F484505
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 880 | 399 | 872 | 158 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2881927736|2881929864 |
| Length | 186 |
| Sequence | KTDFWVGLFVVLGAMALVFLALQAGNMNSFSFAPTYKVQAHFDNLGGLKVRAPVKSSGVVVGRVASIGFDNERFQAVATLELEQQYNFPSDSSASILTSGLLGEQYIGLTPGGEDKMLEQNSEIQYTQSAVVLEELISKFLYSSASNQGTASSDPAAAPPVSTEHNSIKPDVTAGPESIPAPASKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 2 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 3 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 4 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 5 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 6 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 7 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 8 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 238 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 242 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 249 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 250 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 251 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 274 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 275 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 279 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 280 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 281 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 282 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 283 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 284 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 285 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 286 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 287 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 288 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 289 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 290 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 291 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 292 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 293 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 294 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 295 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 296 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 297 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 343 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 359 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 360 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 361 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 362 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 379 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 393 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 394 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 395 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 396 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.75 |
| Metatranscriptomes | 0.34 |
| Isolates | 0.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5 |
| Nodule | 0.11 |
| Rhizoplane | 3.07 |
| Rhizosphere | 88.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000325 | 3300001979 | Bacteria | 20261 |
| 2 | JGI25156J39149_1003651 | 3300002705 | Bacteria | 4951 |
| 3 | JGI25154J39366_1002218 | 3300002738 | Bacteria | 5353 |
| 4 | JGI25157J39369_1013572 | 3300002741 | Bacteria | 1023 |
| 5 | Ga0055538_1005033 | 3300003751 | Bacteria | 1411 |
| 6 | Ga0055539_1011770 | 3300003752 | Bacteria | 1076 |
| 7 | Ga0055533_1002375 | 3300003756 | Bacteria | 4306 |
| 8 | Ga0055542_1000632 | 3300003762 | Bacteria | 29602 |
| 9 | Ga0055541_1000952 | 3300003841 | Bacteria | 6828 |
| 10 | Ga0065704_10543945 | 3300005289 | Bacteria | 639 |
| 11 | Ga0065712_10114968 | 3300005290 | Unclassified | 1759 |
| 12 | Ga0065715_10198640 | 3300005293 | Bacteria | 1374 |
| 13 | Ga0065715_10216561 | 3300005293 | Bacteria | 1290 |
| 14 | Ga0065707_10083651 | 3300005295 | Bacteria | 8537 |
| 15 | Ga0065707_10541434 | 3300005295 | Bacteria | 727 |
| 16 | Ga0065707_10643680 | 3300005295 | Bacteria | 667 |
| 17 | Ga0070658_10497416 | 3300005327 | Bacteria | 1053 |
| 18 | Ga0070676_10004210 | 3300005328 | Bacteria | 7558 |
| 19 | Ga0070676_10309308 | 3300005328 | Bacteria | 1074 |
| 20 | Ga0070690_100003769 | 3300005330 | Bacteria | 8351 |
| 21 | Ga0070690_100229321 | 3300005330 | Bacteria | 1305 |
| 22 | Ga0070670_100013210 | 3300005331 | Bacteria | 7073 |
| 23 | Ga0070670_100014420 | 3300005331 | Bacteria | 6782 |
| 24 | Ga0070670_100125706 | 3300005331 | Bacteria | 2213 |
| 25 | Ga0070670_100206893 | 3300005331 | Bacteria | 1706 |
| 26 | Ga0070670_100280835 | 3300005331 | Bacteria | 1454 |
| 27 | Ga0070670_100327517 | 3300005331 | Bacteria | 1343 |
| 28 | Ga0070677_10020266 | 3300005333 | Bacteria | 2420 |
| 29 | Ga0070677_10050860 | 3300005333 | Bacteria | 1675 |
| 30 | Ga0070677_10053359 | 3300005333 | Bacteria | 1643 |
| 31 | Ga0068869_100000356 | 3300005334 | Bacteria | 24579 |
| 32 | Ga0068869_100084360 | 3300005334 | Bacteria | 2377 |
| 33 | Ga0068869_100093325 | 3300005334 | Bacteria | 2267 |
| 34 | Ga0068869_100478168 | 3300005334 | Bacteria | 1037 |
| 35 | Ga0070666_10006099 | 3300005335 | Bacteria | 7408 |
| 36 | Ga0070666_10032196 | 3300005335 | Bacteria | 3462 |
| 37 | Ga0070666_10909983 | 3300005335 | Bacteria | 651 |
| 38 | Ga0070680_100289763 | 3300005336 | Bacteria | 1387 |
| 39 | Ga0070682_100080768 | 3300005337 | Bacteria | 2103 |
| 40 | Ga0068868_100008239 | 3300005338 | Bacteria | 7460 |
| 41 | Ga0068868_100021435 | 3300005338 | Bacteria | 4865 |
| 42 | Ga0068868_100044231 | 3300005338 | Bacteria | 3481 |
| 43 | Ga0070660_100278067 | 3300005339 | Bacteria | 1369 |
| 44 | Ga0070660_100365428 | 3300005339 | Bacteria | 1190 |
| 45 | Ga0070689_100000418 | 3300005340 | Bacteria | 25038 |
| 46 | Ga0070689_100364738 | 3300005340 | Bacteria | 1214 |
| 47 | Ga0070691_10224301 | 3300005341 | Bacteria | 997 |
| 48 | Ga0070691_10267840 | 3300005341 | Bacteria | 922 |
| 49 | Ga0070661_100262318 | 3300005344 | Bacteria | 1336 |
| 50 | Ga0070661_100838493 | 3300005344 | Bacteria | 756 |
| 51 | Ga0070692_10011872 | 3300005345 | Bacteria | 4016 |
| 52 | Ga0070668_100008431 | 3300005347 | Bacteria | 7654 |
| 53 | Ga0070668_100025855 | 3300005347 | Bacteria | 4452 |
| 54 | Ga0070668_100060850 | 3300005347 | Bacteria | 2925 |
| 55 | Ga0070668_100088308 | 3300005347 | Bacteria | 2440 |
| 56 | Ga0070668_100162744 | 3300005347 | Bacteria | 1811 |
| 57 | Ga0070669_100015544 | 3300005353 | Bacteria | 5426 |
| 58 | Ga0070669_100016089 | 3300005353 | Bacteria | 5335 |
| 59 | Ga0070675_100014034 | 3300005354 | Bacteria | 6309 |
| 60 | Ga0070675_100355068 | 3300005354 | Bacteria | 1301 |
| 61 | Ga0070675_100906411 | 3300005354 | Bacteria | 808 |
| 62 | Ga0070671_100053947 | 3300005355 | Bacteria | 3341 |
| 63 | Ga0070671_100093539 | 3300005355 | Bacteria | 2519 |
| 64 | Ga0070671_100181219 | 3300005355 | Bacteria | 1783 |
| 65 | Ga0070671_100205370 | 3300005355 | Bacteria | 1671 |
| 66 | Ga0070671_100686455 | 3300005355 | Bacteria | 888 |
| 67 | Ga0070674_100007493 | 3300005356 | Bacteria | 6439 |
| 68 | Ga0070674_100036516 | 3300005356 | Bacteria | 3299 |
| 69 | Ga0070674_100140661 | 3300005356 | Bacteria | 1811 |
| 70 | Ga0070673_100003912 | 3300005364 | Bacteria | 9359 |
| 71 | Ga0070673_100006782 | 3300005364 | Bacteria | 7476 |
| 72 | Ga0070673_100038869 | 3300005364 | Bacteria | 3637 |
| 73 | Ga0070673_100407036 | 3300005364 | Bacteria | 1217 |
| 74 | Ga0070673_100418069 | 3300005364 | Bacteria | 1201 |
| 75 | Ga0070688_100020748 | 3300005365 | Bacteria | 3826 |
| 76 | Ga0070688_100114945 | 3300005365 | Bacteria | 1795 |
| 77 | Ga0070688_100133890 | 3300005365 | Unclassified | 1675 |
| 78 | Ga0070688_100586219 | 3300005365 | Bacteria | 852 |
| 79 | Ga0070659_100100299 | 3300005366 | Bacteria | 2330 |
| 80 | Ga0070659_100208654 | 3300005366 | Bacteria | 1609 |
| 81 | Ga0070659_100554551 | 3300005366 | Bacteria | 984 |
| 82 | Ga0070659_100608504 | 3300005366 | Unclassified | 939 |
| 83 | Ga0070667_100001403 | 3300005367 | Bacteria | 21557 |
| 84 | Ga0070667_100002052 | 3300005367 | Bacteria | 17830 |
| 85 | Ga0070667_100113710 | 3300005367 | Bacteria | 2349 |
| 86 | Ga0070667_100173446 | 3300005367 | Bacteria | 1905 |
| 87 | Ga0070667_100219123 | 3300005367 | Bacteria | 1693 |
| 88 | Ga0070667_100353905 | 3300005367 | Bacteria | 1330 |
| 89 | Ga0070714_100000984 | 3300005435 | Bacteria | 20360 |
| 90 | Ga0070714_100044899 | 3300005435 | Bacteria | 3743 |
| 91 | Ga0070713_100009007 | 3300005436 | Bacteria | 7114 |
| 92 | Ga0070713_100051287 | 3300005436 | Bacteria | 3411 |
| 93 | Ga0070710_10008238 | 3300005437 | Bacteria | 5072 |
| 94 | Ga0070701_10166103 | 3300005438 | Bacteria | 1282 |
| 95 | Ga0070711_100000407 | 3300005439 | Bacteria | 22299 |
| 96 | Ga0070711_100429435 | 3300005439 | Bacteria | 1078 |
| 97 | Ga0070705_100020267 | 3300005440 | Bacteria | 3515 |
| 98 | Ga0070705_100296477 | 3300005440 | Bacteria | 1157 |
| 99 | Ga0070700_100432683 | 3300005441 | Bacteria | 997 |
| 100 | Ga0070700_100536992 | 3300005441 | Bacteria | 906 |
| 101 | Ga0070700_100938336 | 3300005441 | Bacteria | 707 |
| 102 | Ga0070694_100012031 | 3300005444 | Bacteria | 5372 |
| 103 | Ga0070694_100033886 | 3300005444 | Bacteria | 3365 |
| 104 | Ga0070694_100167543 | 3300005444 | Bacteria | 1616 |
| 105 | Ga0070694_100306660 | 3300005444 | Bacteria | 1218 |
| 106 | Ga0070708_100153791 | 3300005445 | Bacteria | 2140 |
| 107 | Ga0070663_100097236 | 3300005455 | Bacteria | 2192 |
| 108 | Ga0070678_100007067 | 3300005456 | Bacteria | 6635 |
| 109 | Ga0070678_100068344 | 3300005456 | Bacteria | 2648 |
| 110 | Ga0070678_100133070 | 3300005456 | Bacteria | 1979 |
| 111 | Ga0070678_100927774 | 3300005456 | Bacteria | 797 |
| 112 | Ga0070678_101146787 | 3300005456 | Bacteria | 719 |
| 113 | Ga0070662_100028893 | 3300005457 | Bacteria | 3865 |
| 114 | Ga0070662_100299094 | 3300005457 | Bacteria | 1307 |
| 115 | Ga0068867_100007434 | 3300005459 | Bacteria | 7747 |
| 116 | Ga0068867_100014508 | 3300005459 | Bacteria | 5585 |
| 117 | Ga0068867_100027509 | 3300005459 | Bacteria | 4087 |
| 118 | Ga0068867_100172174 | 3300005459 | Bacteria | 1715 |
| 119 | Ga0068867_100210028 | 3300005459 | Bacteria | 1563 |
| 120 | Ga0068867_100271461 | 3300005459 | Bacteria | 1387 |
| 121 | Ga0068867_102149421 | 3300005459 | Bacteria | 529 |
| 122 | Ga0070685_10005507 | 3300005466 | Bacteria | 6417 |
| 123 | Ga0070685_10229917 | 3300005466 | Bacteria | 1219 |
| 124 | Ga0070706_100023284 | 3300005467 | Bacteria | 5706 |
| 125 | Ga0070706_100032816 | 3300005467 | Bacteria | 4790 |
| 126 | Ga0070706_100097029 | 3300005467 | Bacteria | 2737 |
| 127 | Ga0070707_100059646 | 3300005468 | Bacteria | 3659 |
| 128 | Ga0070707_100197706 | 3300005468 | Bacteria | 1960 |
| 129 | Ga0070707_100310245 | 3300005468 | Bacteria | 1533 |
| 130 | Ga0070698_100009607 | 3300005471 | Bacteria | 10348 |
| 131 | Ga0070699_100007236 | 3300005518 | Bacteria | 9655 |
| 132 | Ga0070699_100063681 | 3300005518 | Bacteria | 3197 |
| 133 | Ga0070679_100116684 | 3300005530 | Bacteria | 2654 |
| 134 | Ga0070684_100066692 | 3300005535 | Bacteria | 3159 |
| 135 | Ga0070697_100019753 | 3300005536 | Bacteria | 5323 |
| 136 | Ga0070697_100079832 | 3300005536 | Bacteria | 2694 |
| 137 | Ga0068853_100086673 | 3300005539 | Bacteria | 2746 |
| 138 | Ga0068853_100404684 | 3300005539 | Bacteria | 1278 |
| 139 | Ga0068853_100849380 | 3300005539 | Bacteria | 876 |
| 140 | Ga0070672_100012906 | 3300005543 | Bacteria | 5887 |
| 141 | Ga0070672_100062364 | 3300005543 | Bacteria | 2942 |
| 142 | Ga0070672_100177390 | 3300005543 | Bacteria | 1774 |
| 143 | Ga0070672_100276586 | 3300005543 | Bacteria | 1418 |
| 144 | Ga0070672_100363412 | 3300005543 | Bacteria | 1236 |
| 145 | Ga0070672_100650613 | 3300005543 | Bacteria | 920 |
| 146 | Ga0070686_100005296 | 3300005544 | Bacteria | 7129 |
| 147 | Ga0070695_100042420 | 3300005545 | Bacteria | 2888 |
| 148 | Ga0070695_100380437 | 3300005545 | Bacteria | 1065 |
| 149 | Ga0070696_100114013 | 3300005546 | Bacteria | 1949 |
| 150 | Ga0070696_100142851 | 3300005546 | Bacteria | 1751 |
| 151 | Ga0070696_100240205 | 3300005546 | Bacteria | 1366 |
| 152 | Ga0070693_100003898 | 3300005547 | Bacteria | 6999 |
| 153 | Ga0070693_100337781 | 3300005547 | Bacteria | 1027 |
| 154 | Ga0070693_100430502 | 3300005547 | Bacteria | 921 |
| 155 | Ga0070693_100576214 | 3300005547 | Bacteria | 809 |
| 156 | Ga0070665_100003736 | 3300005548 | Bacteria | 16125 |
| 157 | Ga0070665_100164457 | 3300005548 | Bacteria | 2221 |
| 158 | Ga0070665_100357321 | 3300005548 | Bacteria | 1467 |
| 159 | Ga0070665_100574790 | 3300005548 | Bacteria | 1140 |
| 160 | Ga0070665_101240370 | 3300005548 | Bacteria | 756 |
| 161 | Ga0070704_100001376 | 3300005549 | Bacteria | 12909 |
| 162 | Ga0070704_100056923 | 3300005549 | Bacteria | 2778 |
| 163 | Ga0070704_100286482 | 3300005549 | Bacteria | 1367 |
| 164 | Ga0068855_100025951 | 3300005563 | Bacteria | 7010 |
| 165 | Ga0068855_100162956 | 3300005563 | Bacteria | 2530 |
| 166 | Ga0068855_100293384 | 3300005563 | Bacteria | 1802 |
| 167 | Ga0068855_101078131 | 3300005563 | Bacteria | 841 |
| 168 | Ga0070664_100112625 | 3300005564 | Bacteria | 2376 |
| 169 | Ga0070664_100121912 | 3300005564 | Unclassified | 2283 |
| 170 | Ga0070664_101051011 | 3300005564 | Bacteria | 766 |
| 171 | Ga0068857_100020112 | 3300005577 | Bacteria | 5868 |
| 172 | Ga0068854_100001272 | 3300005578 | Bacteria | 15149 |
| 173 | Ga0068854_100178024 | 3300005578 | Bacteria | 1659 |
| 174 | Ga0068856_100082809 | 3300005614 | Bacteria | 3184 |
| 175 | Ga0070702_100035387 | 3300005615 | Bacteria | 2759 |
| 176 | Ga0070702_100150253 | 3300005615 | Bacteria | 1494 |
| 177 | Ga0070702_100767191 | 3300005615 | Bacteria | 742 |
| 178 | Ga0070702_101072560 | 3300005615 | Bacteria | 642 |
| 179 | Ga0068852_100079984 | 3300005616 | Bacteria | 2896 |
| 180 | Ga0068852_100201586 | 3300005616 | Bacteria | 1883 |
| 181 | Ga0068852_100331746 | 3300005616 | Bacteria | 1480 |
| 182 | Ga0068852_100606319 | 3300005616 | Bacteria | 1099 |
| 183 | Ga0068859_100010525 | 3300005617 | Bacteria | 9308 |
| 184 | Ga0068859_100014353 | 3300005617 | Bacteria | 7946 |
| 185 | Ga0068859_100021791 | 3300005617 | Bacteria | 6426 |
| 186 | Ga0068859_100041934 | 3300005617 | Bacteria | 4597 |
| 187 | Ga0068859_100208857 | 3300005617 | Bacteria | 2038 |
| 188 | Ga0068859_100306328 | 3300005617 | Bacteria | 1682 |
| 189 | Ga0068859_100427382 | 3300005617 | Bacteria | 1421 |
| 190 | Ga0068859_100672288 | 3300005617 | Bacteria | 1127 |
| 191 | Ga0068864_100000981 | 3300005618 | Bacteria | 23881 |
| 192 | Ga0068864_100013356 | 3300005618 | Bacteria | 6805 |
| 193 | Ga0068864_100283523 | 3300005618 | Bacteria | 1547 |
| 194 | Ga0068864_100347913 | 3300005618 | Bacteria | 1398 |
| 195 | Ga0068864_100568174 | 3300005618 | Bacteria | 1098 |
| 196 | Ga0068864_102304084 | 3300005618 | Bacteria | 545 |
| 197 | Ga0068866_10002776 | 3300005718 | Bacteria | 7222 |
| 198 | Ga0068866_10118829 | 3300005718 | Bacteria | 1486 |
| 199 | Ga0068866_10128000 | 3300005718 | Bacteria | 1440 |
