300025940 Bacteria 4321
500 Ga0207691_10050489 3300025940 Bacteria 3807
501 Ga0207691_10109541 3300025940 Bacteria 2457
502 Ga0207691_10171388 3300025940 Bacteria 1900
503 Ga0207691_10369806 3300025940 Bacteria 1225
504 Ga0207691_10491045 3300025940 Bacteria 1043
505 Ga0207711_10002569 3300025941 Bacteria 16150
506 Ga0207711_10040764 3300025941 Bacteria 3951
507 Ga0207711_10098192 3300025941 Bacteria 2587
508 Ga0207711_10291241 3300025941 Bacteria 1505
509 Ga0207711_10321916 3300025941 Bacteria 1429
510 Ga0207689_10001242 3300025942 Bacteria 24579
511 Ga0207689_10001481 3300025942 Bacteria 22457
512 Ga0207689_10158269 3300025942 Bacteria 1867
513 Ga0207689_10472313 3300025942 Bacteria 1049
514 Ga0207661_10501512 3300025944 Bacteria 1109
515 Ga0207679_10137358 3300025945 Bacteria 1970
516 Ga0207679_10965150 3300025945 Bacteria 781
517 Ga0207667_10062880 3300025949 Bacteria 3880
518 Ga0207667_10127515 3300025949 Bacteria 2621
519 Ga0207667_10168047 3300025949 Bacteria 2255
520 Ga0207651_10006044 3300025960 Bacteria 6285
521 Ga0207651_10010046 3300025960 Bacteria 5221
522 Ga0207651_10061681 3300025960 Bacteria 2609
523 Ga0207651_10176416 3300025960 Bacteria 1691
524 Ga0207651_10265871 3300025960 Bacteria 1410
525 Ga0207712_10014061 3300025961 Bacteria 5138
526 Ga0207668_10014105 3300025972 Bacteria 4941
527 Ga0207668_10017170 3300025972 Bacteria 4530
528 Ga0207668_10025357 3300025972 Bacteria 3837
529 Ga0207668_10029961 3300025972 Bacteria 3572
530 Ga0207668_10126327 3300025972 Bacteria 1945
531 Ga0207668_10443229 3300025972 Bacteria 1106
532 Ga0207668_10707516 3300025972 Bacteria 886
533 Ga0207640_10032590 3300025981 Bacteria 3232
534 Ga0207640_10046407 3300025981 Bacteria 2795
535 Ga0207640_10104743 3300025981 Bacteria 1992
536 Ga0207658_10007145 3300025986 Bacteria 7607
537 Ga0207658_10025111 3300025986 Bacteria 4170
538 Ga0207658_10036223 3300025986 Bacteria 3537
539 Ga0207658_10207191 3300025986 Bacteria 1641
540 Ga0207658_10500229 3300025986 Bacteria 1082
541 Ga0207658_10547720 3300025986 Bacteria 1035
542 Ga0207658_10615478 3300025986 Bacteria 976
543 Ga0207677_10001127 3300026023 Bacteria 14559
544 Ga0207677_10012576 3300026023 Bacteria 4873
545 Ga0207677_10015239 3300026023 Bacteria 4515
546 Ga0207677_10535727 3300026023 Bacteria 1018
547 Ga0207677_10681177 3300026023 Bacteria 910
548 Ga0207677_10916079 3300026023 Bacteria 791
549 Ga0207703_10001000 3300026035 Bacteria 27175
550 Ga0207703_10003742 3300026035 Bacteria 12656
551 Ga0207703_10055465 3300026035 Bacteria 3224
552 Ga0207703_10366809 3300026035 Bacteria 1329
553 Ga0207703_10652329 3300026035 Bacteria 998
554 Ga0207678_10208733 3300026067 Unclassified 1671
555 Ga0207708_10837132 3300026075 Bacteria 794
556 Ga0207702_10015292 3300026078 Bacteria 6362
557 Ga0207641_10004677 3300026088 Bacteria 11809
558 Ga0207641_10026213 3300026088 Bacteria 4810
559 Ga0207641_10039886 3300026088 Bacteria 3929
560 Ga0207641_10101619 3300026088 Bacteria 2534
561 Ga0207641_10108530 3300026088 Bacteria 2457
562 Ga0207648_10004079 3300026089 Bacteria 15140
563 Ga0207648_10019548 3300026089 Bacteria 6113
564 Ga0207648_10025705 3300026089 Bacteria 5242
565 Ga0207648_10058358 3300026089 Bacteria 3365
566 Ga0207648_10100032 3300026089 Bacteria 2540
567 Ga0207648_10327996 3300026089 Bacteria 1376
568 Ga0207648_10643718 3300026089 Bacteria 979
569 Ga0207676_10001564 3300026095 Bacteria 16874
570 Ga0207676_10006171 3300026095 Bacteria 8461
571 Ga0207674_10003455 3300026116 Bacteria 19327
572 Ga0207674_10022759 3300026116 Bacteria 6725
573 Ga0207675_100007047 3300026118 Bacteria 10620
574 Ga0207675_100020605 3300026118 Bacteria 6145
575 Ga0207675_100065462 3300026118 Bacteria 3397
576 Ga0207675_100181547 3300026118 Bacteria 2015
577 Ga0207675_100186391 3300026118 Bacteria 1989
578 Ga0207675_100370527 3300026118 Bacteria 1407
579 Ga0207675_100385233 3300026118 Bacteria 1379
580 Ga0207675_100926116 3300026118 Bacteria 888
581 Ga0207683_10001329 3300026121 Bacteria 22302
582 Ga0207683_10006146 3300026121 Bacteria 10290
583 Ga0207683_10157520 3300026121 Bacteria 2051
584 Ga0207698_10061081 3300026142 Bacteria 2935
585 Ga0207698_10109181 3300026142 Bacteria 2314
586 Ga0207698_10219041 3300026142 Bacteria 1718
587 Ga0207698_10556232 3300026142 Bacteria 1125
588 Ga0207698_11004997 3300026142 Bacteria 845
589 Ga0209969_1003353 3300027360 Bacteria 2213
590 Ga0210000_1004547 3300027462 Bacteria 2000
591 Ga0209995_1000491 3300027471 Bacteria 6054
592 Ga0209179_1000305 3300027512 Bacteria 4721
593 Ga0209999_1006836 3300027543 Bacteria 2053
594 Ga0209970_1010143 3300027614 Bacteria 1539
595 Ga0209983_1008013 3300027665 Bacteria 2159
596 Ga0209282_1000032 3300027666 Bacteria 149218
597 Ga0209588_1024436 3300027671 Bacteria 1908
598 Ga0209588_1042178 3300027671 Bacteria 1473
599 Ga0209971_1015938 3300027682 Bacteria 1782
600 Ga0209974_10001876 3300027876 Bacteria 7685
601 Ga0207428_10003173 3300027907 Bacteria 16092
602 Ga0268266_10008012 3300028379 Bacteria 9446
603 Ga0268266_10047844 3300028379 Bacteria 3665
604 Ga0268266_10098506 3300028379 Bacteria 2572
605 Ga0268266_10198834 3300028379 Bacteria 1834
606 Ga0268266_11419745 3300028379 Bacteria 670
607 Ga0268265_10021619 3300028380 Bacteria 4510
608 Ga0268265_10443750 3300028380 Bacteria 1210
609 Ga0268265_11570559 3300028380 Bacteria 662
610 Ga0268264_10000599 3300028381 Bacteria 43601
611 Ga0268264_10021449 3300028381 Bacteria 5274
612 Ga0268264_10028221 3300028381 Bacteria 4589
613 Ga0268264_10047411 3300028381 Bacteria 3572
614 Ga0268264_10054399 3300028381 Bacteria 3342
615 Ga0268264_10061543 3300028381 Bacteria 3149
616 Ga0268264_10086853 3300028381 Bacteria 2688
617 Ga0268264_10237350 3300028381 Bacteria 1687
618 Ga0268264_10500078 3300028381 Bacteria 1185
619 Ga0307515_10017116 3300028794 Bacteria 13232
620 Ga0265325_10003550 3300031241 Bacteria 10131
621 Ga0265325_10050077 3300031241 Bacteria 2153
622 Ga0265329_10001643 3300031242 Bacteria 10683
623 Ga0265339_10021396 3300031249 Bacteria 3764
624 Ga0265331_10001285 3300031250 Bacteria 18719
625 Ga0265327_10001001 3300031251 Bacteria 40152
626 Ga0265327_10034992 3300031251 Bacteria 2781
627 Ga0265316_10106602 3300031344 Bacteria 2125
628 Ga0307513_10000029 3300031456 Bacteria 191823
629 Ga0307408_100436312 3300031548 Bacteria 1133
630 Ga0307516_10000303 3300031730 Bacteria 63898
631 Ga0307406_10526844 3300031901 Bacteria 963
632 Ga0307416_102931686 3300032002 Bacteria 571
633 Ga0316583_10001434 3300032133 Bacteria 7951
634 Ga0307507_10022145 3300033179 Bacteria 7040
635 Ga0373926_0047206 3300035083 Bacteria 1546
636 Ga0373934_0000473 3300035086 Bacteria 14038
637 Ga0373934_0008715 3300035086 Bacteria 3785
638 Ga0373923_0005607 3300035111 Bacteria 4273
639 Ga0373936_0091754 3300035113 Bacteria 1274
640 Ga0373939_0127629 3300035114 Unclassified 904
641 Ga0373945_0015047 3300035116 Bacteria 2599
642 Ga0373945_0147620 3300035116 Bacteria 951
643 Ga0373945_0256122 3300035116 Bacteria 740
644 Ga0373953_0084590 3300035117 Unclassified 1322
645 Ga0373954_0002521 3300035118 Bacteria 7687
646 Ga0373954_0024323 3300035118 Bacteria 2761
647 Ga0373956_0000957 3300035119 Bacteria 12019
648 Ga0373956_0088654 3300035119 Bacteria 1425
649 Ga0373956_0095263 3300035119 Bacteria 1376
650 Ga0373957_0005485 3300035120 Bacteria 3933
651 Ga0373943_0018692 3300035170 Bacteria 3185
652 Ga0373946_0055723 3300035171 Bacteria 1667
653 Ga0373946_0232834 3300035171 Bacteria 893
654 Ga0373955_0006355 3300035172 Bacteria 5384
655 Ga0373955_0013478 3300035172 Bacteria 3956
656 Ga0373955_0433017 3300035172 Bacteria 801
657 Ga0373955_0572070 3300035172 Bacteria 691
658 Ga0316574_0800008 3300035398 Unclassified 574
659 Ga0373924_0039528 3300035410 Bacteria 1927
660 Ga0373935_0015505 3300035692 Bacteria 4607
661 Ga0373935_0029012 3300035692 Bacteria 3422
662 Ga0373935_0120482 3300035692 Bacteria 1752
663 Ga0373935_0179621 3300035692 Bacteria 1453
664 Ga0373927_0003205 3300035695 Bacteria 11785
665 Ga0373927_0006948 3300035695 Bacteria 7686
666 Ga0373927_0019634 3300035695 Bacteria 4431
667 Ga0373927_0051639 3300035695 Bacteria 2658
668 Ga0373927_0598130 3300035695 Bacteria 729
669 Ga0373933_0000611 3300035724 Bacteria 22317
670 Ga0373933_0026162 3300035724 Bacteria 3349
671 Ga0373933_0232352 3300035724 Bacteria 1185
672 Ga0373933_0779056 3300035724 Bacteria 629
673 Ga0373947_0037736 3300035725 Bacteria 2868
674 Ga0373947_0351225 3300035725 Bacteria 989
675 Ga0373947_0584075 3300035725 Bacteria 761
676 Ga0373937_0003380 3300036401 Bacteria 13395
677 Ga0373937_0005419 3300036401 Bacteria 10918
678 Ga0373937_0046469 3300036401 Bacteria 3970
679 Ga0373937_0403794 3300036401 Bacteria 1296
680 Ga0373937_0656953 3300036401 Bacteria 994
681 Ga0373937_0728404 3300036401 Bacteria 939
682 Ga0316584_0071932 3300036712 Bacteria 2592
683 Ga0373925_0014584 3300037068 Bacteria 5679
684 Ga0373925_0036052 3300037068 Bacteria 3651
685 Ga0373925_0037105 3300037068 Bacteria 3596
686 Ga0373925_0089328 3300037068 Bacteria 2353
687 Ga0373925_0095569 3300037068 Bacteria 2277
688 Ga0373925_0506517 3300037068 Bacteria 991