| 200 | Ga0068866_10174039 | 3300005718 | Bacteria | 1266 |
| 201 | Ga0068861_100013391 | 3300005719 | Bacteria | 5740 |
| 202 | Ga0068861_100037180 | 3300005719 | Bacteria | 3619 |
| 203 | Ga0068861_100541876 | 3300005719 | Bacteria | 1059 |
| 204 | Ga0068861_100825390 | 3300005719 | Bacteria | 872 |
| 205 | Ga0068851_10027126 | 3300005834 | Bacteria | 2821 |
| 206 | Ga0068851_10230248 | 3300005834 | Bacteria | 1044 |
| 207 | Ga0068851_10333592 | 3300005834 | Bacteria | 879 |
| 208 | Ga0068851_10493754 | 3300005834 | Unclassified | 733 |
| 209 | Ga0068870_10078729 | 3300005840 | Bacteria | 1816 |
| 210 | Ga0068870_10095225 | 3300005840 | Unclassified | 1672 |
| 211 | Ga0068863_100000366 | 3300005841 | Bacteria | 45953 |
| 212 | Ga0068863_100004419 | 3300005841 | Bacteria | 13865 |
| 213 | Ga0068863_100059799 | 3300005841 | Bacteria | 3605 |
| 214 | Ga0068863_100107136 | 3300005841 | Bacteria | 2659 |
| 215 | Ga0068863_100242118 | 3300005841 | Bacteria | 1741 |
| 216 | Ga0068863_100361631 | 3300005841 | Bacteria | 1415 |
| 217 | Ga0068863_100534223 | 3300005841 | Bacteria | 1157 |
| 218 | Ga0068863_100742635 | 3300005841 | Bacteria | 977 |
| 219 | Ga0068858_100001946 | 3300005842 | Bacteria | 21056 |
| 220 | Ga0068858_100003588 | 3300005842 | Bacteria | 15356 |
| 221 | Ga0068858_100058632 | 3300005842 | Bacteria | 3560 |
| 222 | Ga0068858_100474109 | 3300005842 | Bacteria | 1207 |
| 223 | Ga0068860_100019348 | 3300005843 | Bacteria | 6605 |
| 224 | Ga0068860_100023185 | 3300005843 | Bacteria | 6001 |
| 225 | Ga0068860_100046386 | 3300005843 | Bacteria | 4143 |
| 226 | Ga0068860_100060219 | 3300005843 | Bacteria | 3608 |
| 227 | Ga0068860_100077510 | 3300005843 | Bacteria | 3161 |
| 228 | Ga0068860_100290492 | 3300005843 | Bacteria | 1600 |
| 229 | Ga0068860_100415583 | 3300005843 | Bacteria | 1333 |
| 230 | Ga0068860_100486307 | 3300005843 | Bacteria | 1231 |
| 231 | Ga0068862_100007718 | 3300005844 | Bacteria | 8898 |
| 232 | Ga0068862_100011362 | 3300005844 | Bacteria | 7352 |
| 233 | Ga0068862_100144386 | 3300005844 | Bacteria | 2114 |
| 234 | Ga0068862_100736020 | 3300005844 | Bacteria | 958 |
| 235 | Ga0075365_10048297 | 3300006038 | Bacteria | 2801 |
| 236 | Ga0075368_10001442 | 3300006042 | Bacteria | 7605 |
| 237 | Ga0075363_100023850 | 3300006048 | Bacteria | 3105 |
| 238 | Ga0075364_10117245 | 3300006051 | Bacteria | 1780 |
| 239 | Ga0075364_10305782 | 3300006051 | Bacteria | 1083 |
| 240 | Ga0070715_10004958 | 3300006163 | Bacteria | 4410 |
| 241 | Ga0070716_100039004 | 3300006173 | Bacteria | 2633 |
| 242 | Ga0070712_100010551 | 3300006175 | Bacteria | 5832 |
| 243 | Ga0070712_100057954 | 3300006175 | Bacteria | 2723 |
| 244 | Ga0070712_100447972 | 3300006175 | Bacteria | 1074 |
| 245 | Ga0075362_10002143 | 3300006177 | Bacteria | 6529 |
| 246 | Ga0075367_10004080 | 3300006178 | Bacteria | 7068 |
| 247 | Ga0075369_10030786 | 3300006186 | Bacteria | 2261 |
| 248 | Ga0075366_10023129 | 3300006195 | Bacteria | 3620 |
| 249 | Ga0075366_10028375 | 3300006195 | Bacteria | 3285 |
| 250 | Ga0075366_10041538 | 3300006195 | Bacteria | 2723 |
| 251 | Ga0097621_100029232 | 3300006237 | Bacteria | 4351 |
| 252 | Ga0097621_100037348 | 3300006237 | Bacteria | 3891 |
| 253 | Ga0097621_100198099 | 3300006237 | Bacteria | 1742 |
| 254 | Ga0097621_100672600 | 3300006237 | Bacteria | 951 |
| 255 | Ga0075370_10000354 | 3300006353 | Bacteria | 16716 |
| 256 | Ga0075370_10090545 | 3300006353 | Bacteria | 1764 |
| 257 | Ga0068871_100014108 | 3300006358 | Bacteria | 5944 |
| 258 | Ga0068871_100028930 | 3300006358 | Bacteria | 4349 |
| 259 | Ga0068871_100132647 | 3300006358 | Bacteria | 2113 |
| 260 | Ga0068871_101738792 | 3300006358 | Bacteria | 592 |
| 261 | Ga0075428_100000089 | 3300006844 | Bacteria | 75097 |
| 262 | Ga0075428_100324335 | 3300006844 | Bacteria | 1655 |
| 263 | Ga0075433_10037026 | 3300006852 | Bacteria | 4206 |
| 264 | Ga0075433_10103037 | 3300006852 | Bacteria | 2528 |
| 265 | Ga0075434_100072309 | 3300006871 | Bacteria | 3441 |
| 266 | Ga0075434_100222563 | 3300006871 | Bacteria | 1907 |
| 267 | Ga0075434_100724688 | 3300006871 | Bacteria | 1012 |
| 268 | Ga0075429_100004777 | 3300006880 | Bacteria | 11670 |
| 269 | Ga0068865_100049867 | 3300006881 | Bacteria | 2889 |
| 270 | Ga0068865_100067648 | 3300006881 | Bacteria | 2524 |
| 271 | Ga0068865_100138902 | 3300006881 | Bacteria | 1830 |
| 272 | Ga0068865_100379199 | 3300006881 | Bacteria | 1153 |
| 273 | Ga0075436_100091180 | 3300006914 | Bacteria | 2119 |
| 274 | Ga0097620_100010526 | 3300006931 | Bacteria | 9308 |
| 275 | Ga0097620_100014355 | 3300006931 | Bacteria | 7946 |
| 276 | Ga0097620_100021791 | 3300006931 | Bacteria | 6426 |
| 277 | Ga0097620_100041932 | 3300006931 | Bacteria | 4597 |
| 278 | Ga0097620_100208869 | 3300006931 | Bacteria | 2038 |
| 279 | Ga0097620_100306314 | 3300006931 | Bacteria | 1682 |
| 280 | Ga0097620_100427365 | 3300006931 | Bacteria | 1421 |
| 281 | Ga0097620_100672185 | 3300006931 | Bacteria | 1127 |
| 282 | Ga0075435_100019130 | 3300007076 | Bacteria | 5221 |
| 283 | Ga0099794_10047706 | 3300007265 | Bacteria | 2054 |
| 284 | Ga0099795_10002497 | 3300007788 | Bacteria | 4344 |
| 285 | Ga0105251_10033989 | 3300009011 | Bacteria | 2527 |
| 286 | Ga0105240_10035226 | 3300009093 | Bacteria | 6452 |
| 287 | Ga0111539_10040592 | 3300009094 | Bacteria | 5601 |
| 288 | Ga0105245_10015183 | 3300009098 | Bacteria | 6709 |
| 289 | Ga0105245_10029140 | 3300009098 | Bacteria | 4875 |
| 290 | Ga0105245_10061915 | 3300009098 | Bacteria | 3375 |
| 291 | Ga0105245_10086123 | 3300009098 | Bacteria | 2881 |
| 292 | Ga0105247_10003683 | 3300009101 | Bacteria | 9946 |
| 293 | Ga0105247_10064056 | 3300009101 | Bacteria | 2283 |
| 294 | Ga0114129_11487541 | 3300009147 | Bacteria | 833 |
| 295 | Ga0105243_10120724 | 3300009148 | Bacteria | 2209 |
| 296 | Ga0105243_10129173 | 3300009148 | Bacteria | 2141 |
| 297 | Ga0105243_10392432 | 3300009148 | Bacteria | 1287 |
| 298 | Ga0105243_10401412 | 3300009148 | Bacteria | 1273 |
| 299 | Ga0105243_11261580 | 3300009148 | Bacteria | 755 |
| 300 | Ga0105241_10007877 | 3300009174 | Bacteria | 7832 |
| 301 | Ga0105241_10125568 | 3300009174 | Bacteria | 2071 |
| 302 | Ga0105241_10612110 | 3300009174 | Bacteria | 985 |
| 303 | Ga0105241_11493905 | 3300009174 | Unclassified | 650 |
| 304 | Ga0105242_10012139 | 3300009176 | Bacteria | 6627 |
| 305 | Ga0105242_10428098 | 3300009176 | Unclassified | 1242 |
| 306 | Ga0105242_10571916 | 3300009176 | Bacteria | 1087 |
| 307 | Ga0105242_10775587 | 3300009176 | Bacteria | 946 |
| 308 | Ga0105248_10001115 | 3300009177 | Bacteria | 29857 |
| 309 | Ga0105248_10021616 | 3300009177 | Bacteria | 7126 |
| 310 | Ga0105248_10053576 | 3300009177 | Bacteria | 4526 |
| 311 | Ga0105248_10220165 | 3300009177 | Bacteria | 2137 |
| 312 | Ga0105248_10358060 | 3300009177 | Bacteria | 1643 |
| 313 | Ga0105248_12172557 | 3300009177 | Bacteria | 631 |
| 314 | Ga0105237_10184058 | 3300009545 | Unclassified | 2089 |
| 315 | Ga0105237_11456812 | 3300009545 | Bacteria | 691 |
| 316 | Ga0105238_10094474 | 3300009551 | Bacteria | 2978 |
| 317 | Ga0105238_10394548 | 3300009551 | Bacteria | 1376 |
| 318 | Ga0105238_10847307 | 3300009551 | Bacteria | 931 |
| 319 | Ga0105238_10871567 | 3300009551 | Bacteria | 918 |
| 320 | Ga0105249_10055830 | 3300009553 | Bacteria | 3615 |
| 321 | Ga0105249_10136486 | 3300009553 | Bacteria | 2348 |
| 322 | Ga0105239_10064179 | 3300010375 | Bacteria | 4031 |
| 323 | Ga0105246_10004097 | 3300011119 | Bacteria | 8848 |
| 324 | Ga0105246_10065272 | 3300011119 | Bacteria | 2545 |
| 325 | Ga0157373_10112346 | 3300013100 | Bacteria | 1915 |
| 326 | Ga0157371_10157396 | 3300013102 | Bacteria | 1622 |
| 327 | Ga0157370_10014165 | 3300013104 | Bacteria | 8175 |
| 328 | Ga0157370_10050446 | 3300013104 | Bacteria | 3977 |
| 329 | Ga0157374_10005148 | 3300013296 | Bacteria | 10967 |
| 330 | Ga0157374_10008385 | 3300013296 | Bacteria | 8826 |
| 331 | Ga0157374_10159531 | 3300013296 | Bacteria | 2197 |
| 332 | Ga0157374_11216300 | 3300013296 | Bacteria | 775 |
| 333 | Ga0157378_10005782 | 3300013297 | Bacteria | 10838 |
| 334 | Ga0157378_10050737 | 3300013297 | Bacteria | 3692 |
| 335 | Ga0157378_10174332 | 3300013297 | Bacteria | 2019 |
| 336 | Ga0157378_10504597 | 3300013297 | Bacteria | 1209 |
| 337 | Ga0157378_10582368 | 3300013297 | Unclassified | 1128 |
| 338 | Ga0157378_11221893 | 3300013297 | Bacteria | 791 |
| 339 | Ga0163162_10025069 | 3300013306 | Bacteria | 5893 |
| 340 | Ga0163162_10064590 | 3300013306 | Bacteria | 3705 |
| 341 | Ga0163162_10289469 | 3300013306 | Bacteria | 1770 |
| 342 | Ga0163162_10863084 | 3300013306 | Bacteria | 1020 |
| 343 | Ga0163162_11546927 | 3300013306 | Bacteria | 756 |
| 344 | Ga0157372_10006135 | 3300013307 | Bacteria | 12775 |
| 345 | Ga0157372_10285662 | 3300013307 | Bacteria | 1919 |
| 346 | Ga0157372_10316358 | 3300013307 | Bacteria | 1817 |
| 347 | Ga0157375_10140435 | 3300013308 | Bacteria | 2542 |
| 348 | Ga0157375_10147814 | 3300013308 | Bacteria | 2482 |
| 349 | Ga0157375_10209481 | 3300013308 | Bacteria | 2106 |
| 350 | Ga0157375_10415281 | 3300013308 | Bacteria | 1512 |
| 351 | Ga0157375_10547847 | 3300013308 | Bacteria | 1319 |
| 352 | Ga0157375_10834489 | 3300013308 | Bacteria | 1069 |
| 353 | Ga0157375_11907163 | 3300013308 | Bacteria | 705 |
| 354 | Ga0163163_10018601 | 3300014325 | Bacteria | 6508 |
| 355 | Ga0163163_10019473 | 3300014325 | Bacteria | 6374 |
| 356 | Ga0163163_12036552 | 3300014325 | Bacteria | 634 |
| 357 | Ga0157380_10414690 | 3300014326 | Bacteria | 1282 |
| 358 | Ga0157380_10889781 | 3300014326 | Bacteria | 916 |
| 359 | Ga0182008_10028058 | 3300014497 | Bacteria | 2848 |
| 360 | Ga0182008_10271996 | 3300014497 | Bacteria | 879 |
| 361 | Ga0157377_10003422 | 3300014745 | Bacteria | 7181 |
| 362 | Ga0157377_10143062 | 3300014745 | Bacteria | 1472 |
| 363 | Ga0157377_10456856 | 3300014745 | Bacteria | 883 |
| 364 | Ga0157379_10009459 | 3300014968 | Bacteria | 8495 |
| 365 | Ga0157379_10019451 | 3300014968 | Bacteria | 5998 |
| 366 | Ga0157379_10029211 | 3300014968 | Bacteria | 4903 |
| 367 | Ga0157379_10094019 | 3300014968 | Bacteria | 2690 |
| 368 | Ga0157379_12026818 | 3300014968 | Bacteria | 569 |
| 369 | Ga0157379_12512901 | 3300014968 | Bacteria | 515 |
| 370 | Ga0157376_10026475 | 3300014969 | Bacteria | 4584 |
| 371 | Ga0157376_10028239 | 3300014969 | Bacteria | 4457 |
| 372 | Ga0157376_10093390 | 3300014969 | Bacteria | 2612 |
| 373 | Ga0157376_10435394 | 3300014969 | Bacteria | 1275 |
| 374 | Ga0157376_10478940 | 3300014969 | Bacteria | 1219 |
| 375 | Ga0163161_10012976 | 3300017792 | Bacteria | 5789 |
| 376 | Ga0163161_10575871 | 3300017792 | Bacteria | 925 |
| 377 | Ga0163161_10976560 | 3300017792 | Bacteria | 722 |
| 378 | Ga0213872_10000532 | 3300021361 | Bacteria | 29832 |
| 379 | Ga0213872_10004390 | 3300021361 | Bacteria | 7506 |
| 380 | Ga0213872_10005558 | 3300021361 | Bacteria | 6455 |
| 381 | Ga0213876_10266176 | 3300021384 | Bacteria | 911 |
| 382 | Ga0209784_100537 | 3300025224 | Bacteria | 13956 |
| 383 | Ga0209566_100235 | 3300025225 | Bacteria | 53611 |
| 384 | Ga0209674_100250 | 3300025226 | Bacteria | 45155 |
| 385 | Ga0209563_103766 | 3300025230 | Bacteria | 3049 |
| 386 | Ga0209258_106236 | 3300025242 | Bacteria | 1896 |
| 387 | Ga0209646_1000119 | 3300025246 | Bacteria | 147427 |
| 388 | Ga0209026_1004177 | 3300025250 | Bacteria | 4415 |
| 389 | Ga0209677_102981 | 3300025253 | Bacteria | 5871 |
| 390 | Ga0209148_1000451 | 3300025254 | Bacteria | 45012 |
| 391 | Ga0209759_1006344 | 3300025256 | Bacteria | 3989 |
| 392 | Ga0209455_1000447 | 3300025272 | Bacteria | 31733 |
| 393 | Ga0209051_1101526 | 3300025303 | Bacteria | 772 |
| 394 | Ga0207697_10014624 | 3300025315 | Bacteria | 3253 |
| 395 | Ga0207656_10042160 | 3300025321 | Bacteria | 1941 |
| 396 | Ga0207656_10082720 | 3300025321 | Bacteria | 1445 |
| 397 | Ga0207656_10276276 | 3300025321 | Bacteria | 828 |
| 398 | Ga0207713_1036244 | 3300025735 | Bacteria | 2118 |
| 399 | Ga0207682_10019707 | 3300025893 | Bacteria | 2643 |
| 400 | Ga0207682_10065180 | 3300025893 | Bacteria | 1533 |
| 401 | Ga0207682_10072956 | 3300025893 | Bacteria | 1457 |
| 402 | Ga0207692_10009535 | 3300025898 | Bacteria | 4060 |
| 403 | Ga0207692_10111139 | 3300025898 | Bacteria | 1520 |
| 404 | Ga0207692_10142830 | 3300025898 | Bacteria | 1363 |
| 405 | Ga0207642_10000532 | 3300025899 | Bacteria | 11649 |
| 406 | Ga0207642_10380857 | 3300025899 | Bacteria | 840 |
| 407 | Ga0207710_10006893 | 3300025900 | Bacteria | 4836 |
| 408 | Ga0207710_10042261 | 3300025900 | Bacteria | 2024 |
| 409 | Ga0207688_10174679 | 3300025901 | Bacteria | 1279 |
| 410 | Ga0207680_10004492 | 3300025903 | Bacteria | 6621 |
| 411 | Ga0207680_10047845 | 3300025903 | Bacteria | 2536 |
| 412 | Ga0207680_10168460 | 3300025903 | Bacteria | 1474 |
| 413 | Ga0207680_10499031 | 3300025903 | Bacteria | 867 |
| 414 | Ga0207680_10815704 | 3300025903 | Bacteria | 669 |
| 415 | Ga0207699_10262319 | 3300025906 | Bacteria | 1194 |
| 416 | Ga0207699_10270118 | 3300025906 | Bacteria | 1178 |
| 417 | Ga0207645_10000353 | 3300025907 | Bacteria | 38206 |
| 418 | Ga0207645_10063743 | 3300025907 | Bacteria | 2355 |
| 419 | Ga0207645_10114291 | 3300025907 | Bacteria | 1749 |
| 420 | Ga0207645_10201921 | 3300025907 | Unclassified | 1308 |
| 421 | Ga0207645_10352083 | 3300025907 | Bacteria | 986 |
| 422 | Ga0207645_10373452 | 3300025907 | Bacteria | 956 |
| 423 | Ga0207643_10040823 | 3300025908 | Bacteria | 2613 |
| 424 | Ga0207643_10681271 | 3300025908 | Unclassified | 664 |
| 425 | Ga0207684_10037180 | 3300025910 | Bacteria | 4131 |
| 426 | Ga0207684_10140723 | 3300025910 | Bacteria | 2074 |
| 427 | Ga0207684_10400161 | 3300025910 | Bacteria | 1180 |
| 428 | Ga0207654_10031392 | 3300025911 | Bacteria | 2925 |
| 429 | Ga0207654_10236136 | 3300025911 | Bacteria | 1220 |
| 430 | Ga0207654_10540660 | 3300025911 | Bacteria | 826 |
| 431 | Ga0207707_10126797 | 3300025912 | Bacteria | 2232 |
| 432 | Ga0207695_10054177 | 3300025913 | Bacteria | 4191 |
| 433 | Ga0207693_10072939 | 3300025915 | Bacteria | 2687 |
| 434 | Ga0207663_10004116 | 3300025916 | Bacteria | 7208 |
| 435 | Ga0207662_10105993 | 3300025918 | Bacteria | 1747 |
| 436 | Ga0207662_10128207 | 3300025918 | Unclassified | 1597 |
| 437 | Ga0207662_10836794 | 3300025918 | Bacteria | 650 |
| 438 | Ga0207657_10000469 | 3300025919 | Bacteria | 42688 |
| 439 | Ga0207657_10214022 | 3300025919 | Bacteria | 1546 |
| 440 | Ga0207649_10378732 | 3300025920 | Bacteria | 1054 |
| 441 | Ga0207646_10039160 | 3300025922 | Bacteria | 4266 |
| 442 | Ga0207646_10076372 | 3300025922 | Bacteria | 2993 |
| 443 | Ga0207646_11085319 | 3300025922 | Bacteria | 705 |
| 444 | Ga0207681_10053876 | 3300025923 | Bacteria | 2732 |
| 445 | Ga0207681_10063520 | 3300025923 | Bacteria | 2546 |
| 446 | Ga0207681_10090251 | 3300025923 | Bacteria | 2187 |
| 447 | Ga0207694_10284818 | 3300025924 | Bacteria | 1358 |
| 448 | Ga0207694_10334152 | 3300025924 | Bacteria | 1252 |
| 449 | Ga0207694_11191781 | 3300025924 | Unclassified | 644 |
| 450 | Ga0207650_10008205 | 3300025925 | Bacteria | 7124 |
| 451 | Ga0207650_10008238 | 3300025925 | Bacteria | 7115 |
| 452 | Ga0207650_10048413 | 3300025925 | Bacteria | 3135 |
| 453 | Ga0207650_10381382 | 3300025925 | Bacteria | 1164 |
| 454 | Ga0207650_10511382 | 3300025925 | Unclassified | 1004 |
| 455 | Ga0207659_10008089 | 3300025926 | Bacteria | 6509 |
| 456 | Ga0207659_10038925 | 3300025926 | Bacteria | 3311 |
| 457 | Ga0207659_10735570 | 3300025926 | Bacteria | 846 |
| 458 | Ga0207687_10003673 | 3300025927 | Bacteria | 10333 |
| 459 | Ga0207687_10021201 | 3300025927 | Bacteria | 4316 |
| 460 | Ga0207687_10069916 | 3300025927 | Bacteria | 2505 |
| 461 | Ga0207687_10422575 | 3300025927 | Bacteria | 1100 |
| 462 | Ga0207700_10000023 | 3300025928 | Bacteria | 152285 |
| 463 | Ga0207700_10011674 | 3300025928 | Bacteria | 5615 |
| 464 | Ga0207700_10022931 | 3300025928 | Bacteria | 4292 |
| 465 | Ga0207700_10149973 | 3300025928 | Bacteria | 1926 |
| 466 | Ga0207664_10007905 | 3300025929 | Bacteria | 7387 |
| 467 | Ga0207664_10156786 | 3300025929 | Bacteria | 1939 |
| 468 | Ga0207664_10165695 | 3300025929 | Bacteria | 1888 |
| 469 | Ga0207644_10042177 | 3300025931 | Bacteria | 3232 |
| 470 | Ga0207644_10074912 | 3300025931 | Bacteria | 2485 |
| 471 | Ga0207644_10406898 | 3300025931 | Bacteria | 1113 |
| 472 | Ga0207644_10776377 | 3300025931 | Unclassified | 801 |
| 473 | Ga0207690_10025592 | 3300025932 | Bacteria | 3708 |
| 474 | Ga0207690_10667290 | 3300025932 | Bacteria | 853 |
| 475 | Ga0207706_10003781 | 3300025933 | Bacteria | 14439 |
| 476 | Ga0207706_10452991 | 3300025933 | Bacteria | 1110 |
| 477 | Ga0207706_10534172 | 3300025933 | Bacteria | 1011 |
| 478 | Ga0207706_10726527 | 3300025933 | Bacteria | 847 |
| 479 | Ga0207686_10000387 | 3300025934 | Bacteria | 30664 |
| 480 | Ga0207686_10165567 | 3300025934 | Bacteria | 1554 |
| 481 | Ga0207686_10620895 | 3300025934 | Bacteria | 853 |
| 482 | Ga0207686_10693757 | 3300025934 | Bacteria | 809 |
| 483 | Ga0207709_10110266 | 3300025935 | Bacteria | 1838 |
| 484 | Ga0207709_10163629 | 3300025935 | Bacteria | 1554 |
| 485 | Ga0207709_10198069 | 3300025935 | Bacteria | 1432 |
| 486 | Ga0207709_10330897 | 3300025935 | Bacteria | 1143 |
| 487 | Ga0207670_10014520 | 3300025936 | Bacteria | 4678 |
| 488 | Ga0207669_10034539 | 3300025937 | Bacteria | 2866 |
| 489 | Ga0207669_10124311 | 3300025937 | Bacteria | 1759 |
| 490 | Ga0207669_10144995 | 3300025937 | Bacteria | 1654 |
| 491 | Ga0207669_10191869 | 3300025937 | Bacteria | 1474 |
| 492 | Ga0207704_10072045 | 3300025938 | Bacteria | 2195 |
| 493 | Ga0207704_10430602 | 3300025938 | Bacteria | 1048 |
| 494 | Ga0207704_10821377 | 3300025938 | Bacteria | 777 |
| 495 | Ga0207704_10870953 | 3300025938 | Unclassified | 756 |
| 496 | Ga0207665_10006073 | 3300025939 | Bacteria | 8020 |
| 497 | Ga0207665_10434857 | 3300025939 | Bacteria | 1004 |
| 498 | Ga0207691_10000663 | 3300025940 | Bacteria | 33984 |
| 499 | Ga0207691_10040229 | 3300025940 | Bacteria | 4321 |
| 500 | Ga0207691_10050489 | 3300025940 | Bacteria | 3807 |
| 501 | Ga0207691_10109541 | 3300025940 | Bacteria | 2457 |
| 502 | Ga0207691_10171388 | 3300025940 | Bacteria | 1900 |
| 503 | Ga0207691_10369806 | 3300025940 | Bacteria | 1225 |
| 504 | Ga0207691_10491045 | 3300025940 | Bacteria | 1043 |
| 505 | Ga0207711_10002569 | 3300025941 | Bacteria | 16150 |
| 506 | Ga0207711_10040764 | 3300025941 | Bacteria | 3951 |
| 507 | Ga0207711_10098192 | 3300025941 | Bacteria | 2587 |
| 508 | Ga0207711_10291241 | 3300025941 | Bacteria | 1505 |
| 509 | Ga0207711_10321916 | 3300025941 | Bacteria | 1429 |
| 510 | Ga0207689_10001242 | 3300025942 | Bacteria | 24579 |
| 511 | Ga0207689_10001481 | 3300025942 | Bacteria | 22457 |
| 512 | Ga0207689_10158269 | 3300025942 | Bacteria | 1867 |
| 513 | Ga0207689_10472313 | 3300025942 | Bacteria | 1049 |
| 514 | Ga0207661_10501512 | 3300025944 | Bacteria | 1109 |
| 515 | Ga0207679_10137358 | 3300025945 | Bacteria | 1970 |
| 516 | Ga0207679_10965150 | 3300025945 | Bacteria | 781 |
| 517 | Ga0207667_10062880 | 3300025949 | Bacteria | 3880 |
| 518 | Ga0207667_10127515 | 3300025949 | Bacteria | 2621 |
| 519 | Ga0207667_10168047 | 3300025949 | Bacteria | 2255 |
| 520 | Ga0207651_10006044 | 3300025960 | Bacteria | 6285 |
| 521 | Ga0207651_10010046 | 3300025960 | Bacteria | 5221 |
| 522 | Ga0207651_10061681 | 3300025960 | Bacteria | 2609 |
| 523 | Ga0207651_10176416 | 3300025960 | Bacteria | 1691 |
| 524 | Ga0207651_10265871 | 3300025960 | Bacteria | 1410 |
| 525 | Ga0207712_10014061 | 3300025961 | Bacteria | 5138 |
| 526 | Ga0207668_10014105 | 3300025972 | Bacteria | 4941 |
| 527 | Ga0207668_10017170 | 3300025972 | Bacteria | 4530 |
| 528 | Ga0207668_10025357 | 3300025972 | Bacteria | 3837 |
| 529 | Ga0207668_10029961 | 3300025972 | Bacteria | 3572 |
| 530 | Ga0207668_10126327 | 3300025972 | Bacteria | 1945 |
| 531 | Ga0207668_10443229 | 3300025972 | Bacteria | 1106 |
| 532 | Ga0207668_10707516 | 3300025972 | Bacteria | 886 |
| 533 | Ga0207640_10032590 | 3300025981 | Bacteria | 3232 |
| 534 | Ga0207640_10046407 | 3300025981 | Bacteria | 2795 |
| 535 | Ga0207640_10104743 | 3300025981 | Bacteria | 1992 |
| 536 | Ga0207658_10007145 | 3300025986 | Bacteria | 7607 |
| 537 | Ga0207658_10025111 | 3300025986 | Bacteria | 4170 |
| 538 | Ga0207658_10036223 | 3300025986 | Bacteria | 3537 |
| 539 | Ga0207658_10207191 | 3300025986 | Bacteria | 1641 |
| 540 | Ga0207658_10500229 | 3300025986 | Bacteria | 1082 |
| 541 | Ga0207658_10547720 | 3300025986 | Bacteria | 1035 |
| 542 | Ga0207658_10615478 | 3300025986 | Bacteria | 976 |
| 543 | Ga0207677_10001127 | 3300026023 | Bacteria | 14559 |
| 544 | Ga0207677_10012576 | 3300026023 | Bacteria | 4873 |
| 545 | Ga0207677_10015239 | 3300026023 | Bacteria | 4515 |
| 546 | Ga0207677_10535727 | 3300026023 | Bacteria | 1018 |
| 547 | Ga0207677_10681177 | 3300026023 | Bacteria | 910 |
| 548 | Ga0207677_10916079 | 3300026023 | Bacteria | 791 |
| 549 | Ga0207703_10001000 | 3300026035 | Bacteria | 27175 |
| 550 | Ga0207703_10003742 | 3300026035 | Bacteria | 12656 |
| 551 | Ga0207703_10055465 | 3300026035 | Bacteria | 3224 |
| 552 | Ga0207703_10366809 | 3300026035 | Bacteria | 1329 |
| 553 | Ga0207703_10652329 | 3300026035 | Bacteria | 998 |
| 554 | Ga0207678_10208733 | 3300026067 | Unclassified | 1671 |
| 555 | Ga0207708_10837132 | 3300026075 | Bacteria | 794 |
| 556 | Ga0207702_10015292 | 3300026078 | Bacteria | 6362 |
| 557 | Ga0207641_10004677 | 3300026088 | Bacteria | 11809 |
| 558 | Ga0207641_10026213 | 3300026088 | Bacteria | 4810 |
| 559 | Ga0207641_10039886 | 3300026088 | Bacteria | 3929 |
| 560 | Ga0207641_10101619 | 3300026088 | Bacteria | 2534 |
| 561 | Ga0207641_10108530 | 3300026088 | Bacteria | 2457 |
| 562 | Ga0207648_10004079 | 3300026089 | Bacteria | 15140 |
| 563 | Ga0207648_10019548 | 3300026089 | Bacteria | 6113 |
| 564 | Ga0207648_10025705 | 3300026089 | Bacteria | 5242 |
| 565 | Ga0207648_10058358 | 3300026089 | Bacteria | 3365 |
| 566 | Ga0207648_10100032 | 3300026089 | Bacteria | 2540 |
| 567 | Ga0207648_10327996 | 3300026089 | Bacteria | 1376 |
| 568 | Ga0207648_10643718 | 3300026089 | Bacteria | 979 |
| 569 | Ga0207676_10001564 | 3300026095 | Bacteria | 16874 |
| 570 | Ga0207676_10006171 | 3300026095 | Bacteria | 8461 |
| 571 | Ga0207674_10003455 | 3300026116 | Bacteria | 19327 |
| 572 | Ga0207674_10022759 | 3300026116 | Bacteria | 6725 |
| 573 | Ga0207675_100007047 | 3300026118 | Bacteria | 10620 |
| 574 | Ga0207675_100020605 | 3300026118 | Bacteria | 6145 |
| 575 | Ga0207675_100065462 | 3300026118 | Bacteria | 3397 |
| 576 | Ga0207675_100181547 | 3300026118 | Bacteria | 2015 |
| 577 | Ga0207675_100186391 | 3300026118 | Bacteria | 1989 |
| 578 | Ga0207675_100370527 | 3300026118 | Bacteria | 1407 |
| 579 | Ga0207675_100385233 | 3300026118 | Bacteria | 1379 |
| 580 | Ga0207675_100926116 | 3300026118 | Bacteria | 888 |
| 581 | Ga0207683_10001329 | 3300026121 | Bacteria | 22302 |
| 582 | Ga0207683_10006146 | 3300026121 | Bacteria | 10290 |
| 583 | Ga0207683_10157520 | 3300026121 | Bacteria | 2051 |
| 584 | Ga0207698_10061081 | 3300026142 | Bacteria | 2935 |
| 585 | Ga0207698_10109181 | 3300026142 | Bacteria | 2314 |
| 586 | Ga0207698_10219041 | 3300026142 | Bacteria | 1718 |
| 587 | Ga0207698_10556232 | 3300026142 | Bacteria | 1125 |
| 588 | Ga0207698_11004997 | 3300026142 | Bacteria | 845 |
| 589 | Ga0209969_1003353 | 3300027360 | Bacteria | 2213 |
| 590 | Ga0210000_1004547 | 3300027462 | Bacteria | 2000 |
| 591 | Ga0209995_1000491 | 3300027471 | Bacteria | 6054 |
| 592 | Ga0209179_1000305 | 3300027512 | Bacteria | 4721 |
| 593 | Ga0209999_1006836 | 3300027543 | Bacteria | 2053 |
| 594 | Ga0209970_1010143 | 3300027614 | Bacteria | 1539 |
| 595 | Ga0209983_1008013 | 3300027665 | Bacteria | 2159 |
| 596 | Ga0209282_1000032 | 3300027666 | Bacteria | 149218 |
| 597 | Ga0209588_1024436 | 3300027671 | Bacteria | 1908 |
| 598 | Ga0209588_1042178 | 3300027671 | Bacteria | 1473 |
| 599 | Ga0209971_1015938 | 3300027682 | Bacteria | 1782 |
| 600 | Ga0209974_10001876 | 3300027876 | Bacteria | 7685 |
| 601 | Ga0207428_10003173 | 3300027907 | Bacteria | 16092 |
| 602 | Ga0268266_10008012 | 3300028379 | Bacteria | 9446 |
| 603 | Ga0268266_10047844 | 3300028379 | Bacteria | 3665 |
| 604 | Ga0268266_10098506 | 3300028379 | Bacteria | 2572 |
| 605 | Ga0268266_10198834 | 3300028379 | Bacteria | 1834 |
| 606 | Ga0268266_11419745 | 3300028379 | Bacteria | 670 |
| 607 | Ga0268265_10021619 | 3300028380 | Bacteria | 4510 |
| 608 | Ga0268265_10443750 | 3300028380 | Bacteria | 1210 |
| 609 | Ga0268265_11570559 | 3300028380 | Bacteria | 662 |
| 610 | Ga0268264_10000599 | 3300028381 | Bacteria | 43601 |
| 611 | Ga0268264_10021449 | 3300028381 | Bacteria | 5274 |
| 612 | Ga0268264_10028221 | 3300028381 | Bacteria | 4589 |
| 613 | Ga0268264_10047411 | 3300028381 | Bacteria | 3572 |
| 614 | Ga0268264_10054399 | 3300028381 | Bacteria | 3342 |
| 615 | Ga0268264_10061543 | 3300028381 | Bacteria | 3149 |
| 616 | Ga0268264_10086853 | 3300028381 | Bacteria | 2688 |
| 617 | Ga0268264_10237350 | 3300028381 | Bacteria | 1687 |
| 618 | Ga0268264_10500078 | 3300028381 | Bacteria | 1185 |
| 619 | Ga0307515_10017116 | 3300028794 | Bacteria | 13232 |
| 620 | Ga0265325_10003550 | 3300031241 | Bacteria | 10131 |
| 621 | Ga0265325_10050077 | 3300031241 | Bacteria | 2153 |
| 622 | Ga0265329_10001643 | 3300031242 | Bacteria | 10683 |
| 623 | Ga0265339_10021396 | 3300031249 | Bacteria | 3764 |
| 624 | Ga0265331_10001285 | 3300031250 | Bacteria | 18719 |
| 625 | Ga0265327_10001001 | 3300031251 | Bacteria | 40152 |
| 626 | Ga0265327_10034992 | 3300031251 | Bacteria | 2781 |
| 627 | Ga0265316_10106602 | 3300031344 | Bacteria | 2125 |
| 628 | Ga0307513_10000029 | 3300031456 | Bacteria | 191823 |
| 629 | Ga0307408_100436312 | 3300031548 | Bacteria | 1133 |
| 630 | Ga0307516_10000303 | 3300031730 | Bacteria | 63898 |
| 631 | Ga0307406_10526844 | 3300031901 | Bacteria | 963 |
| 632 | Ga0307416_102931686 | 3300032002 | Bacteria | 571 |
| 633 | Ga0316583_10001434 | 3300032133 | Bacteria | 7951 |
| 634 | Ga0307507_10022145 | 3300033179 | Bacteria | 7040 |
| 635 | Ga0373926_0047206 | 3300035083 | Bacteria | 1546 |
| 636 | Ga0373934_0000473 | 3300035086 | Bacteria | 14038 |
| 637 | Ga0373934_0008715 | 3300035086 | Bacteria | 3785 |
| 638 | Ga0373923_0005607 | 3300035111 | Bacteria | 4273 |
| 639 | Ga0373936_0091754 | 3300035113 | Bacteria | 1274 |
| 640 | Ga0373939_0127629 | 3300035114 | Unclassified | 904 |
| 641 | Ga0373945_0015047 | 3300035116 | Bacteria | 2599 |
| 642 | Ga0373945_0147620 | 3300035116 | Bacteria | 951 |
| 643 | Ga0373945_0256122 | 3300035116 | Bacteria | 740 |
| 644 | Ga0373953_0084590 | 3300035117 | Unclassified | 1322 |
| 645 | Ga0373954_0002521 | 3300035118 | Bacteria | 7687 |
| 646 | Ga0373954_0024323 | 3300035118 | Bacteria | 2761 |
| 647 | Ga0373956_0000957 | 3300035119 | Bacteria | 12019 |
| 648 | Ga0373956_0088654 | 3300035119 | Bacteria | 1425 |
| 649 | Ga0373956_0095263 | 3300035119 | Bacteria | 1376 |
| 650 | Ga0373957_0005485 | 3300035120 | Bacteria | 3933 |
| 651 | Ga0373943_0018692 | 3300035170 | Bacteria | 3185 |
| 652 | Ga0373946_0055723 | 3300035171 | Bacteria | 1667 |
| 653 | Ga0373946_0232834 | 3300035171 | Bacteria | 893 |
| 654 | Ga0373955_0006355 | 3300035172 | Bacteria | 5384 |
| 655 | Ga0373955_0013478 | 3300035172 | Bacteria | 3956 |
| 656 | Ga0373955_0433017 | 3300035172 | Bacteria | 801 |
| 657 | Ga0373955_0572070 | 3300035172 | Bacteria | 691 |
| 658 | Ga0316574_0800008 | 3300035398 | Unclassified | 574 |
| 659 | Ga0373924_0039528 | 3300035410 | Bacteria | 1927 |
| 660 | Ga0373935_0015505 | 3300035692 | Bacteria | 4607 |
| 661 | Ga0373935_0029012 | 3300035692 | Bacteria | 3422 |
| 662 | Ga0373935_0120482 | 3300035692 | Bacteria | 1752 |
| 663 | Ga0373935_0179621 | 3300035692 | Bacteria | 1453 |
| 664 | Ga0373927_0003205 | 3300035695 | Bacteria | 11785 |
| 665 | Ga0373927_0006948 | 3300035695 | Bacteria | 7686 |
| 666 | Ga0373927_0019634 | 3300035695 | Bacteria | 4431 |
| 667 | Ga0373927_0051639 | 3300035695 | Bacteria | 2658 |
| 668 | Ga0373927_0598130 | 3300035695 | Bacteria | 729 |
| 669 | Ga0373933_0000611 | 3300035724 | Bacteria | 22317 |
| 670 | Ga0373933_0026162 | 3300035724 | Bacteria | 3349 |
| 671 | Ga0373933_0232352 | 3300035724 | Bacteria | 1185 |
| 672 | Ga0373933_0779056 | 3300035724 | Bacteria | 629 |
| 673 | Ga0373947_0037736 | 3300035725 | Bacteria | 2868 |
| 674 | Ga0373947_0351225 | 3300035725 | Bacteria | 989 |
| 675 | Ga0373947_0584075 | 3300035725 | Bacteria | 761 |
| 676 | Ga0373937_0003380 | 3300036401 | Bacteria | 13395 |
| 677 | Ga0373937_0005419 | 3300036401 | Bacteria | 10918 |
| 678 | Ga0373937_0046469 | 3300036401 | Bacteria | 3970 |
| 679 | Ga0373937_0403794 | 3300036401 | Bacteria | 1296 |
| 680 | Ga0373937_0656953 | 3300036401 | Bacteria | 994 |
| 681 | Ga0373937_0728404 | 3300036401 | Bacteria | 939 |
| 682 | Ga0316584_0071932 | 3300036712 | Bacteria | 2592 |
| 683 | Ga0373925_0014584 | 3300037068 | Bacteria | 5679 |
| 684 | Ga0373925_0036052 | 3300037068 | Bacteria | 3651 |
| 685 | Ga0373925_0037105 | 3300037068 | Bacteria | 3596 |
| 686 | Ga0373925_0089328 | 3300037068 | Bacteria | 2353 |
| 687 | Ga0373925_0095569 | 3300037068 | Bacteria | 2277 |
| 688 | Ga0373925_0506517 | 3300037068 | Bacteria | 991 |
| 689 | Ga0436365_1616668 | 3300039437 | Bacteria | 7248 |
| 690 | Ga0436361_0145606 | 3300039447 | Bacteria | 1327 |
| 691 | Ga0436361_0608475 | 3300039447 | Bacteria | 7380 |
| 692 | Ga0436361_0632156 | 3300039447 | Bacteria | 31235 |
| 693 | Ga0436361_0644637 | 3300039447 | Bacteria | 1301 |
| 694 | Ga0436361_1108147 | 3300039447 | Bacteria | 10468 |
| 695 | Ga0439465_0118026 | 3300041413 | Bacteria | 928 |
| 696 | Ga0451789_1207960 | 3300041443 | Bacteria | 785 |
| 697 | Ga0451802_0735006 | 3300041460 | Bacteria | 1008 |
| 698 | Ga0451804_0176278 | 3300041463 | Unclassified | 564 |
| 699 | Ga0451855_0297688 | 3300041511 | Bacteria | 2225 |
| 700 | Ga0439434_0345487 | 3300042435 | Bacteria | 519 |
| 701 | Ga0439464_0170877 | 3300042439 | Bacteria | 685 |
| 702 | Ga0439460_0360968 | 3300042461 | Bacteria | 513 |