689 Ga0436365_1616668 3300039437 Bacteria 7248
690 Ga0436361_0145606 3300039447 Bacteria 1327
691 Ga0436361_0608475 3300039447 Bacteria 7380
692 Ga0436361_0632156 3300039447 Bacteria 31235
693 Ga0436361_0644637 3300039447 Bacteria 1301
694 Ga0436361_1108147 3300039447 Bacteria 10468
695 Ga0439465_0118026 3300041413 Bacteria 928
696 Ga0451789_1207960 3300041443 Bacteria 785
697 Ga0451802_0735006 3300041460 Bacteria 1008
698 Ga0451804_0176278 3300041463 Unclassified 564
699 Ga0451855_0297688 3300041511 Bacteria 2225
700 Ga0439434_0345487 3300042435 Bacteria 519
701 Ga0439464_0170877 3300042439 Bacteria 685
702 Ga0439460_0360968 3300042461 Bacteria 513
703 Ga0451577_0488364 3300042876 Bacteria 1118
704 Ga0451577_1166407 3300042876 Bacteria 688
705 Ga0439440_0136234 3300042993 Bacteria 694
706 Ga0466969_0014206 3300044656 Bacteria 4185
707 Ga0466969_0019480 3300044656 Bacteria 3526
708 Ga0466980_0179596 3300044668 Bacteria 1379
709 Ga0453683_0130728 3300044673 Bacteria 1582
710 Ga0453683_0240838 3300044673 Bacteria 1152
711 Ga0466965_0071872 3300044683 Bacteria 1741
712 Ga0466965_0767703 3300044683 Bacteria 556
713 Ga0466966_0010001 3300044684 Bacteria 6286
714 Ga0466961_0001479 3300044693 Bacteria 14606
715 Ga0466961_0018442 3300044693 Bacteria 4488
716 Ga0466963_0478439 3300044694 Bacteria 879
717 Ga0453684_0000014 3300044712 Bacteria 993311
718 Ga0453684_0000566 3300044712 Bacteria 138895
719 Ga0453684_0001602 3300044712 Bacteria 62203
720 Ga0453684_0003881 3300044712 Bacteria 32897
721 Ga0453684_1785371 3300044712 Bacteria 626
722 Ga0466970_0029628 3300044765 Bacteria 2883
723 Ga0466957_0069405 3300044842 Bacteria 2177
724 Ga0466957_0410301 3300044842 Bacteria 928
725 Ga0466959_0001388 3300045049 Bacteria 14807
726 Ga0466959_0030981 3300045049 Bacteria 3959
727 Ga0466959_0076196 3300045049 Bacteria 2422
728 Ga0451576_0000313 3300045051 Bacteria 117520
729 Ga0451576_1517030 3300045051 Bacteria 696
730 Ga0466967_1486977 3300045976 Bacteria 675
731 Ga0495592_0113429 3300046454 Bacteria 1915
732 Ga0495651_0000274 3300046462 Bacteria 40100
733 Ga0495651_0099703 3300046462 Bacteria 2166
734 Ga0495653_0042203 3300046463 Bacteria 3555
735 Ga0495580_0026400 3300046472 Bacteria 4234
736 Ga0495582_0040091 3300046473 Bacteria 2578
737 Ga0495582_0055742 3300046473 Bacteria 2178
738 Ga0495605_0004722 3300046474 Bacteria 7970
739 Ga0495662_0121474 3300046476 Bacteria 1282
740 Ga0495664_0009419 3300046477 Bacteria 5465
741 Ga0495596_0001563 3300046500 Bacteria 13042
742 Ga0495607_0016883 3300046501 Bacteria 4700
743 Ga0495610_0002561 3300046512 Bacteria 15121
744 Ga0495616_0012563 3300046513 Bacteria 4802
745 Ga0495628_0019972 3300046516 Bacteria 5533
746 Ga0495628_0190111 3300046516 Bacteria 1550
747 Ga0495630_0301730 3300046517 Bacteria 1224
748 Ga0495665_0031800 3300046531 Bacteria 2823
749 Ga0495665_0102904 3300046531 Unclassified 1498
750 Ga0495640_0077917 3300046533 Bacteria 2209
751 Ga0495586_0168594 3300046535 Bacteria 1237
752 Ga0495587_0064444 3300046536 Bacteria 2141
753 Ga0495587_0333263 3300046536 Bacteria 847
754 Ga0495598_0330834 3300046537 Bacteria 582
755 Ga0495609_0020106 3300046538 Bacteria 3085
756 Ga0495621_0043624 3300046539 Bacteria 1582
757 Ga0495645_0000247 3300046543 Bacteria 39450
758 Ga0495645_0266309 3300046543 Bacteria 1132
759 Ga0495645_0282302 3300046543 Bacteria 1091
760 Ga0495667_0076342 3300046559 Bacteria 2180
761 Ga0495667_0331651 3300046559 Bacteria 962
762 Ga0495635_0013237 3300046663 Bacteria 5773
763 Ga0495635_0381952 3300046663 Bacteria 937
764 Ga0495661_0042625 3300046665 Bacteria 2796
765 Ga0495657_0104613 3300046675 Bacteria 1800
766 Ga0495657_0126857 3300046675 Bacteria 1602
767 Ga0495657_0273735 3300046675 Unclassified 1012
768 Ga0495623_0489821 3300046679 Bacteria 650
769 Ga0495647_0011345 3300046681 Bacteria 3052
770 Ga0495647_0022683 3300046681 Bacteria 2269
771 Ga0495658_0035942 3300046683 Bacteria 2729
772 Ga0495658_0060732 3300046683 Bacteria 2168
773 Ga0495613_0259707 3300046689 Bacteria 1210
774 Ga0495670_0236185 3300046691 Bacteria 973
775 Ga0495671_0001606 3300046692 Bacteria 14869
776 Ga0495649_0125866 3300046694 Bacteria 1353
777 Ga0495581_0003832 3300047315 Bacteria 8646
778 Ga0495604_0683038 3300047317 Bacteria 653
779 Ga0495674_0039081 3300047319 Bacteria 4254
780 Ga0495672_0051966 3300047320 Bacteria 2410
781 Ga0495680_0109999 3300047322 Bacteria 2043
782 Ga0495680_0139771 3300047322 Bacteria 1773
783 Ga0495680_0257151 3300047322 Bacteria 1236
784 Ga0495675_0063141 3300047444 Bacteria 2344
785 Ga0495677_0110185 3300047445 Bacteria 1046
786 Ga0495685_009158 3300047447 Bacteria 3301
787 Ga0495684_0025419 3300047471 Bacteria 4550
788 Ga0495684_0452761 3300047471 Bacteria 891
789 Ga0495614_0008587 3300048089 Bacteria 4542
790 Ga0496100_0030650 3300048903 Bacteria 3337
791 Ga0496101_0026167 3300048904 Bacteria 4055
792 Ga0496102_0062616 3300048905 Bacteria 3407
793 Ga0496102_0253850 3300048905 Bacteria 1658
794 Ga0496103_0052493 3300048906 Bacteria 2525
795 Ga0496105_0001094 3300048908 Bacteria 18813
796 Ga0496106_0537427 3300048909 Bacteria 938
797 Ga0496106_0585094 3300048909 Bacteria 894
798 Ga0496106_0597617 3300048909 Viruses 884
799 Ga0496107_0063175 3300048910 Bacteria 2683
800 Ga0496108_0041432 3300048911 Bacteria 3845
801 Ga0496108_0870812 3300048911 Bacteria 774
802 Ga0496109_0021225 3300048912 Bacteria 5741
803 Ga0496109_0039311 3300048912 Bacteria 4282
804 Ga0496109_0203913 3300048912 Bacteria 1859
805 Ga0496109_0487068 3300048912 Bacteria 1164
806 Ga0496109_1460047 3300048912 Bacteria 619
807 Ga0496111_0030457 3300048914 Bacteria 3837
808 Ga0496112_0011743 3300048915 Bacteria 8019
809 Ga0496112_0054119 3300048915 Bacteria 3942
810 Ga0496112_0059588 3300048915 Bacteria 3762
811 Ga0496113_0071811 3300048916 Bacteria 2633
812 Ga0496114_0043224 3300048917 Bacteria 3737
813 Ga0496114_0727272 3300048917 Unclassified 869
814 Ga0496116_0007817 3300048919 Bacteria 9396
815 Ga0496116_0068850 3300048919 Bacteria 2253
816 Ga0496117_0009792 3300048920 Bacteria 8836
817 Ga0496118_0011294 3300048921 Bacteria 8735
818 Ga0496119_0035656 3300048922 Bacteria 3256
819 Ga0496121_0026885 3300048924 Bacteria 5403
820 Ga0496122_0012773 3300048925 Bacteria 8311
821 Ga0496123_0005248 3300048926 Bacteria 13151
822 Ga0496125_0047767 3300048928 Bacteria 3575
823 Ga0496126_0388894 3300048929 Bacteria 1134
824 Ga0501039_0427389 3300049575 Bacteria 1040
825 Ga0501042_0516835 3300049578 Bacteria 867
826 Ga0501067_0060185 3300049583 Bacteria 2102
827 Ga0501072_0476196 3300049588 Bacteria 988
828 Ga0501072_0746572 3300049588 Bacteria 768
829 Ga0501074_0427974 3300049590 Bacteria 939
830 Ga0501076_0630741 3300049592 Bacteria 884
831 Ga0501081_0182101 3300049743 Bacteria 1520
832 Ga0501081_0416357 3300049743 Bacteria 996
833 Ga0501035_0029965 3300049822 Bacteria 4963
834 Ga0501044_0000316 3300049823 Bacteria 61151
835 Ga0501045_0058873 3300049824 Bacteria 2814
836 Ga0501045_1249530 3300049824 Bacteria 541
837 nmdc:mga03683_31474_c1 3300050489 Bacteria 2129
838 nmdc:mga03n38_3166_c1 3300050490 Bacteria 5245
839 nmdc:mga00v17_14509_c1 3300050491 Bacteria 4400
840 nmdc:mga00v17_183801_c2 3300050491 Bacteria 1056
841 nmdc:mga0yw44_18844_c1 3300050492 Bacteria 3790
842 nmdc:mga0yw44_74869_c1 3300050492 Bacteria 2110
843 nmdc:mga0k408_27521_c1 3300050493 Bacteria 3229
844 nmdc:mga0k408_57744_c1 3300050493 Bacteria 2253
845 nmdc:mga0k408_63383_c1 3300050493 Bacteria 2150
846 nmdc:mga0k408_7709_c1 3300050493 Bacteria 5753
847 nmdc:mga06z11_16232_c1 3300050494 Bacteria 3349
848 nmdc:mga04h51_1623_c1 3300050495 Bacteria 5245
849 nmdc:mga07m45_5925_c1 3300050496 Bacteria 6133
850 nmdc:mga09592_2590_c1 3300050508 Bacteria 14645
851 nmdc:mga06r32_13628_c1 3300050510 Bacteria 7371
852 nmdc:mga08y16_1731_c1 3300050511 Bacteria 22150
853 nmdc:mga0n895_221841_c1 3300050512 Bacteria 1919
854 nmdc:mga0n895_32773_c1 3300050512 Bacteria 4988
855 nmdc:mga0n895_836098_c1 3300050512 Bacteria 909
856 nmdc:mga0rr50_11221_c1 3300050513 Bacteria 5721
857 nmdc:mga08x19_72605_c1 3300050514 Bacteria 2245
858 nmdc:mga0a205_49685_c1 3300050515 Bacteria 4049
859 nmdc:mga0sz30_45207_c1 3300050516 Bacteria 1857
860 Ga0495601_0178212 3300053077 Bacteria 1390
861 Ga0495612_0011990 3300053078 Bacteria 3493
862 Ga0495595_0088431 3300053084 Unclassified 1484
863 Ga0495619_0060518 3300053085 Bacteria 2517
864 Ga0495619_0886515 3300053085 Unclassified 601
865 Ga0500594_0024036 3300053118 Bacteria 1549
866 Ga0500634_0002968 3300053161 Bacteria 7393
867 Ga0500637_0155049 3300053178 Bacteria 1322
868 Ga0590075_041710 3300059424 Bacteria 1173
869 Ga0587085_067875 3300059506 Bacteria 690
870 Ga0587090_047069 3300059510 Bacteria 779
871 Ga0587111_0039696 3300060346 Bacteria 998
872 Ga0501082_0183353 3300060353 Bacteria 1821

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10023129 Ga0075366_100231293 143
2 3300050493 nmdc:mga0k408_63383_c1 nmdc:mga0k408_63383_c1_383_1003 143
3 3300013296 Ga0157374_11216300 Ga0157374_112163002 144
4 3300035172 Ga0373955_0013478 Ga0373955_0013478_1301_1771 149
5 3300036401 Ga0373937_0005419 Ga0373937_0005419_1104_1574 149