| 703 | Ga0451577_0488364 | 3300042876 | Bacteria | 1118 |
| 704 | Ga0451577_1166407 | 3300042876 | Bacteria | 688 |
| 705 | Ga0439440_0136234 | 3300042993 | Bacteria | 694 |
| 706 | Ga0466969_0014206 | 3300044656 | Bacteria | 4185 |
| 707 | Ga0466969_0019480 | 3300044656 | Bacteria | 3526 |
| 708 | Ga0466980_0179596 | 3300044668 | Bacteria | 1379 |
| 709 | Ga0453683_0130728 | 3300044673 | Bacteria | 1582 |
| 710 | Ga0453683_0240838 | 3300044673 | Bacteria | 1152 |
| 711 | Ga0466965_0071872 | 3300044683 | Bacteria | 1741 |
| 712 | Ga0466965_0767703 | 3300044683 | Bacteria | 556 |
| 713 | Ga0466966_0010001 | 3300044684 | Bacteria | 6286 |
| 714 | Ga0466961_0001479 | 3300044693 | Bacteria | 14606 |
| 715 | Ga0466961_0018442 | 3300044693 | Bacteria | 4488 |
| 716 | Ga0466963_0478439 | 3300044694 | Bacteria | 879 |
| 717 | Ga0453684_0000014 | 3300044712 | Bacteria | 993311 |
| 718 | Ga0453684_0000566 | 3300044712 | Bacteria | 138895 |
| 719 | Ga0453684_0001602 | 3300044712 | Bacteria | 62203 |
| 720 | Ga0453684_0003881 | 3300044712 | Bacteria | 32897 |
| 721 | Ga0453684_1785371 | 3300044712 | Bacteria | 626 |
| 722 | Ga0466970_0029628 | 3300044765 | Bacteria | 2883 |
| 723 | Ga0466957_0069405 | 3300044842 | Bacteria | 2177 |
| 724 | Ga0466957_0410301 | 3300044842 | Bacteria | 928 |
| 725 | Ga0466959_0001388 | 3300045049 | Bacteria | 14807 |
| 726 | Ga0466959_0030981 | 3300045049 | Bacteria | 3959 |
| 727 | Ga0466959_0076196 | 3300045049 | Bacteria | 2422 |
| 728 | Ga0451576_0000313 | 3300045051 | Bacteria | 117520 |
| 729 | Ga0451576_1517030 | 3300045051 | Bacteria | 696 |
| 730 | Ga0466967_1486977 | 3300045976 | Bacteria | 675 |
| 731 | Ga0495592_0113429 | 3300046454 | Bacteria | 1915 |
| 732 | Ga0495651_0000274 | 3300046462 | Bacteria | 40100 |
| 733 | Ga0495651_0099703 | 3300046462 | Bacteria | 2166 |
| 734 | Ga0495653_0042203 | 3300046463 | Bacteria | 3555 |
| 735 | Ga0495580_0026400 | 3300046472 | Bacteria | 4234 |
| 736 | Ga0495582_0040091 | 3300046473 | Bacteria | 2578 |
| 737 | Ga0495582_0055742 | 3300046473 | Bacteria | 2178 |
| 738 | Ga0495605_0004722 | 3300046474 | Bacteria | 7970 |
| 739 | Ga0495662_0121474 | 3300046476 | Bacteria | 1282 |
| 740 | Ga0495664_0009419 | 3300046477 | Bacteria | 5465 |
| 741 | Ga0495596_0001563 | 3300046500 | Bacteria | 13042 |
| 742 | Ga0495607_0016883 | 3300046501 | Bacteria | 4700 |
| 743 | Ga0495610_0002561 | 3300046512 | Bacteria | 15121 |
| 744 | Ga0495616_0012563 | 3300046513 | Bacteria | 4802 |
| 745 | Ga0495628_0019972 | 3300046516 | Bacteria | 5533 |
| 746 | Ga0495628_0190111 | 3300046516 | Bacteria | 1550 |
| 747 | Ga0495630_0301730 | 3300046517 | Bacteria | 1224 |
| 748 | Ga0495665_0031800 | 3300046531 | Bacteria | 2823 |
| 749 | Ga0495665_0102904 | 3300046531 | Unclassified | 1498 |
| 750 | Ga0495640_0077917 | 3300046533 | Bacteria | 2209 |
| 751 | Ga0495586_0168594 | 3300046535 | Bacteria | 1237 |
| 752 | Ga0495587_0064444 | 3300046536 | Bacteria | 2141 |
| 753 | Ga0495587_0333263 | 3300046536 | Bacteria | 847 |
| 754 | Ga0495598_0330834 | 3300046537 | Bacteria | 582 |
| 755 | Ga0495609_0020106 | 3300046538 | Bacteria | 3085 |
| 756 | Ga0495621_0043624 | 3300046539 | Bacteria | 1582 |
| 757 | Ga0495645_0000247 | 3300046543 | Bacteria | 39450 |
| 758 | Ga0495645_0266309 | 3300046543 | Bacteria | 1132 |
| 759 | Ga0495645_0282302 | 3300046543 | Bacteria | 1091 |
| 760 | Ga0495667_0076342 | 3300046559 | Bacteria | 2180 |
| 761 | Ga0495667_0331651 | 3300046559 | Bacteria | 962 |
| 762 | Ga0495635_0013237 | 3300046663 | Bacteria | 5773 |
| 763 | Ga0495635_0381952 | 3300046663 | Bacteria | 937 |
| 764 | Ga0495661_0042625 | 3300046665 | Bacteria | 2796 |
| 765 | Ga0495657_0104613 | 3300046675 | Bacteria | 1800 |
| 766 | Ga0495657_0126857 | 3300046675 | Bacteria | 1602 |
| 767 | Ga0495657_0273735 | 3300046675 | Unclassified | 1012 |
| 768 | Ga0495623_0489821 | 3300046679 | Bacteria | 650 |
| 769 | Ga0495647_0011345 | 3300046681 | Bacteria | 3052 |
| 770 | Ga0495647_0022683 | 3300046681 | Bacteria | 2269 |
| 771 | Ga0495658_0035942 | 3300046683 | Bacteria | 2729 |
| 772 | Ga0495658_0060732 | 3300046683 | Bacteria | 2168 |
| 773 | Ga0495613_0259707 | 3300046689 | Bacteria | 1210 |
| 774 | Ga0495670_0236185 | 3300046691 | Bacteria | 973 |
| 775 | Ga0495671_0001606 | 3300046692 | Bacteria | 14869 |
| 776 | Ga0495649_0125866 | 3300046694 | Bacteria | 1353 |
| 777 | Ga0495581_0003832 | 3300047315 | Bacteria | 8646 |
| 778 | Ga0495604_0683038 | 3300047317 | Bacteria | 653 |
| 779 | Ga0495674_0039081 | 3300047319 | Bacteria | 4254 |
| 780 | Ga0495672_0051966 | 3300047320 | Bacteria | 2410 |
| 781 | Ga0495680_0109999 | 3300047322 | Bacteria | 2043 |
| 782 | Ga0495680_0139771 | 3300047322 | Bacteria | 1773 |
| 783 | Ga0495680_0257151 | 3300047322 | Bacteria | 1236 |
| 784 | Ga0495675_0063141 | 3300047444 | Bacteria | 2344 |
| 785 | Ga0495677_0110185 | 3300047445 | Bacteria | 1046 |
| 786 | Ga0495685_009158 | 3300047447 | Bacteria | 3301 |
| 787 | Ga0495684_0025419 | 3300047471 | Bacteria | 4550 |
| 788 | Ga0495684_0452761 | 3300047471 | Bacteria | 891 |
| 789 | Ga0495614_0008587 | 3300048089 | Bacteria | 4542 |
| 790 | Ga0496100_0030650 | 3300048903 | Bacteria | 3337 |
| 791 | Ga0496101_0026167 | 3300048904 | Bacteria | 4055 |
| 792 | Ga0496102_0062616 | 3300048905 | Bacteria | 3407 |
| 793 | Ga0496102_0253850 | 3300048905 | Bacteria | 1658 |
| 794 | Ga0496103_0052493 | 3300048906 | Bacteria | 2525 |
| 795 | Ga0496105_0001094 | 3300048908 | Bacteria | 18813 |
| 796 | Ga0496106_0537427 | 3300048909 | Bacteria | 938 |
| 797 | Ga0496106_0585094 | 3300048909 | Bacteria | 894 |
| 798 | Ga0496106_0597617 | 3300048909 | Viruses | 884 |
| 799 | Ga0496107_0063175 | 3300048910 | Bacteria | 2683 |
| 800 | Ga0496108_0041432 | 3300048911 | Bacteria | 3845 |
| 801 | Ga0496108_0870812 | 3300048911 | Bacteria | 774 |
| 802 | Ga0496109_0021225 | 3300048912 | Bacteria | 5741 |
| 803 | Ga0496109_0039311 | 3300048912 | Bacteria | 4282 |
| 804 | Ga0496109_0203913 | 3300048912 | Bacteria | 1859 |
| 805 | Ga0496109_0487068 | 3300048912 | Bacteria | 1164 |
| 806 | Ga0496109_1460047 | 3300048912 | Bacteria | 619 |
| 807 | Ga0496111_0030457 | 3300048914 | Bacteria | 3837 |
| 808 | Ga0496112_0011743 | 3300048915 | Bacteria | 8019 |
| 809 | Ga0496112_0054119 | 3300048915 | Bacteria | 3942 |
| 810 | Ga0496112_0059588 | 3300048915 | Bacteria | 3762 |
| 811 | Ga0496113_0071811 | 3300048916 | Bacteria | 2633 |
| 812 | Ga0496114_0043224 | 3300048917 | Bacteria | 3737 |
| 813 | Ga0496114_0727272 | 3300048917 | Unclassified | 869 |
| 814 | Ga0496116_0007817 | 3300048919 | Bacteria | 9396 |
| 815 | Ga0496116_0068850 | 3300048919 | Bacteria | 2253 |
| 816 | Ga0496117_0009792 | 3300048920 | Bacteria | 8836 |
| 817 | Ga0496118_0011294 | 3300048921 | Bacteria | 8735 |
| 818 | Ga0496119_0035656 | 3300048922 | Bacteria | 3256 |
| 819 | Ga0496121_0026885 | 3300048924 | Bacteria | 5403 |
| 820 | Ga0496122_0012773 | 3300048925 | Bacteria | 8311 |
| 821 | Ga0496123_0005248 | 3300048926 | Bacteria | 13151 |
| 822 | Ga0496125_0047767 | 3300048928 | Bacteria | 3575 |
| 823 | Ga0496126_0388894 | 3300048929 | Bacteria | 1134 |
| 824 | Ga0501039_0427389 | 3300049575 | Bacteria | 1040 |
| 825 | Ga0501042_0516835 | 3300049578 | Bacteria | 867 |
| 826 | Ga0501067_0060185 | 3300049583 | Bacteria | 2102 |
| 827 | Ga0501072_0476196 | 3300049588 | Bacteria | 988 |
| 828 | Ga0501072_0746572 | 3300049588 | Bacteria | 768 |
| 829 | Ga0501074_0427974 | 3300049590 | Bacteria | 939 |
| 830 | Ga0501076_0630741 | 3300049592 | Bacteria | 884 |
| 831 | Ga0501081_0182101 | 3300049743 | Bacteria | 1520 |
| 832 | Ga0501081_0416357 | 3300049743 | Bacteria | 996 |
| 833 | Ga0501035_0029965 | 3300049822 | Bacteria | 4963 |
| 834 | Ga0501044_0000316 | 3300049823 | Bacteria | 61151 |
| 835 | Ga0501045_0058873 | 3300049824 | Bacteria | 2814 |
| 836 | Ga0501045_1249530 | 3300049824 | Bacteria | 541 |
| 837 | nmdc:mga03683_31474_c1 | 3300050489 | Bacteria | 2129 |
| 838 | nmdc:mga03n38_3166_c1 | 3300050490 | Bacteria | 5245 |
| 839 | nmdc:mga00v17_14509_c1 | 3300050491 | Bacteria | 4400 |
| 840 | nmdc:mga00v17_183801_c2 | 3300050491 | Bacteria | 1056 |
| 841 | nmdc:mga0yw44_18844_c1 | 3300050492 | Bacteria | 3790 |
| 842 | nmdc:mga0yw44_74869_c1 | 3300050492 | Bacteria | 2110 |
| 843 | nmdc:mga0k408_27521_c1 | 3300050493 | Bacteria | 3229 |
| 844 | nmdc:mga0k408_57744_c1 | 3300050493 | Bacteria | 2253 |
| 845 | nmdc:mga0k408_63383_c1 | 3300050493 | Bacteria | 2150 |
| 846 | nmdc:mga0k408_7709_c1 | 3300050493 | Bacteria | 5753 |
| 847 | nmdc:mga06z11_16232_c1 | 3300050494 | Bacteria | 3349 |
| 848 | nmdc:mga04h51_1623_c1 | 3300050495 | Bacteria | 5245 |
| 849 | nmdc:mga07m45_5925_c1 | 3300050496 | Bacteria | 6133 |
| 850 | nmdc:mga09592_2590_c1 | 3300050508 | Bacteria | 14645 |
| 851 | nmdc:mga06r32_13628_c1 | 3300050510 | Bacteria | 7371 |
| 852 | nmdc:mga08y16_1731_c1 | 3300050511 | Bacteria | 22150 |
| 853 | nmdc:mga0n895_221841_c1 | 3300050512 | Bacteria | 1919 |
| 854 | nmdc:mga0n895_32773_c1 | 3300050512 | Bacteria | 4988 |
| 855 | nmdc:mga0n895_836098_c1 | 3300050512 | Bacteria | 909 |
| 856 | nmdc:mga0rr50_11221_c1 | 3300050513 | Bacteria | 5721 |
| 857 | nmdc:mga08x19_72605_c1 | 3300050514 | Bacteria | 2245 |
| 858 | nmdc:mga0a205_49685_c1 | 3300050515 | Bacteria | 4049 |
| 859 | nmdc:mga0sz30_45207_c1 | 3300050516 | Bacteria | 1857 |
| 860 | Ga0495601_0178212 | 3300053077 | Bacteria | 1390 |
| 861 | Ga0495612_0011990 | 3300053078 | Bacteria | 3493 |
| 862 | Ga0495595_0088431 | 3300053084 | Unclassified | 1484 |
| 863 | Ga0495619_0060518 | 3300053085 | Bacteria | 2517 |
| 864 | Ga0495619_0886515 | 3300053085 | Unclassified | 601 |
| 865 | Ga0500594_0024036 | 3300053118 | Bacteria | 1549 |
| 866 | Ga0500634_0002968 | 3300053161 | Bacteria | 7393 |
| 867 | Ga0500637_0155049 | 3300053178 | Bacteria | 1322 |
| 868 | Ga0590075_041710 | 3300059424 | Bacteria | 1173 |
| 869 | Ga0587085_067875 | 3300059506 | Bacteria | 690 |
| 870 | Ga0587090_047069 | 3300059510 | Bacteria | 779 |
| 871 | Ga0587111_0039696 | 3300060346 | Bacteria | 998 |
| 872 | Ga0501082_0183353 | 3300060353 | Bacteria | 1821 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10023129 | Ga0075366_100231293 | 143 |
| 2 | 3300050493 | nmdc:mga0k408_63383_c1 | nmdc:mga0k408_63383_c1_383_1003 | 143 |
| 3 | 3300013296 | Ga0157374_11216300 | Ga0157374_112163002 | 144 |
| 4 | 3300035172 | Ga0373955_0013478 | Ga0373955_0013478_1301_1771 | 149 |
| 5 | 3300036401 | Ga0373937_0005419 | Ga0373937_0005419_1104_1574 | 149 |
| 6 | 3300046675 | Ga0495657_0273735 | Ga0495657_0273735_384_854 | 149 |
| 7 | 3300046679 | Ga0495623_0489821 | Ga0495623_0489821_74_544 | 149 |
| 8 | iso_pu_bacteria | 2895511927 | 2895513346 | 149 |
| 9 | 3300005355 | Ga0070671_100686455 | Ga0070671_1006864552 | 150 |
| 10 | 3300005456 | Ga0070678_100927774 | Ga0070678_1009277741 | 150 |
| 11 | 3300005616 | Ga0068852_100606319 | Ga0068852_1006063192 | 150 |
| 12 | 3300005617 | Ga0068859_100672288 | Ga0068859_1006722882 | 150 |
| 13 | 3300005834 | Ga0068851_10230248 | Ga0068851_102302482 | 150 |
| 14 | 3300006931 | Ga0097620_100672185 | Ga0097620_1006721852 | 150 |
| 15 | 3300025960 | Ga0207651_10176416 | Ga0207651_101764163 | 150 |
| 16 | 3300026067 | Ga0207678_10208733 | Ga0207678_102087333 | 150 |
| 17 | 3300026089 | Ga0207648_10025705 | Ga0207648_100257056 | 150 |
| 18 | 3300026121 | Ga0207683_10157520 | Ga0207683_101575202 | 150 |
| 19 | 3300026142 | Ga0207698_10219041 | Ga0207698_102190412 | 150 |
| 20 | 3300031901 | Ga0307406_10526844 | Ga0307406_105268442 | 150 |
| 21 | 3300032002 | Ga0307416_102931686 | Ga0307416_1029316861 | 150 |
| 22 | iso_pu_bacteria | 2846037992 | 2846039680 | 150 |
| 23 | 3300005295 | Ga0065707_10083651 | Ga0065707_100836516 | 152 |
| 24 | iso_pu_bacteria | 2643221603 | 2644027004 | 152 |
| 25 | iso_pu_bacteria | 2739367655 | 2739611320 | 152 |
| 26 | iso_pu_bacteria | 2857537821 | 2857542497 | 152 |
| 27 | iso_pu_bacteria | 2857576091 | 2857578011 | 152 |
| 28 | iso_pu_bacteria | 2881927736 | 2881929864 | 152 |
| 29 | iso_pu_bacteria | 2887375801 | 2887376216 | 152 |
| 30 | 3300005439 | Ga0070711_100429435 | Ga0070711_1004294352 | 153 |
| 31 | 3300005617 | Ga0068859_100041934 | Ga0068859_1000419344 | 153 |
| 32 | 3300005841 | Ga0068863_100242118 | Ga0068863_1002421182 | 153 |
| 33 | 3300005843 | Ga0068860_100290492 | Ga0068860_1002904922 | 153 |
| 34 | 3300006175 | Ga0070712_100057954 | Ga0070712_1000579543 | 153 |
| 35 | 3300006931 | Ga0097620_100041932 | Ga0097620_1000419324 | 153 |
| 36 | 3300009011 | Ga0105251_10033989 | Ga0105251_100339892 | 153 |
| 37 | 3300014968 | Ga0157379_10029211 | Ga0157379_100292116 | 153 |
| 38 | 3300025915 | Ga0207693_10072939 | Ga0207693_100729392 | 153 |
| 39 | 3300025928 | Ga0207700_10000023 | Ga0207700_10000023119 | 153 |
| 40 | 3300027666 | Ga0209282_1000032 | Ga0209282_1000032102 | 153 |
| 41 | 3300028381 | Ga0268264_10086853 | Ga0268264_100868532 | 153 |
| 42 | 3300035114 | Ga0373939_0127629 | Ga0373939_0127629_322_801 | 153 |
| 43 | 3300035692 | Ga0373935_0179621 | Ga0373935_0179621_459_1010 | 153 |
| 44 | 3300035695 | Ga0373927_0003205 | Ga0373927_0003205_2900_3451 | 153 |
| 45 | 3300037068 | Ga0373925_0506517 | Ga0373925_0506517_146_697 | 153 |
| 46 | 3300046474 | Ga0495605_0004722 | Ga0495605_0004722_5430_5984 | 153 |
| 47 | 3300046500 | Ga0495596_0001563 | Ga0495596_0001563_7007_7561 | 153 |
| 48 | 3300046501 | Ga0495607_0016883 | Ga0495607_0016883_3689_4243 | 153 |
| 49 | 3300046512 | Ga0495610_0002561 | Ga0495610_0002561_7121_7675 | 153 |
| 50 | 3300046513 | Ga0495616_0012563 | Ga0495616_0012563_1944_2498 | 153 |
| 51 | 3300046538 | Ga0495609_0020106 | Ga0495609_0020106_432_986 | 153 |
| 52 | 3300046665 | Ga0495661_0042625 | Ga0495661_0042625_408_962 | 153 |
| 53 | 3300046691 | Ga0495670_0236185 | Ga0495670_0236185_226_780 | 153 |
| 54 | 3300046692 | Ga0495671_0001606 | Ga0495671_0001606_9235_9789 | 153 |
| 55 | 3300046694 | Ga0495649_0125866 | Ga0495649_0125866_412_966 | 153 |
| 56 | 3300047320 | Ga0495672_0051966 | Ga0495672_0051966_187_741 | 153 |
| 57 | 3300047447 | Ga0495685_009158 | Ga0495685_009158_472_1026 | 153 |
| 58 | 3300048919 | Ga0496116_0007817 | Ga0496116_0007817_4846_5400 | 153 |
| 59 | 3300048924 | Ga0496121_0026885 | Ga0496121_0026885_231_785 | 153 |
| 60 | 3300048925 | Ga0496122_0012773 | Ga0496122_0012773_220_774 | 153 |
| 61 | 3300048926 | Ga0496123_0005248 | Ga0496123_0005248_5194_5748 | 153 |
| 62 | 3300048928 | Ga0496125_0047767 | Ga0496125_0047767_2587_3141 | 153 |
| 63 | 3300048929 | Ga0496126_0388894 | Ga0496126_0388894_455_1009 | 153 |
| 64 | 3300053077 | Ga0495601_0178212 | Ga0495601_0178212_608_1084 | 153 |
| 65 | 3300005340 | Ga0070689_100364738 | Ga0070689_1003647381 | 154 |
| 66 | 3300005456 | Ga0070678_101146787 | Ga0070678_1011467871 | 154 |
| 67 | 3300005459 | Ga0068867_100210028 | Ga0068867_1002100282 | 154 |
| 68 | 3300005539 | Ga0068853_100404684 | Ga0068853_1004046841 | 154 |
| 69 | 3300005616 | Ga0068852_100331746 | Ga0068852_1003317462 | 154 |
| 70 | 3300005617 | Ga0068859_100306328 | Ga0068859_1003063283 | 154 |
| 71 | 3300005618 | Ga0068864_102304084 | Ga0068864_1023040841 | 154 |
| 72 | 3300005841 | Ga0068863_100534223 | Ga0068863_1005342232 | 154 |
| 73 | 3300005843 | Ga0068860_100060219 | Ga0068860_1000602195 | 154 |
| 74 | 3300006051 | Ga0075364_10305782 | Ga0075364_103057822 | 154 |
| 75 | 3300006931 | Ga0097620_100306314 | Ga0097620_1003063142 | 154 |
| 76 | 3300009177 | Ga0105248_10220165 | Ga0105248_102201652 | 154 |
| 77 | 3300013306 | Ga0163162_11546927 | Ga0163162_115469272 | 154 |
| 78 | 3300013308 | Ga0157375_10147814 | Ga0157375_101478143 | 154 |
| 79 | 3300014968 | Ga0157379_12026818 | Ga0157379_120268181 | 154 |
| 80 | 3300014968 | Ga0157379_12512901 | Ga0157379_125129011 | 154 |
| 81 | 3300014969 | Ga0157376_10478940 | Ga0157376_104789402 | 154 |
| 82 | 3300025735 | Ga0207713_1036244 | Ga0207713_10362442 | 154 |
| 83 | 3300025903 | Ga0207680_10499031 | Ga0207680_104990312 | 154 |
| 84 | 3300025937 | Ga0207669_10124311 | Ga0207669_101243113 | 154 |
| 85 | 3300025941 | Ga0207711_10321916 | Ga0207711_103219162 | 154 |
| 86 | 3300026023 | Ga0207677_10535727 | Ga0207677_105357272 | 154 |
| 87 | 3300026118 | Ga0207675_100370527 | Ga0207675_1003705273 | 154 |
| 88 | 3300026142 | Ga0207698_11004997 | Ga0207698_110049972 | 154 |
| 89 | 3300028381 | Ga0268264_10021449 | Ga0268264_100214497 | 154 |
| 90 | 3300044694 | Ga0466963_0478439 | Ga0466963_0478439_75_608 | 154 |
| 91 | 3300049578 | Ga0501042_0516835 | Ga0501042_0516835_280_744 | 154 |
| 92 | 3300049588 | Ga0501072_0476196 | Ga0501072_0476196_23_487 | 154 |
| 93 | 3300049590 | Ga0501074_0427974 | Ga0501074_0427974_19_483 | 154 |
| 94 | 3300049743 | Ga0501081_0416357 | Ga0501081_0416357_349_813 | 154 |
| 95 | 3300049824 | Ga0501045_1249530 | Ga0501045_1249530_65_529 | 154 |
| 96 | 3300050491 | nmdc:mga00v17_183801_c2 | nmdc:mga00v17_183801_c2_320_790 | 154 |
| 97 | 3300005289 | Ga0065704_10543945 | Ga0065704_105439451 | 155 |
| 98 | 3300005293 | Ga0065715_10198640 | Ga0065715_101986402 | 155 |
| 99 | 3300005293 | Ga0065715_10216561 | Ga0065715_102165612 | 155 |
| 100 | 3300005295 | Ga0065707_10643680 | Ga0065707_106436802 | 155 |
| 101 | 3300005328 | Ga0070676_10004210 | Ga0070676_100042107 | 155 |
| 102 | 3300005331 | Ga0070670_100013210 | Ga0070670_1000132105 | 155 |
| 103 | 3300005331 | Ga0070670_100014420 | Ga0070670_1000144208 | 155 |
| 104 | 3300005331 | Ga0070670_100206893 | Ga0070670_1002068932 | 155 |
| 105 | 3300005331 | Ga0070670_100280835 | Ga0070670_1002808352 | 155 |
| 106 | 3300005331 | Ga0070670_100327517 | Ga0070670_1003275172 | 155 |
| 107 | 3300005333 | Ga0070677_10020266 | Ga0070677_100202664 | 155 |
| 108 | 3300005333 | Ga0070677_10053359 | Ga0070677_100533591 | 155 |
| 109 | 3300005334 | Ga0068869_100000356 | Ga0068869_10000035621 | 155 |
| 110 | 3300005334 | Ga0068869_100093325 | Ga0068869_1000933253 | 155 |
| 111 | 3300005334 | Ga0068869_100478168 | Ga0068869_1004781682 | 155 |
| 112 | 3300005335 | Ga0070666_10032196 | Ga0070666_100321964 | 155 |
| 113 | 3300005335 | Ga0070666_10909983 | Ga0070666_109099832 | 155 |
| 114 | 3300005338 | Ga0068868_100021435 | Ga0068868_1000214354 | 155 |
| 115 | 3300005338 | Ga0068868_100044231 | Ga0068868_1000442312 | 155 |
| 116 | 3300005339 | Ga0070660_100365428 | Ga0070660_1003654282 | 155 |
| 117 | 3300005344 | Ga0070661_100262318 | Ga0070661_1002623182 | 155 |
| 118 | 3300005344 | Ga0070661_100838493 | Ga0070661_1008384932 | 155 |
| 119 | 3300005347 | Ga0070668_100008431 | Ga0070668_1000084319 | 155 |
| 120 | 3300005347 | Ga0070668_100025855 | Ga0070668_1000258554 | 155 |
| 121 | 3300005347 | Ga0070668_100060850 | Ga0070668_1000608502 | 155 |
| 122 | 3300005347 | Ga0070668_100088308 | Ga0070668_1000883085 | 155 |
| 123 | 3300005347 | Ga0070668_100162744 | Ga0070668_1001627442 | 155 |
| 124 | 3300005353 | Ga0070669_100015544 | Ga0070669_1000155445 | 155 |
| 125 | 3300005353 | Ga0070669_100016089 | Ga0070669_1000160896 | 155 |
| 126 | 3300005354 | Ga0070675_100014034 | Ga0070675_1000140342 | 155 |
| 127 | 3300005354 | Ga0070675_100355068 | Ga0070675_1003550681 | 155 |
| 128 | 3300005354 | Ga0070675_100906411 | Ga0070675_1009064112 | 155 |
| 129 | 3300005355 | Ga0070671_100053947 | Ga0070671_1000539473 | 155 |
| 130 | 3300005355 | Ga0070671_100181219 | Ga0070671_1001812193 | 155 |
| 131 | 3300005355 | Ga0070671_100205370 | Ga0070671_1002053703 | 155 |
| 132 | 3300005356 | Ga0070674_100007493 | Ga0070674_1000074934 | 155 |
| 133 | 3300005356 | Ga0070674_100140661 | Ga0070674_1001406613 | 155 |
| 134 | 3300005364 | Ga0070673_100003912 | Ga0070673_1000039122 | 155 |
| 135 | 3300005364 | Ga0070673_100038869 | Ga0070673_1000388693 | 155 |
| 136 | 3300005364 | Ga0070673_100407036 | Ga0070673_1004070362 | 155 |
| 137 | 3300005364 | Ga0070673_100418069 | Ga0070673_1004180692 | 155 |
| 138 | 3300005365 | Ga0070688_100020748 | Ga0070688_1000207483 | 155 |
| 139 | 3300005365 | Ga0070688_100114945 | Ga0070688_1001149453 | 155 |
| 140 | 3300005365 | Ga0070688_100586219 | Ga0070688_1005862192 | 155 |
| 141 | 3300005366 | Ga0070659_100100299 | Ga0070659_1001002993 | 155 |
| 142 | 3300005366 | Ga0070659_100554551 | Ga0070659_1005545512 | 155 |
| 143 | 3300005367 | Ga0070667_100001403 | Ga0070667_10000140311 | 155 |
| 144 | 3300005367 | Ga0070667_100002052 | Ga0070667_1000020523 | 155 |
| 145 | 3300005367 | Ga0070667_100113710 | Ga0070667_1001137104 | 155 |
| 146 | 3300005367 | Ga0070667_100173446 | Ga0070667_1001734462 | 155 |
| 147 | 3300005367 | Ga0070667_100353905 | Ga0070667_1003539052 | 155 |
| 148 | 3300005435 | Ga0070714_100044899 | Ga0070714_1000448992 | 155 |
| 149 | 3300005441 | Ga0070700_100432683 | Ga0070700_1004326832 | 155 |
| 150 | 3300005441 | Ga0070700_100536992 | Ga0070700_1005369922 | 155 |
| 151 | 3300005444 | Ga0070694_100306660 | Ga0070694_1003066602 | 155 |
| 152 | 3300005456 | Ga0070678_100068344 | Ga0070678_1000683443 | 155 |
| 153 | 3300005456 | Ga0070678_100133070 | Ga0070678_1001330702 | 155 |
| 154 | 3300005457 | Ga0070662_100299094 | Ga0070662_1002990942 | 155 |
| 155 | 3300005459 | Ga0068867_100007434 | Ga0068867_1000074342 | 155 |
| 156 | 3300005459 | Ga0068867_100027509 | Ga0068867_1000275094 | 155 |
| 157 | 3300005459 | Ga0068867_100172174 | Ga0068867_1001721743 | 155 |
| 158 | 3300005459 | Ga0068867_100271461 | Ga0068867_1002714611 | 155 |
| 159 | 3300005466 | Ga0070685_10229917 | Ga0070685_102299172 | 155 |
| 160 | 3300005539 | Ga0068853_100849380 | Ga0068853_1008493801 | 155 |
| 161 | 3300005543 | Ga0070672_100062364 | Ga0070672_1000623643 | 155 |
| 162 | 3300005543 | Ga0070672_100177390 | Ga0070672_1001773902 | 155 |
| 163 | 3300005543 | Ga0070672_100276586 | Ga0070672_1002765862 | 155 |
| 164 | 3300005543 | Ga0070672_100363412 | Ga0070672_1003634122 | 155 |
| 165 | 3300005543 | Ga0070672_100650613 | Ga0070672_1006506132 | 155 |
| 166 | 3300005545 | Ga0070695_100380437 | Ga0070695_1003804372 | 155 |
| 167 | 3300005546 | Ga0070696_100142851 | Ga0070696_1001428512 | 155 |
| 168 | 3300005547 | Ga0070693_100576214 | Ga0070693_1005762141 | 155 |
| 169 | 3300005548 | Ga0070665_100164457 | Ga0070665_1001644573 | 155 |
| 170 | 3300005548 | Ga0070665_100357321 | Ga0070665_1003573212 | 155 |
| 171 | 3300005548 | Ga0070665_100574790 | Ga0070665_1005747902 | 155 |
| 172 | 3300005548 | Ga0070665_101240370 | Ga0070665_1012403702 | 155 |
| 173 | 3300005549 | Ga0070704_100286482 | Ga0070704_1002864822 | 155 |
| 174 | 3300005563 | Ga0068855_100025951 | Ga0068855_1000259518 | 155 |
| 175 | 3300005563 | Ga0068855_100162956 | Ga0068855_1001629562 | 155 |
| 176 | 3300005577 | Ga0068857_100020112 | Ga0068857_1000201124 | 155 |
| 177 | 3300005578 | Ga0068854_100178024 | Ga0068854_1001780241 | 155 |
| 178 | 3300005615 | Ga0070702_100150253 | Ga0070702_1001502533 | 155 |
| 179 | 3300005616 | Ga0068852_100201586 | Ga0068852_1002015861 | 155 |
| 180 | 3300005617 | Ga0068859_100014353 | Ga0068859_1000143536 | 155 |
| 181 | 3300005617 | Ga0068859_100021791 | Ga0068859_1000217917 | 155 |
| 182 | 3300005617 | Ga0068859_100208857 | Ga0068859_1002088574 | 155 |
| 183 | 3300005617 | Ga0068859_100427382 | Ga0068859_1004273822 | 155 |
| 184 | 3300005618 | Ga0068864_100000981 | Ga0068864_10000098112 | 155 |
| 185 | 3300005618 | Ga0068864_100283523 | Ga0068864_1002835232 | 155 |
| 186 | 3300005618 | Ga0068864_100347913 | Ga0068864_1003479131 | 155 |
| 187 | 3300005618 | Ga0068864_100568174 | Ga0068864_1005681742 | 155 |
| 188 | 3300005718 | Ga0068866_10118829 | Ga0068866_101188293 | 155 |
| 189 | 3300005718 | Ga0068866_10174039 | Ga0068866_101740392 | 155 |
| 190 | 3300005719 | Ga0068861_100013391 | Ga0068861_1000133914 | 155 |
| 191 | 3300005719 | Ga0068861_100037180 | Ga0068861_1000371803 | 155 |
| 192 | 3300005719 | Ga0068861_100541876 | Ga0068861_1005418762 | 155 |
| 193 | 3300005719 | Ga0068861_100825390 | Ga0068861_1008253902 | 155 |
| 194 | 3300005834 | Ga0068851_10333592 | Ga0068851_103335922 | 155 |
| 195 | 3300005834 | Ga0068851_10493754 | Ga0068851_104937542 | 155 |
| 196 | 3300005840 | Ga0068870_10078729 | Ga0068870_100787292 | 155 |
| 197 | 3300005841 | Ga0068863_100004419 | Ga0068863_10000441911 | 155 |
| 198 | 3300005841 | Ga0068863_100059799 | Ga0068863_1000597993 | 155 |
| 199 | 3300005841 | Ga0068863_100107136 | Ga0068863_1001071363 | 155 |
| 200 | 3300005841 | Ga0068863_100361631 | Ga0068863_1003616312 | 155 |
| 201 | 3300005842 | Ga0068858_100001946 | Ga0068858_10000194621 | 155 |
| 202 | 3300005842 | Ga0068858_100058632 | Ga0068858_1000586323 | 155 |
| 203 | 3300005842 | Ga0068858_100474109 | Ga0068858_1004741092 | 155 |
| 204 | 3300005843 | Ga0068860_100019348 | Ga0068860_1000193487 | 155 |
| 205 | 3300005843 | Ga0068860_100023185 | Ga0068860_1000231854 | 155 |
| 206 | 3300005843 | Ga0068860_100077510 | Ga0068860_1000775103 | 155 |
| 207 | 3300005843 | Ga0068860_100415583 | Ga0068860_1004155832 | 155 |
| 208 | 3300005843 | Ga0068860_100486307 | Ga0068860_1004863072 | 155 |
| 209 | 3300005844 | Ga0068862_100007718 | Ga0068862_1000077188 | 155 |
| 210 | 3300005844 | Ga0068862_100011362 | Ga0068862_1000113629 | 155 |
| 211 | 3300005844 | Ga0068862_100144386 | Ga0068862_1001443863 | 155 |
| 212 | 3300005844 | Ga0068862_100736020 | Ga0068862_1007360202 | 155 |
| 213 | 3300006237 | Ga0097621_100029232 | Ga0097621_1000292323 | 155 |
| 214 | 3300006237 | Ga0097621_100672600 | Ga0097621_1006726002 | 155 |
| 215 | 3300006358 | Ga0068871_100028930 | Ga0068871_1000289305 | 155 |
| 216 | 3300006358 | Ga0068871_101738792 | Ga0068871_1017387921 | 155 |
| 217 | 3300006844 | Ga0075428_100324335 | Ga0075428_1003243353 | 155 |
| 218 | 3300006881 | Ga0068865_100067648 | Ga0068865_1000676484 | 155 |
| 219 | 3300006881 | Ga0068865_100138902 | Ga0068865_1001389023 | 155 |
| 220 | 3300006881 | Ga0068865_100379199 | Ga0068865_1003791992 | 155 |
| 221 | 3300006931 | Ga0097620_100014355 | Ga0097620_1000143556 | 155 |
| 222 | 3300006931 | Ga0097620_100021791 | Ga0097620_1000217917 | 155 |
| 223 | 3300006931 | Ga0097620_100208869 | Ga0097620_1002088694 | 155 |
| 224 | 3300006931 | Ga0097620_100427365 | Ga0097620_1004273652 | 155 |
| 225 | 3300009101 | Ga0105247_10064056 | Ga0105247_100640563 | 155 |
| 226 | 3300009147 | Ga0114129_11487541 | Ga0114129_114875412 | 155 |
| 227 | 3300009148 | Ga0105243_10129173 | Ga0105243_101291733 | 155 |
| 228 | 3300009148 | Ga0105243_10401412 | Ga0105243_104014122 | 155 |
| 229 | 3300009148 | Ga0105243_11261580 | Ga0105243_112615802 | 155 |
| 230 | 3300009176 | Ga0105242_10571916 | Ga0105242_105719162 | 155 |
| 231 | 3300009177 | Ga0105248_10001115 | Ga0105248_1000111517 | 155 |
| 232 | 3300009177 | Ga0105248_10053576 | Ga0105248_100535764 | 155 |
| 233 | 3300009177 | Ga0105248_12172557 | Ga0105248_121725572 | 155 |
| 234 | 3300009551 | Ga0105238_10847307 | Ga0105238_108473072 | 155 |
| 235 | 3300009553 | Ga0105249_10055830 | Ga0105249_100558302 | 155 |
| 236 | 3300009553 | Ga0105249_10136486 | Ga0105249_101364863 | 155 |
| 237 | 3300013104 | Ga0157370_10050446 | Ga0157370_100504462 | 155 |
| 238 | 3300013296 | Ga0157374_10008385 | Ga0157374_100083853 | 155 |
| 239 | 3300013297 | Ga0157378_10174332 | Ga0157378_101743323 | 155 |
| 240 | 3300013297 | Ga0157378_11221893 | Ga0157378_112218932 | 155 |
| 241 | 3300013306 | Ga0163162_10289469 | Ga0163162_102894692 | 155 |
| 242 | 3300013306 | Ga0163162_10863084 | Ga0163162_108630841 | 155 |
| 243 | 3300013307 | Ga0157372_10006135 | Ga0157372_1000613516 | 155 |
| 244 | 3300013307 | Ga0157372_10285662 | Ga0157372_102856622 | 155 |
| 245 | 3300013308 | Ga0157375_10209481 | Ga0157375_102094813 | 155 |
| 246 | 3300013308 | Ga0157375_10547847 | Ga0157375_105478471 | 155 |
| 247 | 3300013308 | Ga0157375_10834489 | Ga0157375_108344892 | 155 |
| 248 | 3300013308 | Ga0157375_11907163 | Ga0157375_119071631 | 155 |
| 249 | 3300014325 | Ga0163163_10018601 | Ga0163163_100186013 | 155 |
| 250 | 3300014325 | Ga0163163_12036552 | Ga0163163_120365521 | 155 |
| 251 | 3300014326 | Ga0157380_10414690 | Ga0157380_104146902 | 155 |
| 252 | 3300014326 | Ga0157380_10889781 | Ga0157380_108897812 | 155 |
| 253 | 3300014497 | Ga0182008_10028058 | Ga0182008_100280584 | 155 |
| 254 | 3300014745 | Ga0157377_10143062 | Ga0157377_101430622 | 155 |
| 255 | 3300014745 | Ga0157377_10456856 | Ga0157377_104568562 | 155 |
| 256 | 3300014968 | Ga0157379_10009459 | Ga0157379_100094597 | 155 |
| 257 | 3300014968 | Ga0157379_10094019 | Ga0157379_100940192 | 155 |
| 258 | 3300014969 | Ga0157376_10093390 | Ga0157376_100933902 | 155 |
| 259 | 3300014969 | Ga0157376_10435394 | Ga0157376_104353942 | 155 |
| 260 | 3300017792 | Ga0163161_10012976 | Ga0163161_100129765 | 155 |
| 261 | 3300017792 | Ga0163161_10976560 | Ga0163161_109765602 | 155 |
| 262 | 3300025303 | Ga0209051_1101526 | Ga0209051_11015262 | 155 |
| 263 | 3300025315 | Ga0207697_10014624 | Ga0207697_100146244 | 155 |
| 264 | 3300025321 | Ga0207656_10082720 | Ga0207656_100827202 | 155 |
| 265 | 3300025321 | Ga0207656_10276276 | Ga0207656_102762762 | 155 |
| 266 | 3300025893 | Ga0207682_10065180 | Ga0207682_100651802 | 155 |
| 267 | 3300025893 | Ga0207682_10072956 | Ga0207682_100729562 | 155 |
| 268 | 3300025900 | Ga0207710_10042261 | Ga0207710_100422612 | 155 |
| 269 | 3300025901 | Ga0207688_10174679 | Ga0207688_101746791 | 155 |
| 270 | 3300025903 | Ga0207680_10047845 | Ga0207680_100478453 | 155 |
| 271 | 3300025903 | Ga0207680_10815704 | Ga0207680_108157042 | 155 |
| 272 | 3300025907 | Ga0207645_10000353 | Ga0207645_1000035342 | 155 |
| 273 | 3300025907 | Ga0207645_10063743 | Ga0207645_100637432 | 155 |
| 274 | 3300025907 | Ga0207645_10201921 | Ga0207645_102019212 | 155 |
| 275 | 3300025907 | Ga0207645_10352083 | Ga0207645_103520832 | 155 |
| 276 | 3300025907 | Ga0207645_10373452 | Ga0207645_103734522 | 155 |
| 277 | 3300025908 | Ga0207643_10040823 | Ga0207643_100408232 | 155 |
| 278 | 3300025918 | Ga0207662_10105993 | Ga0207662_101059932 | 155 |
| 279 | 3300025918 | Ga0207662_10836794 | Ga0207662_108367942 | 155 |
| 280 | 3300025919 | Ga0207657_10214022 | Ga0207657_102140222 | 155 |
| 281 | 3300025922 | Ga0207646_11085319 | Ga0207646_110853192 | 155 |
| 282 | 3300025923 | Ga0207681_10053876 | Ga0207681_100538763 | 155 |