6 3300046675 Ga0495657_0273735 Ga0495657_0273735_384_854 149
7 3300046679 Ga0495623_0489821 Ga0495623_0489821_74_544 149
8 iso_pu_bacteria 2895511927 2895513346 149
9 3300005355 Ga0070671_100686455 Ga0070671_1006864552 150
10 3300005456 Ga0070678_100927774 Ga0070678_1009277741 150
11 3300005616 Ga0068852_100606319 Ga0068852_1006063192 150
12 3300005617 Ga0068859_100672288 Ga0068859_1006722882 150
13 3300005834 Ga0068851_10230248 Ga0068851_102302482 150
14 3300006931 Ga0097620_100672185 Ga0097620_1006721852 150
15 3300025960 Ga0207651_10176416 Ga0207651_101764163 150
16 3300026067 Ga0207678_10208733 Ga0207678_102087333 150
17 3300026089 Ga0207648_10025705 Ga0207648_100257056 150
18 3300026121 Ga0207683_10157520 Ga0207683_101575202 150
19 3300026142 Ga0207698_10219041 Ga0207698_102190412 150
20 3300031901 Ga0307406_10526844 Ga0307406_105268442 150
21 3300032002 Ga0307416_102931686 Ga0307416_1029316861 150
22 iso_pu_bacteria 2846037992 2846039680 150
23 3300005295 Ga0065707_10083651 Ga0065707_100836516 152
24 iso_pu_bacteria 2643221603 2644027004 152
25 iso_pu_bacteria 2739367655 2739611320 152
26 iso_pu_bacteria 2857537821 2857542497 152
27 iso_pu_bacteria 2857576091 2857578011 152
28 iso_pu_bacteria 2881927736 2881929864 152
29 iso_pu_bacteria 2887375801 2887376216 152
30 3300005439 Ga0070711_100429435 Ga0070711_1004294352 153
31 3300005617 Ga0068859_100041934 Ga0068859_1000419344 153
32 3300005841 Ga0068863_100242118 Ga0068863_1002421182 153
33 3300005843 Ga0068860_100290492 Ga0068860_1002904922 153
34 3300006175 Ga0070712_100057954 Ga0070712_1000579543 153
35 3300006931 Ga0097620_100041932 Ga0097620_1000419324 153
36 3300009011 Ga0105251_10033989 Ga0105251_100339892 153
37 3300014968 Ga0157379_10029211 Ga0157379_100292116 153
38 3300025915 Ga0207693_10072939 Ga0207693_100729392 153
39 3300025928 Ga0207700_10000023 Ga0207700_10000023119 153
40 3300027666 Ga0209282_1000032 Ga0209282_1000032102 153
41 3300028381 Ga0268264_10086853 Ga0268264_100868532 153
42 3300035114 Ga0373939_0127629 Ga0373939_0127629_322_801 153
43 3300035692 Ga0373935_0179621 Ga0373935_0179621_459_1010 153
44 3300035695 Ga0373927_0003205 Ga0373927_0003205_2900_3451 153
45 3300037068 Ga0373925_0506517 Ga0373925_0506517_146_697 153
46 3300046474 Ga0495605_0004722 Ga0495605_0004722_5430_5984 153
47 3300046500 Ga0495596_0001563 Ga0495596_0001563_7007_7561 153
48 3300046501 Ga0495607_0016883 Ga0495607_0016883_3689_4243 153
49 3300046512 Ga0495610_0002561 Ga0495610_0002561_7121_7675 153
50 3300046513 Ga0495616_0012563 Ga0495616_0012563_1944_2498 153
51 3300046538 Ga0495609_0020106 Ga0495609_0020106_432_986 153
52 3300046665 Ga0495661_0042625 Ga0495661_0042625_408_962 153
53 3300046691 Ga0495670_0236185 Ga0495670_0236185_226_780 153
54 3300046692 Ga0495671_0001606 Ga0495671_0001606_9235_9789 153
55 3300046694 Ga0495649_0125866 Ga0495649_0125866_412_966 153
56 3300047320 Ga0495672_0051966 Ga0495672_0051966_187_741 153
57 3300047447 Ga0495685_009158 Ga0495685_009158_472_1026 153
58 3300048919 Ga0496116_0007817 Ga0496116_0007817_4846_5400 153
59 3300048924 Ga0496121_0026885 Ga0496121_0026885_231_785 153
60 3300048925 Ga0496122_0012773 Ga0496122_0012773_220_774 153
61 3300048926 Ga0496123_0005248 Ga0496123_0005248_5194_5748 153
62 3300048928 Ga0496125_0047767 Ga0496125_0047767_2587_3141 153
63 3300048929 Ga0496126_0388894 Ga0496126_0388894_455_1009 153
64 3300053077 Ga0495601_0178212 Ga0495601_0178212_608_1084 153
65 3300005340 Ga0070689_100364738 Ga0070689_1003647381 154
66 3300005456 Ga0070678_101146787 Ga0070678_1011467871 154
67 3300005459 Ga0068867_100210028 Ga0068867_1002100282 154
68 3300005539 Ga0068853_100404684 Ga0068853_1004046841 154
69 3300005616 Ga0068852_100331746 Ga0068852_1003317462 154
70 3300005617 Ga0068859_100306328 Ga0068859_1003063283 154
71 3300005618 Ga0068864_102304084 Ga0068864_1023040841 154
72 3300005841 Ga0068863_100534223 Ga0068863_1005342232 154
73 3300005843 Ga0068860_100060219 Ga0068860_1000602195 154
74 3300006051 Ga0075364_10305782 Ga0075364_103057822 154
75 3300006931 Ga0097620_100306314 Ga0097620_1003063142 154
76 3300009177 Ga0105248_10220165 Ga0105248_102201652 154
77 3300013306 Ga0163162_11546927 Ga0163162_115469272 154
78 3300013308 Ga0157375_10147814 Ga0157375_101478143 154
79 3300014968 Ga0157379_12026818 Ga0157379_120268181 154
80 3300014968 Ga0157379_12512901 Ga0157379_125129011 154
81 3300014969 Ga0157376_10478940 Ga0157376_104789402 154
82 3300025735 Ga0207713_1036244 Ga0207713_10362442 154
83 3300025903 Ga0207680_10499031 Ga0207680_104990312 154
84 3300025937 Ga0207669_10124311 Ga0207669_101243113 154
85 3300025941 Ga0207711_10321916 Ga0207711_103219162 154
86 3300026023 Ga0207677_10535727 Ga0207677_105357272 154
87 3300026118 Ga0207675_100370527 Ga0207675_1003705273 154
88 3300026142 Ga0207698_11004997 Ga0207698_110049972 154
89 3300028381 Ga0268264_10021449 Ga0268264_100214497 154
90 3300044694 Ga0466963_0478439 Ga0466963_0478439_75_608 154
91 3300049578 Ga0501042_0516835 Ga0501042_0516835_280_744 154
92 3300049588 Ga0501072_0476196 Ga0501072_0476196_23_487 154
93 3300049590 Ga0501074_0427974 Ga0501074_0427974_19_483 154
94 3300049743 Ga0501081_0416357 Ga0501081_0416357_349_813 154
95 3300049824 Ga0501045_1249530 Ga0501045_1249530_65_529 154
96 3300050491 nmdc:mga00v17_183801_c2 nmdc:mga00v17_183801_c2_320_790 154
97 3300005289 Ga0065704_10543945 Ga0065704_105439451 155
98 3300005293 Ga0065715_10198640 Ga0065715_101986402 155
99 3300005293 Ga0065715_10216561 Ga0065715_102165612 155
100 3300005295 Ga0065707_10643680 Ga0065707_106436802 155
101 3300005328 Ga0070676_10004210 Ga0070676_100042107 155
102 3300005331 Ga0070670_100013210 Ga0070670_1000132105 155
103 3300005331 Ga0070670_100014420 Ga0070670_1000144208 155
104 3300005331 Ga0070670_100206893 Ga0070670_1002068932 155
105 3300005331 Ga0070670_100280835 Ga0070670_1002808352 155
106 3300005331 Ga0070670_100327517 Ga0070670_1003275172 155
107 3300005333 Ga0070677_10020266 Ga0070677_100202664 155
108 3300005333 Ga0070677_10053359 Ga0070677_100533591 155
109 3300005334 Ga0068869_100000356 Ga0068869_10000035621 155
110 3300005334 Ga0068869_100093325 Ga0068869_1000933253 155
111 3300005334 Ga0068869_100478168 Ga0068869_1004781682 155
112 3300005335 Ga0070666_10032196 Ga0070666_100321964 155
113 3300005335 Ga0070666_10909983 Ga0070666_109099832 155
114 3300005338 Ga0068868_100021435 Ga0068868_1000214354 155
115 3300005338 Ga0068868_100044231 Ga0068868_1000442312 155
116 3300005339 Ga0070660_100365428 Ga0070660_1003654282 155
117 3300005344 Ga0070661_100262318 Ga0070661_1002623182 155
118 3300005344 Ga0070661_100838493 Ga0070661_1008384932 155
119 3300005347 Ga0070668_100008431 Ga0070668_1000084319 155
120 3300005347 Ga0070668_100025855 Ga0070668_1000258554 155
121 3300005347 Ga0070668_100060850 Ga0070668_1000608502 155
122 3300005347 Ga0070668_100088308 Ga0070668_1000883085 155
123 3300005347 Ga0070668_100162744 Ga0070668_1001627442 155
124 3300005353 Ga0070669_100015544 Ga0070669_1000155445 155
125 3300005353 Ga0070669_100016089 Ga0070669_1000160896 155
126 3300005354 Ga0070675_100014034 Ga0070675_1000140342 155
127 3300005354 Ga0070675_100355068 Ga0070675_1003550681 155
128 3300005354 Ga0070675_100906411 Ga0070675_1009064112 155
129 3300005355 Ga0070671_100053947 Ga0070671_1000539473 155
130 3300005355 Ga0070671_100181219 Ga0070671_1001812193 155
131 3300005355 Ga0070671_100205370 Ga0070671_1002053703 155
132 3300005356 Ga0070674_100007493 Ga0070674_1000074934 155
133 3300005356 Ga0070674_100140661 Ga0070674_1001406613 155
134 3300005364 Ga0070673_100003912 Ga0070673_1000039122 155
135 3300005364 Ga0070673_100038869 Ga0070673_1000388693 155
136 3300005364 Ga0070673_100407036 Ga0070673_1004070362 155
137 3300005364 Ga0070673_100418069 Ga0070673_1004180692 155
138 3300005365 Ga0070688_100020748 Ga0070688_1000207483 155
139 3300005365 Ga0070688_100114945 Ga0070688_1001149453 155
140 3300005365 Ga0070688_100586219 Ga0070688_1005862192 155
141 3300005366 Ga0070659_100100299 Ga0070659_1001002993 155
142 3300005366 Ga0070659_100554551 Ga0070659_1005545512 155
143 3300005367 Ga0070667_100001403 Ga0070667_10000140311 155
144 3300005367 Ga0070667_100002052 Ga0070667_1000020523 155
145 3300005367 Ga0070667_100113710 Ga0070667_1001137104 155
146 3300005367 Ga0070667_100173446 Ga0070667_1001734462 155
147 3300005367 Ga0070667_100353905 Ga0070667_1003539052 155
148 3300005435 Ga0070714_100044899 Ga0070714_1000448992 155
149 3300005441 Ga0070700_100432683 Ga0070700_1004326832 155
150 3300005441 Ga0070700_100536992 Ga0070700_1005369922 155
151 3300005444 Ga0070694_100306660 Ga0070694_1003066602 155
152 3300005456 Ga0070678_100068344 Ga0070678_1000683443 155
153 3300005456 Ga0070678_100133070 Ga0070678_1001330702 155
154 3300005457 Ga0070662_100299094 Ga0070662_1002990942 155
155 3300005459 Ga0068867_100007434 Ga0068867_1000074342 155
156 3300005459 Ga0068867_100027509 Ga0068867_1000275094 155
157 3300005459 Ga0068867_100172174 Ga0068867_1001721743 155
158 3300005459 Ga0068867_100271461 Ga0068867_1002714611 155
159 3300005466 Ga0070685_10229917 Ga0070685_102299172 155
160 3300005539 Ga0068853_100849380 Ga0068853_1008493801 155
161 3300005543 Ga0070672_100062364 Ga0070672_1000623643 155
162 3300005543 Ga0070672_100177390 Ga0070672_1001773902 155
163 3300005543 Ga0070672_100276586 Ga0070672_1002765862 155
164 3300005543 Ga0070672_100363412 Ga0070672_1003634122 155
165 3300005543 Ga0070672_100650613 Ga0070672_1006506132 155
166 3300005545 Ga0070695_100380437 Ga0070695_1003804372 155
167 3300005546 Ga0070696_100142851 Ga0070696_1001428512 155
168 3300005547 Ga0070693_100576214 Ga0070693_1005762141 155
169 3300005548 Ga0070665_100164457 Ga0070665_1001644573 155
170 3300005548 Ga0070665_100357321 Ga0070665_1003573212 155
171 3300005548 Ga0070665_100574790 Ga0070665_1005747902 155
172 3300005548 Ga0070665_101240370 Ga0070665_1012403702 155
173 3300005549 Ga0070704_100286482 Ga0070704_1002864822 155
174 3300005563 Ga0068855_100025951 Ga0068855_1000259518 155
175 3300005563 Ga0068855_100162956 Ga0068855_1001629562 155
176 3300005577 Ga0068857_100020112 Ga0068857_1000201124 155
177 3300005578 Ga0068854_100178024 Ga0068854_1001780241 155
178 3300005615 Ga0070702_100150253 Ga0070702_1001502533 155
179 3300005616 Ga0068852_100201586 Ga0068852_1002015861 155
180 3300005617 Ga0068859_100014353 Ga0068859_1000143536 155
181 3300005617 Ga0068859_100021791 Ga0068859_1000217917 155
182 3300005617 Ga0068859_100208857 Ga0068859_1002088574 155
183 3300005617 Ga0068859_100427382 Ga0068859_1004273822 155
184 3300005618 Ga0068864_100000981 Ga0068864_10000098112 155
185 3300005618 Ga0068864_100283523 Ga0068864_1002835232 155
186 3300005618 Ga0068864_100347913 Ga0068864_1003479131 155
187 3300005618 Ga0068864_100568174 Ga0068864_1005681742 155
188 3300005718 Ga0068866_10118829 Ga0068866_101188293 155
189 3300005718 Ga0068866_10174039 Ga0068866_101740392 155
190 3300005719 Ga0068861_100013391 Ga0068861_1000133914 155
191 3300005719 Ga0068861_100037180 Ga0068861_1000371803 155
192 3300005719 Ga0068861_100541876 Ga0068861_1005418762 155
193 3300005719 Ga0068861_100825390 Ga0068861_1008253902 155
194 3300005834 Ga0068851_10333592 Ga0068851_103335922 155
195 3300005834 Ga0068851_10493754 Ga0068851_104937542 155
196 3300005840 Ga0068870_10078729 Ga0068870_100787292 155
197 3300005841 Ga0068863_100004419 Ga0068863_10000441911 155
198 3300005841 Ga0068863_100059799 Ga0068863_1000597993 155
199 3300005841 Ga0068863_100107136 Ga0068863_1001071363 155
200 3300005841 Ga0068863_100361631 Ga0068863_1003616312 155
201 3300005842 Ga0068858_100001946 Ga0068858_10000194621 155
202 3300005842 Ga0068858_100058632 Ga0068858_1000586323 155
203 3300005842 Ga0068858_100474109 Ga0068858_1004741092 155
204 3300005843 Ga0068860_100019348 Ga0068860_1000193487 155
205 3300005843 Ga0068860_100023185 Ga0068860_1000231854 155
206 3300005843 Ga0068860_100077510 Ga0068860_1000775103 155
207 3300005843 Ga0068860_100415583 Ga0068860_1004155832 155
208 3300005843 Ga0068860_100486307 Ga0068860_1004863072 155
209 3300005844 Ga0068862_100007718 Ga0068862_1000077188 155
210 3300005844 Ga0068862_100011362 Ga0068862_1000113629 155
211 3300005844 Ga0068862_100144386 Ga0068862_1001443863 155
212 3300005844 Ga0068862_100736020 Ga0068862_1007360202 155
213 3300006237 Ga0097621_100029232 Ga0097621_1000292323 155
214 3300006237 Ga0097621_100672600 Ga0097621_1006726002 155
215 3300006358 Ga0068871_100028930 Ga0068871_1000289305 155
216 3300006358 Ga0068871_101738792 Ga0068871_1017387921 155
217 3300006844 Ga0075428_100324335 Ga0075428_1003243353 155
218 3300006881 Ga0068865_100067648 Ga0068865_1000676484 155
219 3300006881 Ga0068865_100138902 Ga0068865_1001389023 155
220 3300006881 Ga0068865_100379199 Ga0068865_1003791992 155
221 3300006931 Ga0097620_100014355 Ga0097620_1000143556 155
222 3300006931 Ga0097620_100021791 Ga0097620_1000217917 155
223 3300006931 Ga0097620_100208869 Ga0097620_1002088694 155
224 3300006931 Ga0097620_100427365 Ga0097620_1004273652 155
225 3300009101 Ga0105247_10064056 Ga0105247_100640563 155
226 3300009147 Ga0114129_11487541 Ga0114129_114875412 155
227 3300009148 Ga0105243_10129173 Ga0105243_101291733 155
228 3300009148 Ga0105243_10401412 Ga0105243_104014122 155
229 3300009148 Ga0105243_11261580 Ga0105243_112615802 155
230 3300009176 Ga0105242_10571916 Ga0105242_105719162 155
231 3300009177 Ga0105248_10001115 Ga0105248_1000111517 155
232 3300009177 Ga0105248_10053576 Ga0105248_100535764 155
233 3300009177 Ga0105248_12172557 Ga0105248_121725572 155
234 3300009551 Ga0105238_10847307 Ga0105238_108473072 155
235 3300009553 Ga0105249_10055830 Ga0105249_100558302 155
236 3300009553 Ga0105249_10136486 Ga0105249_101364863 155
237 3300013104 Ga0157370_10050446 Ga0157370_100504462 155
238 3300013296 Ga0157374_10008385 Ga0157374_100083853 155
239 3300013297 Ga0157378_10174332 Ga0157378_101743323 155
240 3300013297 Ga0157378_11221893 Ga0157378_112218932 155
241 3300013306 Ga0163162_10289469 Ga0163162_102894692 155
242 3300013306 Ga0163162_10863084 Ga0163162_108630841 155
243 3300013307 Ga0157372_10006135 Ga0157372_1000613516 155
244 3300013307 Ga0157372_10285662 Ga0157372_102856622 155
245 3300013308 Ga0157375_10209481 Ga0157375_102094813 155
246 3300013308 Ga0157375_10547847 Ga0157375_105478471 155
247 3300013308 Ga0157375_10834489 Ga0157375_108344892 155
248 3300013308 Ga0157375_11907163 Ga0157375_119071631 155
249 3300014325 Ga0163163_10018601 Ga0163163_100186013 155
250 3300014325 Ga0163163_12036552 Ga0163163_120365521 155
251 3300014326 Ga0157380_10414690 Ga0157380_104146902 155
252 3300014326 Ga0157380_10889781 Ga0157380_108897812 155
253 3300014497 Ga0182008_10028058 Ga0182008_100280584 155
254 3300014745 Ga0157377_10143062 Ga0157377_101430622 155
255 3300014745 Ga0157377_10456856 Ga0157377_104568562 155
256 3300014968 Ga0157379_10009459 Ga0157379_100094597 155
257 3300014968 Ga0157379_10094019 Ga0157379_100940192 155
258 3300014969 Ga0157376_10093390 Ga0157376_100933902 155
259 3300014969 Ga0157376_10435394 Ga0157376_104353942 155
260 3300017792 Ga0163161_10012976 Ga0163161_100129765 155
261 3300017792 Ga0163161_10976560 Ga0163161_109765602 155
262 3300025303 Ga0209051_1101526 Ga0209051_11015262 155
263 3300025315 Ga0207697_10014624 Ga0207697_100146244 155
264 3300025321 Ga0207656_10082720 Ga0207656_100827202 155
265 3300025321 Ga0207656_10276276 Ga0207656_102762762 155
266 3300025893 Ga0207682_10065180 Ga0207682_100651802 155
267 3300025893 Ga0207682_10072956 Ga0207682_100729562 155
268 3300025900 Ga0207710_10042261 Ga0207710_100422612 155
269 3300025901 Ga0207688_10174679 Ga0207688_101746791 155
270 3300025903 Ga0207680_10047845 Ga0207680_100478453 155
271 3300025903 Ga0207680_10815704 Ga0207680_108157042 155
272 3300025907 Ga0207645_10000353 Ga0207645_1000035342 155
273 3300025907 Ga0207645_10063743 Ga0207645_100637432 155
274 3300025907 Ga0207645_10201921 Ga0207645_102019212 155
275 3300025907 Ga0207645_10352083 Ga0207645_103520832 155
276 3300025907 Ga0207645_10373452 Ga0207645_103734522 155
277 3300025908 Ga0207643_10040823 Ga0207643_100408232 155
278 3300025918 Ga0207662_10105993 Ga0207662_101059932 155
279 3300025918 Ga0207662_10836794 Ga0207662_108367942 155
280 3300025919 Ga0207657_10214022 Ga0207657_102140222 155
281 3300025922 Ga0207646_11085319 Ga0207646_110853192 155
282 3300025923 Ga0207681_10053876 Ga0207681_100538763 155
283 3300025923 Ga0207681_10063520 Ga0207681_100635202 155
284 3300025923 Ga0207681_10090251 Ga0207681_100902513 155
285 3300025924 Ga0207694_11191781 Ga0207694_111917812 155
286 3300025925 Ga0207650_10008205 Ga0207650_100082054 155
287 3300025925 Ga0207650_10008238 Ga0207650_100082382 155
288 3300025925 Ga0207650_10048413 Ga0207650_100484133 155
289 3300025925 Ga0207650_10381382 Ga0207650_103813822 155
290 3300025925 Ga0207650_10511382 Ga0207650_105113822 155
291 3300025926 Ga0207659_10008089 Ga0207659_100080892 155
292 3300025926 Ga0207659_10038925 Ga0207659_100389254 155
293 3300025926 Ga0207659_10735570 Ga0207659_107355702 155
294 3300025927 Ga0207687_10422575 Ga0207687_104225752 155
295 3300025929 Ga0207664_10156786 Ga0207664_101567863 155
296 3300025931 Ga0207644_10406898 Ga0207644_104068982 155
297 3300025932 Ga0207690_10025592 Ga0207690_100255923 155
298 3300025932 Ga0207690_10667290 Ga0207690_106672902 155
299 3300025933 Ga0207706_10534172 Ga0207706_105341722 155
300 3300025933 Ga0207706_10726527 Ga0207706_107265271 155
301 3300025934 Ga0207686_10693757 Ga0207686_106937572 155
302 3300025935 Ga0207709_10198069 Ga0207709_101980691 155
303 3300025935 Ga0207709_10330897 Ga0207709_103308972 155
304 3300025937 Ga0207669_10034539 Ga0207669_100345392 155
305 3300025937 Ga0207669_10144995 Ga0207669_101449952 155
306 3300025938 Ga0207704_10430602 Ga0207704_104306022 155
307 3300025938 Ga0207704_10821377 Ga0207704_108213771 155
308 3300025940 Ga0207691_10000663 Ga0207691_1000066340 155
309 3300025940 Ga0207691_10050489 Ga0207691_100504892 155
310 3300025940 Ga0207691_10109541 Ga0207691_101095412 155
311 3300025940 Ga0207691_10171388 Ga0207691_101713882 155
312 3300025940 Ga0207691_10369806 Ga0207691_103698062 155
313 3300025940 Ga0207691_10491045 Ga0207691_104910452 155