| 283 | 3300025923 | Ga0207681_10063520 | Ga0207681_100635202 | 155 |
| 284 | 3300025923 | Ga0207681_10090251 | Ga0207681_100902513 | 155 |
| 285 | 3300025924 | Ga0207694_11191781 | Ga0207694_111917812 | 155 |
| 286 | 3300025925 | Ga0207650_10008205 | Ga0207650_100082054 | 155 |
| 287 | 3300025925 | Ga0207650_10008238 | Ga0207650_100082382 | 155 |
| 288 | 3300025925 | Ga0207650_10048413 | Ga0207650_100484133 | 155 |
| 289 | 3300025925 | Ga0207650_10381382 | Ga0207650_103813822 | 155 |
| 290 | 3300025925 | Ga0207650_10511382 | Ga0207650_105113822 | 155 |
| 291 | 3300025926 | Ga0207659_10008089 | Ga0207659_100080892 | 155 |
| 292 | 3300025926 | Ga0207659_10038925 | Ga0207659_100389254 | 155 |
| 293 | 3300025926 | Ga0207659_10735570 | Ga0207659_107355702 | 155 |
| 294 | 3300025927 | Ga0207687_10422575 | Ga0207687_104225752 | 155 |
| 295 | 3300025929 | Ga0207664_10156786 | Ga0207664_101567863 | 155 |
| 296 | 3300025931 | Ga0207644_10406898 | Ga0207644_104068982 | 155 |
| 297 | 3300025932 | Ga0207690_10025592 | Ga0207690_100255923 | 155 |
| 298 | 3300025932 | Ga0207690_10667290 | Ga0207690_106672902 | 155 |
| 299 | 3300025933 | Ga0207706_10534172 | Ga0207706_105341722 | 155 |
| 300 | 3300025933 | Ga0207706_10726527 | Ga0207706_107265271 | 155 |
| 301 | 3300025934 | Ga0207686_10693757 | Ga0207686_106937572 | 155 |
| 302 | 3300025935 | Ga0207709_10198069 | Ga0207709_101980691 | 155 |
| 303 | 3300025935 | Ga0207709_10330897 | Ga0207709_103308972 | 155 |
| 304 | 3300025937 | Ga0207669_10034539 | Ga0207669_100345392 | 155 |
| 305 | 3300025937 | Ga0207669_10144995 | Ga0207669_101449952 | 155 |
| 306 | 3300025938 | Ga0207704_10430602 | Ga0207704_104306022 | 155 |
| 307 | 3300025938 | Ga0207704_10821377 | Ga0207704_108213771 | 155 |
| 308 | 3300025940 | Ga0207691_10000663 | Ga0207691_1000066340 | 155 |
| 309 | 3300025940 | Ga0207691_10050489 | Ga0207691_100504892 | 155 |
| 310 | 3300025940 | Ga0207691_10109541 | Ga0207691_101095412 | 155 |
| 311 | 3300025940 | Ga0207691_10171388 | Ga0207691_101713882 | 155 |
| 312 | 3300025940 | Ga0207691_10369806 | Ga0207691_103698062 | 155 |
| 313 | 3300025940 | Ga0207691_10491045 | Ga0207691_104910452 | 155 |
| 314 | 3300025941 | Ga0207711_10040764 | Ga0207711_100407644 | 155 |
| 315 | 3300025941 | Ga0207711_10098192 | Ga0207711_100981922 | 155 |
| 316 | 3300025942 | Ga0207689_10001242 | Ga0207689_1000124221 | 155 |
| 317 | 3300025942 | Ga0207689_10001481 | Ga0207689_1000148127 | 155 |
| 318 | 3300025942 | Ga0207689_10472313 | Ga0207689_104723132 | 155 |
| 319 | 3300025949 | Ga0207667_10062880 | Ga0207667_100628804 | 155 |
| 320 | 3300025949 | Ga0207667_10168047 | Ga0207667_101680473 | 155 |
| 321 | 3300025960 | Ga0207651_10010046 | Ga0207651_100100462 | 155 |
| 322 | 3300025960 | Ga0207651_10061681 | Ga0207651_100616812 | 155 |
| 323 | 3300025960 | Ga0207651_10265871 | Ga0207651_102658712 | 155 |
| 324 | 3300025961 | Ga0207712_10014061 | Ga0207712_100140615 | 155 |
| 325 | 3300025972 | Ga0207668_10014105 | Ga0207668_100141055 | 155 |
| 326 | 3300025972 | Ga0207668_10017170 | Ga0207668_100171702 | 155 |
| 327 | 3300025972 | Ga0207668_10025357 | Ga0207668_100253571 | 155 |
| 328 | 3300025972 | Ga0207668_10029961 | Ga0207668_100299615 | 155 |
| 329 | 3300025972 | Ga0207668_10126327 | Ga0207668_101263273 | 155 |
| 330 | 3300025972 | Ga0207668_10443229 | Ga0207668_104432292 | 155 |
| 331 | 3300025972 | Ga0207668_10707516 | Ga0207668_107075161 | 155 |
| 332 | 3300025981 | Ga0207640_10104743 | Ga0207640_101047432 | 155 |
| 333 | 3300025986 | Ga0207658_10025111 | Ga0207658_100251116 | 155 |
| 334 | 3300025986 | Ga0207658_10207191 | Ga0207658_102071912 | 155 |
| 335 | 3300025986 | Ga0207658_10500229 | Ga0207658_105002292 | 155 |
| 336 | 3300025986 | Ga0207658_10547720 | Ga0207658_105477201 | 155 |
| 337 | 3300025986 | Ga0207658_10615478 | Ga0207658_106154782 | 155 |
| 338 | 3300026023 | Ga0207677_10012576 | Ga0207677_100125765 | 155 |
| 339 | 3300026023 | Ga0207677_10681177 | Ga0207677_106811772 | 155 |
| 340 | 3300026023 | Ga0207677_10916079 | Ga0207677_109160792 | 155 |
| 341 | 3300026035 | Ga0207703_10003742 | Ga0207703_100037425 | 155 |
| 342 | 3300026035 | Ga0207703_10055465 | Ga0207703_100554654 | 155 |
| 343 | 3300026035 | Ga0207703_10366809 | Ga0207703_103668092 | 155 |
| 344 | 3300026035 | Ga0207703_10652329 | Ga0207703_106523292 | 155 |
| 345 | 3300026075 | Ga0207708_10837132 | Ga0207708_108371322 | 155 |
| 346 | 3300026088 | Ga0207641_10026213 | Ga0207641_100262137 | 155 |
| 347 | 3300026088 | Ga0207641_10039886 | Ga0207641_100398862 | 155 |
| 348 | 3300026088 | Ga0207641_10101619 | Ga0207641_101016193 | 155 |
| 349 | 3300026088 | Ga0207641_10108530 | Ga0207641_101085305 | 155 |
| 350 | 3300026089 | Ga0207648_10004079 | Ga0207648_1000407911 | 155 |
| 351 | 3300026089 | Ga0207648_10058358 | Ga0207648_100583586 | 155 |
| 352 | 3300026089 | Ga0207648_10100032 | Ga0207648_101000322 | 155 |
| 353 | 3300026089 | Ga0207648_10327996 | Ga0207648_103279962 | 155 |
| 354 | 3300026089 | Ga0207648_10643718 | Ga0207648_106437182 | 155 |
| 355 | 3300026095 | Ga0207676_10006171 | Ga0207676_100061719 | 155 |
| 356 | 3300026116 | Ga0207674_10022759 | Ga0207674_100227597 | 155 |
| 357 | 3300026118 | Ga0207675_100007047 | Ga0207675_1000070479 | 155 |
| 358 | 3300026118 | Ga0207675_100020605 | Ga0207675_1000206054 | 155 |
| 359 | 3300026118 | Ga0207675_100065462 | Ga0207675_1000654626 | 155 |
| 360 | 3300026118 | Ga0207675_100186391 | Ga0207675_1001863913 | 155 |
| 361 | 3300026118 | Ga0207675_100385233 | Ga0207675_1003852332 | 155 |
| 362 | 3300026118 | Ga0207675_100926116 | Ga0207675_1009261162 | 155 |
| 363 | 3300026121 | Ga0207683_10001329 | Ga0207683_100013296 | 155 |
| 364 | 3300026142 | Ga0207698_10061081 | Ga0207698_100610813 | 155 |
| 365 | 3300027665 | Ga0209983_1008013 | Ga0209983_10080133 | 155 |
| 366 | 3300028379 | Ga0268266_10047844 | Ga0268266_100478443 | 155 |
| 367 | 3300028379 | Ga0268266_10098506 | Ga0268266_100985062 | 155 |
| 368 | 3300028379 | Ga0268266_11419745 | Ga0268266_114197451 | 155 |
| 369 | 3300028380 | Ga0268265_10021619 | Ga0268265_100216194 | 155 |
| 370 | 3300028380 | Ga0268265_10443750 | Ga0268265_104437502 | 155 |
| 371 | 3300028380 | Ga0268265_11570559 | Ga0268265_115705592 | 155 |
| 372 | 3300028381 | Ga0268264_10000599 | Ga0268264_1000059949 | 155 |
| 373 | 3300028381 | Ga0268264_10047411 | Ga0268264_100474112 | 155 |
| 374 | 3300028381 | Ga0268264_10054399 | Ga0268264_100543994 | 155 |
| 375 | 3300028381 | Ga0268264_10237350 | Ga0268264_102373503 | 155 |
| 376 | 3300028381 | Ga0268264_10500078 | Ga0268264_105000782 | 155 |
| 377 | 3300031242 | Ga0265329_10001643 | Ga0265329_1000164312 | 155 |
| 378 | 3300031249 | Ga0265339_10021396 | Ga0265339_100213965 | 155 |
| 379 | 3300031250 | Ga0265331_10001285 | Ga0265331_100012854 | 155 |
| 380 | 3300031251 | Ga0265327_10001001 | Ga0265327_1000100115 | 155 |
| 381 | 3300031344 | Ga0265316_10106602 | Ga0265316_101066022 | 155 |
| 382 | 3300035724 | Ga0373933_0779056 | Ga0373933_0779056_11_478 | 155 |
| 383 | 3300036401 | Ga0373937_0656953 | Ga0373937_0656953_171_638 | 155 |
| 384 | 3300036401 | Ga0373937_0728404 | Ga0373937_0728404_369_836 | 155 |
| 385 | 3300041443 | Ga0451789_1207960 | Ga0451789_1207960_105_578 | 155 |
| 386 | 3300042461 | Ga0439460_0360968 | Ga0439460_0360968_32_502 | 155 |
| 387 | 3300044673 | Ga0453683_0240838 | Ga0453683_0240838_32_502 | 155 |
| 388 | 3300044842 | Ga0466957_0410301 | Ga0466957_0410301_56_619 | 155 |
| 389 | 3300045051 | Ga0451576_1517030 | Ga0451576_1517030_27_497 | 155 |
| 390 | 3300046537 | Ga0495598_0330834 | Ga0495598_0330834_85_558 | 155 |
| 391 | 3300048909 | Ga0496106_0537427 | Ga0496106_0537427_337_804 | 155 |
| 392 | 3300048909 | Ga0496106_0597617 | Ga0496106_0597617_146_613 | 155 |
| 393 | 3300048911 | Ga0496108_0041432 | Ga0496108_0041432_1398_1865 | 155 |
| 394 | 3300048911 | Ga0496108_0870812 | Ga0496108_0870812_42_533 | 155 |
| 395 | 3300048912 | Ga0496109_0039311 | Ga0496109_0039311_3802_4272 | 155 |
| 396 | 3300048912 | Ga0496109_0203913 | Ga0496109_0203913_1260_1727 | 155 |
| 397 | 3300048912 | Ga0496109_0487068 | Ga0496109_0487068_134_625 | 155 |
| 398 | 3300048912 | Ga0496109_1460047 | Ga0496109_1460047_96_563 | 155 |
| 399 | 3300048914 | Ga0496111_0030457 | Ga0496111_0030457_68_535 | 155 |
| 400 | 3300048915 | Ga0496112_0011743 | Ga0496112_0011743_4166_4633 | 155 |
| 401 | 3300048916 | Ga0496113_0071811 | Ga0496113_0071811_668_1135 | 155 |
| 402 | 3300048917 | Ga0496114_0727272 | Ga0496114_0727272_21_488 | 155 |
| 403 | 3300049824 | Ga0501045_0058873 | Ga0501045_0058873_107_574 | 155 |
| 404 | 3300053085 | Ga0495619_0886515 | Ga0495619_0886515_20_487 | 155 |
| 405 | 3300001979 | JGI24740J21852_10000325 | JGI24740J21852_1000032514 | 156 |
| 406 | 3300002705 | JGI25156J39149_1003651 | JGI25156J39149_10036515 | 156 |
| 407 | 3300002738 | JGI25154J39366_1002218 | JGI25154J39366_10022183 | 156 |
| 408 | 3300002741 | JGI25157J39369_1013572 | JGI25157J39369_10135722 | 156 |
| 409 | 3300003751 | Ga0055538_1005033 | Ga0055538_10050332 | 156 |
| 410 | 3300003752 | Ga0055539_1011770 | Ga0055539_10117702 | 156 |
| 411 | 3300003756 | Ga0055533_1002375 | Ga0055533_10023756 | 156 |
| 412 | 3300003762 | Ga0055542_1000632 | Ga0055542_100063218 | 156 |
| 413 | 3300003841 | Ga0055541_1000952 | Ga0055541_10009525 | 156 |
| 414 | 3300005290 | Ga0065712_10114968 | Ga0065712_101149683 | 156 |
| 415 | 3300005295 | Ga0065707_10541434 | Ga0065707_105414341 | 156 |
| 416 | 3300005327 | Ga0070658_10497416 | Ga0070658_104974162 | 156 |
| 417 | 3300005328 | Ga0070676_10309308 | Ga0070676_103093082 | 156 |
| 418 | 3300005330 | Ga0070690_100003769 | Ga0070690_1000037696 | 156 |
| 419 | 3300005330 | Ga0070690_100229321 | Ga0070690_1002293212 | 156 |
| 420 | 3300005331 | Ga0070670_100125706 | Ga0070670_1001257061 | 156 |
| 421 | 3300005333 | Ga0070677_10050860 | Ga0070677_100508601 | 156 |
| 422 | 3300005334 | Ga0068869_100084360 | Ga0068869_1000843603 | 156 |
| 423 | 3300005335 | Ga0070666_10006099 | Ga0070666_100060992 | 156 |
| 424 | 3300005336 | Ga0070680_100289763 | Ga0070680_1002897632 | 156 |
| 425 | 3300005337 | Ga0070682_100080768 | Ga0070682_1000807681 | 156 |
| 426 | 3300005338 | Ga0068868_100008239 | Ga0068868_1000082396 | 156 |
| 427 | 3300005339 | Ga0070660_100278067 | Ga0070660_1002780672 | 156 |
| 428 | 3300005340 | Ga0070689_100000418 | Ga0070689_10000041819 | 156 |
| 429 | 3300005341 | Ga0070691_10224301 | Ga0070691_102243012 | 156 |
| 430 | 3300005341 | Ga0070691_10267840 | Ga0070691_102678402 | 156 |
| 431 | 3300005345 | Ga0070692_10011872 | Ga0070692_100118725 | 156 |
| 432 | 3300005355 | Ga0070671_100093539 | Ga0070671_1000935394 | 156 |
| 433 | 3300005356 | Ga0070674_100036516 | Ga0070674_1000365162 | 156 |
| 434 | 3300005364 | Ga0070673_100006782 | Ga0070673_1000067828 | 156 |
| 435 | 3300005365 | Ga0070688_100133890 | Ga0070688_1001338903 | 156 |
| 436 | 3300005366 | Ga0070659_100208654 | Ga0070659_1002086542 | 156 |
| 437 | 3300005366 | Ga0070659_100608504 | Ga0070659_1006085042 | 156 |
| 438 | 3300005367 | Ga0070667_100219123 | Ga0070667_1002191232 | 156 |
| 439 | 3300005435 | Ga0070714_100000984 | Ga0070714_10000098422 | 156 |
| 440 | 3300005436 | Ga0070713_100009007 | Ga0070713_1000090076 | 156 |
| 441 | 3300005436 | Ga0070713_100051287 | Ga0070713_1000512873 | 156 |
| 442 | 3300005437 | Ga0070710_10008238 | Ga0070710_100082388 | 156 |
| 443 | 3300005438 | Ga0070701_10166103 | Ga0070701_101661032 | 156 |
| 444 | 3300005439 | Ga0070711_100000407 | Ga0070711_10000040714 | 156 |
| 445 | 3300005440 | Ga0070705_100020267 | Ga0070705_1000202673 | 156 |
| 446 | 3300005440 | Ga0070705_100296477 | Ga0070705_1002964772 | 156 |
| 447 | 3300005441 | Ga0070700_100938336 | Ga0070700_1009383362 | 156 |
| 448 | 3300005444 | Ga0070694_100012031 | Ga0070694_1000120318 | 156 |
| 449 | 3300005444 | Ga0070694_100033886 | Ga0070694_1000338863 | 156 |
| 450 | 3300005444 | Ga0070694_100167543 | Ga0070694_1001675432 | 156 |
| 451 | 3300005445 | Ga0070708_100153791 | Ga0070708_1001537912 | 156 |
| 452 | 3300005455 | Ga0070663_100097236 | Ga0070663_1000972362 | 156 |
| 453 | 3300005456 | Ga0070678_100007067 | Ga0070678_1000070678 | 156 |
| 454 | 3300005457 | Ga0070662_100028893 | Ga0070662_1000288932 | 156 |
| 455 | 3300005459 | Ga0068867_100014508 | Ga0068867_1000145085 | 156 |
| 456 | 3300005459 | Ga0068867_102149421 | Ga0068867_1021494211 | 156 |
| 457 | 3300005466 | Ga0070685_10005507 | Ga0070685_100055076 | 156 |
| 458 | 3300005467 | Ga0070706_100023284 | Ga0070706_1000232844 | 156 |
| 459 | 3300005467 | Ga0070706_100032816 | Ga0070706_1000328163 | 156 |
| 460 | 3300005467 | Ga0070706_100097029 | Ga0070706_1000970292 | 156 |
| 461 | 3300005468 | Ga0070707_100059646 | Ga0070707_1000596463 | 156 |
| 462 | 3300005468 | Ga0070707_100197706 | Ga0070707_1001977062 | 156 |
| 463 | 3300005468 | Ga0070707_100310245 | Ga0070707_1003102453 | 156 |
| 464 | 3300005471 | Ga0070698_100009607 | Ga0070698_1000096077 | 156 |
| 465 | 3300005518 | Ga0070699_100007236 | Ga0070699_1000072365 | 156 |
| 466 | 3300005518 | Ga0070699_100063681 | Ga0070699_1000636814 | 156 |
| 467 | 3300005530 | Ga0070679_100116684 | Ga0070679_1001166843 | 156 |
| 468 | 3300005535 | Ga0070684_100066692 | Ga0070684_1000666923 | 156 |
| 469 | 3300005536 | Ga0070697_100019753 | Ga0070697_1000197534 | 156 |
| 470 | 3300005536 | Ga0070697_100079832 | Ga0070697_1000798322 | 156 |
| 471 | 3300005539 | Ga0068853_100086673 | Ga0068853_1000866733 | 156 |
| 472 | 3300005543 | Ga0070672_100012906 | Ga0070672_1000129063 | 156 |
| 473 | 3300005544 | Ga0070686_100005296 | Ga0070686_1000052964 | 156 |
| 474 | 3300005545 | Ga0070695_100042420 | Ga0070695_1000424203 | 156 |
| 475 | 3300005546 | Ga0070696_100114013 | Ga0070696_1001140132 | 156 |
| 476 | 3300005546 | Ga0070696_100240205 | Ga0070696_1002402052 | 156 |
| 477 | 3300005547 | Ga0070693_100003898 | Ga0070693_1000038984 | 156 |
| 478 | 3300005547 | Ga0070693_100337781 | Ga0070693_1003377812 | 156 |
| 479 | 3300005547 | Ga0070693_100430502 | Ga0070693_1004305022 | 156 |
| 480 | 3300005548 | Ga0070665_100003736 | Ga0070665_10000373612 | 156 |
| 481 | 3300005549 | Ga0070704_100001376 | Ga0070704_10000137617 | 156 |
| 482 | 3300005549 | Ga0070704_100056923 | Ga0070704_1000569233 | 156 |
| 483 | 3300005563 | Ga0068855_100293384 | Ga0068855_1002933842 | 156 |
| 484 | 3300005563 | Ga0068855_101078131 | Ga0068855_1010781312 | 156 |
| 485 | 3300005564 | Ga0070664_100112625 | Ga0070664_1001126252 | 156 |
| 486 | 3300005564 | Ga0070664_100121912 | Ga0070664_1001219122 | 156 |
| 487 | 3300005564 | Ga0070664_101051011 | Ga0070664_1010510112 | 156 |
| 488 | 3300005578 | Ga0068854_100001272 | Ga0068854_10000127210 | 156 |
| 489 | 3300005614 | Ga0068856_100082809 | Ga0068856_1000828093 | 156 |
| 490 | 3300005615 | Ga0070702_100035387 | Ga0070702_1000353873 | 156 |
| 491 | 3300005615 | Ga0070702_100767191 | Ga0070702_1007671912 | 156 |
| 492 | 3300005615 | Ga0070702_101072560 | Ga0070702_1010725601 | 156 |
| 493 | 3300005616 | Ga0068852_100079984 | Ga0068852_1000799843 | 156 |
| 494 | 3300005617 | Ga0068859_100010525 | Ga0068859_1000105254 | 156 |
| 495 | 3300005618 | Ga0068864_100013356 | Ga0068864_10001335610 | 156 |
| 496 | 3300005718 | Ga0068866_10002776 | Ga0068866_100027767 | 156 |
| 497 | 3300005718 | Ga0068866_10128000 | Ga0068866_101280002 | 156 |
| 498 | 3300005834 | Ga0068851_10027126 | Ga0068851_100271263 | 156 |
| 499 | 3300005840 | Ga0068870_10095225 | Ga0068870_100952253 | 156 |
| 500 | 3300005841 | Ga0068863_100000366 | Ga0068863_10000036618 | 156 |
| 501 | 3300005841 | Ga0068863_100742635 | Ga0068863_1007426352 | 156 |
| 502 | 3300005842 | Ga0068858_100003588 | Ga0068858_1000035889 | 156 |
| 503 | 3300005843 | Ga0068860_100046386 | Ga0068860_1000463864 | 156 |
| 504 | 3300006038 | Ga0075365_10048297 | Ga0075365_100482972 | 156 |
| 505 | 3300006042 | Ga0075368_10001442 | Ga0075368_100014425 | 156 |
| 506 | 3300006048 | Ga0075363_100023850 | Ga0075363_1000238505 | 156 |
| 507 | 3300006051 | Ga0075364_10117245 | Ga0075364_101172452 | 156 |
| 508 | 3300006163 | Ga0070715_10004958 | Ga0070715_100049582 | 156 |
| 509 | 3300006173 | Ga0070716_100039004 | Ga0070716_1000390044 | 156 |
| 510 | 3300006175 | Ga0070712_100010551 | Ga0070712_1000105517 | 156 |
| 511 | 3300006175 | Ga0070712_100447972 | Ga0070712_1004479722 | 156 |
| 512 | 3300006177 | Ga0075362_10002143 | Ga0075362_100021435 | 156 |
| 513 | 3300006178 | Ga0075367_10004080 | Ga0075367_100040805 | 156 |
| 514 | 3300006186 | Ga0075369_10030786 | Ga0075369_100307863 | 156 |
| 515 | 3300006195 | Ga0075366_10028375 | Ga0075366_100283753 | 156 |
| 516 | 3300006195 | Ga0075366_10041538 | Ga0075366_100415383 | 156 |
| 517 | 3300006237 | Ga0097621_100037348 | Ga0097621_1000373483 | 156 |
| 518 | 3300006237 | Ga0097621_100198099 | Ga0097621_1001980992 | 156 |
| 519 | 3300006353 | Ga0075370_10000354 | Ga0075370_1000035411 | 156 |
| 520 | 3300006353 | Ga0075370_10090545 | Ga0075370_100905452 | 156 |
| 521 | 3300006358 | Ga0068871_100014108 | Ga0068871_1000141084 | 156 |
| 522 | 3300006358 | Ga0068871_100132647 | Ga0068871_1001326474 | 156 |
| 523 | 3300006844 | Ga0075428_100000089 | Ga0075428_10000008927 | 156 |
| 524 | 3300006852 | Ga0075433_10037026 | Ga0075433_100370265 | 156 |
| 525 | 3300006852 | Ga0075433_10103037 | Ga0075433_101030373 | 156 |
| 526 | 3300006871 | Ga0075434_100072309 | Ga0075434_1000723094 | 156 |
| 527 | 3300006871 | Ga0075434_100222563 | Ga0075434_1002225633 | 156 |
| 528 | 3300006871 | Ga0075434_100724688 | Ga0075434_1007246882 | 156 |
| 529 | 3300006880 | Ga0075429_100004777 | Ga0075429_1000047778 | 156 |
| 530 | 3300006881 | Ga0068865_100049867 | Ga0068865_1000498673 | 156 |
| 531 | 3300006914 | Ga0075436_100091180 | Ga0075436_1000911803 | 156 |
| 532 | 3300006931 | Ga0097620_100010526 | Ga0097620_1000105264 | 156 |
| 533 | 3300007076 | Ga0075435_100019130 | Ga0075435_1000191304 | 156 |
| 534 | 3300007265 | Ga0099794_10047706 | Ga0099794_100477062 | 156 |
| 535 | 3300007788 | Ga0099795_10002497 | Ga0099795_100024973 | 156 |
| 536 | 3300009093 | Ga0105240_10035226 | Ga0105240_100352268 | 156 |
| 537 | 3300009094 | Ga0111539_10040592 | Ga0111539_100405923 | 156 |
| 538 | 3300009098 | Ga0105245_10015183 | Ga0105245_100151835 | 156 |
| 539 | 3300009098 | Ga0105245_10029140 | Ga0105245_100291406 | 156 |
| 540 | 3300009098 | Ga0105245_10061915 | Ga0105245_100619153 | 156 |
| 541 | 3300009098 | Ga0105245_10086123 | Ga0105245_100861233 | 156 |
| 542 | 3300009101 | Ga0105247_10003683 | Ga0105247_100036834 | 156 |
| 543 | 3300009148 | Ga0105243_10120724 | Ga0105243_101207242 | 156 |
| 544 | 3300009148 | Ga0105243_10392432 | Ga0105243_103924322 | 156 |
| 545 | 3300009174 | Ga0105241_10007877 | Ga0105241_100078779 | 156 |
| 546 | 3300009174 | Ga0105241_10125568 | Ga0105241_101255683 | 156 |
| 547 | 3300009174 | Ga0105241_10612110 | Ga0105241_106121102 | 156 |
| 548 | 3300009174 | Ga0105241_11493905 | Ga0105241_114939052 | 156 |
| 549 | 3300009176 | Ga0105242_10012139 | Ga0105242_100121396 | 156 |
| 550 | 3300009176 | Ga0105242_10428098 | Ga0105242_104280983 | 156 |
| 551 | 3300009176 | Ga0105242_10775587 | Ga0105242_107755872 | 156 |
| 552 | 3300009177 | Ga0105248_10021616 | Ga0105248_100216166 | 156 |
| 553 | 3300009177 | Ga0105248_10358060 | Ga0105248_103580602 | 156 |
| 554 | 3300009545 | Ga0105237_10184058 | Ga0105237_101840583 | 156 |
| 555 | 3300009545 | Ga0105237_11456812 | Ga0105237_114568122 | 156 |
| 556 | 3300009551 | Ga0105238_10094474 | Ga0105238_100944742 | 156 |
| 557 | 3300009551 | Ga0105238_10394548 | Ga0105238_103945482 | 156 |
| 558 | 3300009551 | Ga0105238_10871567 | Ga0105238_108715671 | 156 |
| 559 | 3300010375 | Ga0105239_10064179 | Ga0105239_100641794 | 156 |
| 560 | 3300011119 | Ga0105246_10004097 | Ga0105246_100040979 | 156 |
| 561 | 3300011119 | Ga0105246_10065272 | Ga0105246_100652722 | 156 |
| 562 | 3300013100 | Ga0157373_10112346 | Ga0157373_101123462 | 156 |
| 563 | 3300013102 | Ga0157371_10157396 | Ga0157371_101573962 | 156 |
| 564 | 3300013104 | Ga0157370_10014165 | Ga0157370_1001416511 | 156 |
| 565 | 3300013296 | Ga0157374_10005148 | Ga0157374_100051487 | 156 |
| 566 | 3300013296 | Ga0157374_10159531 | Ga0157374_101595313 | 156 |
| 567 | 3300013297 | Ga0157378_10005782 | Ga0157378_100057829 | 156 |
| 568 | 3300013297 | Ga0157378_10050737 | Ga0157378_100507376 | 156 |
| 569 | 3300013297 | Ga0157378_10504597 | Ga0157378_105045972 | 156 |
| 570 | 3300013297 | Ga0157378_10582368 | Ga0157378_105823682 | 156 |
| 571 | 3300013306 | Ga0163162_10025069 | Ga0163162_100250696 | 156 |
| 572 | 3300013306 | Ga0163162_10064590 | Ga0163162_100645904 | 156 |
| 573 | 3300013307 | Ga0157372_10316358 | Ga0157372_103163582 | 156 |
| 574 | 3300013308 | Ga0157375_10140435 | Ga0157375_101404354 | 156 |
| 575 | 3300013308 | Ga0157375_10415281 | Ga0157375_104152813 | 156 |
| 576 | 3300014325 | Ga0163163_10019473 | Ga0163163_100194736 | 156 |
| 577 | 3300014497 | Ga0182008_10271996 | Ga0182008_102719962 | 156 |
| 578 | 3300014745 | Ga0157377_10003422 | Ga0157377_100034223 | 156 |
| 579 | 3300014968 | Ga0157379_10019451 | Ga0157379_100194516 | 156 |
| 580 | 3300014969 | Ga0157376_10026475 | Ga0157376_100264753 | 156 |
| 581 | 3300014969 | Ga0157376_10028239 | Ga0157376_100282392 | 156 |
| 582 | 3300017792 | Ga0163161_10575871 | Ga0163161_105758712 | 156 |
| 583 | 3300021361 | Ga0213872_10000532 | Ga0213872_1000053216 | 156 |
| 584 | 3300021361 | Ga0213872_10004390 | Ga0213872_100043903 | 156 |
| 585 | 3300021361 | Ga0213872_10005558 | Ga0213872_100055587 | 156 |
| 586 | 3300021384 | Ga0213876_10266176 | Ga0213876_102661762 | 156 |
| 587 | 3300025224 | Ga0209784_100537 | Ga0209784_1005376 | 156 |
| 588 | 3300025225 | Ga0209566_100235 | Ga0209566_10023522 | 156 |
| 589 | 3300025226 | Ga0209674_100250 | Ga0209674_10025037 | 156 |
| 590 | 3300025230 | Ga0209563_103766 | Ga0209563_1037664 | 156 |
| 591 | 3300025242 | Ga0209258_106236 | Ga0209258_1062362 | 156 |
| 592 | 3300025246 | Ga0209646_1000119 | Ga0209646_100011991 | 156 |
| 593 | 3300025250 | Ga0209026_1004177 | Ga0209026_10041775 | 156 |
| 594 | 3300025253 | Ga0209677_102981 | Ga0209677_1029813 | 156 |
| 595 | 3300025254 | Ga0209148_1000451 | Ga0209148_100045129 | 156 |
| 596 | 3300025256 | Ga0209759_1006344 | Ga0209759_10063443 | 156 |
| 597 | 3300025272 | Ga0209455_1000447 | Ga0209455_10004479 | 156 |
| 598 | 3300025321 | Ga0207656_10042160 | Ga0207656_100421602 | 156 |
| 599 | 3300025893 | Ga0207682_10019707 | Ga0207682_100197074 | 156 |
| 600 | 3300025898 | Ga0207692_10009535 | Ga0207692_100095354 | 156 |
| 601 | 3300025898 | Ga0207692_10111139 | Ga0207692_101111392 | 156 |
| 602 | 3300025898 | Ga0207692_10142830 | Ga0207692_101428302 | 156 |
| 603 | 3300025899 | Ga0207642_10000532 | Ga0207642_100005327 | 156 |
| 604 | 3300025899 | Ga0207642_10380857 | Ga0207642_103808572 | 156 |
| 605 | 3300025900 | Ga0207710_10006893 | Ga0207710_100068937 | 156 |
| 606 | 3300025903 | Ga0207680_10004492 | Ga0207680_100044924 | 156 |
| 607 | 3300025903 | Ga0207680_10168460 | Ga0207680_101684602 | 156 |
| 608 | 3300025906 | Ga0207699_10262319 | Ga0207699_102623192 | 156 |
| 609 | 3300025906 | Ga0207699_10270118 | Ga0207699_102701182 | 156 |
| 610 | 3300025907 | Ga0207645_10114291 | Ga0207645_101142912 | 156 |
| 611 | 3300025908 | Ga0207643_10681271 | Ga0207643_106812712 | 156 |
| 612 | 3300025910 | Ga0207684_10037180 | Ga0207684_100371804 | 156 |
| 613 | 3300025910 | Ga0207684_10140723 | Ga0207684_101407232 | 156 |
| 614 | 3300025910 | Ga0207684_10400161 | Ga0207684_104001612 | 156 |
| 615 | 3300025911 | Ga0207654_10031392 | Ga0207654_100313923 | 156 |
| 616 | 3300025911 | Ga0207654_10236136 | Ga0207654_102361362 | 156 |
| 617 | 3300025911 | Ga0207654_10540660 | Ga0207654_105406602 | 156 |
| 618 | 3300025912 | Ga0207707_10126797 | Ga0207707_101267973 | 156 |
| 619 | 3300025913 | Ga0207695_10054177 | Ga0207695_100541777 | 156 |
| 620 | 3300025916 | Ga0207663_10004116 | Ga0207663_100041164 | 156 |
| 621 | 3300025918 | Ga0207662_10128207 | Ga0207662_101282072 | 156 |
| 622 | 3300025919 | Ga0207657_10000469 | Ga0207657_1000046937 | 156 |
| 623 | 3300025920 | Ga0207649_10378732 | Ga0207649_103787322 | 156 |
| 624 | 3300025922 | Ga0207646_10039160 | Ga0207646_100391604 | 156 |
| 625 | 3300025922 | Ga0207646_10076372 | Ga0207646_100763724 | 156 |
| 626 | 3300025924 | Ga0207694_10284818 | Ga0207694_102848182 | 156 |
| 627 | 3300025924 | Ga0207694_10334152 | Ga0207694_103341522 | 156 |
| 628 | 3300025927 | Ga0207687_10003673 | Ga0207687_100036739 | 156 |
| 629 | 3300025927 | Ga0207687_10021201 | Ga0207687_100212016 | 156 |
| 630 | 3300025927 | Ga0207687_10069916 | Ga0207687_100699162 | 156 |
| 631 | 3300025928 | Ga0207700_10011674 | Ga0207700_100116743 | 156 |
| 632 | 3300025928 | Ga0207700_10022931 | Ga0207700_100229314 | 156 |
| 633 | 3300025928 | Ga0207700_10149973 | Ga0207700_101499733 | 156 |
| 634 | 3300025929 | Ga0207664_10007905 | Ga0207664_100079055 | 156 |
| 635 | 3300025929 | Ga0207664_10165695 | Ga0207664_101656952 | 156 |
| 636 | 3300025931 | Ga0207644_10042177 | Ga0207644_100421773 | 156 |
| 637 | 3300025931 | Ga0207644_10074912 | Ga0207644_100749122 | 156 |
| 638 | 3300025931 | Ga0207644_10776377 | Ga0207644_107763772 | 156 |
| 639 | 3300025933 | Ga0207706_10003781 | Ga0207706_100037815 | 156 |
| 640 | 3300025933 | Ga0207706_10452991 | Ga0207706_104529912 | 156 |
| 641 | 3300025934 | Ga0207686_10000387 | Ga0207686_1000038710 | 156 |
| 642 | 3300025934 | Ga0207686_10165567 | Ga0207686_101655672 | 156 |
| 643 | 3300025934 | Ga0207686_10620895 | Ga0207686_106208951 | 156 |
| 644 | 3300025935 | Ga0207709_10110266 | Ga0207709_101102662 | 156 |
| 645 | 3300025935 | Ga0207709_10163629 | Ga0207709_101636292 | 156 |
| 646 | 3300025936 | Ga0207670_10014520 | Ga0207670_100145204 | 156 |
| 647 | 3300025937 | Ga0207669_10191869 | Ga0207669_101918692 | 156 |
| 648 | 3300025938 | Ga0207704_10072045 | Ga0207704_100720452 | 156 |
| 649 | 3300025938 | Ga0207704_10870953 | Ga0207704_108709532 | 156 |
| 650 | 3300025939 | Ga0207665_10006073 | Ga0207665_100060734 | 156 |
| 651 | 3300025939 | Ga0207665_10434857 | Ga0207665_104348571 | 156 |
| 652 | 3300025940 | Ga0207691_10040229 | Ga0207691_100402295 | 156 |
| 653 | 3300025941 | Ga0207711_10002569 | Ga0207711_100025696 | 156 |
| 654 | 3300025941 | Ga0207711_10291241 | Ga0207711_102912412 | 156 |
| 655 | 3300025942 | Ga0207689_10158269 | Ga0207689_101582692 | 156 |
| 656 | 3300025944 | Ga0207661_10501512 | Ga0207661_105015121 | 156 |
| 657 | 3300025945 | Ga0207679_10137358 | Ga0207679_101373582 | 156 |
| 658 | 3300025945 | Ga0207679_10965150 | Ga0207679_109651501 | 156 |
| 659 | 3300025949 | Ga0207667_10127515 | Ga0207667_101275155 | 156 |
| 660 | 3300025960 | Ga0207651_10006044 | Ga0207651_100060446 | 156 |
| 661 | 3300025981 | Ga0207640_10032590 | Ga0207640_100325904 | 156 |
| 662 | 3300025981 | Ga0207640_10046407 | Ga0207640_100464073 | 156 |
| 663 | 3300025986 | Ga0207658_10007145 | Ga0207658_100071454 | 156 |
| 664 | 3300025986 | Ga0207658_10036223 | Ga0207658_100362234 | 156 |
| 665 | 3300026023 | Ga0207677_10001127 | Ga0207677_1000112713 | 156 |
| 666 | 3300026023 | Ga0207677_10015239 | Ga0207677_100152393 | 156 |
| 667 | 3300026035 | Ga0207703_10001000 | Ga0207703_1000100024 | 156 |
| 668 | 3300026078 | Ga0207702_10015292 | Ga0207702_100152922 | 156 |
| 669 | 3300026088 | Ga0207641_10004677 | Ga0207641_1000467712 | 156 |
| 670 | 3300026089 | Ga0207648_10019548 | Ga0207648_100195485 | 156 |
| 671 | 3300026095 | Ga0207676_10001564 | Ga0207676_1000156415 | 156 |
| 672 | 3300026116 | Ga0207674_10003455 | Ga0207674_1000345518 | 156 |
| 673 | 3300026118 | Ga0207675_100181547 | Ga0207675_1001815473 | 156 |
| 674 | 3300026121 | Ga0207683_10006146 | Ga0207683_100061468 | 156 |
| 675 | 3300026142 | Ga0207698_10109181 | Ga0207698_101091812 | 156 |
| 676 | 3300026142 | Ga0207698_10556232 | Ga0207698_105562322 | 156 |
| 677 | 3300027360 | Ga0209969_1003353 | Ga0209969_10033534 | 156 |
| 678 | 3300027462 | Ga0210000_1004547 | Ga0210000_10045473 | 156 |
| 679 | 3300027471 | Ga0209995_1000491 | Ga0209995_10004917 | 156 |
| 680 | 3300027512 | Ga0209179_1000305 | Ga0209179_10003056 | 156 |
| 681 | 3300027543 | Ga0209999_1006836 | Ga0209999_10068362 | 156 |
| 682 | 3300027614 | Ga0209970_1010143 | Ga0209970_10101433 | 156 |
| 683 | 3300027671 | Ga0209588_1024436 | Ga0209588_10244362 | 156 |
| 684 | 3300027671 | Ga0209588_1042178 | Ga0209588_10421782 | 156 |
| 685 | 3300027682 | Ga0209971_1015938 | Ga0209971_10159383 | 156 |
| 686 | 3300027876 | Ga0209974_10001876 | Ga0209974_100018769 | 156 |
| 687 | 3300027907 | Ga0207428_10003173 | Ga0207428_1000317310 | 156 |
| 688 | 3300028379 | Ga0268266_10008012 | Ga0268266_1000801210 | 156 |
| 689 | 3300028379 | Ga0268266_10198834 | Ga0268266_101988342 | 156 |
| 690 | 3300028381 | Ga0268264_10028221 | Ga0268264_100282214 | 156 |
| 691 | 3300028381 | Ga0268264_10061543 | Ga0268264_100615433 | 156 |
| 692 | 3300028794 | Ga0307515_10017116 | Ga0307515_100171166 | 156 |
| 693 | 3300031241 | Ga0265325_10003550 | Ga0265325_1000355012 | 156 |
| 694 | 3300031241 | Ga0265325_10050077 | Ga0265325_100500773 | 156 |
| 695 | 3300031251 | Ga0265327_10034992 | Ga0265327_100349924 | 156 |
| 696 | 3300031456 | Ga0307513_10000029 | Ga0307513_10000029160 | 156 |
| 697 | 3300031548 | Ga0307408_100436312 | Ga0307408_1004363122 | 156 |
| 698 | 3300031730 | Ga0307516_10000303 | Ga0307516_1000030345 | 156 |
| 699 | 3300032133 | Ga0316583_10001434 | Ga0316583_100014347 | 156 |
| 700 | 3300033179 | Ga0307507_10022145 | Ga0307507_100221455 | 156 |
| 701 | 3300035083 | Ga0373926_0047206 | Ga0373926_0047206_612_1082 | 156 |
| 702 | 3300035086 | Ga0373934_0000473 | Ga0373934_0000473_4516_4989 | 156 |
| 703 | 3300035086 | Ga0373934_0008715 | Ga0373934_0008715_1963_2433 | 156 |
| 704 | 3300035111 | Ga0373923_0005607 | Ga0373923_0005607_504_974 | 156 |
| 705 | 3300035113 | Ga0373936_0091754 | Ga0373936_0091754_704_1183 | 156 |
| 706 | 3300035116 | Ga0373945_0015047 | Ga0373945_0015047_1476_1946 | 156 |
| 707 | 3300035116 | Ga0373945_0147620 | Ga0373945_0147620_241_711 | 156 |
| 708 | 3300035116 | Ga0373945_0256122 | Ga0373945_0256122_138_608 | 156 |