314 3300025941 Ga0207711_10040764 Ga0207711_100407644 155
315 3300025941 Ga0207711_10098192 Ga0207711_100981922 155
316 3300025942 Ga0207689_10001242 Ga0207689_1000124221 155
317 3300025942 Ga0207689_10001481 Ga0207689_1000148127 155
318 3300025942 Ga0207689_10472313 Ga0207689_104723132 155
319 3300025949 Ga0207667_10062880 Ga0207667_100628804 155
320 3300025949 Ga0207667_10168047 Ga0207667_101680473 155
321 3300025960 Ga0207651_10010046 Ga0207651_100100462 155
322 3300025960 Ga0207651_10061681 Ga0207651_100616812 155
323 3300025960 Ga0207651_10265871 Ga0207651_102658712 155
324 3300025961 Ga0207712_10014061 Ga0207712_100140615 155
325 3300025972 Ga0207668_10014105 Ga0207668_100141055 155
326 3300025972 Ga0207668_10017170 Ga0207668_100171702 155
327 3300025972 Ga0207668_10025357 Ga0207668_100253571 155
328 3300025972 Ga0207668_10029961 Ga0207668_100299615 155
329 3300025972 Ga0207668_10126327 Ga0207668_101263273 155
330 3300025972 Ga0207668_10443229 Ga0207668_104432292 155
331 3300025972 Ga0207668_10707516 Ga0207668_107075161 155
332 3300025981 Ga0207640_10104743 Ga0207640_101047432 155
333 3300025986 Ga0207658_10025111 Ga0207658_100251116 155
334 3300025986 Ga0207658_10207191 Ga0207658_102071912 155
335 3300025986 Ga0207658_10500229 Ga0207658_105002292 155
336 3300025986 Ga0207658_10547720 Ga0207658_105477201 155
337 3300025986 Ga0207658_10615478 Ga0207658_106154782 155
338 3300026023 Ga0207677_10012576 Ga0207677_100125765 155
339 3300026023 Ga0207677_10681177 Ga0207677_106811772 155
340 3300026023 Ga0207677_10916079 Ga0207677_109160792 155
341 3300026035 Ga0207703_10003742 Ga0207703_100037425 155
342 3300026035 Ga0207703_10055465 Ga0207703_100554654 155
343 3300026035 Ga0207703_10366809 Ga0207703_103668092 155
344 3300026035 Ga0207703_10652329 Ga0207703_106523292 155
345 3300026075 Ga0207708_10837132 Ga0207708_108371322 155
346 3300026088 Ga0207641_10026213 Ga0207641_100262137 155
347 3300026088 Ga0207641_10039886 Ga0207641_100398862 155
348 3300026088 Ga0207641_10101619 Ga0207641_101016193 155
349 3300026088 Ga0207641_10108530 Ga0207641_101085305 155
350 3300026089 Ga0207648_10004079 Ga0207648_1000407911 155
351 3300026089 Ga0207648_10058358 Ga0207648_100583586 155
352 3300026089 Ga0207648_10100032 Ga0207648_101000322 155
353 3300026089 Ga0207648_10327996 Ga0207648_103279962 155
354 3300026089 Ga0207648_10643718 Ga0207648_106437182 155
355 3300026095 Ga0207676_10006171 Ga0207676_100061719 155
356 3300026116 Ga0207674_10022759 Ga0207674_100227597 155
357 3300026118 Ga0207675_100007047 Ga0207675_1000070479 155
358 3300026118 Ga0207675_100020605 Ga0207675_1000206054 155
359 3300026118 Ga0207675_100065462 Ga0207675_1000654626 155
360 3300026118 Ga0207675_100186391 Ga0207675_1001863913 155
361 3300026118 Ga0207675_100385233 Ga0207675_1003852332 155
362 3300026118 Ga0207675_100926116 Ga0207675_1009261162 155
363 3300026121 Ga0207683_10001329 Ga0207683_100013296 155
364 3300026142 Ga0207698_10061081 Ga0207698_100610813 155
365 3300027665 Ga0209983_1008013 Ga0209983_10080133 155
366 3300028379 Ga0268266_10047844 Ga0268266_100478443 155
367 3300028379 Ga0268266_10098506 Ga0268266_100985062 155
368 3300028379 Ga0268266_11419745 Ga0268266_114197451 155
369 3300028380 Ga0268265_10021619 Ga0268265_100216194 155
370 3300028380 Ga0268265_10443750 Ga0268265_104437502 155
371 3300028380 Ga0268265_11570559 Ga0268265_115705592 155
372 3300028381 Ga0268264_10000599 Ga0268264_1000059949 155
373 3300028381 Ga0268264_10047411 Ga0268264_100474112 155
374 3300028381 Ga0268264_10054399 Ga0268264_100543994 155
375 3300028381 Ga0268264_10237350 Ga0268264_102373503 155
376 3300028381 Ga0268264_10500078 Ga0268264_105000782 155
377 3300031242 Ga0265329_10001643 Ga0265329_1000164312 155
378 3300031249 Ga0265339_10021396 Ga0265339_100213965 155
379 3300031250 Ga0265331_10001285 Ga0265331_100012854 155
380 3300031251 Ga0265327_10001001 Ga0265327_1000100115 155
381 3300031344 Ga0265316_10106602 Ga0265316_101066022 155
382 3300035724 Ga0373933_0779056 Ga0373933_0779056_11_478 155
383 3300036401 Ga0373937_0656953 Ga0373937_0656953_171_638 155
384 3300036401 Ga0373937_0728404 Ga0373937_0728404_369_836 155
385 3300041443 Ga0451789_1207960 Ga0451789_1207960_105_578 155
386 3300042461 Ga0439460_0360968 Ga0439460_0360968_32_502 155
387 3300044673 Ga0453683_0240838 Ga0453683_0240838_32_502 155
388 3300044842 Ga0466957_0410301 Ga0466957_0410301_56_619 155
389 3300045051 Ga0451576_1517030 Ga0451576_1517030_27_497 155
390 3300046537 Ga0495598_0330834 Ga0495598_0330834_85_558 155
391 3300048909 Ga0496106_0537427 Ga0496106_0537427_337_804 155
392 3300048909 Ga0496106_0597617 Ga0496106_0597617_146_613 155
393 3300048911 Ga0496108_0041432 Ga0496108_0041432_1398_1865 155
394 3300048911 Ga0496108_0870812 Ga0496108_0870812_42_533 155
395 3300048912 Ga0496109_0039311 Ga0496109_0039311_3802_4272 155
396 3300048912 Ga0496109_0203913 Ga0496109_0203913_1260_1727 155
397 3300048912 Ga0496109_0487068 Ga0496109_0487068_134_625 155
398 3300048912 Ga0496109_1460047 Ga0496109_1460047_96_563 155
399 3300048914 Ga0496111_0030457 Ga0496111_0030457_68_535 155
400 3300048915 Ga0496112_0011743 Ga0496112_0011743_4166_4633 155
401 3300048916 Ga0496113_0071811 Ga0496113_0071811_668_1135 155
402 3300048917 Ga0496114_0727272 Ga0496114_0727272_21_488 155
403 3300049824 Ga0501045_0058873 Ga0501045_0058873_107_574 155
404 3300053085 Ga0495619_0886515 Ga0495619_0886515_20_487 155
405 3300001979 JGI24740J21852_10000325 JGI24740J21852_1000032514 156
406 3300002705 JGI25156J39149_1003651 JGI25156J39149_10036515 156
407 3300002738 JGI25154J39366_1002218 JGI25154J39366_10022183 156
408 3300002741 JGI25157J39369_1013572 JGI25157J39369_10135722 156
409 3300003751 Ga0055538_1005033 Ga0055538_10050332 156
410 3300003752 Ga0055539_1011770 Ga0055539_10117702 156
411 3300003756 Ga0055533_1002375 Ga0055533_10023756 156
412 3300003762 Ga0055542_1000632 Ga0055542_100063218 156
413 3300003841 Ga0055541_1000952 Ga0055541_10009525 156
414 3300005290 Ga0065712_10114968 Ga0065712_101149683 156
415 3300005295 Ga0065707_10541434 Ga0065707_105414341 156
416 3300005327 Ga0070658_10497416 Ga0070658_104974162 156
417 3300005328 Ga0070676_10309308 Ga0070676_103093082 156
418 3300005330 Ga0070690_100003769 Ga0070690_1000037696 156
419 3300005330 Ga0070690_100229321 Ga0070690_1002293212 156
420 3300005331 Ga0070670_100125706 Ga0070670_1001257061 156
421 3300005333 Ga0070677_10050860 Ga0070677_100508601 156
422 3300005334 Ga0068869_100084360 Ga0068869_1000843603 156
423 3300005335 Ga0070666_10006099 Ga0070666_100060992 156
424 3300005336 Ga0070680_100289763 Ga0070680_1002897632 156
425 3300005337 Ga0070682_100080768 Ga0070682_1000807681 156
426 3300005338 Ga0068868_100008239 Ga0068868_1000082396 156
427 3300005339 Ga0070660_100278067 Ga0070660_1002780672 156
428 3300005340 Ga0070689_100000418 Ga0070689_10000041819 156
429 3300005341 Ga0070691_10224301 Ga0070691_102243012 156
430 3300005341 Ga0070691_10267840 Ga0070691_102678402 156
431 3300005345 Ga0070692_10011872 Ga0070692_100118725 156
432 3300005355 Ga0070671_100093539 Ga0070671_1000935394 156
433 3300005356 Ga0070674_100036516 Ga0070674_1000365162 156
434 3300005364 Ga0070673_100006782 Ga0070673_1000067828 156
435 3300005365 Ga0070688_100133890 Ga0070688_1001338903 156
436 3300005366 Ga0070659_100208654 Ga0070659_1002086542 156
437 3300005366 Ga0070659_100608504 Ga0070659_1006085042 156
438 3300005367 Ga0070667_100219123 Ga0070667_1002191232 156
439 3300005435 Ga0070714_100000984 Ga0070714_10000098422 156
440 3300005436 Ga0070713_100009007 Ga0070713_1000090076 156
441 3300005436 Ga0070713_100051287 Ga0070713_1000512873 156
442 3300005437 Ga0070710_10008238 Ga0070710_100082388 156
443 3300005438 Ga0070701_10166103 Ga0070701_101661032 156
444 3300005439 Ga0070711_100000407 Ga0070711_10000040714 156
445 3300005440 Ga0070705_100020267 Ga0070705_1000202673 156
446 3300005440 Ga0070705_100296477 Ga0070705_1002964772 156
447 3300005441 Ga0070700_100938336 Ga0070700_1009383362 156
448 3300005444 Ga0070694_100012031 Ga0070694_1000120318 156
449 3300005444 Ga0070694_100033886 Ga0070694_1000338863 156
450 3300005444 Ga0070694_100167543 Ga0070694_1001675432 156
451 3300005445 Ga0070708_100153791 Ga0070708_1001537912 156
452 3300005455 Ga0070663_100097236 Ga0070663_1000972362 156
453 3300005456 Ga0070678_100007067 Ga0070678_1000070678 156
454 3300005457 Ga0070662_100028893 Ga0070662_1000288932 156
455 3300005459 Ga0068867_100014508 Ga0068867_1000145085 156
456 3300005459 Ga0068867_102149421 Ga0068867_1021494211 156
457 3300005466 Ga0070685_10005507 Ga0070685_100055076 156
458 3300005467 Ga0070706_100023284 Ga0070706_1000232844 156
459 3300005467 Ga0070706_100032816 Ga0070706_1000328163 156
460 3300005467 Ga0070706_100097029 Ga0070706_1000970292 156
461 3300005468 Ga0070707_100059646 Ga0070707_1000596463 156
462 3300005468 Ga0070707_100197706 Ga0070707_1001977062 156
463 3300005468 Ga0070707_100310245 Ga0070707_1003102453 156
464 3300005471 Ga0070698_100009607 Ga0070698_1000096077 156
465 3300005518 Ga0070699_100007236 Ga0070699_1000072365 156
466 3300005518 Ga0070699_100063681 Ga0070699_1000636814 156
467 3300005530 Ga0070679_100116684 Ga0070679_1001166843 156
468 3300005535 Ga0070684_100066692 Ga0070684_1000666923 156
469 3300005536 Ga0070697_100019753 Ga0070697_1000197534 156
470 3300005536 Ga0070697_100079832 Ga0070697_1000798322 156
471 3300005539 Ga0068853_100086673 Ga0068853_1000866733 156
472 3300005543 Ga0070672_100012906 Ga0070672_1000129063 156
473 3300005544 Ga0070686_100005296 Ga0070686_1000052964 156
474 3300005545 Ga0070695_100042420 Ga0070695_1000424203 156
475 3300005546 Ga0070696_100114013 Ga0070696_1001140132 156
476 3300005546 Ga0070696_100240205 Ga0070696_1002402052 156
477 3300005547 Ga0070693_100003898 Ga0070693_1000038984 156
478 3300005547 Ga0070693_100337781 Ga0070693_1003377812 156
479 3300005547 Ga0070693_100430502 Ga0070693_1004305022 156
480 3300005548 Ga0070665_100003736 Ga0070665_10000373612 156
481 3300005549 Ga0070704_100001376 Ga0070704_10000137617 156
482 3300005549 Ga0070704_100056923 Ga0070704_1000569233 156
483 3300005563 Ga0068855_100293384 Ga0068855_1002933842 156
484 3300005563 Ga0068855_101078131 Ga0068855_1010781312 156
485 3300005564 Ga0070664_100112625 Ga0070664_1001126252 156
486 3300005564 Ga0070664_100121912 Ga0070664_1001219122 156
487 3300005564 Ga0070664_101051011 Ga0070664_1010510112 156
488 3300005578 Ga0068854_100001272 Ga0068854_10000127210 156
489 3300005614 Ga0068856_100082809 Ga0068856_1000828093 156
490 3300005615 Ga0070702_100035387 Ga0070702_1000353873 156
491 3300005615 Ga0070702_100767191 Ga0070702_1007671912 156
492 3300005615 Ga0070702_101072560 Ga0070702_1010725601 156
493 3300005616 Ga0068852_100079984 Ga0068852_1000799843 156
494 3300005617 Ga0068859_100010525 Ga0068859_1000105254 156
495 3300005618 Ga0068864_100013356 Ga0068864_10001335610 156
496 3300005718 Ga0068866_10002776 Ga0068866_100027767 156
497 3300005718 Ga0068866_10128000 Ga0068866_101280002 156
498 3300005834 Ga0068851_10027126 Ga0068851_100271263 156
499 3300005840 Ga0068870_10095225 Ga0068870_100952253 156
500 3300005841 Ga0068863_100000366 Ga0068863_10000036618 156
501 3300005841 Ga0068863_100742635 Ga0068863_1007426352 156
502 3300005842 Ga0068858_100003588 Ga0068858_1000035889 156
503 3300005843 Ga0068860_100046386 Ga0068860_1000463864 156
504 3300006038 Ga0075365_10048297 Ga0075365_100482972 156
505 3300006042 Ga0075368_10001442 Ga0075368_100014425 156
506 3300006048 Ga0075363_100023850 Ga0075363_1000238505 156
507 3300006051 Ga0075364_10117245 Ga0075364_101172452 156
508 3300006163 Ga0070715_10004958 Ga0070715_100049582 156
509 3300006173 Ga0070716_100039004 Ga0070716_1000390044 156
510 3300006175 Ga0070712_100010551 Ga0070712_1000105517 156
511 3300006175 Ga0070712_100447972 Ga0070712_1004479722 156
512 3300006177 Ga0075362_10002143 Ga0075362_100021435 156
513 3300006178 Ga0075367_10004080 Ga0075367_100040805 156
514 3300006186 Ga0075369_10030786 Ga0075369_100307863 156
515 3300006195 Ga0075366_10028375 Ga0075366_100283753 156
516 3300006195 Ga0075366_10041538 Ga0075366_100415383 156
517 3300006237 Ga0097621_100037348 Ga0097621_1000373483 156
518 3300006237 Ga0097621_100198099 Ga0097621_1001980992 156
519 3300006353 Ga0075370_10000354 Ga0075370_1000035411 156
520 3300006353 Ga0075370_10090545 Ga0075370_100905452 156
521 3300006358 Ga0068871_100014108 Ga0068871_1000141084 156
522 3300006358 Ga0068871_100132647 Ga0068871_1001326474 156
523 3300006844 Ga0075428_100000089 Ga0075428_10000008927 156
524 3300006852 Ga0075433_10037026 Ga0075433_100370265 156
525 3300006852 Ga0075433_10103037 Ga0075433_101030373 156
526 3300006871 Ga0075434_100072309 Ga0075434_1000723094 156
527 3300006871 Ga0075434_100222563 Ga0075434_1002225633 156
528 3300006871 Ga0075434_100724688 Ga0075434_1007246882 156
529 3300006880 Ga0075429_100004777 Ga0075429_1000047778 156
530 3300006881 Ga0068865_100049867 Ga0068865_1000498673 156
531 3300006914 Ga0075436_100091180 Ga0075436_1000911803 156
532 3300006931 Ga0097620_100010526 Ga0097620_1000105264 156
533 3300007076 Ga0075435_100019130 Ga0075435_1000191304 156
534 3300007265 Ga0099794_10047706 Ga0099794_100477062 156
535 3300007788 Ga0099795_10002497 Ga0099795_100024973 156
536 3300009093 Ga0105240_10035226 Ga0105240_100352268 156
537 3300009094 Ga0111539_10040592 Ga0111539_100405923 156
538 3300009098 Ga0105245_10015183 Ga0105245_100151835 156
539 3300009098 Ga0105245_10029140 Ga0105245_100291406 156
540 3300009098 Ga0105245_10061915 Ga0105245_100619153 156
541 3300009098 Ga0105245_10086123 Ga0105245_100861233 156
542 3300009101 Ga0105247_10003683 Ga0105247_100036834 156
543 3300009148 Ga0105243_10120724 Ga0105243_101207242 156
544 3300009148 Ga0105243_10392432 Ga0105243_103924322 156
545 3300009174 Ga0105241_10007877 Ga0105241_100078779 156
546 3300009174 Ga0105241_10125568 Ga0105241_101255683 156
547 3300009174 Ga0105241_10612110 Ga0105241_106121102 156
548 3300009174 Ga0105241_11493905 Ga0105241_114939052 156
549 3300009176 Ga0105242_10012139 Ga0105242_100121396 156
550 3300009176 Ga0105242_10428098 Ga0105242_104280983 156
551 3300009176 Ga0105242_10775587 Ga0105242_107755872 156
552 3300009177 Ga0105248_10021616 Ga0105248_100216166 156
553 3300009177 Ga0105248_10358060 Ga0105248_103580602 156
554 3300009545 Ga0105237_10184058 Ga0105237_101840583 156
555 3300009545 Ga0105237_11456812 Ga0105237_114568122 156
556 3300009551 Ga0105238_10094474 Ga0105238_100944742 156
557 3300009551 Ga0105238_10394548 Ga0105238_103945482 156
558 3300009551 Ga0105238_10871567 Ga0105238_108715671 156
559 3300010375 Ga0105239_10064179 Ga0105239_100641794 156
560 3300011119 Ga0105246_10004097 Ga0105246_100040979 156
561 3300011119 Ga0105246_10065272 Ga0105246_100652722 156
562 3300013100 Ga0157373_10112346 Ga0157373_101123462 156
563 3300013102 Ga0157371_10157396 Ga0157371_101573962 156
564 3300013104 Ga0157370_10014165 Ga0157370_1001416511 156
565 3300013296 Ga0157374_10005148 Ga0157374_100051487 156
566 3300013296 Ga0157374_10159531 Ga0157374_101595313 156
567 3300013297 Ga0157378_10005782 Ga0157378_100057829 156
568 3300013297 Ga0157378_10050737 Ga0157378_100507376 156
569 3300013297 Ga0157378_10504597 Ga0157378_105045972 156
570 3300013297 Ga0157378_10582368 Ga0157378_105823682 156
571 3300013306 Ga0163162_10025069 Ga0163162_100250696 156
572 3300013306 Ga0163162_10064590 Ga0163162_100645904 156
573 3300013307 Ga0157372_10316358 Ga0157372_103163582 156
574 3300013308 Ga0157375_10140435 Ga0157375_101404354 156
575 3300013308 Ga0157375_10415281 Ga0157375_104152813 156
576 3300014325 Ga0163163_10019473 Ga0163163_100194736 156
577 3300014497 Ga0182008_10271996 Ga0182008_102719962 156
578 3300014745 Ga0157377_10003422 Ga0157377_100034223 156
579 3300014968 Ga0157379_10019451 Ga0157379_100194516 156
580 3300014969 Ga0157376_10026475 Ga0157376_100264753 156
581 3300014969 Ga0157376_10028239 Ga0157376_100282392 156
582 3300017792 Ga0163161_10575871 Ga0163161_105758712 156
583 3300021361 Ga0213872_10000532 Ga0213872_1000053216 156
584 3300021361 Ga0213872_10004390 Ga0213872_100043903 156
585 3300021361 Ga0213872_10005558 Ga0213872_100055587 156
586 3300021384 Ga0213876_10266176 Ga0213876_102661762 156
587 3300025224 Ga0209784_100537 Ga0209784_1005376 156
588 3300025225 Ga0209566_100235 Ga0209566_10023522 156
589 3300025226 Ga0209674_100250 Ga0209674_10025037 156
590 3300025230 Ga0209563_103766 Ga0209563_1037664 156
591 3300025242 Ga0209258_106236 Ga0209258_1062362 156
592 3300025246 Ga0209646_1000119 Ga0209646_100011991 156
593 3300025250 Ga0209026_1004177 Ga0209026_10041775 156
594 3300025253 Ga0209677_102981 Ga0209677_1029813 156
595 3300025254 Ga0209148_1000451 Ga0209148_100045129 156
596 3300025256 Ga0209759_1006344 Ga0209759_10063443 156
597 3300025272 Ga0209455_1000447 Ga0209455_10004479 156
598 3300025321 Ga0207656_10042160 Ga0207656_100421602 156
599 3300025893 Ga0207682_10019707 Ga0207682_100197074 156
600 3300025898 Ga0207692_10009535 Ga0207692_100095354 156
601 3300025898 Ga0207692_10111139 Ga0207692_101111392 156
602 3300025898 Ga0207692_10142830 Ga0207692_101428302 156
603 3300025899 Ga0207642_10000532 Ga0207642_100005327 156
604 3300025899 Ga0207642_10380857 Ga0207642_103808572 156
605 3300025900 Ga0207710_10006893 Ga0207710_100068937 156
606 3300025903 Ga0207680_10004492 Ga0207680_100044924 156
607 3300025903 Ga0207680_10168460 Ga0207680_101684602 156
608 3300025906 Ga0207699_10262319 Ga0207699_102623192 156
609 3300025906 Ga0207699_10270118 Ga0207699_102701182 156
610 3300025907 Ga0207645_10114291 Ga0207645_101142912 156
611 3300025908 Ga0207643_10681271 Ga0207643_106812712 156
612 3300025910 Ga0207684_10037180 Ga0207684_100371804 156
613 3300025910 Ga0207684_10140723 Ga0207684_101407232 156
614 3300025910 Ga0207684_10400161 Ga0207684_104001612 156
615 3300025911 Ga0207654_10031392 Ga0207654_100313923 156
616 3300025911 Ga0207654_10236136 Ga0207654_102361362 156
617 3300025911 Ga0207654_10540660 Ga0207654_105406602 156
618 3300025912 Ga0207707_10126797 Ga0207707_101267973 156
619 3300025913 Ga0207695_10054177 Ga0207695_100541777 156
620 3300025916 Ga0207663_10004116 Ga0207663_100041164 156
621 3300025918 Ga0207662_10128207 Ga0207662_101282072 156
622 3300025919 Ga0207657_10000469 Ga0207657_1000046937 156
623 3300025920 Ga0207649_10378732 Ga0207649_103787322 156
624 3300025922 Ga0207646_10039160 Ga0207646_100391604 156
625 3300025922 Ga0207646_10076372 Ga0207646_100763724 156
626 3300025924 Ga0207694_10284818 Ga0207694_102848182 156
627 3300025924 Ga0207694_10334152 Ga0207694_103341522 156
628 3300025927 Ga0207687_10003673 Ga0207687_100036739 156
629 3300025927 Ga0207687_10021201 Ga0207687_100212016 156
630 3300025927 Ga0207687_10069916 Ga0207687_100699162 156
631 3300025928 Ga0207700_10011674 Ga0207700_100116743 156
632 3300025928 Ga0207700_10022931 Ga0207700_100229314 156
633 3300025928 Ga0207700_10149973 Ga0207700_101499733 156
634 3300025929 Ga0207664_10007905 Ga0207664_100079055 156
635 3300025929 Ga0207664_10165695 Ga0207664_101656952 156
636 3300025931 Ga0207644_10042177 Ga0207644_100421773 156
637 3300025931 Ga0207644_10074912 Ga0207644_100749122 156
638 3300025931 Ga0207644_10776377 Ga0207644_107763772 156
639 3300025933 Ga0207706_10003781 Ga0207706_100037815 156
640 3300025933 Ga0207706_10452991 Ga0207706_104529912 156
641 3300025934 Ga0207686_10000387 Ga0207686_1000038710 156
642 3300025934 Ga0207686_10165567 Ga0207686_101655672 156
643 3300025934 Ga0207686_10620895 Ga0207686_106208951 156
644 3300025935 Ga0207709_10110266 Ga0207709_101102662 156
645 3300025935 Ga0207709_10163629 Ga0207709_101636292 156
646 3300025936 Ga0207670_10014520 Ga0207670_100145204 156
647 3300025937 Ga0207669_10191869 Ga0207669_101918692 156
648 3300025938 Ga0207704_10072045 Ga0207704_100720452 156
649 3300025938 Ga0207704_10870953 Ga0207704_108709532 156
650 3300025939 Ga0207665_10006073 Ga0207665_100060734 156
651 3300025939 Ga0207665_10434857 Ga0207665_104348571 156
652 3300025940 Ga0207691_10040229 Ga0207691_100402295 156
653 3300025941 Ga0207711_10002569 Ga0207711_100025696 156
654 3300025941 Ga0207711_10291241 Ga0207711_102912412 156
655 3300025942 Ga0207689_10158269 Ga0207689_101582692 156
656 3300025944 Ga0207661_10501512 Ga0207661_105015121 156
657 3300025945 Ga0207679_10137358 Ga0207679_101373582 156
658 3300025945 Ga0207679_10965150 Ga0207679_109651501 156
659 3300025949 Ga0207667_10127515 Ga0207667_101275155 156
660 3300025960 Ga0207651_10006044 Ga0207651_100060446 156
661 3300025981 Ga0207640_10032590 Ga0207640_100325904 156
662 3300025981 Ga0207640_10046407 Ga0207640_100464073 156
663 3300025986 Ga0207658_10007145 Ga0207658_100071454 156
664 3300025986 Ga0207658_10036223 Ga0207658_100362234 156
665 3300026023 Ga0207677_10001127 Ga0207677_1000112713 156
666 3300026023 Ga0207677_10015239 Ga0207677_100152393 156
667 3300026035 Ga0207703_10001000 Ga0207703_1000100024 156
668 3300026078 Ga0207702_10015292 Ga0207702_100152922 156
669 3300026088 Ga0207641_10004677 Ga0207641_1000467712 156
670 3300026089 Ga0207648_10019548 Ga0207648_100195485 156
671 3300026095 Ga0207676_10001564 Ga0207676_1000156415 156
672 3300026116 Ga0207674_10003455 Ga0207674_1000345518 156
673 3300026118 Ga0207675_100181547 Ga0207675_1001815473 156
674 3300026121 Ga0207683_10006146 Ga0207683_100061468 156
675 3300026142 Ga0207698_10109181 Ga0207698_101091812 156
676 3300026142 Ga0207698_10556232 Ga0207698_105562322 156
677 3300027360 Ga0209969_1003353 Ga0209969_10033534 156
678 3300027462 Ga0210000_1004547 Ga0210000_10045473 156
679 3300027471 Ga0209995_1000491 Ga0209995_10004917 156
680 3300027512 Ga0209179_1000305 Ga0209179_10003056 156
681 3300027543 Ga0209999_1006836 Ga0209999_10068362 156
682 3300027614 Ga0209970_1010143 Ga0209970_10101433 156
683 3300027671 Ga0209588_1024436 Ga0209588_10244362 156
684 3300027671 Ga0209588_1042178 Ga0209588_10421782 156
685 3300027682 Ga0209971_1015938 Ga0209971_10159383 156
686 3300027876 Ga0209974_10001876 Ga0209974_100018769 156
687 3300027907 Ga0207428_10003173 Ga0207428_1000317310 156
688 3300028379 Ga0268266_10008012 Ga0268266_1000801210 156
689 3300028379 Ga0268266_10198834 Ga0268266_101988342 156
690 3300028381 Ga0268264_10028221 Ga0268264_100282214 156
691 3300028381 Ga0268264_10061543 Ga0268264_100615433 156
692 3300028794 Ga0307515_10017116 Ga0307515_100171166 156
693 3300031241 Ga0265325_10003550 Ga0265325_1000355012 156
694 3300031241 Ga0265325_10050077 Ga0265325_100500773 156
695 3300031251 Ga0265327_10034992 Ga0265327_100349924 156
696 3300031456 Ga0307513_10000029 Ga0307513_10000029160 156
697 3300031548 Ga0307408_100436312 Ga0307408_1004363122 156
698 3300031730 Ga0307516_10000303 Ga0307516_1000030345 156
699 3300032133 Ga0316583_10001434 Ga0316583_100014347 156
700 3300033179 Ga0307507_10022145 Ga0307507_100221455 156
701 3300035083 Ga0373926_0047206 Ga0373926_0047206_612_1082 156
702 3300035086 Ga0373934_0000473 Ga0373934_0000473_4516_4989 156
703 3300035086 Ga0373934_0008715 Ga0373934_0008715_1963_2433 156
704 3300035111 Ga0373923_0005607 Ga0373923_0005607_504_974 156
705 3300035113 Ga0373936_0091754 Ga0373936_0091754_704_1183 156
706 3300035116 Ga0373945_0015047 Ga0373945_0015047_1476_1946 156
707 3300035116 Ga0373945_0147620 Ga0373945_0147620_241_711 156
708 3300035116 Ga0373945_0256122 Ga0373945_0256122_138_608 156
709 3300035117 Ga0373953_0084590 Ga0373953_0084590_829_1299 156
710 3300035118 Ga0373954_0002521 Ga0373954_0002521_685_1158 156
711 3300035118 Ga0373954_0024323 Ga0373954_0024323_1227_1697 156
712 3300035119 Ga0373956_0000957 Ga0373956_0000957_5048_5521 156
713 3300035119 Ga0373956_0088654 Ga0373956_0088654_167_637 156
714 3300035119 Ga0373956_0095263 Ga0373956_0095263_496_966 156
715 3300035120 Ga0373957_0005485 Ga0373957_0005485_2417_2887 156
716 3300035170 Ga0373943_0018692 Ga0373943_0018692_1333_1803 156
717 3300035171 Ga0373946_0055723 Ga0373946_0055723_797_1267 156
718 3300035171 Ga0373946_0232834 Ga0373946_0232834_250_720 156
719 3300035172 Ga0373955_0006355 Ga0373955_0006355_4126_4596 156
720 3300035172 Ga0373955_0433017 Ga0373955_0433017_269_742 156
721 3300035172 Ga0373955_0572070 Ga0373955_0572070_16_486 156
722 3300035398 Ga0316574_0800008 Ga0316574_0800008_40_513 156
723 3300035410 Ga0373924_0039528 Ga0373924_0039528_364_834 156
724 3300035692 Ga0373935_0015505 Ga0373935_0015505_671_1141 156
725 3300035692 Ga0373935_0029012 Ga0373935_0029012_312_791 156
726 3300035692 Ga0373935_0120482 Ga0373935_0120482_612_1082 156
727 3300035695 Ga0373927_0006948 Ga0373927_0006948_591_1070 156
728 3300035695 Ga0373927_0019634 Ga0373927_0019634_1873_2400 156
729 3300035695 Ga0373927_0051639 Ga0373927_0051639_1588_2058 156
730 3300035695 Ga0373927_0598130 Ga0373927_0598130_80_556 156
731 3300035724 Ga0373933_0000611 Ga0373933_0000611_16536_17009 156
732 3300035724 Ga0373933_0026162 Ga0373933_0026162_1192_1662 156
733 3300035724 Ga0373933_0232352 Ga0373933_0232352_595_1068 156
734 3300035725 Ga0373947_0037736 Ga0373947_0037736_568_1038 156
735 3300035725 Ga0373947_0351225 Ga0373947_0351225_113_583 156
736 3300035725 Ga0373947_0584075 Ga0373947_0584075_202_672 156
737 3300036401 Ga0373937_0003380 Ga0373937_0003380_8003_8476 156
738 3300036401 Ga0373937_0046469 Ga0373937_0046469_3264_3734 156
739 3300036401 Ga0373937_0403794 Ga0373937_0403794_658_1128 156
740 3300036712 Ga0316584_0071932 Ga0316584_0071932_286_759 156
741 3300037068 Ga0373925_0014584 Ga0373925_0014584_2448_2927 156
742 3300037068 Ga0373925_0036052 Ga0373925_0036052_1567_2037 156
743 3300037068 Ga0373925_0037105 Ga0373925_0037105_2854_3324 156
744 3300037068 Ga0373925_0089328 Ga0373925_0089328_1719_2189 156
745 3300037068 Ga0373925_0095569 Ga0373925_0095569_1779_2249 156
746 3300039437 Ga0436365_1616668 Ga0436365_1616668_5578_6159 156
747 3300039447 Ga0436361_0145606 Ga0436361_0145606_768_1256 156
748 3300039447 Ga0436361_0608475 Ga0436361_0608475_1635_2135 156
749 3300039447 Ga0436361_0632156 Ga0436361_0632156_17220_17708 156
750 3300039447 Ga0436361_0644637 Ga0436361_0644637_194_697 156
751 3300039447 Ga0436361_1108147 Ga0436361_1108147_7128_7628 156
752 3300041413 Ga0439465_0118026 Ga0439465_0118026_97_570 156
753 3300041460 Ga0451802_0735006 Ga0451802_0735006_174_668 156
754 3300041463 Ga0451804_0176278 Ga0451804_0176278_51_527 156
755 3300041511 Ga0451855_0297688 Ga0451855_0297688_1186_1659 156
756 3300042435 Ga0439434_0345487 Ga0439434_0345487_22_498 156
757 3300042439 Ga0439464_0170877 Ga0439464_0170877_146_628 156
758 3300042876 Ga0451577_0488364 Ga0451577_0488364_255_731 156
759 3300042876 Ga0451577_1166407 Ga0451577_1166407_103_588 156
760 3300042993 Ga0439440_0136234 Ga0439440_0136234_89_565 156
761 3300044656 Ga0466969_0014206 Ga0466969_0014206_1023_1661 156
762 3300044656 Ga0466969_0019480 Ga0466969_0019480_2202_2708 156
763 3300044668 Ga0466980_0179596 Ga0466980_0179596_785_1360 156
764 3300044673 Ga0453683_0130728 Ga0453683_0130728_329_808 156
765 3300044683 Ga0466965_0071872 Ga0466965_0071872_288_761 156
766 3300044683 Ga0466965_0767703 Ga0466965_0767703_34_540 156
767 3300044684 Ga0466966_0010001 Ga0466966_0010001_1161_1799 156
768 3300044693 Ga0466961_0001479 Ga0466961_0001479_2185_2691 156
769 3300044693 Ga0466961_0018442 Ga0466961_0018442_2986_3624 156
770 3300044712 Ga0453684_0000014 Ga0453684_0000014_745054_745533 156
771 3300044712 Ga0453684_0000566 Ga0453684_0000566_29556_30026 156
772 3300044712 Ga0453684_0001602 Ga0453684_0001602_18645_19124 156
773 3300044712 Ga0453684_0003881 Ga0453684_0003881_19450_19929 156
774 3300044712 Ga0453684_1785371 Ga0453684_1785371_133_612 156
775 3300044765 Ga0466970_0029628 Ga0466970_0029628_655_1293 156
776 3300044842 Ga0466957_0069405 Ga0466957_0069405_797_1270 156
777 3300045049 Ga0466959_0001388 Ga0466959_0001388_6393_7031 156
778 3300045049 Ga0466959_0030981 Ga0466959_0030981_35_541 156
779 3300045049 Ga0466959_0076196 Ga0466959_0076196_1882_2388 156
780 3300045051 Ga0451576_0000313 Ga0451576_0000313_19262_19741 156
781 3300045976 Ga0466967_1486977 Ga0466967_1486977_122_595 156
782 3300046454 Ga0495592_0113429 Ga0495592_0113429_215_688 156
783 3300046462 Ga0495651_0000274 Ga0495651_0000274_8917_9390 156
784 3300046462 Ga0495651_0099703 Ga0495651_0099703_791_1261 156
785 3300046463 Ga0495653_0042203 Ga0495653_0042203_2802_3272 156
786 3300046472 Ga0495580_0026400 Ga0495580_0026400_1290_1760 156
787 3300046473 Ga0495582_0040091 Ga0495582_0040091_1530_2000 156
788 3300046473 Ga0495582_0055742 Ga0495582_0055742_935_1405 156
789 3300046476 Ga0495662_0121474 Ga0495662_0121474_565_1035 156
790 3300046477 Ga0495664_0009419 Ga0495664_0009419_142_612 156
791 3300046516 Ga0495628_0019972 Ga0495628_0019972_2840_3313 156
792 3300046516 Ga0495628_0190111 Ga0495628_0190111_374_844 156
793 3300046517 Ga0495630_0301730 Ga0495630_0301730_564_1034 156
794 3300046531 Ga0495665_0031800 Ga0495665_0031800_1393_1863 156
795 3300046531 Ga0495665_0102904 Ga0495665_0102904_68_538 156
796 3300046533 Ga0495640_0077917 Ga0495640_0077917_1432_1902 156
797 3300046535 Ga0495586_0168594 Ga0495586_0168594_618_1088 156
798 3300046536 Ga0495587_0064444 Ga0495587_0064444_1366_1836 156
799 3300046536 Ga0495587_0333263 Ga0495587_0333263_109_582 156
800 3300046539 Ga0495621_0043624 Ga0495621_0043624_261_731 156
801 3300046543 Ga0495645_0000247 Ga0495645_0000247_34125_34598 156
802 3300046543 Ga0495645_0266309 Ga0495645_0266309_586_1056 156
803 3300046543 Ga0495645_0282302 Ga0495645_0282302_258_728 156
804 3300046559 Ga0495667_0076342 Ga0495667_0076342_574_1044 156
805 3300046559 Ga0495667_0331651 Ga0495667_0331651_141_614 156
806 3300046663 Ga0495635_0013237 Ga0495635_0013237_3624_4094 156
807 3300046663 Ga0495635_0381952 Ga0495635_0381952_210_686 156
808 3300046675 Ga0495657_0104613 Ga0495657_0104613_488_958 156
809 3300046675 Ga0495657_0126857 Ga0495657_0126857_831_1304 156
810 3300046681 Ga0495647_0011345 Ga0495647_0011345_2129_2599 156
811 3300046681 Ga0495647_0022683 Ga0495647_0022683_669_1139 156
812 3300046683 Ga0495658_0035942 Ga0495658_0035942_1624_2094 156
813 3300046683 Ga0495658_0060732 Ga0495658_0060732_925_1395 156
814 3300046689 Ga0495613_0259707 Ga0495613_0259707_464_934 156
815 3300047315 Ga0495581_0003832 Ga0495581_0003832_1368_1838 156
816 3300047317 Ga0495604_0683038 Ga0495604_0683038_109_582 156
817 3300047319 Ga0495674_0039081 Ga0495674_0039081_2343_2813 156
818 3300047322 Ga0495680_0109999 Ga0495680_0109999_1420_1890 156
819 3300047322 Ga0495680_0139771 Ga0495680_0139771_150_623 156
820 3300047322 Ga0495680_0257151 Ga0495680_0257151_329_802 156
821 3300047444 Ga0495675_0063141 Ga0495675_0063141_13_483 156
822 3300047445 Ga0495677_0110185 Ga0495677_0110185_458_928 156
823 3300047471 Ga0495684_0025419 Ga0495684_0025419_2692_3162 156
824 3300047471 Ga0495684_0452761 Ga0495684_0452761_165_635 156
825 3300048089 Ga0495614_0008587 Ga0495614_0008587_3156_3626 156
826 3300048903 Ga0496100_0030650 Ga0496100_0030650_1496_1966 156
827 3300048904 Ga0496101_0026167 Ga0496101_0026167_241_711 156
828 3300048905 Ga0496102_0062616 Ga0496102_0062616_25_495 156
829 3300048905 Ga0496102_0253850 Ga0496102_0253850_66_587 156
830 3300048906 Ga0496103_0052493 Ga0496103_0052493_691_1161 156
831 3300048908 Ga0496105_0001094 Ga0496105_0001094_12973_13443 156
832 3300048909 Ga0496106_0585094 Ga0496106_0585094_396_866 156
833 3300048910 Ga0496107_0063175 Ga0496107_0063175_1725_2195 156
834 3300048912 Ga0496109_0021225 Ga0496109_0021225_1609_2079 156
835 3300048915 Ga0496112_0054119 Ga0496112_0054119_3109_3579 156
836 3300048915 Ga0496112_0059588 Ga0496112_0059588_2405_2875 156
837 3300048917 Ga0496114_0043224 Ga0496114_0043224_2230_2700 156
838 3300048919 Ga0496116_0068850 Ga0496116_0068850_366_887 156
839 3300048920 Ga0496117_0009792 Ga0496117_0009792_5513_6013 156
840 3300048921 Ga0496118_0011294 Ga0496118_0011294_3576_4076 156
841 3300048922 Ga0496119_0035656 Ga0496119_0035656_2343_2843 156
842 3300049575 Ga0501039_0427389 Ga0501039_0427389_464_943 156
843 3300049583 Ga0501067_0060185 Ga0501067_0060185_1430_1951 156
844 3300049588 Ga0501072_0746572 Ga0501072_0746572_51_530 156
845 3300049592 Ga0501076_0630741 Ga0501076_0630741_109_588 156
846 3300049743 Ga0501081_0182101 Ga0501081_0182101_784_1263 156
847 3300049822 Ga0501035_0029965 Ga0501035_0029965_2393_2899 156
848 3300049823 Ga0501044_0000316 Ga0501044_0000316_14191_14697 156
849 3300050489 nmdc:mga03683_31474_c1 nmdc:mga03683_31474_c1_1358_1966 156
850 3300050490 nmdc:mga03n38_3166_c1 nmdc:mga03n38_3166_c1_1857_2465 156
851 3300050491 nmdc:mga00v17_14509_c1 nmdc:mga00v17_14509_c1_2906_3514 156
852 3300050492 nmdc:mga0yw44_18844_c1 nmdc:mga0yw44_18844_c1_1257_1844 156
853 3300050492 nmdc:mga0yw44_74869_c1 nmdc:mga0yw44_74869_c1_616_1224 156
854 3300050493 nmdc:mga0k408_27521_c1 nmdc:mga0k408_27521_c1_1768_2262 156
855 3300050493 nmdc:mga0k408_57744_c1 nmdc:mga0k408_57744_c1_1606_2097 156
856 3300050493 nmdc:mga0k408_7709_c1 nmdc:mga0k408_7709_c1_3430_4038 156
857 3300050494 nmdc:mga06z11_16232_c1 nmdc:mga06z11_16232_c1_1037_1645 156
858 3300050495 nmdc:mga04h51_1623_c1 nmdc:mga04h51_1623_c1_1857_2465 156
859 3300050496 nmdc:mga07m45_5925_c1 nmdc:mga07m45_5925_c1_2345_2836 156
860 3300050508 nmdc:mga09592_2590_c1 nmdc:mga09592_2590_c1_1048_1524 156
861 3300050510 nmdc:mga06r32_13628_c1 nmdc:mga06r32_13628_c1_6651_7130 156
862 3300050511 nmdc:mga08y16_1731_c1 nmdc:mga08y16_1731_c1_1679_2155 156
863 3300050512 nmdc:mga0n895_221841_c1 nmdc:mga0n895_221841_c1_905_1381 156
864 3300050512 nmdc:mga0n895_32773_c1 nmdc:mga0n895_32773_c1_2662_3180 156
865 3300050512 nmdc:mga0n895_836098_c1 nmdc:mga0n895_836098_c1_106_621 156
866 3300050513 nmdc:mga0rr50_11221_c1 nmdc:mga0rr50_11221_c1_1200_1718 156
867 3300050514 nmdc:mga08x19_72605_c1 nmdc:mga08x19_72605_c1_645_1163 156
868 3300050515 nmdc:mga0a205_49685_c1 nmdc:mga0a205_49685_c1_433_951 156
869 3300050516 nmdc:mga0sz30_45207_c1 nmdc:mga0sz30_45207_c1_459_1067 156
870 3300053078 Ga0495612_0011990 Ga0495612_0011990_1282_1752 156
871 3300053084 Ga0495595_0088431 Ga0495595_0088431_280_750 156
872 3300053085 Ga0495619_0060518 Ga0495619_0060518_1540_2010 156
873 3300053118 Ga0500594_0024036 Ga0500594_0024036_481_1089 156
874 3300053161 Ga0500634_0002968 Ga0500634_0002968_4139_4690 156
875 3300053178 Ga0500637_0155049 Ga0500637_0155049_630_1235 156
876 3300059424 Ga0590075_041710 Ga0590075_041710_336_827 156
877 3300059506 Ga0587085_067875 Ga0587085_067875_168_641 156
878 3300059510 Ga0587090_047069 Ga0587090_047069_217_690 156
879 3300060346 Ga0587111_0039696 Ga0587111_0039696_312_785 156
880 3300060353 Ga0501082_0183353 Ga0501082_0183353_1012_1491 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02470

MlaD

MlaD protein

34

112

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uw8-assembly1.cif.gz_B structure of e. coli mce protein mlad, core mce domain 0.9668 38 133
5uw8-assembly1.cif.gz_D structure of e. coli mce protein mlad, core mce domain 0.9649 39 134
5uw8-assembly1.cif.gz_G structure of e. coli mce protein mlad, core mce domain 0.9637 39 134
5uw2-assembly1.cif.gz_A-2 structure of e. coli mce protein mlad, periplasmic domain 0.9403 38 146
5uw8-assembly1.cif.gz_B structure of e. coli mce protein mlad, core mce domain 0.9382 38 133
ID Description Score Start End Superfamily
af_O53969_38_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9739 38 116 2.40.50.140
af_O53969_38_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9617 38 116 2.40.50.140
af_P64604_38_117_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9587 38 116 2.30.30.60
af_O07787_38_113_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9559 38 116 2.40.50.140
af_O53971_37_112_2.40.30.170 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Efflux pump adaptor protein, beta barrel domain 0.9546 39 116 2.40.30.170
ID Description Score Start End GO Terms
AF-A0A1E7H0D0-F1-model_v4 Outer membrane lipid asymmetry maintenance protein MlaD 0.9698 42 146 GO:0005543
GO:0005548
AF-A0A1A9VJV1-F1-model_v4 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 0.9549 35 149 GO:0005743
GO:0032981
AF-A0A836VLA8-F1-model_v4 MCE family protein 0.9483 38 147
AF-A0A378Z6D7-F1-model_v4 deleted 0.9478 15 156
AF-A0A5C7PNS0-F1-model_v4 Outer membrane lipid asymmetry maintenance protein MlaD 0.9462 16 150 GO:0005543
GO:0005548

Feature Viewer

pLDDT pTM Quality
89.82 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map