| 709 | 3300035117 | Ga0373953_0084590 | Ga0373953_0084590_829_1299 | 156 |
| 710 | 3300035118 | Ga0373954_0002521 | Ga0373954_0002521_685_1158 | 156 |
| 711 | 3300035118 | Ga0373954_0024323 | Ga0373954_0024323_1227_1697 | 156 |
| 712 | 3300035119 | Ga0373956_0000957 | Ga0373956_0000957_5048_5521 | 156 |
| 713 | 3300035119 | Ga0373956_0088654 | Ga0373956_0088654_167_637 | 156 |
| 714 | 3300035119 | Ga0373956_0095263 | Ga0373956_0095263_496_966 | 156 |
| 715 | 3300035120 | Ga0373957_0005485 | Ga0373957_0005485_2417_2887 | 156 |
| 716 | 3300035170 | Ga0373943_0018692 | Ga0373943_0018692_1333_1803 | 156 |
| 717 | 3300035171 | Ga0373946_0055723 | Ga0373946_0055723_797_1267 | 156 |
| 718 | 3300035171 | Ga0373946_0232834 | Ga0373946_0232834_250_720 | 156 |
| 719 | 3300035172 | Ga0373955_0006355 | Ga0373955_0006355_4126_4596 | 156 |
| 720 | 3300035172 | Ga0373955_0433017 | Ga0373955_0433017_269_742 | 156 |
| 721 | 3300035172 | Ga0373955_0572070 | Ga0373955_0572070_16_486 | 156 |
| 722 | 3300035398 | Ga0316574_0800008 | Ga0316574_0800008_40_513 | 156 |
| 723 | 3300035410 | Ga0373924_0039528 | Ga0373924_0039528_364_834 | 156 |
| 724 | 3300035692 | Ga0373935_0015505 | Ga0373935_0015505_671_1141 | 156 |
| 725 | 3300035692 | Ga0373935_0029012 | Ga0373935_0029012_312_791 | 156 |
| 726 | 3300035692 | Ga0373935_0120482 | Ga0373935_0120482_612_1082 | 156 |
| 727 | 3300035695 | Ga0373927_0006948 | Ga0373927_0006948_591_1070 | 156 |
| 728 | 3300035695 | Ga0373927_0019634 | Ga0373927_0019634_1873_2400 | 156 |
| 729 | 3300035695 | Ga0373927_0051639 | Ga0373927_0051639_1588_2058 | 156 |
| 730 | 3300035695 | Ga0373927_0598130 | Ga0373927_0598130_80_556 | 156 |
| 731 | 3300035724 | Ga0373933_0000611 | Ga0373933_0000611_16536_17009 | 156 |
| 732 | 3300035724 | Ga0373933_0026162 | Ga0373933_0026162_1192_1662 | 156 |
| 733 | 3300035724 | Ga0373933_0232352 | Ga0373933_0232352_595_1068 | 156 |
| 734 | 3300035725 | Ga0373947_0037736 | Ga0373947_0037736_568_1038 | 156 |
| 735 | 3300035725 | Ga0373947_0351225 | Ga0373947_0351225_113_583 | 156 |
| 736 | 3300035725 | Ga0373947_0584075 | Ga0373947_0584075_202_672 | 156 |
| 737 | 3300036401 | Ga0373937_0003380 | Ga0373937_0003380_8003_8476 | 156 |
| 738 | 3300036401 | Ga0373937_0046469 | Ga0373937_0046469_3264_3734 | 156 |
| 739 | 3300036401 | Ga0373937_0403794 | Ga0373937_0403794_658_1128 | 156 |
| 740 | 3300036712 | Ga0316584_0071932 | Ga0316584_0071932_286_759 | 156 |
| 741 | 3300037068 | Ga0373925_0014584 | Ga0373925_0014584_2448_2927 | 156 |
| 742 | 3300037068 | Ga0373925_0036052 | Ga0373925_0036052_1567_2037 | 156 |
| 743 | 3300037068 | Ga0373925_0037105 | Ga0373925_0037105_2854_3324 | 156 |
| 744 | 3300037068 | Ga0373925_0089328 | Ga0373925_0089328_1719_2189 | 156 |
| 745 | 3300037068 | Ga0373925_0095569 | Ga0373925_0095569_1779_2249 | 156 |
| 746 | 3300039437 | Ga0436365_1616668 | Ga0436365_1616668_5578_6159 | 156 |
| 747 | 3300039447 | Ga0436361_0145606 | Ga0436361_0145606_768_1256 | 156 |
| 748 | 3300039447 | Ga0436361_0608475 | Ga0436361_0608475_1635_2135 | 156 |
| 749 | 3300039447 | Ga0436361_0632156 | Ga0436361_0632156_17220_17708 | 156 |
| 750 | 3300039447 | Ga0436361_0644637 | Ga0436361_0644637_194_697 | 156 |
| 751 | 3300039447 | Ga0436361_1108147 | Ga0436361_1108147_7128_7628 | 156 |
| 752 | 3300041413 | Ga0439465_0118026 | Ga0439465_0118026_97_570 | 156 |
| 753 | 3300041460 | Ga0451802_0735006 | Ga0451802_0735006_174_668 | 156 |
| 754 | 3300041463 | Ga0451804_0176278 | Ga0451804_0176278_51_527 | 156 |
| 755 | 3300041511 | Ga0451855_0297688 | Ga0451855_0297688_1186_1659 | 156 |
| 756 | 3300042435 | Ga0439434_0345487 | Ga0439434_0345487_22_498 | 156 |
| 757 | 3300042439 | Ga0439464_0170877 | Ga0439464_0170877_146_628 | 156 |
| 758 | 3300042876 | Ga0451577_0488364 | Ga0451577_0488364_255_731 | 156 |
| 759 | 3300042876 | Ga0451577_1166407 | Ga0451577_1166407_103_588 | 156 |
| 760 | 3300042993 | Ga0439440_0136234 | Ga0439440_0136234_89_565 | 156 |
| 761 | 3300044656 | Ga0466969_0014206 | Ga0466969_0014206_1023_1661 | 156 |
| 762 | 3300044656 | Ga0466969_0019480 | Ga0466969_0019480_2202_2708 | 156 |
| 763 | 3300044668 | Ga0466980_0179596 | Ga0466980_0179596_785_1360 | 156 |
| 764 | 3300044673 | Ga0453683_0130728 | Ga0453683_0130728_329_808 | 156 |
| 765 | 3300044683 | Ga0466965_0071872 | Ga0466965_0071872_288_761 | 156 |
| 766 | 3300044683 | Ga0466965_0767703 | Ga0466965_0767703_34_540 | 156 |
| 767 | 3300044684 | Ga0466966_0010001 | Ga0466966_0010001_1161_1799 | 156 |
| 768 | 3300044693 | Ga0466961_0001479 | Ga0466961_0001479_2185_2691 | 156 |
| 769 | 3300044693 | Ga0466961_0018442 | Ga0466961_0018442_2986_3624 | 156 |
| 770 | 3300044712 | Ga0453684_0000014 | Ga0453684_0000014_745054_745533 | 156 |
| 771 | 3300044712 | Ga0453684_0000566 | Ga0453684_0000566_29556_30026 | 156 |
| 772 | 3300044712 | Ga0453684_0001602 | Ga0453684_0001602_18645_19124 | 156 |
| 773 | 3300044712 | Ga0453684_0003881 | Ga0453684_0003881_19450_19929 | 156 |
| 774 | 3300044712 | Ga0453684_1785371 | Ga0453684_1785371_133_612 | 156 |
| 775 | 3300044765 | Ga0466970_0029628 | Ga0466970_0029628_655_1293 | 156 |
| 776 | 3300044842 | Ga0466957_0069405 | Ga0466957_0069405_797_1270 | 156 |
| 777 | 3300045049 | Ga0466959_0001388 | Ga0466959_0001388_6393_7031 | 156 |
| 778 | 3300045049 | Ga0466959_0030981 | Ga0466959_0030981_35_541 | 156 |
| 779 | 3300045049 | Ga0466959_0076196 | Ga0466959_0076196_1882_2388 | 156 |
| 780 | 3300045051 | Ga0451576_0000313 | Ga0451576_0000313_19262_19741 | 156 |
| 781 | 3300045976 | Ga0466967_1486977 | Ga0466967_1486977_122_595 | 156 |
| 782 | 3300046454 | Ga0495592_0113429 | Ga0495592_0113429_215_688 | 156 |
| 783 | 3300046462 | Ga0495651_0000274 | Ga0495651_0000274_8917_9390 | 156 |
| 784 | 3300046462 | Ga0495651_0099703 | Ga0495651_0099703_791_1261 | 156 |
| 785 | 3300046463 | Ga0495653_0042203 | Ga0495653_0042203_2802_3272 | 156 |
| 786 | 3300046472 | Ga0495580_0026400 | Ga0495580_0026400_1290_1760 | 156 |
| 787 | 3300046473 | Ga0495582_0040091 | Ga0495582_0040091_1530_2000 | 156 |
| 788 | 3300046473 | Ga0495582_0055742 | Ga0495582_0055742_935_1405 | 156 |
| 789 | 3300046476 | Ga0495662_0121474 | Ga0495662_0121474_565_1035 | 156 |
| 790 | 3300046477 | Ga0495664_0009419 | Ga0495664_0009419_142_612 | 156 |
| 791 | 3300046516 | Ga0495628_0019972 | Ga0495628_0019972_2840_3313 | 156 |
| 792 | 3300046516 | Ga0495628_0190111 | Ga0495628_0190111_374_844 | 156 |
| 793 | 3300046517 | Ga0495630_0301730 | Ga0495630_0301730_564_1034 | 156 |
| 794 | 3300046531 | Ga0495665_0031800 | Ga0495665_0031800_1393_1863 | 156 |
| 795 | 3300046531 | Ga0495665_0102904 | Ga0495665_0102904_68_538 | 156 |
| 796 | 3300046533 | Ga0495640_0077917 | Ga0495640_0077917_1432_1902 | 156 |
| 797 | 3300046535 | Ga0495586_0168594 | Ga0495586_0168594_618_1088 | 156 |
| 798 | 3300046536 | Ga0495587_0064444 | Ga0495587_0064444_1366_1836 | 156 |
| 799 | 3300046536 | Ga0495587_0333263 | Ga0495587_0333263_109_582 | 156 |
| 800 | 3300046539 | Ga0495621_0043624 | Ga0495621_0043624_261_731 | 156 |
| 801 | 3300046543 | Ga0495645_0000247 | Ga0495645_0000247_34125_34598 | 156 |
| 802 | 3300046543 | Ga0495645_0266309 | Ga0495645_0266309_586_1056 | 156 |
| 803 | 3300046543 | Ga0495645_0282302 | Ga0495645_0282302_258_728 | 156 |
| 804 | 3300046559 | Ga0495667_0076342 | Ga0495667_0076342_574_1044 | 156 |
| 805 | 3300046559 | Ga0495667_0331651 | Ga0495667_0331651_141_614 | 156 |
| 806 | 3300046663 | Ga0495635_0013237 | Ga0495635_0013237_3624_4094 | 156 |
| 807 | 3300046663 | Ga0495635_0381952 | Ga0495635_0381952_210_686 | 156 |
| 808 | 3300046675 | Ga0495657_0104613 | Ga0495657_0104613_488_958 | 156 |
| 809 | 3300046675 | Ga0495657_0126857 | Ga0495657_0126857_831_1304 | 156 |
| 810 | 3300046681 | Ga0495647_0011345 | Ga0495647_0011345_2129_2599 | 156 |
| 811 | 3300046681 | Ga0495647_0022683 | Ga0495647_0022683_669_1139 | 156 |
| 812 | 3300046683 | Ga0495658_0035942 | Ga0495658_0035942_1624_2094 | 156 |
| 813 | 3300046683 | Ga0495658_0060732 | Ga0495658_0060732_925_1395 | 156 |
| 814 | 3300046689 | Ga0495613_0259707 | Ga0495613_0259707_464_934 | 156 |
| 815 | 3300047315 | Ga0495581_0003832 | Ga0495581_0003832_1368_1838 | 156 |
| 816 | 3300047317 | Ga0495604_0683038 | Ga0495604_0683038_109_582 | 156 |
| 817 | 3300047319 | Ga0495674_0039081 | Ga0495674_0039081_2343_2813 | 156 |
| 818 | 3300047322 | Ga0495680_0109999 | Ga0495680_0109999_1420_1890 | 156 |
| 819 | 3300047322 | Ga0495680_0139771 | Ga0495680_0139771_150_623 | 156 |
| 820 | 3300047322 | Ga0495680_0257151 | Ga0495680_0257151_329_802 | 156 |
| 821 | 3300047444 | Ga0495675_0063141 | Ga0495675_0063141_13_483 | 156 |
| 822 | 3300047445 | Ga0495677_0110185 | Ga0495677_0110185_458_928 | 156 |
| 823 | 3300047471 | Ga0495684_0025419 | Ga0495684_0025419_2692_3162 | 156 |
| 824 | 3300047471 | Ga0495684_0452761 | Ga0495684_0452761_165_635 | 156 |
| 825 | 3300048089 | Ga0495614_0008587 | Ga0495614_0008587_3156_3626 | 156 |
| 826 | 3300048903 | Ga0496100_0030650 | Ga0496100_0030650_1496_1966 | 156 |
| 827 | 3300048904 | Ga0496101_0026167 | Ga0496101_0026167_241_711 | 156 |
| 828 | 3300048905 | Ga0496102_0062616 | Ga0496102_0062616_25_495 | 156 |
| 829 | 3300048905 | Ga0496102_0253850 | Ga0496102_0253850_66_587 | 156 |
| 830 | 3300048906 | Ga0496103_0052493 | Ga0496103_0052493_691_1161 | 156 |
| 831 | 3300048908 | Ga0496105_0001094 | Ga0496105_0001094_12973_13443 | 156 |
| 832 | 3300048909 | Ga0496106_0585094 | Ga0496106_0585094_396_866 | 156 |
| 833 | 3300048910 | Ga0496107_0063175 | Ga0496107_0063175_1725_2195 | 156 |
| 834 | 3300048912 | Ga0496109_0021225 | Ga0496109_0021225_1609_2079 | 156 |
| 835 | 3300048915 | Ga0496112_0054119 | Ga0496112_0054119_3109_3579 | 156 |
| 836 | 3300048915 | Ga0496112_0059588 | Ga0496112_0059588_2405_2875 | 156 |
| 837 | 3300048917 | Ga0496114_0043224 | Ga0496114_0043224_2230_2700 | 156 |
| 838 | 3300048919 | Ga0496116_0068850 | Ga0496116_0068850_366_887 | 156 |
| 839 | 3300048920 | Ga0496117_0009792 | Ga0496117_0009792_5513_6013 | 156 |
| 840 | 3300048921 | Ga0496118_0011294 | Ga0496118_0011294_3576_4076 | 156 |
| 841 | 3300048922 | Ga0496119_0035656 | Ga0496119_0035656_2343_2843 | 156 |
| 842 | 3300049575 | Ga0501039_0427389 | Ga0501039_0427389_464_943 | 156 |
| 843 | 3300049583 | Ga0501067_0060185 | Ga0501067_0060185_1430_1951 | 156 |
| 844 | 3300049588 | Ga0501072_0746572 | Ga0501072_0746572_51_530 | 156 |
| 845 | 3300049592 | Ga0501076_0630741 | Ga0501076_0630741_109_588 | 156 |
| 846 | 3300049743 | Ga0501081_0182101 | Ga0501081_0182101_784_1263 | 156 |
| 847 | 3300049822 | Ga0501035_0029965 | Ga0501035_0029965_2393_2899 | 156 |
| 848 | 3300049823 | Ga0501044_0000316 | Ga0501044_0000316_14191_14697 | 156 |
| 849 | 3300050489 | nmdc:mga03683_31474_c1 | nmdc:mga03683_31474_c1_1358_1966 | 156 |
| 850 | 3300050490 | nmdc:mga03n38_3166_c1 | nmdc:mga03n38_3166_c1_1857_2465 | 156 |
| 851 | 3300050491 | nmdc:mga00v17_14509_c1 | nmdc:mga00v17_14509_c1_2906_3514 | 156 |
| 852 | 3300050492 | nmdc:mga0yw44_18844_c1 | nmdc:mga0yw44_18844_c1_1257_1844 | 156 |
| 853 | 3300050492 | nmdc:mga0yw44_74869_c1 | nmdc:mga0yw44_74869_c1_616_1224 | 156 |
| 854 | 3300050493 | nmdc:mga0k408_27521_c1 | nmdc:mga0k408_27521_c1_1768_2262 | 156 |
| 855 | 3300050493 | nmdc:mga0k408_57744_c1 | nmdc:mga0k408_57744_c1_1606_2097 | 156 |
| 856 | 3300050493 | nmdc:mga0k408_7709_c1 | nmdc:mga0k408_7709_c1_3430_4038 | 156 |
| 857 | 3300050494 | nmdc:mga06z11_16232_c1 | nmdc:mga06z11_16232_c1_1037_1645 | 156 |
| 858 | 3300050495 | nmdc:mga04h51_1623_c1 | nmdc:mga04h51_1623_c1_1857_2465 | 156 |
| 859 | 3300050496 | nmdc:mga07m45_5925_c1 | nmdc:mga07m45_5925_c1_2345_2836 | 156 |
| 860 | 3300050508 | nmdc:mga09592_2590_c1 | nmdc:mga09592_2590_c1_1048_1524 | 156 |
| 861 | 3300050510 | nmdc:mga06r32_13628_c1 | nmdc:mga06r32_13628_c1_6651_7130 | 156 |
| 862 | 3300050511 | nmdc:mga08y16_1731_c1 | nmdc:mga08y16_1731_c1_1679_2155 | 156 |
| 863 | 3300050512 | nmdc:mga0n895_221841_c1 | nmdc:mga0n895_221841_c1_905_1381 | 156 |
| 864 | 3300050512 | nmdc:mga0n895_32773_c1 | nmdc:mga0n895_32773_c1_2662_3180 | 156 |
| 865 | 3300050512 | nmdc:mga0n895_836098_c1 | nmdc:mga0n895_836098_c1_106_621 | 156 |
| 866 | 3300050513 | nmdc:mga0rr50_11221_c1 | nmdc:mga0rr50_11221_c1_1200_1718 | 156 |
| 867 | 3300050514 | nmdc:mga08x19_72605_c1 | nmdc:mga08x19_72605_c1_645_1163 | 156 |
| 868 | 3300050515 | nmdc:mga0a205_49685_c1 | nmdc:mga0a205_49685_c1_433_951 | 156 |
| 869 | 3300050516 | nmdc:mga0sz30_45207_c1 | nmdc:mga0sz30_45207_c1_459_1067 | 156 |
| 870 | 3300053078 | Ga0495612_0011990 | Ga0495612_0011990_1282_1752 | 156 |
| 871 | 3300053084 | Ga0495595_0088431 | Ga0495595_0088431_280_750 | 156 |
| 872 | 3300053085 | Ga0495619_0060518 | Ga0495619_0060518_1540_2010 | 156 |
| 873 | 3300053118 | Ga0500594_0024036 | Ga0500594_0024036_481_1089 | 156 |
| 874 | 3300053161 | Ga0500634_0002968 | Ga0500634_0002968_4139_4690 | 156 |
| 875 | 3300053178 | Ga0500637_0155049 | Ga0500637_0155049_630_1235 | 156 |
| 876 | 3300059424 | Ga0590075_041710 | Ga0590075_041710_336_827 | 156 |
| 877 | 3300059506 | Ga0587085_067875 | Ga0587085_067875_168_641 | 156 |
| 878 | 3300059510 | Ga0587090_047069 | Ga0587090_047069_217_690 | 156 |
| 879 | 3300060346 | Ga0587111_0039696 | Ga0587111_0039696_312_785 | 156 |
| 880 | 3300060353 | Ga0501082_0183353 | Ga0501082_0183353_1012_1491 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uw8-assembly1.cif.gz_B | structure of e. coli mce protein mlad, core mce domain | 0.9668 | 38 | 133 |
| 5uw8-assembly1.cif.gz_D | structure of e. coli mce protein mlad, core mce domain | 0.9649 | 39 | 134 |
| 5uw8-assembly1.cif.gz_G | structure of e. coli mce protein mlad, core mce domain | 0.9637 | 39 | 134 |
| 5uw2-assembly1.cif.gz_A-2 | structure of e. coli mce protein mlad, periplasmic domain | 0.9403 | 38 | 146 |
| 5uw8-assembly1.cif.gz_B | structure of e. coli mce protein mlad, core mce domain | 0.9382 | 38 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53969_38_114_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9739 | 38 | 116 | 2.40.50.140 |
| af_O53969_38_114_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9617 | 38 | 116 | 2.40.50.140 |
| af_P64604_38_117_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.9587 | 38 | 116 | 2.30.30.60 |
| af_O07787_38_113_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9559 | 38 | 116 | 2.40.50.140 |
| af_O53971_37_112_2.40.30.170 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Efflux pump adaptor protein, beta barrel domain | 0.9546 | 39 | 116 | 2.40.30.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E7H0D0-F1-model_v4 | Outer membrane lipid asymmetry maintenance protein MlaD | 0.9698 | 42 | 146 |
GO:0005543
GO:0005548 |
| AF-A0A1A9VJV1-F1-model_v4 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 | 0.9549 | 35 | 149 |
GO:0005743
GO:0032981 |
| AF-A0A836VLA8-F1-model_v4 | MCE family protein | 0.9483 | 38 | 147 |
|
| AF-A0A378Z6D7-F1-model_v4 | deleted | 0.9478 | 15 | 156 |
|
| AF-A0A5C7PNS0-F1-model_v4 | Outer membrane lipid asymmetry maintenance protein MlaD | 0.9462 | 16 | 150 |
GO:0005543
GO:0005548 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar