F484477
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 880 | 368 | 851 | 368 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10015684|rootH1_100156842 |
| Length | 397 |
| Sequence | MRSGIHPLALSLSKGCSAWLRRGFDKLSPNGVWAVLMAVALLGGCASSSKPKPTPLDPLTPTVTPKQIWNSRIDAVQYPLTVAVVGNAFTLAGSDGSVLALDADSGRELWRANAGAKLSAGVGTDGRFAAVVTRDGELIVFEQGQVKWRKPLSARVTTAPLVAGERVFVVGVDRIVRAFDALDGRRIWTLQRPSDPLTLAQAGVLVPFKDTLVVGQGPRMVGVDPTAGTVRWDVPVGSPRGANEIERLADLVAPSARVGNLICARSFQAAVGCVDAQRGATVWSRNIGGTDGVAADAEFVFAADATDRLTAWKTPSGDVAWTSDKYLYRGMSAPVIFGKSVVFGDVEGTVHWFARDTGEAQARQTTDGSAIVTAPVVAGSTMLVVTKNGGLYAYRQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 7 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 8 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 9 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 10 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 11 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 12 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 13 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 14 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 15 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 16 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 17 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 18 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 19 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 20 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 21 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 22 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 23 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 24 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 25 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 26 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 27 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 28 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 29 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 30 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 31 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 32 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 37 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 38 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 39 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 51 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 58 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 61 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 105 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 106 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 119 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 143 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 221 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 225 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 240 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 241 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 257 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 258 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 259 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 260 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 261 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 262 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 263 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 264 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 265 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 266 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 267 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 278 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 279 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 320 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 332 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 333 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 334 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 340 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 346 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 347 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 349 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 350 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 351 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 352 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 353 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 354 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 355 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 356 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 360 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 361 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 362 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 363 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 364 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 367 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 368 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.02 |
| Metatranscriptomes | 0.68 |
| Isolates | 3.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.93 |
| Nodule | 0.57 |
| Rhizoplane | 2.73 |
| Rhizosphere | 69.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000581 | 3300002705 | Bacteria | 20815 |
| 2 | JGI25157J39369_1000163 | 3300002741 | Bacteria | 55914 |
| 3 | JGI25152J39213_1002264 | 3300002773 | Bacteria | 7426 |
| 4 | JGI25153J46596_10009871 | 3300003215 | Bacteria | 4380 |
| 5 | JGI25153J46596_10012943 | 3300003215 | Bacteria | 3561 |
| 6 | rootH1_10015684 | 3300003316 | Bacteria | 2826 |
| 7 | rootH1_10025577 | 3300003316 | Bacteria | 4801 |
| 8 | rootH1_10027067 | 3300003316 | Bacteria | 3617 |
| 9 | rootH2_10011660 | 3300003320 | Bacteria | 8700 |
| 10 | rootH2_10029880 | 3300003320 | Bacteria | 4608 |
| 11 | rootL2_10000980 | 3300003322 | Bacteria | 20057 |
| 12 | rootL2_10045989 | 3300003322 | Bacteria | 5182 |
| 13 | rootL2_10259464 | 3300003322 | Bacteria | 2440 |
| 14 | rootL2_10274554 | 3300003322 | Bacteria | 1247 |
| 15 | rootL2_10321793 | 3300003322 | Bacteria | 1967 |
| 16 | rootH1_10011477 | 3300003323 | Bacteria | 2676 |
| 17 | rootH1_10036624 | 3300003323 | Bacteria | 4780 |
| 18 | rootH1_10047957 | 3300003323 | Bacteria | 2722 |
| 19 | rootH1_10058315 | 3300003323 | Bacteria | 2654 |
| 20 | rootH1_10058316 | 3300003323 | Bacteria | 3331 |
| 21 | rootH1_10141431 | 3300003323 | Bacteria | 2562 |
| 22 | JGI26128J50194_1000130 | 3300003347 | Bacteria | 3187 |
| 23 | Ga0055539_1000603 | 3300003752 | Bacteria | 9936 |
| 24 | Ga0055539_1000826 | 3300003752 | Bacteria | 7281 |
| 25 | Ga0055533_1000006 | 3300003756 | Bacteria | 635559 |
| 26 | Ga0055525_1000026 | 3300003759 | Bacteria | 345798 |
| 27 | Ga0055525_1000677 | 3300003759 | Bacteria | 12912 |
| 28 | Ga0055535_1000881 | 3300003761 | Bacteria | 20958 |
| 29 | Ga0055529_1000175 | 3300003763 | Bacteria | 87829 |
| 30 | Ga0055526_1010561 | 3300003771 | Bacteria | 4278 |
| 31 | Ga0055524_1000175 | 3300003775 | Bacteria | 72850 |
| 32 | Ga0055524_1020352 | 3300003775 | Bacteria | 2237 |
| 33 | Ga0055530_10005340 | 3300003791 | Bacteria | 6149 |
| 34 | Ga0055540_1000062 | 3300003792 | Bacteria | 128474 |
| 35 | Ga0055531_10000823 | 3300003794 | Bacteria | 25703 |
| 36 | Ga0055531_10010250 | 3300003794 | Bacteria | 4685 |
| 37 | Ga0055531_10024473 | 3300003794 | Bacteria | 2227 |
| 38 | Ga0055531_10025337 | 3300003794 | Bacteria | 2158 |
| 39 | Ga0055543_1002639 | 3300004625 | Bacteria | 5769 |
| 40 | Ga0065165_1000006 | 3300005262 | Bacteria | 352298 |
| 41 | Ga0065165_1002955 | 3300005262 | Bacteria | 12945 |
| 42 | Ga0065165_1003031 | 3300005262 | Bacteria | 12647 |
| 43 | Ga0070658_10016622 | 3300005327 | Bacteria | 5888 |
| 44 | Ga0070658_10092351 | 3300005327 | Bacteria | 2496 |
| 45 | Ga0070658_10100106 | 3300005327 | Bacteria | 2395 |
| 46 | Ga0070658_10126284 | 3300005327 | Bacteria | 2129 |
| 47 | Ga0070658_10157061 | 3300005327 | Bacteria | 1907 |
| 48 | Ga0070676_10004487 | 3300005328 | Bacteria | 7346 |
| 49 | Ga0070676_10007485 | 3300005328 | Bacteria | 5861 |
| 50 | Ga0070676_10010804 | 3300005328 | Bacteria | 4953 |
| 51 | Ga0070683_100024422 | 3300005329 | Bacteria | 5414 |
| 52 | Ga0070683_100045692 | 3300005329 | Bacteria | 4043 |
| 53 | Ga0070683_100083823 | 3300005329 | Bacteria | 2986 |
| 54 | Ga0070690_100006323 | 3300005330 | Bacteria | 6717 |
| 55 | Ga0070690_100025841 | 3300005330 | Bacteria | 3618 |
| 56 | Ga0070690_100214400 | 3300005330 | Bacteria | 1346 |
| 57 | Ga0070670_100011707 | 3300005331 | Bacteria | 7503 |
| 58 | Ga0070670_100028084 | 3300005331 | Bacteria | 4841 |
| 59 | Ga0070670_100099798 | 3300005331 | Bacteria | 2498 |
| 60 | Ga0070670_100156408 | 3300005331 | Bacteria | 1974 |
| 61 | Ga0070677_10005950 | 3300005333 | Bacteria | 4042 |
| 62 | Ga0070677_10008103 | 3300005333 | Bacteria | 3526 |
| 63 | Ga0068869_100006760 | 3300005334 | Bacteria | 7289 |
| 64 | Ga0068869_100009857 | 3300005334 | Bacteria | 6204 |
| 65 | Ga0068869_100013849 | 3300005334 | Bacteria | 5376 |
| 66 | Ga0068869_100015658 | 3300005334 | Bacteria | 5093 |
| 67 | Ga0070666_10009854 | 3300005335 | Bacteria | 5965 |
| 68 | Ga0070666_10099867 | 3300005335 | Bacteria | 1999 |
| 69 | Ga0070682_100045865 | 3300005337 | Bacteria | 2711 |
| 70 | Ga0068868_100015136 | 3300005338 | Bacteria | 5699 |
| 71 | Ga0068868_100015986 | 3300005338 | Bacteria | 5564 |
| 72 | Ga0068868_100024050 | 3300005338 | Bacteria | 4618 |
| 73 | Ga0070660_100038551 | 3300005339 | Bacteria | 3628 |
| 74 | Ga0070689_100163417 | 3300005340 | Bacteria | 1801 |
| 75 | Ga0070687_100006756 | 3300005343 | Bacteria | 4728 |
| 76 | Ga0070661_100000264 | 3300005344 | Bacteria | 43037 |
| 77 | Ga0070661_100007118 | 3300005344 | Bacteria | 7718 |
| 78 | Ga0070661_100109713 | 3300005344 | Bacteria | 2059 |
| 79 | Ga0070692_10081509 | 3300005345 | Bacteria | 1744 |
| 80 | Ga0070668_100003264 | 3300005347 | Bacteria | 11958 |
| 81 | Ga0070668_100038465 | 3300005347 | Bacteria | 3656 |
| 82 | Ga0070668_100054526 | 3300005347 | Bacteria | 3084 |
| 83 | Ga0070668_100289283 | 3300005347 | Bacteria | 1371 |
| 84 | Ga0070669_100006416 | 3300005353 | Bacteria | 8464 |
| 85 | Ga0070669_100023264 | 3300005353 | Bacteria | 4438 |
| 86 | Ga0070669_100032799 | 3300005353 | Bacteria | 3752 |
| 87 | Ga0070669_100047550 | 3300005353 | Bacteria | 3130 |
| 88 | Ga0070675_100007196 | 3300005354 | Bacteria | 8576 |
| 89 | Ga0070675_100010823 | 3300005354 | Bacteria | 7134 |
| 90 | Ga0070675_100013850 | 3300005354 | Bacteria | 6349 |
| 91 | Ga0070675_100028234 | 3300005354 | Bacteria | 4515 |
| 92 | Ga0070675_100041764 | 3300005354 | Bacteria | 3746 |
| 93 | Ga0070675_100050429 | 3300005354 | Bacteria | 3417 |
| 94 | Ga0070675_100090433 | 3300005354 | Bacteria | 2564 |
| 95 | Ga0070675_100111612 | 3300005354 | Bacteria | 2314 |
| 96 | Ga0070671_100003736 | 3300005355 | Bacteria | 11951 |
| 97 | Ga0070671_100012623 | 3300005355 | Bacteria | 6809 |
| 98 | Ga0070671_100023315 | 3300005355 | Bacteria | 5064 |
| 99 | Ga0070671_100025218 | 3300005355 | Bacteria | 4877 |
| 100 | Ga0070671_100044580 | 3300005355 | Bacteria | 3685 |
| 101 | Ga0070671_100070828 | 3300005355 | Bacteria | 2909 |
| 102 | Ga0070671_100075778 | 3300005355 | Bacteria | 2811 |
| 103 | Ga0070671_100174448 | 3300005355 | Bacteria | 1818 |
| 104 | Ga0070671_100229158 | 3300005355 | Bacteria | 1576 |
| 105 | Ga0070671_100250306 | 3300005355 | Unclassified | 1505 |
| 106 | Ga0070674_100000872 | 3300005356 | Bacteria | 15687 |
| 107 | Ga0070674_100007044 | 3300005356 | Bacteria | 6610 |
| 108 | Ga0070674_100014286 | 3300005356 | Bacteria | 4934 |
| 109 | Ga0070674_100075626 | 3300005356 | Bacteria | 2392 |
| 110 | Ga0070674_100263364 | 3300005356 | Bacteria | 1359 |
| 111 | Ga0070673_100002229 | 3300005364 | Bacteria | 11725 |
| 112 | Ga0070673_100002506 | 3300005364 | Bacteria | 11201 |
| 113 | Ga0070673_100055860 | 3300005364 | Bacteria | 3112 |
| 114 | Ga0070673_100056823 | 3300005364 | Bacteria | 3089 |
| 115 | Ga0070673_100083713 | 3300005364 | Bacteria | 2592 |
| 116 | Ga0070673_100089865 | 3300005364 | Bacteria | 2508 |
| 117 | Ga0070673_100153751 | 3300005364 | Bacteria | 1950 |
| 118 | Ga0070673_100169270 | 3300005364 | Bacteria | 1864 |
| 119 | Ga0070688_100150388 | 3300005365 | Bacteria | 1591 |
| 120 | Ga0070659_100000798 | 3300005366 | Bacteria | 22978 |
| 121 | Ga0070659_100004438 | 3300005366 | Bacteria | 10024 |
| 122 | Ga0070659_100008843 | 3300005366 | Bacteria | 7379 |
| 123 | Ga0070667_100001505 | 3300005367 | Bacteria | 20850 |
| 124 | Ga0070667_100022532 | 3300005367 | Bacteria | 5222 |
| 125 | Ga0070667_100033625 | 3300005367 | Bacteria | 4287 |
| 126 | Ga0070667_100316638 | 3300005367 | Bacteria | 1407 |
| 127 | Ga0070701_10016840 | 3300005438 | Bacteria | 3406 |
| 128 | Ga0070663_100002931 | 3300005455 | Bacteria | 9711 |
| 129 | Ga0070663_100006397 | 3300005455 | Bacteria | 7082 |
| 130 | Ga0070663_100053479 | 3300005455 | Bacteria | 2883 |
| 131 | Ga0070663_100133738 | 3300005455 | Bacteria | 1886 |
| 132 | Ga0070678_100010708 | 3300005456 | Bacteria | 5615 |
| 133 | Ga0070678_100037384 | 3300005456 | Bacteria | 3409 |
| 134 | Ga0070662_100004274 | 3300005457 | Bacteria | 9015 |
| 135 | Ga0070662_100011800 | 3300005457 | Bacteria | 5773 |
| 136 | Ga0070662_100030909 | 3300005457 | Bacteria | 3752 |
| 137 | Ga0070662_100072979 | 3300005457 | Bacteria | 2535 |
| 138 | Ga0070662_100091378 | 3300005457 | Bacteria | 2286 |
| 139 | Ga0068867_100000175 | 3300005459 | Bacteria | 41852 |
| 140 | Ga0068867_100000820 | 3300005459 | Bacteria | 20957 |
| 141 | Ga0068867_100004786 | 3300005459 | Bacteria | 9528 |
| 142 | Ga0068867_100006286 | 3300005459 | Bacteria | 8400 |
| 143 | Ga0068867_100024053 | 3300005459 | Bacteria | 4364 |
| 144 | Ga0068867_100033157 | 3300005459 | Bacteria | 3738 |
| 145 | Ga0068867_100057584 | 3300005459 | Bacteria | 2878 |
| 146 | Ga0068867_100107576 | 3300005459 | Bacteria | 2137 |
| 147 | Ga0068867_100212214 | 3300005459 | Bacteria | 1555 |
| 148 | Ga0070706_100000212 | 3300005467 | Bacteria | 71525 |
| 149 | Ga0070698_100108940 | 3300005471 | Bacteria | 2737 |
| 150 | Ga0070679_100000691 | 3300005530 | Bacteria | 28927 |
| 151 | Ga0070679_100102950 | 3300005530 | Bacteria | 2841 |
| 152 | Ga0068853_100052483 | 3300005539 | Bacteria | 3512 |
| 153 | Ga0068853_100124447 | 3300005539 | Bacteria | 2303 |
| 154 | Ga0070672_100002531 | 3300005543 | Bacteria | 11641 |
| 155 | Ga0070672_100017803 | 3300005543 | Bacteria | 5121 |
| 156 | Ga0070672_100017849 | 3300005543 | Bacteria | 5116 |
| 157 | Ga0070672_100082281 | 3300005543 | Bacteria | 2583 |
| 158 | Ga0070672_100155527 | 3300005543 | Bacteria | 1894 |
| 159 | Ga0070672_100294319 | 3300005543 | Bacteria | 1375 |
| 160 | Ga0070693_100044860 | 3300005547 | Bacteria | 2503 |
| 161 | Ga0070665_100018978 | 3300005548 | Bacteria | 6898 |
| 162 | Ga0068855_100011038 | 3300005563 | Bacteria | 10902 |
| 163 | Ga0068855_100097732 | 3300005563 | Bacteria | 3382 |
| 164 | Ga0070664_100003853 | 3300005564 | Bacteria | 12108 |
| 165 | Ga0070664_100014573 | 3300005564 | Bacteria | 6413 |
| 166 | Ga0070664_100047862 | 3300005564 | Bacteria | 3614 |
| 167 | Ga0070664_100088741 | 3300005564 | Bacteria | 2673 |
| 168 | Ga0070664_100092220 | 3300005564 | Bacteria | 2622 |
| 169 | Ga0068857_100020499 | 3300005577 | Bacteria | 5815 |
| 170 | Ga0068857_100113306 | 3300005577 | Bacteria | 2438 |
| 171 | Ga0068854_100001430 | 3300005578 | Bacteria | 14430 |
| 172 | Ga0068854_100055949 | 3300005578 | Bacteria | 2842 |
| 173 | Ga0068854_100061535 | 3300005578 | Bacteria | 2720 |
| 174 | Ga0068856_100001213 | 3300005614 | Bacteria | 27067 |
| 175 | Ga0068856_100008607 | 3300005614 | Bacteria | 9922 |
| 176 | Ga0068852_100034935 | 3300005616 | Bacteria | 4187 |
| 177 | Ga0068852_100067623 | 3300005616 | Bacteria | 3124 |
| 178 | Ga0068852_100072433 | 3300005616 | Bacteria | 3028 |
| 179 | Ga0068852_100108043 | 3300005616 | Bacteria | 2525 |
| 180 | Ga0068852_100111780 | 3300005616 | Bacteria | 2485 |
| 181 | Ga0068852_100147546 | 3300005616 | Bacteria | 2183 |
| 182 | Ga0068859_100060368 | 3300005617 | Bacteria | 3821 |
| 183 | Ga0068859_100069869 | 3300005617 | Bacteria | 3547 |
| 184 | Ga0068859_100113840 | 3300005617 | Bacteria | 2769 |
| 185 | Ga0068859_100275256 | 3300005617 | Bacteria | 1776 |
| 186 | Ga0068864_100002247 | 3300005618 | Bacteria | 15969 |
| 187 | Ga0068864_100014624 | 3300005618 | Bacteria | 6518 |
| 188 | Ga0068864_100031800 | 3300005618 | Bacteria | 4479 |
| 189 | Ga0068864_100036248 | 3300005618 | Bacteria | 4203 |
| 190 | Ga0068864_100093790 | 3300005618 | Bacteria | 2652 |
| 191 | Ga0068864_100104651 | 3300005618 | Bacteria | 2514 |
| 192 | Ga0068866_10067699 | 3300005718 | Bacteria | 1875 |
| 193 | Ga0068866_10084098 | 3300005718 | Bacteria | 1716 |
| 194 | Ga0068861_100000343 | 3300005719 | Bacteria | 26498 |
| 195 | Ga0068861_100006489 | 3300005719 | Bacteria | 7972 |
| 196 | Ga0068861_100038625 | 3300005719 | Bacteria | 3558 |
| 197 | Ga0068861_100043773 | 3300005719 | Bacteria | 3363 |
| 198 | Ga0068861_100054344 | 3300005719 | Bacteria | 3050 |
| 199 | Ga0068861_100155337 | 3300005719 | Bacteria | 1881 |
| 200 | Ga0068861_100161480 | 3300005719 | Bacteria | 1849 |
| 201 | Ga0068851_10002903 | 3300005834 | Bacteria | 7573 |
| 202 | Ga0068851_10009782 | 3300005834 | Bacteria | 4466 |
| 203 | Ga0068851_10018574 | 3300005834 | Bacteria | 3350 |
| 204 | Ga0068870_10061740 | 3300005840 | Bacteria | 2016 |
| 205 | Ga0068863_100007447 | 3300005841 | Bacteria | 10712 |
| 206 | Ga0068863_100062745 | 3300005841 | Bacteria | 3514 |
| 207 | Ga0068863_100103524 | 3300005841 | Bacteria | 2708 |
| 208 | Ga0068858_100001875 | 3300005842 | Bacteria | 21440 |
| 209 | Ga0068858_100002875 | 3300005842 | Bacteria | 17315 |
| 210 | Ga0068858_100005928 | 3300005842 | Bacteria | 11931 |
| 211 | Ga0068858_100266324 | 3300005842 | Bacteria | 1630 |
| 212 | Ga0068860_100000707 | 3300005843 | Bacteria | 38265 |
| 213 | Ga0068860_100000715 | 3300005843 | Bacteria | 37986 |
| 214 | Ga0068860_100006018 | 3300005843 | Bacteria | 12209 |
| 215 | Ga0068860_100120930 | 3300005843 | Bacteria | 2507 |
| 216 | Ga0068860_100132386 | 3300005843 | Bacteria | 2394 |
| 217 | Ga0068862_100047844 | 3300005844 | Bacteria | 3650 |
| 218 | Ga0068862_100048239 | 3300005844 | Bacteria | 3636 |
| 219 | Ga0068862_100053491 | 3300005844 | Bacteria | 3456 |
| 220 | Ga0075365_10009206 | 3300006038 | Bacteria | 5664 |
| 221 | Ga0075365_10044561 | 3300006038 | Bacteria | 2907 |
| 222 | Ga0075368_10005570 | 3300006042 | Bacteria | 4339 |
| 223 | Ga0075368_10026244 | 3300006042 | Bacteria | 2241 |
| 224 | Ga0075363_100112717 | 3300006048 | Bacteria | 1513 |
| 225 | Ga0075364_10009703 | 3300006051 | Bacteria | 5785 |
| 226 | Ga0075364_10043054 | 3300006051 | Bacteria | 2935 |
| 227 | Ga0075362_10006087 | 3300006177 | Bacteria | 4469 |
| 228 | Ga0075362_10014577 | 3300006177 | Bacteria | 3175 |
| 229 | Ga0075367_10002841 | 3300006178 | Bacteria | 8043 |
| 230 | Ga0075367_10021959 | 3300006178 | Bacteria | 3573 |
| 231 | Ga0075367_10022933 | 3300006178 | Bacteria | 3507 |
| 232 | Ga0075367_10055639 | 3300006178 | Bacteria | 2349 |
| 233 | Ga0075369_10012396 | 3300006186 | Bacteria | 3368 |
| 234 | Ga0075369_10016575 | 3300006186 | Bacteria | 2976 |
| 235 | Ga0075366_10000822 | 3300006195 | Bacteria | 14915 |
| 236 | Ga0075366_10002910 | 3300006195 | Bacteria | 8897 |
| 237 | Ga0075366_10023388 | 3300006195 | Bacteria | 3599 |
| 238 | Ga0075366_10027415 | 3300006195 | Bacteria | 3342 |
| 239 | Ga0075366_10028537 | 3300006195 | Bacteria | 3275 |
| 240 | Ga0075366_10031525 | 3300006195 | Bacteria | 3120 |
| 241 | Ga0075366_10063815 | 3300006195 | Bacteria | 2190 |
| 242 | Ga0075366_10077598 | 3300006195 | Bacteria | 1982 |
| 243 | Ga0075366_10105294 | 3300006195 | Bacteria | 1695 |
| 244 | Ga0075366_10118128 | 3300006195 | Bacteria | 1597 |
| 245 | Ga0097621_100034144 | 3300006237 | Bacteria | 4055 |
| 246 | Ga0075370_10000245 | 3300006353 | Bacteria | 19479 |
| 247 | Ga0075370_10000373 | 3300006353 | Bacteria | 16463 |
| 248 | Ga0075370_10001845 | 3300006353 | Bacteria | 9489 |
| 249 | Ga0075370_10003141 | 3300006353 | Bacteria | 7799 |
| 250 | Ga0075370_10006552 | 3300006353 | Bacteria | 5865 |
| 251 | Ga0075370_10007745 | 3300006353 | Bacteria | 5485 |
| 252 | Ga0075370_10030190 | 3300006353 | Bacteria | 3023 |
| 253 | Ga0075370_10040177 | 3300006353 | Bacteria | 2638 |
| 254 | Ga0075370_10041160 | 3300006353 | Bacteria | 2608 |
| 255 | Ga0075370_10048362 | 3300006353 | Bacteria | 2409 |
| 256 | Ga0075370_10086367 | 3300006353 | Bacteria | 1807 |
| 257 | Ga0075370_10116508 | 3300006353 | Bacteria | 1553 |
| 258 | Ga0068871_100007319 | 3300006358 | Bacteria | 7878 |
| 259 | Ga0068871_100051943 | 3300006358 | Bacteria | 3318 |
| 260 | Ga0068871_100077187 | 3300006358 | Bacteria | 2753 |
| 261 | Ga0075430_100030832 | 3300006846 | Bacteria | 4554 |
| 262 | Ga0075429_100003825 | 3300006880 | Bacteria | 12856 |
| 263 | Ga0075429_100044687 | 3300006880 | Bacteria | 3853 |
| 264 | Ga0068865_100007045 | 3300006881 | Bacteria | 6901 |
| 265 | Ga0068865_100062800 | 3300006881 | Bacteria | 2608 |
| 266 | Ga0068865_100097476 | 3300006881 | Bacteria | 2146 |
| 267 | Ga0097620_100060368 | 3300006931 | Bacteria | 3821 |
| 268 | Ga0097620_100069871 | 3300006931 | Bacteria | 3547 |
| 269 | Ga0097620_100113838 | 3300006931 | Bacteria | 2769 |
| 270 | Ga0097620_100275236 | 3300006931 | Bacteria | 1776 |
| 271 | Ga0099823_1001245 | 3300006944 | Bacteria | 20453 |
| 272 | Ga0079104_1000186 | 3300006946 | Bacteria | 87104 |
| 273 | Ga0105240_10007877 | 3300009093 | Bacteria | 15365 |
| 274 | Ga0105240_10018656 | 3300009093 | Bacteria | 9298 |
| 275 | Ga0105240_10203719 | 3300009093 | Bacteria | 2317 |
| 276 | Ga0105240_10276166 | 3300009093 | Bacteria | 1933 |
| 277 | Ga0105245_10044542 | 3300009098 | Bacteria | 3961 |
| 278 | Ga0105245_10045165 | 3300009098 | Bacteria | 3933 |
| 279 | Ga0105245_10058026 | 3300009098 | Bacteria | 3483 |
| 280 | Ga0105243_10000770 | 3300009148 | Bacteria | 30670 |
| 281 | Ga0105243_10071375 | 3300009148 | Bacteria | 2807 |
| 282 | Ga0105243_10207955 | 3300009148 | Bacteria | 1721 |
| 283 | Ga0105248_10002863 | 3300009177 | Bacteria | 19149 |
| 284 | Ga0105248_10003419 | 3300009177 | Bacteria | 17638 |
| 285 | Ga0105248_10040203 | 3300009177 | Bacteria | 5243 |
| 286 | Ga0105248_10103094 | 3300009177 | Bacteria | 3215 |
| 287 | Ga0105248_10252975 | 3300009177 | Bacteria | 1983 |
| 288 | Ga0105237_10000367 | 3300009545 | Bacteria | 63983 |
| 289 | Ga0105237_10010721 | 3300009545 | Bacteria | 9723 |
| 290 | Ga0105238_10009305 | 3300009551 | Bacteria | 9837 |
| 291 | Ga0105238_10019763 | 3300009551 | Bacteria | 6858 |
| 292 | Ga0105238_10080890 | 3300009551 | Bacteria | 3238 |
| 293 | Ga0105249_10030174 | 3300009553 | Bacteria | 4900 |
| 294 | Ga0105239_10000150 | 3300010375 | Bacteria | 100349 |
| 295 | Ga0105239_10019576 | 3300010375 | Bacteria | 7471 |
| 296 | Ga0157319_1000009 | 3300012497 | Bacteria | 227971 |
| 297 | Ga0157371_10216460 | 3300013102 | Bacteria | 1375 |
| 298 | Ga0157369_10006554 | 3300013105 | Bacteria | 13478 |
| 299 | Ga0157369_10131752 | 3300013105 | Bacteria | 2649 |
| 300 | Ga0157369_10167164 | 3300013105 | Bacteria | 2319 |
| 301 | Ga0157374_10004558 | 3300013296 | Bacteria | 11622 |
| 302 | Ga0157374_10050751 | 3300013296 | Bacteria | 3857 |
| 303 | Ga0157374_10066719 | 3300013296 | Bacteria | 3382 |
| 304 | Ga0157374_10148076 | 3300013296 | Bacteria | 2281 |
| 305 | Ga0157378_10009725 | 3300013297 | Bacteria | 8376 |
| 306 | Ga0157378_10168281 | 3300013297 | Bacteria | 2054 |
| 307 | Ga0163162_10002501 | 3300013306 | Bacteria | 17377 |
| 308 | Ga0163162_10005242 | 3300013306 | Bacteria | 12495 |
| 309 | Ga0163162_10064153 | 3300013306 | Bacteria | 3718 |
| 310 | Ga0163162_10066285 | 3300013306 | Bacteria | 3659 |
| 311 | Ga0163162_10511524 | 3300013306 | Bacteria | 1331 |
| 312 | Ga0157372_10033047 | 3300013307 | Bacteria | 5678 |
| 313 | Ga0157375_10001357 | 3300013308 | Bacteria | 21138 |
| 314 | Ga0157375_10069367 | 3300013308 | Bacteria | 3531 |
| 315 | Ga0157375_10075576 | 3300013308 | Bacteria | 3394 |
| 316 | Ga0157375_10084089 | 3300013308 | Bacteria | 3230 |
| 317 | Ga0157375_10183926 | 3300013308 | Bacteria | 2242 |
| 318 | Ga0157380_10051418 | 3300014326 | Bacteria | 3259 |
| 319 | Ga0157377_10000014 | 3300014745 | Bacteria | 213961 |
| 320 | Ga0157377_10026579 | 3300014745 | Bacteria | 3099 |
| 321 | Ga0157379_10000528 | 3300014968 | Bacteria | 30947 |
| 322 | Ga0157379_10000717 | 3300014968 | Bacteria | 26869 |
| 323 | Ga0157379_10004404 | 3300014968 | Bacteria | 12063 |
| 324 | Ga0157379_10016935 | 3300014968 | Bacteria | 6412 |
| 325 | Ga0157379_10066823 | 3300014968 | Bacteria | 3215 |
| 326 | Ga0157379_10146152 | 3300014968 | Bacteria | 2132 |
| 327 | Ga0157379_10288325 | 3300014968 | Bacteria | 1495 |
| 328 | Ga0157376_10026261 | 3300014969 | Bacteria | 4599 |
| 329 | Ga0157376_10026355 | 3300014969 | Bacteria | 4593 |
| 330 | Ga0157376_10284085 | 3300014969 | Bacteria | 1560 |
| 331 | Ga0182007_10030022 | 3300015262 | Bacteria | 1859 |
| 332 | Ga0163161_10017116 | 3300017792 | Bacteria | 5071 |
| 333 | Ga0163161_10042390 | 3300017792 | Bacteria | 3273 |
| 334 | Ga0163161_10043582 | 3300017792 | Bacteria | 3231 |
| 335 | Ga0163161_10052347 | 3300017792 | Bacteria | 2959 |
| 336 | Ga0213872_10000004 | 3300021361 | Bacteria | 306230 |
| 337 | Ga0213872_10000016 | 3300021361 | Bacteria | 180524 |
| 338 | Ga0213872_10021606 | 3300021361 | Bacteria | 2965 |
| 339 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 340 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 341 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 342 | Ga0207427_101024 | 3300025231 | Bacteria | 11685 |
| 343 | Ga0209258_100060 | 3300025242 | Bacteria | 319881 |
| 344 | Ga0209258_100482 | 3300025242 | Bacteria | 41643 |
| 345 | Ga0207425_1000596 | 3300025245 | Bacteria | 20990 |
| 346 | Ga0209646_1000242 | 3300025246 | Bacteria | 56037 |
| 347 | Ga0209026_1000311 | 3300025250 | Bacteria | 52155 |
| 348 | Ga0209677_100274 | 3300025253 | Bacteria | 34497 |
| 349 | Ga0209677_100396 | 3300025253 | Bacteria | 26411 |
| 350 | Ga0209759_1000373 | 3300025256 | Bacteria | 56051 |
| 351 | Ga0209759_1001241 | 3300025256 | Bacteria | 15482 |
| 352 | Ga0209759_1001792 | 3300025256 | Bacteria | 10886 |
| 353 | Ga0209759_1011322 | 3300025256 | Bacteria | 2542 |
| 354 | Ga0209129_1000148 | 3300025258 | Bacteria | 114559 |
| 355 | Ga0209455_1000093 | 3300025272 | Bacteria | 220487 |
| 356 | Ga0209673_1014079 | 3300025273 | Bacteria | 3116 |
| 357 | Ga0209673_1030300 | 3300025273 | Bacteria | 1706 |
| 358 | Ga0209675_1007295 | 3300025291 | Bacteria | 4271 |
| 359 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 360 | Ga0209564_1000251 | 3300025295 | Bacteria | 114511 |
| 361 | Ga0209758_1000387 | 3300025297 | Bacteria | 76099 |
| 362 | Ga0209758_1000439 | 3300025297 | Bacteria | 69980 |
| 363 | Ga0209050_1001091 | 3300025298 | Bacteria | 32964 |
| 364 | Ga0209050_1003695 | 3300025298 | Bacteria | 11025 |
| 365 | Ga0209050_1008655 | 3300025298 | Bacteria | 5377 |
| 366 | Ga0209256_1000024 | 3300025299 | Bacteria | 448909 |
| 367 | Ga0209256_1003497 | 3300025299 | Bacteria | 10949 |
| 368 | Ga0209256_1029936 | 3300025299 | Bacteria | 1509 |
| 369 | Ga0209051_1000063 | 3300025303 | Bacteria | 249739 |
| 370 | Ga0209051_1000674 | 3300025303 | Bacteria | 38231 |
| 371 | Ga0209051_1007021 | 3300025303 | Bacteria | 6237 |
| 372 | Ga0209051_1009412 | 3300025303 | Bacteria | 5041 |
| 373 | Ga0209051_1013119 | 3300025303 | Bacteria | 3962 |
| 374 | Ga0209257_1000118 | 3300025304 | Bacteria | 225963 |
| 375 | Ga0209257_1000354 | 3300025304 | Bacteria | 93718 |
| 376 | Ga0209257_1001690 | 3300025304 | Bacteria | 24813 |
| 377 | Ga0209257_1005187 | 3300025304 | Bacteria | 9375 |
| 378 | Ga0207697_10026681 | 3300025315 | Bacteria | 2362 |
| 379 | Ga0207656_10033570 | 3300025321 | Bacteria | 2139 |
| 380 | Ga0207682_10007000 | 3300025893 | Bacteria | 4520 |
| 381 | Ga0207682_10019819 | 3300025893 | Bacteria | 2636 |
| 382 | Ga0207642_10009348 | 3300025899 | Bacteria | 3406 |
| 383 | Ga0207680_10024481 | 3300025903 | Bacteria | 3314 |
| 384 | Ga0207645_10005371 | 3300025907 | Bacteria | 9312 |
| 385 | Ga0207645_10006398 | 3300025907 | Bacteria | 8458 |
| 386 | Ga0207645_10011247 | 3300025907 | Bacteria | 6121 |
| 387 | Ga0207645_10012047 | 3300025907 | Bacteria | 5879 |
| 388 | Ga0207643_10054635 | 3300025908 | Bacteria | 2270 |
| 389 | Ga0207705_10041475 | 3300025909 | Bacteria | 3302 |
| 390 | Ga0207705_10070454 | 3300025909 | Bacteria | 2534 |
| 391 | Ga0207705_10101472 | 3300025909 | Bacteria | 2117 |
| 392 | Ga0207705_10106674 | 3300025909 | Bacteria | 2066 |
| 393 | Ga0207705_10109683 | 3300025909 | Bacteria | 2038 |
| 394 | Ga0207684_10031655 | 3300025910 | Bacteria | 4499 |
| 395 | Ga0207695_10022061 | 3300025913 | Bacteria | 7244 |
| 396 | Ga0207695_10080409 | 3300025913 | Bacteria | 3300 |
| 397 | Ga0207695_10214074 | 3300025913 | Bacteria | 1836 |
| 398 | Ga0207671_10000808 | 3300025914 | Bacteria | 39539 |
| 399 | Ga0207671_10051031 | 3300025914 | Bacteria | 3064 |
| 400 | Ga0207660_10127668 | 3300025917 | Bacteria | 1932 |
| 401 | Ga0207657_10025575 | 3300025919 | Bacteria | 5440 |
| 402 | Ga0207657_10034414 | 3300025919 | Bacteria | 4556 |
| 403 | Ga0207657_10069954 | 3300025919 | Bacteria | 2976 |
| 404 | Ga0207657_10155427 | 3300025919 | Bacteria | 1860 |
| 405 | Ga0207649_10002218 | 3300025920 | Bacteria | 10971 |
| 406 | Ga0207649_10208085 | 3300025920 | Unclassified | 1386 |
| 407 | Ga0207681_10003342 | 3300025923 | Bacteria | 10045 |
| 408 | Ga0207681_10004604 | 3300025923 | Bacteria | 8484 |
| 409 | Ga0207681_10040916 | 3300025923 | Bacteria | 3087 |
| 410 | Ga0207681_10060654 | 3300025923 | Bacteria | 2597 |
| 411 | Ga0207681_10268752 | 3300025923 | Bacteria | 1338 |
| 412 | Ga0207694_10011050 | 3300025924 | Bacteria | 6820 |
| 413 | Ga0207694_10018782 | 3300025924 | Bacteria | 5226 |
| 414 | Ga0207694_10025116 | 3300025924 | Bacteria | 4527 |
| 415 | Ga0207650_10000913 | 3300025925 | Bacteria | 22271 |
| 416 | Ga0207650_10002352 | 3300025925 | Bacteria | 13138 |
| 417 | Ga0207650_10055543 | 3300025925 | Bacteria | 2939 |
| 418 | Ga0207650_10056571 | 3300025925 | Bacteria | 2915 |
| 419 | Ga0207650_10095532 | 3300025925 | Bacteria | 2278 |
| 420 | Ga0207650_10102942 | 3300025925 | Bacteria | 2201 |
| 421 | Ga0207650_10124723 | 3300025925 | Bacteria | 2009 |
| 422 | Ga0207659_10000189 | 3300025926 | Bacteria | 36771 |
| 423 | Ga0207659_10023299 | 3300025926 | Bacteria | 4130 |
| 424 | Ga0207659_10052768 | 3300025926 | Bacteria | 2898 |
| 425 | Ga0207659_10060534 | 3300025926 | Bacteria | 2726 |
| 426 | Ga0207659_10061752 | 3300025926 | Bacteria | 2702 |
| 427 | Ga0207687_10163203 | 3300025927 | Bacteria | 1712 |
| 428 | Ga0207687_10188937 | 3300025927 | Bacteria | 1602 |
| 429 | Ga0207687_10266671 | 3300025927 | Bacteria | 1367 |
| 430 | Ga0207644_10011782 | 3300025931 | Bacteria | 5790 |
| 431 | Ga0207644_10011940 | 3300025931 | Bacteria | 5759 |
| 432 | Ga0207644_10021306 | 3300025931 | Bacteria | 4414 |
| 433 | Ga0207644_10062647 | 3300025931 | Bacteria | 2698 |
| 434 | Ga0207644_10102739 | 3300025931 | Bacteria | 2150 |
| 435 | Ga0207644_10128780 | 3300025931 | Bacteria | 1935 |
| 436 | Ga0207644_10188502 | 3300025931 | Bacteria | 1620 |
| 437 | Ga0207690_10005208 | 3300025932 | Bacteria | 7669 |
| 438 | Ga0207690_10025524 | 3300025932 | Bacteria | 3712 |
| 439 | Ga0207690_10051255 | 3300025932 | Bacteria | 2759 |
| 440 | Ga0207706_10005764 | 3300025933 | Bacteria | 11526 |
| 441 | Ga0207706_10202053 | 3300025933 | Bacteria | 1743 |
| 442 | Ga0207706_10242710 | 3300025933 | Bacteria | 1575 |
| 443 | Ga0207709_10008507 | 3300025935 | Bacteria | 5677 |
| 444 | Ga0207709_10070045 | 3300025935 | Bacteria | 2222 |
| 445 | Ga0207709_10214020 | 3300025935 | Bacteria | 1385 |
| 446 | Ga0207670_10171453 | 3300025936 | Bacteria | 1627 |
| 447 | Ga0207669_10001563 | 3300025937 | Bacteria | 9764 |
| 448 | Ga0207669_10019506 | 3300025937 | Bacteria | 3533 |
| 449 | Ga0207669_10042973 | 3300025937 | Bacteria | 2643 |
| 450 | Ga0207704_10017226 | 3300025938 | Bacteria | 3738 |
| 451 | Ga0207704_10037398 | 3300025938 | Bacteria | 2804 |
| 452 | Ga0207691_10002491 | 3300025940 | Bacteria | 18008 |
| 453 | Ga0207691_10031896 | 3300025940 | Bacteria | 4917 |
| 454 | Ga0207691_10041039 | 3300025940 | Bacteria | 4275 |
| 455 | Ga0207691_10066755 | 3300025940 | Bacteria | 3254 |
| 456 | Ga0207691_10095480 | 3300025940 | Bacteria | 2659 |
| 457 | Ga0207691_10106688 | 3300025940 | Bacteria | 2494 |
| 458 | Ga0207691_10109068 | 3300025940 | Bacteria | 2463 |
| 459 | Ga0207691_10136583 | 3300025940 | Bacteria | 2162 |
| 460 | Ga0207711_10016270 | 3300025941 | Bacteria | 6177 |
| 461 | Ga0207711_10021818 | 3300025941 | Bacteria | 5349 |
| 462 | Ga0207711_10025880 | 3300025941 | Bacteria | 4921 |
| 463 | Ga0207711_10041959 | 3300025941 | Bacteria | 3897 |
| 464 | Ga0207711_10077719 | 3300025941 | Bacteria | 2894 |
| 465 | Ga0207711_10108033 | 3300025941 | Bacteria | 2471 |
| 466 | Ga0207689_10003071 | 3300025942 | Bacteria | 15384 |
| 467 | Ga0207689_10005946 | 3300025942 | Bacteria | 10800 |
| 468 | Ga0207689_10021427 | 3300025942 | Bacteria | 5433 |
| 469 | Ga0207689_10070391 | 3300025942 | Bacteria | 2874 |
| 470 | Ga0207689_10122290 | 3300025942 | Bacteria | 2141 |
| 471 | Ga0207679_10001861 | 3300025945 | Bacteria | 13115 |
| 472 | Ga0207679_10006511 | 3300025945 | Bacteria | 7384 |
| 473 | Ga0207679_10024938 | 3300025945 | Bacteria | 4106 |
| 474 | Ga0207679_10190752 | 3300025945 | Bacteria | 1704 |
| 475 | Ga0207667_10026613 | 3300025949 | Bacteria | 6314 |
| 476 | Ga0207667_10043775 | 3300025949 | Bacteria | 4749 |
| 477 | Ga0207667_10313796 | 3300025949 | Bacteria | 1601 |
| 478 | Ga0207651_10028921 | 3300025960 | Bacteria | 3504 |
| 479 | Ga0207651_10113617 | 3300025960 | Bacteria | 2038 |
| 480 | Ga0207651_10150055 | 3300025960 | Bacteria | 1813 |
| 481 | Ga0207651_10165821 | 3300025960 | Bacteria | 1737 |
| 482 | Ga0207651_10234102 | 3300025960 | Bacteria | 1493 |
| 483 | Ga0207668_10019001 | 3300025972 | Bacteria | 4334 |
| 484 | Ga0207668_10022822 | 3300025972 | Bacteria | 4011 |
| 485 | Ga0207668_10028021 | 3300025972 | Bacteria | 3677 |
| 486 | Ga0207668_10164836 | 3300025972 | Bacteria | 1731 |
| 487 | Ga0207658_10002880 | 3300025986 | Bacteria | 12329 |
| 488 | Ga0207658_10011427 | 3300025986 | Bacteria | 6043 |
| 489 | Ga0207658_10103090 | 3300025986 | Bacteria | 2239 |
| 490 | Ga0207658_10224549 | 3300025986 | Bacteria | 1582 |
| 491 | Ga0207677_10006940 | 3300026023 | Bacteria | 6229 |
| 492 | Ga0207677_10007467 | 3300026023 | Bacteria | 6052 |
| 493 | Ga0207677_10107360 | 3300026023 | Bacteria | 2070 |
| 494 | Ga0207703_10001371 | 3300026035 | Bacteria | 22250 |
| 495 | Ga0207703_10003102 | 3300026035 | Bacteria | 14039 |
| 496 | Ga0207703_10075044 | 3300026035 | Bacteria | 2801 |
| 497 | Ga0207703_10337194 | 3300026035 | Bacteria | 1385 |
| 498 | Ga0207639_10083633 | 3300026041 | Bacteria | 2533 |
| 499 | Ga0207639_10093223 | 3300026041 | Bacteria | 2415 |
| 500 | Ga0207639_10093396 | 3300026041 | Bacteria | 2413 |
| 501 | Ga0207639_10132862 | 3300026041 | Bacteria | 2063 |
| 502 | Ga0207678_10002552 | 3300026067 | Bacteria | 16593 |
| 503 | Ga0207678_10028588 | 3300026067 | Bacteria | 4866 |
| 504 | Ga0207678_10175820 | 3300026067 | Bacteria | 1828 |
| 505 | Ga0207708_10113340 | 3300026075 | Bacteria | 2107 |
| 506 | Ga0207702_10001598 | 3300026078 | Bacteria | 22413 |
| 507 | Ga0207702_10007455 | 3300026078 | Bacteria | 9334 |
| 508 | Ga0207641_10001848 | 3300026088 | Bacteria | 20315 |
| 509 | Ga0207641_10003303 | 3300026088 | Bacteria | 14346 |
| 510 | Ga0207641_10061733 | 3300026088 | Bacteria | 3197 |
| 511 | Ga0207641_10198703 | 3300026088 | Bacteria | 1847 |
| 512 | Ga0207648_10000142 | 3300026089 | Bacteria | 71593 |
| 513 | Ga0207648_10001050 | 3300026089 | Bacteria | 30933 |
| 514 | Ga0207648_10001133 | 3300026089 | Bacteria | 29959 |
| 515 | Ga0207648_10008497 | 3300026089 | Bacteria | 9937 |
| 516 | Ga0207648_10024671 | 3300026089 | Bacteria | 5363 |
| 517 | Ga0207648_10045451 | 3300026089 | Bacteria | 3851 |
| 518 | Ga0207648_10116109 | 3300026089 | Bacteria | 2352 |
| 519 | Ga0207648_10147811 | 3300026089 | Bacteria | 2073 |
| 520 | Ga0207648_10169411 | 3300026089 | Bacteria | 1930 |
| 521 | Ga0207676_10005300 | 3300026095 | Bacteria | 9134 |
| 522 | Ga0207676_10011402 | 3300026095 | Bacteria | 6352 |
| 523 | Ga0207676_10105908 | 3300026095 | Bacteria | 2342 |
| 524 | Ga0207676_10132508 | 3300026095 | Bacteria | 2121 |
| 525 | Ga0207674_10014389 | 3300026116 | Bacteria | 8740 |
| 526 | Ga0207674_10038360 | 3300026116 | Bacteria | 4973 |
| 527 | Ga0207674_10073745 | 3300026116 | Bacteria | 3426 |
| 528 | Ga0207674_10164584 | 3300026116 | Bacteria | 2172 |
| 529 | Ga0207674_10206732 | 3300026116 | Bacteria | 1912 |
| 530 | Ga0207675_100006272 | 3300026118 | Bacteria | 11285 |
| 531 | Ga0207675_100009210 | 3300026118 | Bacteria | 9259 |
| 532 | Ga0207675_100029352 | 3300026118 | Bacteria | 5125 |
| 533 | Ga0207675_100107068 | 3300026118 | Bacteria | 2636 |
| 534 | Ga0207675_100136627 | 3300026118 | Bacteria | 2327 |
| 535 | Ga0207683_10008770 | 3300026121 | Bacteria | 8635 |
| 536 | Ga0207683_10009813 | 3300026121 | Bacteria | 8166 |
| 537 | Ga0207683_10054604 | 3300026121 | Bacteria | 3503 |
| 538 | Ga0207683_10073314 | 3300026121 | Bacteria | 3028 |
| 539 | Ga0207683_10087122 | 3300026121 | Bacteria | 2777 |
| 540 | Ga0207683_10172117 | 3300026121 | Bacteria | 1961 |
| 541 | Ga0207683_10352355 | 3300026121 | Bacteria | 1351 |
| 542 | Ga0207698_10002851 | 3300026142 | Bacteria | 10340 |
| 543 | Ga0207698_10005667 | 3300026142 | Bacteria | 7734 |
| 544 | Ga0207698_10007500 | 3300026142 | Bacteria | 6837 |
| 545 | Ga0207698_10061866 | 3300026142 | Bacteria | 2920 |
| 546 | Ga0207698_10089223 | 3300026142 | Bacteria | 2517 |
| 547 | Ga0207698_10208000 | 3300026142 | Bacteria | 1758 |
| 548 | Ga0207698_10234734 | 3300026142 | Bacteria | 1667 |
| 549 | Ga0209281_1000442 | 3300027111 | Bacteria | 59796 |
| 550 | Ga0209389_1027328 | 3300027296 | Bacteria | 4924 |
| 551 | Ga0209966_1000004 | 3300027695 | Bacteria | 108133 |
| 552 | Ga0209974_10002124 | 3300027876 | Bacteria | 7251 |
| 553 | Ga0268266_10020171 | 3300028379 | Bacteria | 5681 |
| 554 | Ga0268266_10088313 | 3300028379 | Bacteria | 2713 |
| 555 | Ga0268265_10008626 | 3300028380 | Bacteria | 6889 |
| 556 | Ga0268265_10036142 | 3300028380 | Bacteria | 3616 |
| 557 | Ga0268265_10047867 | 3300028380 | Bacteria | 3206 |
| 558 | Ga0268265_10096698 | 3300028380 | Bacteria | 2374 |
| 559 | Ga0268264_10007839 | 3300028381 | Bacteria | 8888 |
| 560 | Ga0268264_10119005 | 3300028381 | Bacteria | 2325 |
| 561 | Ga0265336_10000062 | 3300028666 | Bacteria | 101023 |
| 562 | Ga0307517_10013803 | 3300028786 | Bacteria | 10936 |
| 563 | Ga0307515_10000022 | 3300028794 | Bacteria | 404064 |
| 564 | Ga0307515_10000191 | 3300028794 | Bacteria | 149201 |
| 565 | Ga0307515_10003517 | 3300028794 | Bacteria | 32929 |
| 566 | Ga0307515_10003519 | 3300028794 | Bacteria | 32915 |
| 567 | Ga0307515_10021930 | 3300028794 | Bacteria | 11292 |
| 568 | Ga0307515_10036215 | 3300028794 | Bacteria | 7992 |
| 569 | Ga0307515_10063975 | 3300028794 | Bacteria | 5152 |
| 570 | Ga0307515_10082008 | 3300028794 | Bacteria | 4179 |
| 571 | Ga0307515_10135477 | 3300028794 | Bacteria | 2681 |
| 572 | Ga0307515_10150616 | 3300028794 | Bacteria | 2434 |
| 573 | Ga0307515_10187724 | 3300028794 | Bacteria | 1989 |
| 574 | Ga0265324_10015589 | 3300029957 | Bacteria | 2791 |
| 575 | Ga0307511_10068954 | 3300030521 | Bacteria | 2606 |
| 576 | Ga0307512_10056761 | 3300030522 | Bacteria | 3070 |
| 577 | Ga0307512_10141375 | 3300030522 | Bacteria | 1472 |
| 578 | Ga0265330_10000032 | 3300031235 | Bacteria | 130592 |
| 579 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 580 | Ga0265328_10015973 | 3300031239 | Bacteria | 2930 |
| 581 | Ga0265327_10000043 | 3300031251 | Bacteria | 285108 |
| 582 | Ga0265316_10000151 | 3300031344 | Bacteria | 76436 |
| 583 | Ga0307513_10011299 | 3300031456 | Bacteria | 11111 |
| 584 | Ga0307513_10015357 | 3300031456 | Bacteria | 9285 |
| 585 | Ga0307513_10023996 | 3300031456 | Bacteria | 7106 |
| 586 | Ga0307513_10058698 | 3300031456 | Bacteria | 4087 |
| 587 | Ga0307509_10000215 | 3300031507 | Bacteria | 92190 |
| 588 | Ga0307509_10098502 | 3300031507 | Bacteria | 2968 |
| 589 | Ga0307509_10118652 | 3300031507 | Bacteria | 2628 |
| 590 | Ga0307509_10177294 | 3300031507 | Bacteria | 2002 |
| 591 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 592 | Ga0307408_100000513 | 3300031548 | Bacteria | 33428 |
| 593 | Ga0307408_100188771 | 3300031548 | Bacteria | 1659 |
| 594 | Ga0307508_10000017 | 3300031616 | Bacteria | 203567 |
| 595 | Ga0307508_10000094 | 3300031616 | Bacteria | 104107 |
| 596 | Ga0307508_10034900 | 3300031616 | Bacteria | 4532 |
| 597 | Ga0307508_10067005 | 3300031616 | Bacteria | 3159 |
| 598 | Ga0307508_10185848 | 3300031616 | Bacteria | 1680 |
| 599 | Ga0307514_10002966 | 3300031649 | Bacteria | 16819 |
| 600 | Ga0307514_10004466 | 3300031649 | Bacteria | 12861 |
| 601 | Ga0265314_10000022 | 3300031711 | Bacteria | 297299 |
| 602 | Ga0307516_10000254 | 3300031730 | Bacteria | 68771 |
| 603 | Ga0307516_10001811 | 3300031730 | Bacteria | 29376 |
| 604 | Ga0307516_10002501 | 3300031730 | Bacteria | 24512 |
| 605 | Ga0307516_10006776 | 3300031730 | Bacteria | 13382 |
| 606 | Ga0307516_10035350 | 3300031730 | Bacteria | 5014 |
| 607 | Ga0307516_10132006 | 3300031730 | Bacteria | 2276 |
| 608 | Ga0307516_10160601 | 3300031730 | Bacteria | 1998 |
| 609 | Ga0307516_10175088 | 3300031730 | Bacteria | 1883 |
| 610 | Ga0307406_10000279 | 3300031901 | Bacteria | 30071 |
| 611 | Ga0307409_100001509 | 3300031995 | Bacteria | 11510 |
| 612 | Ga0307409_100060955 | 3300031995 | Bacteria | 2945 |
| 613 | Ga0307416_100031303 | 3300032002 | Bacteria | 4003 |
| 614 | Ga0307416_100073842 | 3300032002 | Bacteria | 2846 |
| 615 | Ga0307411_10030308 | 3300032005 | Bacteria | 3314 |
| 616 | Ga0307411_10032183 | 3300032005 | Bacteria | 3237 |
| 617 | Ga0307411_10038304 | 3300032005 | Bacteria | 3023 |
| 618 | Ga0307411_10048742 | 3300032005 | Bacteria | 2748 |
| 619 | Ga0307415_100004973 | 3300032126 | Bacteria | 6994 |
| 620 | Ga0307507_10093838 | 3300033179 | Bacteria | 2554 |
| 621 | Ga0307507_10098962 | 3300033179 | Bacteria | 2452 |
| 622 | Ga0307510_10007507 | 3300033180 | Bacteria | 12984 |
| 623 | Ga0307510_10027415 | 3300033180 | Bacteria | 6526 |
| 624 | Ga0307510_10057953 | 3300033180 | Bacteria | 4014 |
| 625 | Ga0373939_0000164 | 3300035114 | Bacteria | 18449 |
| 626 | Ga0373960_0002111 | 3300035121 | Bacteria | 4477 |
| 627 | Ga0373931_0002571 | 3300035691 | Bacteria | 8081 |
| 628 | Ga0373931_0044183 | 3300035691 | Bacteria | 2349 |
| 629 | Ga0373935_0155852 | 3300035692 | Bacteria | 1553 |
| 630 | Ga0373927_0029351 | 3300035695 | Bacteria | 3584 |
| 631 | Ga0373927_0091127 | 3300035695 | Bacteria | 1980 |
| 632 | Ga0373937_0138413 | 3300036401 | Bacteria | 2277 |
| 633 | Ga0373925_0004683 | 3300037068 | Bacteria | 10322 |
| 634 | Ga0373925_0035343 | 3300037068 | Bacteria | 3686 |
| 635 | Ga0373925_0169558 | 3300037068 | Bacteria | 1723 |
| 636 | Ga0395899_0002565 | 3300037312 | Bacteria | 14691 |
| 637 | Ga0395899_0028348 | 3300037312 | Bacteria | 4218 |
| 638 | Ga0395900_0000188 | 3300037418 | Bacteria | 99195 |
| 639 | Ga0395900_0005484 | 3300037418 | Bacteria | 13283 |
| 640 | Ga0395900_0249015 | 3300037418 | Bacteria | 1779 |
| 641 | Ga0395898_0006418 | 3300037466 | Bacteria | 12559 |
| 642 | Ga0395898_0017271 | 3300037466 | Bacteria | 7370 |
| 643 | Ga0395898_0028321 | 3300037466 | Bacteria | 5615 |
| 644 | Ga0395898_0110946 | 3300037466 | Bacteria | 2629 |
| 645 | Ga0395905_0000106 | 3300037471 | Bacteria | 140180 |
| 646 | Ga0395905_0001392 | 3300037471 | Bacteria | 29351 |
| 647 | Ga0395905_0002852 | 3300037471 | Bacteria | 18906 |
| 648 | Ga0395905_0002964 | 3300037471 | Bacteria | 18450 |
| 649 | Ga0395905_0004837 | 3300037471 | Bacteria | 13888 |
| 650 | Ga0395905_0010220 | 3300037471 | Bacteria | 9146 |
| 651 | Ga0395905_0020704 | 3300037471 | Bacteria | 6228 |
| 652 | Ga0395905_0020789 | 3300037471 | Bacteria | 6215 |
| 653 | Ga0395905_0060299 | 3300037471 | Bacteria | 3547 |
| 654 | Ga0395905_0139665 | 3300037471 | Bacteria | 2279 |
| 655 | Ga0395905_0213324 | 3300037471 | Bacteria | 1808 |
| 656 | Ga0395905_0243284 | 3300037471 | Bacteria | 1681 |
| 657 | Ga0395901_0006203 | 3300038443 | Bacteria | 12113 |
| 658 | Ga0395901_0035718 | 3300038443 | Bacteria | 5135 |
| 659 | Ga0395901_0092099 | 3300038443 | Bacteria | 3173 |
| 660 | Ga0395901_0092493 | 3300038443 | Bacteria | 3166 |
| 661 | Ga0395901_0189875 | 3300038443 | Bacteria | 2154 |
| 662 | Ga0436361_0141959 | 3300039447 | Bacteria | 3063 |
| 663 | Ga0436361_0376061 | 3300039447 | Bacteria | 200571 |
| 664 | Ga0436361_0399628 | 3300039447 | Bacteria | 3018 |
| 665 | Ga0436361_0583521 | 3300039447 | Bacteria | 71514 |
| 666 | Ga0451791_1242034 | 3300041451 | Bacteria | 1203 |
| 667 | Ga0451800_1626932 | 3300041459 | Bacteria | 1587 |
| 668 | Ga0439431_0009009 | 3300041997 | Bacteria | 2249 |
| 669 | Ga0439437_001198 | 3300042000 | Bacteria | 2718 |
| 670 | Ga0450919_000269 | 3300042121 | Bacteria | 6030 |
| 671 | Ga0450920_007520 | 3300042122 | Bacteria | 1976 |
| 672 | Ga0450923_001458 | 3300042125 | Bacteria | 3139 |
| 673 | Ga0450891_000891 | 3300042129 | Bacteria | 3126 |
| 674 | Ga0450889_000608 | 3300042144 | Bacteria | 3976 |
| 675 | Ga0439459_0000228 | 3300042438 | Bacteria | 6442 |
| 676 | Ga0439464_0000764 | 3300042439 | Bacteria | 6994 |
| 677 | Ga0439464_0003749 | 3300042439 | Bacteria | 3859 |
| 678 | Ga0450918_000945 | 3300042531 | Bacteria | 6076 |
| 679 | Ga0450893_0005693 | 3300042532 | Bacteria | 2007 |
| 680 | Ga0451577_0001353 | 3300042876 | Bacteria | 33109 |
| 681 | Ga0466969_0000002 | 3300044656 | Bacteria | 178693 |
| 682 | Ga0466969_0007330 | 3300044656 | Bacteria | 5863 |
| 683 | Ga0466969_0009526 | 3300044656 | Bacteria | 5147 |
| 684 | Ga0466969_0037283 | 3300044656 | Bacteria | 2452 |
| 685 | Ga0466965_0002506 | 3300044683 | Bacteria | 7817 |
| 686 | Ga0466965_0014746 | 3300044683 | Bacteria | 3701 |
| 687 | Ga0466965_0064093 | 3300044683 | Bacteria | 1839 |
| 688 | Ga0466965_0081038 | 3300044683 | Bacteria | 1641 |
| 689 | Ga0466966_0001339 | 3300044684 | Bacteria | 15826 |
| 690 | Ga0466966_0007833 | 3300044684 | Bacteria | 7070 |
| 691 | Ga0466966_0015276 | 3300044684 | Bacteria | 5077 |
| 692 | Ga0466966_0020128 | 3300044684 | Bacteria | 4391 |
| 693 | Ga0466961_0008620 | 3300044693 | Bacteria | 6498 |
| 694 | Ga0466961_0026940 | 3300044693 | Bacteria | 3696 |
| 695 | Ga0466961_0090320 | 3300044693 | Bacteria | 1934 |
| 696 | Ga0466963_0074855 | 3300044694 | Bacteria | 2284 |
| 697 | Ga0466963_0144363 | 3300044694 | Bacteria | 1650 |
| 698 | Ga0466964_0002006 | 3300044706 | Bacteria | 7158 |
| 699 | Ga0453684_0006474 | 3300044712 | Bacteria | 22221 |
| 700 | Ga0453684_0083182 | 3300044712 | Bacteria | 3984 |
| 701 | Ga0466971_0001980 | 3300044719 | Bacteria | 8667 |
| 702 | Ga0466968_0017259 | 3300044735 | Bacteria | 2883 |
| 703 | Ga0466970_0044954 | 3300044765 | Bacteria | 2351 |
| 704 | Ga0466970_0140502 | 3300044765 | Bacteria | 1330 |
| 705 | Ga0466959_0001562 | 3300045049 | Bacteria | 14096 |
| 706 | Ga0466959_0004663 | 3300045049 | Bacteria | 9223 |
| 707 | Ga0466959_0008282 | 3300045049 | Bacteria | 7343 |
| 708 | Ga0451576_0079493 | 3300045051 | Bacteria | 3412 |
| 709 | Ga0451576_0087359 | 3300045051 | Bacteria | 3243 |
| 710 | Ga0451576_0271512 | 3300045051 | Bacteria | 1773 |
| 711 | Ga0451576_0334921 | 3300045051 | Bacteria | 1584 |
| 712 | Ga0466967_0026883 | 3300045976 | Bacteria | 4776 |
| 713 | Ga0466967_0339891 | 3300045976 | Bacteria | 1451 |
| 714 | Ga0495592_0001770 | 3300046454 | Bacteria | 15193 |
| 715 | Ga0495638_0042795 | 3300046460 | Bacteria | 2860 |
| 716 | Ga0495650_0008824 | 3300046471 | Bacteria | 5825 |
| 717 | Ga0495650_0021298 | 3300046471 | Bacteria | 3138 |
| 718 | Ga0495580_0033530 | 3300046472 | Bacteria | 3699 |
| 719 | Ga0495639_0046092 | 3300046475 | Bacteria | 1973 |
| 720 | Ga0495585_0005980 | 3300046492 | Bacteria | 7613 |
| 721 | Ga0495583_0000153 | 3300046506 | Bacteria | 115755 |
| 722 | Ga0495606_0002667 | 3300046507 | Bacteria | 20265 |
| 723 | Ga0495606_0029123 | 3300046507 | Bacteria | 3882 |
| 724 | Ga0495610_0026708 | 3300046512 | Bacteria | 3079 |
| 725 | Ga0495610_0073678 | 3300046512 | Bacteria | 1586 |
| 726 | Ga0495620_0022622 | 3300046515 | Bacteria | 3024 |
| 727 | Ga0495632_0022786 | 3300046519 | Bacteria | 3352 |
| 728 | Ga0495632_0072153 | 3300046519 | Bacteria | 1657 |
| 729 | Ga0495643_0020062 | 3300046522 | Bacteria | 3861 |
| 730 | Ga0495654_0000550 | 3300046530 | Bacteria | 30238 |
| 731 | Ga0495586_0022236 | 3300046535 | Bacteria | 3383 |
| 732 | Ga0495598_0035208 | 3300046537 | Bacteria | 1432 |
| 733 | Ga0495597_0010147 | 3300046542 | Bacteria | 4614 |
| 734 | Ga0495625_0005772 | 3300046660 | Bacteria | 11192 |
| 735 | Ga0495625_0013423 | 3300046660 | Bacteria | 6584 |
| 736 | Ga0495625_0043089 | 3300046660 | Bacteria | 3275 |
| 737 | Ga0495658_0010441 | 3300046683 | Bacteria | 4646 |
| 738 | Ga0495658_0088988 | 3300046683 | Bacteria | 1826 |
| 739 | Ga0495658_0115747 | 3300046683 | Bacteria | 1616 |
| 740 | Ga0495658_0168679 | 3300046683 | Bacteria | 1353 |
| 741 | Ga0495649_0002833 | 3300046694 | Bacteria | 12031 |
| 742 | Ga0495649_0013059 | 3300046694 | Bacteria | 4803 |
| 743 | Ga0495660_0031092 | 3300046810 | Bacteria | 3004 |
| 744 | Ga0495660_0038817 | 3300046810 | Bacteria | 2646 |
| 745 | Ga0495676_0056004 | 3300047321 | Bacteria | 3121 |
| 746 | Ga0495687_002210 | 3300047443 | Bacteria | 16075 |
| 747 | Ga0495684_0177860 | 3300047471 | Bacteria | 1579 |
| 748 | Ga0495686_0060940 | 3300047472 | Bacteria | 2345 |
| 749 | Ga0495626_0078352 | 3300048091 | Bacteria | 1472 |
| 750 | Ga0496102_0020879 | 3300048905 | Bacteria | 5789 |
| 751 | Ga0496102_0026281 | 3300048905 | Bacteria | 5190 |
| 752 | Ga0496102_0046041 | 3300048905 | Bacteria | 3961 |
| 753 | Ga0496104_0008841 | 3300048907 | Bacteria | 8953 |
| 754 | Ga0496105_0107002 | 3300048908 | Bacteria | 2309 |
| 755 | Ga0496106_0089601 | 3300048909 | Bacteria | 2372 |
| 756 | Ga0496108_0073683 | 3300048911 | Bacteria | 2882 |
| 757 | Ga0496108_0118426 | 3300048911 | Bacteria | 2270 |
| 758 | Ga0496108_0143944 | 3300048911 | Bacteria | 2054 |
| 759 | Ga0496108_0229757 | 3300048911 | Bacteria | 1613 |
| 760 | Ga0496109_0013396 | 3300048912 | Bacteria | 7111 |
| 761 | Ga0496109_0125200 | 3300048912 | Bacteria | 2396 |
| 762 | Ga0496109_0243456 | 3300048912 | Bacteria | 1693 |
| 763 | Ga0496110_0073096 | 3300048913 | Bacteria | 3043 |
| 764 | Ga0496111_0076891 | 3300048914 | Bacteria | 2433 |
| 765 | Ga0496113_0032000 | 3300048916 | Bacteria | 3821 |
| 766 | Ga0496113_0099656 | 3300048916 | Bacteria | 2250 |
| 767 | Ga0496114_0003382 | 3300048917 | Bacteria | 12248 |
| 768 | Ga0496114_0073018 | 3300048917 | Bacteria | 2887 |
| 769 | Ga0496114_0122684 | 3300048917 | Bacteria | 2236 |
| 770 | Ga0496114_0136188 | 3300048917 | Bacteria | 2124 |
| 771 | Ga0496115_0057989 | 3300048918 | Bacteria | 3115 |
| 772 | Ga0496121_0022752 | 3300048924 | Bacteria | 6064 |
| 773 | Ga0496124_0000151 | 3300048927 | Bacteria | 142761 |
| 774 | Ga0496124_0008805 | 3300048927 | Bacteria | 10481 |
| 775 | Ga0496125_0005971 | 3300048928 | Bacteria | 13330 |
| 776 | Ga0501309_000516 | 3300049129 | Bacteria | 3173 |
| 777 | Ga0501310_000594 | 3300049130 | Bacteria | 3185 |
| 778 | Ga0501305_003384 | 3300049161 | Bacteria | 1802 |
| 779 | Ga0501312_000367 | 3300049528 | Bacteria | 3459 |
| 780 | Ga0501314_000187 | 3300049530 | Bacteria | 3350 |
| 781 | Ga0501322_000294 | 3300049538 | Bacteria | 2207 |
| 782 | Ga0501034_0140259 | 3300049571 | Bacteria | 2397 |
| 783 | Ga0501043_0000141 | 3300049579 | Bacteria | 67326 |
| 784 | Ga0501046_0000047 | 3300049580 | Bacteria | 140344 |
| 785 | Ga0501047_0000058 | 3300049581 | Bacteria | 139202 |
| 786 | Ga0501048_0015863 | 3300049582 | Bacteria | 5559 |
| 787 | Ga0501198_000002 | 3300049649 | Bacteria | 197356 |
| 788 | Ga0501222_000002 | 3300049662 | Bacteria | 169093 |
| 789 | Ga0501262_001512 | 3300049759 | Bacteria | 2609 |
| 790 | Ga0501267_000119 | 3300049764 | Bacteria | 5089 |
| 791 | Ga0501035_0107232 | 3300049822 | Bacteria | 2449 |
| 792 | nmdc:mga03683_10537_c1 | 3300050489 | Bacteria | 3317 |
| 793 | nmdc:mga03683_8491_c1 | 3300050489 | Bacteria | 3615 |
| 794 | nmdc:mga03n38_39797_c1 | 3300050490 | Bacteria | 2040 |
| 795 | nmdc:mga00v17_12324_c1 | 3300050491 | Bacteria | 4716 |
| 796 | nmdc:mga0k408_11200_c1 | 3300050493 | Bacteria | 4877 |
| 797 | nmdc:mga0k408_1236_c1 | 3300050493 | Bacteria | 13975 |
| 798 | nmdc:mga0k408_140890_c1 | 3300050493 | Bacteria | 1435 |
| 799 | nmdc:mga0k408_1461_c1 | 3300050493 | Bacteria | 12750 |
| 800 | nmdc:mga0k408_23800_c1 | 3300050493 | Bacteria | 3459 |
| 801 | nmdc:mga0k408_40389_c1 | 3300050493 | Bacteria | 2685 |
| 802 | nmdc:mga0k408_41303_c1 | 3300050493 | Bacteria | 2655 |
| 803 | nmdc:mga0k408_64737_c1 | 3300050493 | Bacteria | 2128 |
| 804 | nmdc:mga0k408_7522_c1 | 3300050493 | Bacteria | 5818 |
| 805 | nmdc:mga0k408_777_c1 | 3300050493 | Bacteria | 17540 |
| 806 | nmdc:mga06z11_33118_c1 | 3300050494 | Bacteria | 2525 |
| 807 | nmdc:mga06z11_3424_c1 | 3300050494 | Bacteria | 6130 |
| 808 | nmdc:mga07m45_10379_c1 | 3300050496 | Bacteria | 4864 |
| 809 | nmdc:mga07m45_1634_c1 | 3300050496 | Bacteria | 10321 |
| 810 | nmdc:mga07m45_182_c1 | 3300050496 | Bacteria | 25233 |
| 811 | nmdc:mga07m45_34095_c1 | 3300050496 | Bacteria | 2828 |
| 812 | nmdc:mga07m45_43473_c1 | 3300050496 | Bacteria | 2519 |
| 813 | nmdc:mga07m45_44545_c1 | 3300050496 | Bacteria | 2491 |
| 814 | nmdc:mga07m45_4520_c1 | 3300050496 | Bacteria | 6814 |
| 815 | nmdc:mga07m45_58545_c1 | 3300050496 | Bacteria | 2180 |
| 816 | nmdc:mga07m45_61002_c1 | 3300050496 | Bacteria | 2136 |
| 817 | nmdc:mga07m45_843_c1 | 3300050496 | Bacteria | 13299 |
| 818 | nmdc:mga09592_3371_c1 | 3300050508 | Bacteria | 12912 |
| 819 | nmdc:mga0sz30_31849_c1 | 3300050516 | Bacteria | 2184 |
| 820 | Ga0495601_0030415 | 3300053077 | Bacteria | 3353 |
| 821 | Ga0500635_0000033 | 3300053080 | Bacteria | 97175 |
| 822 | Ga0500635_0061116 | 3300053080 | Bacteria | 1315 |
| 823 | Ga0500578_0000002 | 3300053086 | Bacteria | 293507 |
| 824 | Ga0500578_0043483 | 3300053086 | Bacteria | 2884 |
| 825 | Ga0500644_0034098 | 3300053088 | Bacteria | 1640 |
| 826 | Ga0500646_0004313 | 3300053090 | Bacteria | 3604 |
| 827 | Ga0500646_0023026 | 3300053090 | Bacteria | 1669 |
| 828 | Ga0500583_0011260 | 3300053092 | Bacteria | 3362 |
| 829 | Ga0500583_0058658 | 3300053092 | Bacteria | 1811 |
| 830 | Ga0500651_0009619 | 3300053093 | Bacteria | 5757 |
| 831 | Ga0500593_001202 | 3300053117 | Bacteria | 9351 |
| 832 | Ga0500594_0000251 | 3300053118 | Bacteria | 12824 |
| 833 | Ga0500607_034061 | 3300053121 | Bacteria | 2790 |
| 834 | Ga0500623_057724 | 3300053127 | Bacteria | 1929 |
| 835 | Ga0500652_000102 | 3300053131 | Bacteria | 33562 |
| 836 | Ga0500658_0009139 | 3300053134 | Bacteria | 3657 |
| 837 | Ga0500559_0000392 | 3300053136 | Bacteria | 31988 |
| 838 | Ga0500559_0010715 | 3300053136 | Bacteria | 3930 |
| 839 | Ga0500568_0003681 | 3300053139 | Bacteria | 8423 |
| 840 | Ga0500568_0006565 | 3300053139 | Bacteria | 5822 |
| 841 | Ga0500577_0004869 | 3300053142 | Bacteria | 3574 |
| 842 | Ga0500604_0025337 | 3300053151 | Bacteria | 1705 |
| 843 | Ga0500619_000015 | 3300053154 | Bacteria | 54620 |
| 844 | Ga0500622_0002031 | 3300053156 | Bacteria | 15103 |
| 845 | Ga0500622_0007029 | 3300053156 | Bacteria | 6438 |
| 846 | Ga0500634_0044624 | 3300053161 | Bacteria | 2400 |
| 847 | Ga0500636_0044649 | 3300053177 | Bacteria | 2613 |
| 848 | Ga0500645_006937 | 3300053730 | Bacteria | 3994 |
| 849 | Ga0500587_002000 | 3300053739 | Bacteria | 2909 |
| 850 | Ga0590071_000456 | 3300059421 | Bacteria | 11882 |
| 851 | Ga0466962_0004675 | 3300061719 | Bacteria | 6574 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005530 | Ga0070679_100102950 | Ga0070679_1001029502 | 275 |
| 2 | 3300009093 | Ga0105240_10007877 | Ga0105240_100078777 | 275 |
| 3 | 3300009551 | Ga0105238_10080890 | Ga0105238_100808902 | 275 |
| 4 | 3300025949 | Ga0207667_10043775 | Ga0207667_100437754 | 275 |
| 5 | 3300005353 | Ga0070669_100047550 | Ga0070669_1000475502 | 288 |
| 6 | 3300005354 | Ga0070675_100090433 | Ga0070675_1000904332 | 288 |
| 7 | 3300005364 | Ga0070673_100056823 | Ga0070673_1000568233 | 288 |
| 8 | 3300025923 | Ga0207681_10040916 | Ga0207681_100409162 | 288 |
| 9 | 3300025926 | Ga0207659_10060534 | Ga0207659_100605342 | 288 |
| 10 | 3300025940 | Ga0207691_10066755 | Ga0207691_100667551 | 288 |
| 11 | 3300025960 | Ga0207651_10165821 | Ga0207651_101658212 | 288 |
| 12 | 3300013102 | Ga0157371_10216460 | Ga0157371_102164602 | 290 |
| 13 | 3300026142 | Ga0207698_10089223 | Ga0207698_100892232 | 295 |
| 14 | 3300025925 | Ga0207650_10102942 | Ga0207650_101029422 | 300 |
| 15 | 3300005327 | Ga0070658_10157061 | Ga0070658_101570611 | 302 |
| 16 | 3300005329 | Ga0070683_100024422 | Ga0070683_1000244224 | 302 |
| 17 | 3300005339 | Ga0070660_100038551 | Ga0070660_1000385513 | 302 |
| 18 | 3300005344 | Ga0070661_100007118 | Ga0070661_1000071185 | 302 |
| 19 | 3300005366 | Ga0070659_100004438 | Ga0070659_1000044389 | 302 |
| 20 | 3300005564 | Ga0070664_100014573 | Ga0070664_1000145735 | 302 |
| 21 | 3300005577 | Ga0068857_100113306 | Ga0068857_1001133062 | 302 |
| 22 | 3300005578 | Ga0068854_100001430 | Ga0068854_1000014306 | 302 |
| 23 | 3300005614 | Ga0068856_100008607 | Ga0068856_1000086074 | 302 |
| 24 | 3300005834 | Ga0068851_10002903 | Ga0068851_100029037 | 302 |
| 25 | 3300006042 | Ga0075368_10026244 | Ga0075368_100262442 | 302 |
| 26 | 3300009093 | Ga0105240_10203719 | Ga0105240_102037192 | 302 |
| 27 | 3300009551 | Ga0105238_10019763 | Ga0105238_100197635 | 302 |
| 28 | 3300013307 | Ga0157372_10033047 | Ga0157372_100330473 | 302 |
| 29 | 3300025909 | Ga0207705_10070454 | Ga0207705_100704543 | 302 |
| 30 | 3300025913 | Ga0207695_10214074 | Ga0207695_102140741 | 302 |
| 31 | 3300025919 | Ga0207657_10025575 | Ga0207657_100255754 | 302 |
| 32 | 3300025924 | Ga0207694_10025116 | Ga0207694_100251162 | 302 |
| 33 | 3300025932 | Ga0207690_10005208 | Ga0207690_100052087 | 302 |
| 34 | 3300026041 | Ga0207639_10093223 | Ga0207639_100932232 | 302 |
| 35 | 3300026078 | Ga0207702_10007455 | Ga0207702_100074554 | 302 |
| 36 | 3300026116 | Ga0207674_10164584 | Ga0207674_101645842 | 302 |
| 37 | 3300026142 | Ga0207698_10002851 | Ga0207698_100028515 | 302 |
| 38 | 3300005329 | Ga0070683_100045692 | Ga0070683_1000456922 | 304 |
| 39 | 3300005564 | Ga0070664_100088741 | Ga0070664_1000887413 | 304 |
| 40 | 3300050496 | nmdc:mga07m45_58545_c1 | nmdc:mga07m45_58545_c1_108_1076 | 305 |
| 41 | 3300005364 | Ga0070673_100089865 | Ga0070673_1000898653 | 307 |
| 42 | 3300005616 | Ga0068852_100111780 | Ga0068852_1001117803 | 307 |
| 43 | 3300006051 | Ga0075364_10009703 | Ga0075364_100097032 | 307 |
| 44 | 3300006178 | Ga0075367_10022933 | Ga0075367_100229332 | 307 |
| 45 | 3300006353 | Ga0075370_10040177 | Ga0075370_100401772 | 307 |
| 46 | 3300009545 | Ga0105237_10010721 | Ga0105237_100107219 | 307 |
| 47 | 3300010375 | Ga0105239_10019576 | Ga0105239_100195767 | 307 |
| 48 | 3300025914 | Ga0207671_10051031 | Ga0207671_100510312 | 307 |
| 49 | 3300025942 | Ga0207689_10122290 | Ga0207689_101222902 | 307 |
| 50 | 3300031239 | Ga0265328_10015973 | Ga0265328_100159732 | 307 |
| 51 | 3300031251 | Ga0265327_10000043 | Ga0265327_1000004373 | 307 |
| 52 | 3300050491 | nmdc:mga00v17_12324_c1 | nmdc:mga00v17_12324_c1_1790_2950 | 307 |
| 53 | 3300050493 | nmdc:mga0k408_40389_c1 | nmdc:mga0k408_40389_c1_805_1965 | 307 |
| 54 | 3300050494 | nmdc:mga06z11_3424_c1 | nmdc:mga06z11_3424_c1_2042_3202 | 307 |
| 55 | 3300050496 | nmdc:mga07m45_10379_c1 | nmdc:mga07m45_10379_c1_1607_2767 | 307 |
| 56 | 3300050516 | nmdc:mga0sz30_31849_c1 | nmdc:mga0sz30_31849_c1_726_1886 | 307 |
| 57 | 3300006038 | Ga0075365_10044561 | Ga0075365_100445613 | 308 |
| 58 | 3300006178 | Ga0075367_10055639 | Ga0075367_100556393 | 308 |
| 59 | 3300006186 | Ga0075369_10012396 | Ga0075369_100123963 | 308 |
| 60 | 3300006353 | Ga0075370_10007745 | Ga0075370_100077453 | 308 |
| 61 | 3300026116 | Ga0207674_10038360 | Ga0207674_100383605 | 308 |
| 62 | 3300031730 | Ga0307516_10160601 | Ga0307516_101606012 | 308 |
| 63 | 3300044765 | Ga0466970_0140502 | Ga0466970_0140502_324_1301 | 308 |
| 64 | 3300046460 | Ga0495638_0042795 | Ga0495638_0042795_1417_2535 | 308 |
| 65 | 3300046515 | Ga0495620_0022622 | Ga0495620_0022622_919_2037 | 308 |
| 66 | 3300050489 | nmdc:mga03683_10537_c1 | nmdc:mga03683_10537_c1_1911_3029 | 308 |
| 67 | 3300050496 | nmdc:mga07m45_4520_c1 | nmdc:mga07m45_4520_c1_4999_6117 | 308 |
| 68 | 3300053088 | Ga0500644_0034098 | Ga0500644_0034098_476_1594 | 308 |
| 69 | 3300053092 | Ga0500583_0058658 | Ga0500583_0058658_332_1450 | 308 |
| 70 | 3300053093 | Ga0500651_0009619 | Ga0500651_0009619_750_1868 | 308 |
| 71 | 3300053127 | Ga0500623_057724 | Ga0500623_057724_544_1662 | 308 |
| 72 | 3300053131 | Ga0500652_000102 | Ga0500652_000102_16069_17187 | 308 |
| 73 | 3300053142 | Ga0500577_0004869 | Ga0500577_0004869_1167_2285 | 308 |
| 74 | 3300053151 | Ga0500604_0025337 | Ga0500604_0025337_348_1466 | 308 |
| 75 | 3300053156 | Ga0500622_0007029 | Ga0500622_0007029_4600_5718 | 308 |
| 76 | 3300046472 | Ga0495580_0033530 | Ga0495580_0033530_2349_3509 | 309 |
| 77 | 3300031616 | Ga0307508_10067005 | Ga0307508_100670054 | 310 |
| 78 | 3300046537 | Ga0495598_0035208 | Ga0495598_0035208_83_1186 | 310 |
| 79 | 3300005356 | Ga0070674_100075626 | Ga0070674_1000756262 | 313 |
| 80 | 3300046519 | Ga0495632_0022786 | Ga0495632_0022786_660_1778 | 313 |
| 81 | 3300053090 | Ga0500646_0004313 | Ga0500646_0004313_103_1221 | 313 |
| 82 | 3300053139 | Ga0500568_0003681 | Ga0500568_0003681_5283_6401 | 313 |
| 83 | 3300006195 | Ga0075366_10028537 | Ga0075366_100285373 | 315 |
| 84 | 3300048911 | Ga0496108_0118426 | Ga0496108_0118426_79_1230 | 315 |
| 85 | 3300048912 | Ga0496109_0125200 | Ga0496109_0125200_518_1669 | 315 |
| 86 | 3300050493 | nmdc:mga0k408_23800_c1 | nmdc:mga0k408_23800_c1_136_1248 | 315 |
| 87 | 3300005331 | Ga0070670_100156408 | Ga0070670_1001564082 | 316 |
| 88 | 3300031730 | Ga0307516_10000254 | Ga0307516_1000025412 | 316 |
| 89 | 3300003322 | rootL2_10259464 | rootL2_102594642 | 317 |
| 90 | 3300005843 | Ga0068860_100132386 | Ga0068860_1001323862 | 318 |
| 91 | 3300041451 | Ga0451791_1242034 | Ga0451791_1242034_15_1022 | 318 |
| 92 | 3300045976 | Ga0466967_0339891 | Ga0466967_0339891_32_1039 | 318 |
| 93 | 3300053086 | Ga0500578_0000002 | Ga0500578_0000002_121685_122803 | 318 |
| 94 | 3300013297 | Ga0157378_10168281 | Ga0157378_101682812 | 319 |
| 95 | 3300053154 | Ga0500619_000015 | Ga0500619_000015_34800_35945 | 320 |
| 96 | 3300005262 | Ga0065165_1003031 | Ga0065165_10030316 | 322 |
| 97 | 3300025299 | Ga0209256_1029936 | Ga0209256_10299362 | 322 |
| 98 | 3300002773 | JGI25152J39213_1002264 | JGI25152J39213_10022645 | 323 |
| 99 | 3300003215 | JGI25153J46596_10012943 | JGI25153J46596_100129431 | 323 |
| 100 | 3300003323 | rootH1_10011477 | rootH1_100114772 | 323 |
| 101 | 3300003771 | Ga0055526_1010561 | Ga0055526_10105614 | 323 |
| 102 | 3300025245 | Ga0207425_1000596 | Ga0207425_100059611 | 323 |
| 103 | 3300025258 | Ga0209129_1000148 | Ga0209129_100014854 | 323 |
| 104 | 3300025295 | Ga0209564_1000251 | Ga0209564_100025161 | 323 |
| 105 | 3300025297 | Ga0209758_1000387 | Ga0209758_100038761 | 323 |
| 106 | 3300025298 | Ga0209050_1001091 | Ga0209050_10010915 | 323 |
| 107 | 3300025303 | Ga0209051_1013119 | Ga0209051_10131193 | 323 |
| 108 | 3300005331 | Ga0070670_100099798 | Ga0070670_1000997982 | 324 |
| 109 | 3300005354 | Ga0070675_100050429 | Ga0070675_1000504292 | 324 |
| 110 | 3300025925 | Ga0207650_10055543 | Ga0207650_100555432 | 324 |
| 111 | 3300025926 | Ga0207659_10023299 | Ga0207659_100232992 | 324 |
| 112 | 3300028379 | Ga0268266_10088313 | Ga0268266_100883132 | 324 |
| 113 | 3300031649 | Ga0307514_10002966 | Ga0307514_1000296614 | 324 |
| 114 | 3300005367 | Ga0070667_100033625 | Ga0070667_1000336254 | 325 |
| 115 | 3300005539 | Ga0068853_100124447 | Ga0068853_1001244472 | 325 |
| 116 | 3300005543 | Ga0070672_100155527 | Ga0070672_1001555272 | 325 |
| 117 | 3300005842 | Ga0068858_100002875 | Ga0068858_1000028758 | 325 |
| 118 | 3300005843 | Ga0068860_100006018 | Ga0068860_1000060187 | 325 |
| 119 | 3300013308 | Ga0157375_10183926 | Ga0157375_101839263 | 325 |
| 120 | 3300014326 | Ga0157380_10051418 | Ga0157380_100514182 | 325 |
| 121 | 3300014968 | Ga0157379_10000528 | Ga0157379_1000052817 | 325 |
| 122 | 3300014968 | Ga0157379_10146152 | Ga0157379_101461522 | 325 |
| 123 | 3300025986 | Ga0207658_10103090 | Ga0207658_101030902 | 325 |
| 124 | 3300026035 | Ga0207703_10075044 | Ga0207703_100750443 | 325 |
| 125 | 3300026041 | Ga0207639_10132862 | Ga0207639_101328622 | 325 |
| 126 | 3300028381 | Ga0268264_10119005 | Ga0268264_101190052 | 325 |
| 127 | 3300005543 | Ga0070672_100082281 | Ga0070672_1000822812 | 326 |
| 128 | 3300025940 | Ga0207691_10106688 | Ga0207691_101066882 | 326 |
| 129 | 3300025941 | Ga0207711_10041959 | Ga0207711_100419593 | 326 |
| 130 | 3300005578 | Ga0068854_100055949 | Ga0068854_1000559492 | 327 |
| 131 | 3300005719 | Ga0068861_100161480 | Ga0068861_1001614801 | 327 |
| 132 | 3300005844 | Ga0068862_100048239 | Ga0068862_1000482392 | 327 |
| 133 | 3300028380 | Ga0268265_10008626 | Ga0268265_100086263 | 327 |
| 134 | 3300044712 | Ga0453684_0006474 | Ga0453684_0006474_9640_10752 | 328 |
| 135 | 3300003215 | JGI25153J46596_10009871 | JGI25153J46596_100098712 | 329 |
| 136 | 3300005327 | Ga0070658_10100106 | Ga0070658_101001062 | 329 |
| 137 | 3300005355 | Ga0070671_100229158 | Ga0070671_1002291582 | 329 |
| 138 | 3300005364 | Ga0070673_100153751 | Ga0070673_1001537512 | 329 |
| 139 | 3300005459 | Ga0068867_100057584 | Ga0068867_1000575843 | 329 |
| 140 | 3300005617 | Ga0068859_100275256 | Ga0068859_1002752562 | 329 |
| 141 | 3300006931 | Ga0097620_100275236 | Ga0097620_1002752362 | 329 |
| 142 | 3300025297 | Ga0209758_1000439 | Ga0209758_10004392 | 329 |
| 143 | 3300025315 | Ga0207697_10026681 | Ga0207697_100266812 | 329 |
| 144 | 3300025893 | Ga0207682_10019819 | Ga0207682_100198192 | 329 |
| 145 | 3300025960 | Ga0207651_10150055 | Ga0207651_101500552 | 329 |
| 146 | 3300026075 | Ga0207708_10113340 | Ga0207708_101133402 | 329 |
| 147 | 3300028786 | Ga0307517_10013803 | Ga0307517_100138038 | 329 |
| 148 | 3300047471 | Ga0495684_0177860 | Ga0495684_0177860_146_1312 | 329 |
| 149 | 3300025925 | Ga0207650_10124723 | Ga0207650_101247232 | 330 |
| 150 | 3300025960 | Ga0207651_10234102 | Ga0207651_102341022 | 330 |
| 151 | 3300028794 | Ga0307515_10036215 | Ga0307515_100362154 | 330 |
| 152 | 3300037471 | Ga0395905_0213324 | Ga0395905_0213324_92_1207 | 330 |
| 153 | 3300046683 | Ga0495658_0010441 | Ga0495658_0010441_2297_3463 | 330 |
| 154 | 3300005353 | Ga0070669_100023264 | Ga0070669_1000232644 | 331 |
| 155 | 3300005354 | Ga0070675_100111612 | Ga0070675_1001116122 | 331 |
| 156 | 3300005459 | Ga0068867_100033157 | Ga0068867_1000331574 | 331 |
| 157 | 3300005718 | Ga0068866_10067699 | Ga0068866_100676991 | 331 |
| 158 | 3300005719 | Ga0068861_100000343 | Ga0068861_1000003438 | 331 |
| 159 | 3300005843 | Ga0068860_100000715 | Ga0068860_10000071529 | 331 |
| 160 | 3300006881 | Ga0068865_100007045 | Ga0068865_1000070452 | 331 |
| 161 | 3300013297 | Ga0157378_10009725 | Ga0157378_100097258 | 331 |
| 162 | 3300013306 | Ga0163162_10005242 | Ga0163162_100052424 | 331 |
| 163 | 3300017792 | Ga0163161_10042390 | Ga0163161_100423903 | 331 |
| 164 | 3300025938 | Ga0207704_10017226 | Ga0207704_100172261 | 331 |
| 165 | 3300025941 | Ga0207711_10108033 | Ga0207711_101080333 | 331 |
| 166 | 3300026089 | Ga0207648_10001050 | Ga0207648_100010506 | 331 |
| 167 | 3300026118 | Ga0207675_100107068 | Ga0207675_1001070681 | 331 |
| 168 | 3300028380 | Ga0268265_10047867 | Ga0268265_100478673 | 331 |
| 169 | 3300028381 | Ga0268264_10007839 | Ga0268264_100078397 | 331 |
| 170 | 3300053080 | Ga0500635_0061116 | Ga0500635_0061116_74_1192 | 331 |
| 171 | 3300005364 | Ga0070673_100083713 | Ga0070673_1000837132 | 332 |
| 172 | 3300005616 | Ga0068852_100067623 | Ga0068852_1000676232 | 332 |
| 173 | 3300006353 | Ga0075370_10000373 | Ga0075370_1000037313 | 332 |
| 174 | 3300025925 | Ga0207650_10095532 | Ga0207650_100955322 | 332 |
| 175 | 3300025931 | Ga0207644_10188502 | Ga0207644_101885022 | 332 |
| 176 | 3300025940 | Ga0207691_10095480 | Ga0207691_100954802 | 332 |
| 177 | 3300031344 | Ga0265316_10000151 | Ga0265316_1000015142 | 332 |
| 178 | 3300044683 | Ga0466965_0081038 | Ga0466965_0081038_38_1105 | 332 |
| 179 | 3300048091 | Ga0495626_0078352 | Ga0495626_0078352_178_1245 | 332 |
| 180 | 3300049822 | Ga0501035_0107232 | Ga0501035_0107232_56_1165 | 332 |
| 181 | 3300003323 | rootH1_10141431 | rootH1_101414313 | 333 |
| 182 | 3300005327 | Ga0070658_10126284 | Ga0070658_101262842 | 333 |
| 183 | 3300005355 | Ga0070671_100025218 | Ga0070671_1000252183 | 333 |
| 184 | 3300014968 | Ga0157379_10016935 | Ga0157379_100169354 | 333 |
| 185 | 3300025909 | Ga0207705_10101472 | Ga0207705_101014722 | 333 |
| 186 | 3300025931 | Ga0207644_10021306 | Ga0207644_100213064 | 333 |
| 187 | 3300059421 | Ga0590071_000456 | Ga0590071_000456_2482_3633 | 333 |
| 188 | 3300005543 | Ga0070672_100294319 | Ga0070672_1002943192 | 334 |
| 189 | 3300006846 | Ga0075430_100030832 | Ga0075430_1000308324 | 334 |
| 190 | 3300006880 | Ga0075429_100003825 | Ga0075429_1000038259 | 334 |
| 191 | 3300021361 | Ga0213872_10021606 | Ga0213872_100216062 | 334 |
| 192 | 3300039447 | Ga0436361_0399628 | Ga0436361_0399628_1577_2707 | 334 |
| 193 | 3300050508 | nmdc:mga09592_3371_c1 | nmdc:mga09592_3371_c1_8568_9683 | 334 |
| 194 | 3300006177 | Ga0075362_10014577 | Ga0075362_100145773 | 335 |
| 195 | 3300006195 | Ga0075366_10077598 | Ga0075366_100775982 | 335 |
| 196 | 3300025321 | Ga0207656_10033570 | Ga0207656_100335703 | 335 |
| 197 | 3300025931 | Ga0207644_10102739 | Ga0207644_101027393 | 335 |
| 198 | 3300031616 | Ga0307508_10000094 | Ga0307508_1000009450 | 335 |
| 199 | 3300046454 | Ga0495592_0001770 | Ga0495592_0001770_11578_12705 | 335 |
| 200 | 3300048911 | Ga0496108_0229757 | Ga0496108_0229757_119_1273 | 335 |
| 201 | 3300050493 | nmdc:mga0k408_11200_c1 | nmdc:mga0k408_11200_c1_1386_2504 | 335 |
| 202 | 3300053161 | Ga0500634_0044624 | Ga0500634_0044624_607_1680 | 335 |
| 203 | 3300031507 | Ga0307509_10118652 | Ga0307509_101186522 | 336 |
| 204 | 3300045051 | Ga0451576_0087359 | Ga0451576_0087359_1755_2864 | 336 |
| 205 | 3300049649 | Ga0501198_000002 | Ga0501198_000002_43654_44772 | 336 |
| 206 | 3300049662 | Ga0501222_000002 | Ga0501222_000002_144187_145305 | 336 |
| 207 | 3300003316 | rootH1_10027067 | rootH1_100270675 | 337 |
| 208 | 3300006195 | Ga0075366_10118128 | Ga0075366_101181282 | 337 |
| 209 | 3300006353 | Ga0075370_10116508 | Ga0075370_101165082 | 337 |
| 210 | 3300009098 | Ga0105245_10058026 | Ga0105245_100580263 | 337 |
| 211 | 3300013296 | Ga0157374_10148076 | Ga0157374_101480762 | 337 |
| 212 | 3300013306 | Ga0163162_10002501 | Ga0163162_1000250112 | 337 |
| 213 | 3300013308 | Ga0157375_10001357 | Ga0157375_1000135719 | 337 |
| 214 | 3300014968 | Ga0157379_10000717 | Ga0157379_1000071722 | 337 |
| 215 | 3300050493 | nmdc:mga0k408_41303_c1 | nmdc:mga0k408_41303_c1_714_1850 | 337 |
| 216 | 3300050496 | nmdc:mga07m45_43473_c1 | nmdc:mga07m45_43473_c1_12_1148 | 337 |
| 217 | 3300013105 | Ga0157369_10131752 | Ga0157369_101317522 | 338 |
| 218 | 3300046660 | Ga0495625_0005772 | Ga0495625_0005772_7328_8404 | 338 |
| 219 | 3300049579 | Ga0501043_0000141 | Ga0501043_0000141_32835_33950 | 338 |
| 220 | 3300049580 | Ga0501046_0000047 | Ga0501046_0000047_26822_27937 | 338 |
| 221 | 3300049581 | Ga0501047_0000058 | Ga0501047_0000058_112810_113925 | 338 |
| 222 | 3300049582 | Ga0501048_0015863 | Ga0501048_0015863_389_1504 | 338 |
| 223 | 3300053090 | Ga0500646_0023026 | Ga0500646_0023026_559_1632 | 338 |
| 224 | 3300005335 | Ga0070666_10099867 | Ga0070666_100998672 | 339 |
| 225 | 3300031548 | Ga0307408_100000008 | Ga0307408_100000008221 | 339 |
| 226 | 3300037471 | Ga0395905_0060299 | Ga0395905_0060299_295_1455 | 339 |
| 227 | 3300053177 | Ga0500636_0044649 | Ga0500636_0044649_613_1776 | 339 |
| 228 | 3300005333 | Ga0070677_10008103 | Ga0070677_100081032 | 340 |
| 229 | 3300005353 | Ga0070669_100006416 | Ga0070669_1000064164 | 340 |
| 230 | 3300005354 | Ga0070675_100010823 | Ga0070675_1000108233 | 340 |
| 231 | 3300005355 | Ga0070671_100023315 | Ga0070671_1000233152 | 340 |
| 232 | 3300005356 | Ga0070674_100014286 | Ga0070674_1000142865 | 340 |
| 233 | 3300005364 | Ga0070673_100002229 | Ga0070673_1000022293 | 340 |
| 234 | 3300005456 | Ga0070678_100037384 | Ga0070678_1000373842 | 340 |
| 235 | 3300005457 | Ga0070662_100091378 | Ga0070662_1000913782 | 340 |
| 236 | 3300005459 | Ga0068867_100000820 | Ga0068867_10000082017 | 340 |
| 237 | 3300005564 | Ga0070664_100047862 | Ga0070664_1000478622 | 340 |
| 238 | 3300005618 | Ga0068864_100031800 | Ga0068864_1000318004 | 340 |
| 239 | 3300005834 | Ga0068851_10009782 | Ga0068851_100097823 | 340 |
| 240 | 3300006358 | Ga0068871_100007319 | Ga0068871_1000073193 | 340 |
| 241 | 3300017792 | Ga0163161_10052347 | Ga0163161_100523473 | 340 |
| 242 | 3300025893 | Ga0207682_10007000 | Ga0207682_100070003 | 340 |
| 243 | 3300025923 | Ga0207681_10004604 | Ga0207681_100046048 | 340 |
| 244 | 3300025925 | Ga0207650_10000913 | Ga0207650_100009138 | 340 |
| 245 | 3300025926 | Ga0207659_10000189 | Ga0207659_1000018917 | 340 |
| 246 | 3300025931 | Ga0207644_10011782 | Ga0207644_100117822 | 340 |
| 247 | 3300025933 | Ga0207706_10242710 | Ga0207706_102427102 | 340 |
| 248 | 3300025940 | Ga0207691_10002491 | Ga0207691_100024919 | 340 |
| 249 | 3300025945 | Ga0207679_10024938 | Ga0207679_100249382 | 340 |
| 250 | 3300026023 | Ga0207677_10007467 | Ga0207677_100074673 | 340 |
| 251 | 3300026088 | Ga0207641_10061733 | Ga0207641_100617333 | 340 |
| 252 | 3300026089 | Ga0207648_10001133 | Ga0207648_100011333 | 340 |
| 253 | 3300026121 | Ga0207683_10009813 | Ga0207683_100098134 | 340 |
| 254 | 3300026121 | Ga0207683_10054604 | Ga0207683_100546043 | 340 |
| 255 | 3300026121 | Ga0207683_10073314 | Ga0207683_100733142 | 340 |
| 256 | 3300046530 | Ga0495654_0000550 | Ga0495654_0000550_23541_24674 | 340 |
| 257 | 3300035692 | Ga0373935_0155852 | Ga0373935_0155852_294_1391 | 341 |
| 258 | 3300036401 | Ga0373937_0138413 | Ga0373937_0138413_607_1704 | 341 |
| 259 | 3300037068 | Ga0373925_0169558 | Ga0373925_0169558_272_1369 | 341 |
| 260 | 3300046683 | Ga0495658_0115747 | Ga0495658_0115747_233_1330 | 341 |
| 261 | 3300048927 | Ga0496124_0000151 | Ga0496124_0000151_69714_70859 | 341 |
| 262 | 3300048928 | Ga0496125_0005971 | Ga0496125_0005971_10704_11849 | 341 |
| 263 | 3300053077 | Ga0495601_0030415 | Ga0495601_0030415_776_1873 | 341 |
| 264 | 3300005331 | Ga0070670_100011707 | Ga0070670_1000117076 | 342 |
| 265 | 3300005355 | Ga0070671_100070828 | Ga0070671_1000708282 | 342 |
| 266 | 3300005543 | Ga0070672_100017803 | Ga0070672_1000178033 | 342 |
| 267 | 3300006353 | Ga0075370_10086367 | Ga0075370_100863671 | 342 |
| 268 | 3300006358 | Ga0068871_100077187 | Ga0068871_1000771872 | 342 |
| 269 | 3300013308 | Ga0157375_10069367 | Ga0157375_100693673 | 342 |
| 270 | 3300014969 | Ga0157376_10026355 | Ga0157376_100263554 | 342 |
| 271 | 3300025925 | Ga0207650_10002352 | Ga0207650_100023525 | 342 |
| 272 | 3300025931 | Ga0207644_10128780 | Ga0207644_101287801 | 342 |
| 273 | 3300025940 | Ga0207691_10031896 | Ga0207691_100318963 | 342 |
| 274 | 3300025945 | Ga0207679_10190752 | Ga0207679_101907521 | 342 |
| 275 | 3300028794 | Ga0307515_10082008 | Ga0307515_100820082 | 342 |
| 276 | 3300048907 | Ga0496104_0008841 | Ga0496104_0008841_1377_2513 | 342 |
| 277 | 3300048912 | Ga0496109_0013396 | Ga0496109_0013396_456_1598 | 342 |
| 278 | 3300048917 | Ga0496114_0122684 | Ga0496114_0122684_644_1780 | 342 |
| 279 | 3300053092 | Ga0500583_0011260 | Ga0500583_0011260_692_1828 | 342 |
| 280 | 3300005530 | Ga0070679_100000691 | Ga0070679_10000069113 | 343 |
| 281 | 3300006051 | Ga0075364_10043054 | Ga0075364_100430543 | 343 |
| 282 | 3300006177 | Ga0075362_10006087 | Ga0075362_100060873 | 343 |
| 283 | 3300006178 | Ga0075367_10002841 | Ga0075367_100028417 | 343 |
| 284 | 3300006186 | Ga0075369_10016575 | Ga0075369_100165752 | 343 |
| 285 | 3300006353 | Ga0075370_10006552 | Ga0075370_100065525 | 343 |
| 286 | 3300025917 | Ga0207660_10127668 | Ga0207660_101276682 | 343 |
| 287 | 3300042000 | Ga0439437_001198 | Ga0439437_001198_699_1844 | 343 |
| 288 | 3300042129 | Ga0450891_000891 | Ga0450891_000891_852_1997 | 343 |
| 289 | 3300042144 | Ga0450889_000608 | Ga0450889_000608_190_1335 | 343 |
| 290 | 3300042532 | Ga0450893_0005693 | Ga0450893_0005693_348_1493 | 343 |
| 291 | 3300046492 | Ga0495585_0005980 | Ga0495585_0005980_3777_4907 | 343 |
| 292 | 3300046507 | Ga0495606_0029123 | Ga0495606_0029123_214_1344 | 343 |
| 293 | 3300046512 | Ga0495610_0026708 | Ga0495610_0026708_1247_2338 | 343 |
| 294 | 3300046519 | Ga0495632_0072153 | Ga0495632_0072153_286_1377 | 343 |
| 295 | 3300048911 | Ga0496108_0073683 | Ga0496108_0073683_1551_2696 | 343 |
| 296 | 3300049129 | Ga0501309_000516 | Ga0501309_000516_655_1800 | 343 |
| 297 | 3300049130 | Ga0501310_000594 | Ga0501310_000594_664_1809 | 343 |
| 298 | 3300049161 | Ga0501305_003384 | Ga0501305_003384_14_1159 | 343 |
| 299 | 3300049528 | Ga0501312_000367 | Ga0501312_000367_631_1776 | 343 |
| 300 | 3300049530 | Ga0501314_000187 | Ga0501314_000187_1568_2713 | 343 |
| 301 | 3300049538 | Ga0501322_000294 | Ga0501322_000294_404_1549 | 343 |
| 302 | 3300049759 | Ga0501262_001512 | Ga0501262_001512_1183_2328 | 343 |
| 303 | 3300049764 | Ga0501267_000119 | Ga0501267_000119_2934_4079 | 343 |
| 304 | 3300050489 | nmdc:mga03683_8491_c1 | nmdc:mga03683_8491_c1_2157_3293 | 343 |
| 305 | 3300050490 | nmdc:mga03n38_39797_c1 | nmdc:mga03n38_39797_c1_323_1459 | 343 |
| 306 | 3300050493 | nmdc:mga0k408_64737_c1 | nmdc:mga0k408_64737_c1_150_1241 | 343 |
| 307 | 3300050493 | nmdc:mga0k408_7522_c1 | nmdc:mga0k408_7522_c1_420_1556 | 343 |
| 308 | 3300050496 | nmdc:mga07m45_61002_c1 | nmdc:mga07m45_61002_c1_737_1828 | 343 |
| 309 | 3300053739 | Ga0500587_002000 | Ga0500587_002000_1085_2176 | 343 |
| 310 | 3300005337 | Ga0070682_100045865 | Ga0070682_1000458652 | 344 |
| 311 | 3300005338 | Ga0068868_100015136 | Ga0068868_1000151363 | 344 |
| 312 | 3300005616 | Ga0068852_100034935 | Ga0068852_1000349352 | 344 |
| 313 | 3300009098 | Ga0105245_10044542 | Ga0105245_100445424 | 344 |
| 314 | 3300009177 | Ga0105248_10002863 | Ga0105248_1000286313 | 344 |
| 315 | 3300013105 | Ga0157369_10167164 | Ga0157369_101671642 | 344 |
| 316 | 3300013296 | Ga0157374_10004558 | Ga0157374_1000455810 | 344 |
| 317 | 3300013306 | Ga0163162_10064153 | Ga0163162_100641532 | 344 |
| 318 | 3300014745 | Ga0157377_10026579 | Ga0157377_100265793 | 344 |
| 319 | 3300014968 | Ga0157379_10004404 | Ga0157379_100044044 | 344 |
| 320 | 3300014969 | Ga0157376_10026261 | Ga0157376_100262614 | 344 |
| 321 | 3300025923 | Ga0207681_10268752 | Ga0207681_102687522 | 344 |
| 322 | 3300026116 | Ga0207674_10073745 | Ga0207674_100737453 | 344 |
| 323 | 3300026142 | Ga0207698_10005667 | Ga0207698_100056674 | 344 |
| 324 | 3300045051 | Ga0451576_0271512 | Ga0451576_0271512_107_1252 | 344 |
| 325 | 3300046810 | Ga0495660_0031092 | Ga0495660_0031092_1055_2176 | 344 |
| 326 | 3300048905 | Ga0496102_0046041 | Ga0496102_0046041_2440_3585 | 344 |
| 327 | 3300048909 | Ga0496106_0089601 | Ga0496106_0089601_399_1544 | 344 |
| 328 | 3300048914 | Ga0496111_0076891 | Ga0496111_0076891_398_1543 | 344 |
| 329 | 3300048916 | Ga0496113_0099656 | Ga0496113_0099656_339_1484 | 344 |
| 330 | 3300048917 | Ga0496114_0073018 | Ga0496114_0073018_289_1434 | 344 |
| 331 | 3300048918 | Ga0496115_0057989 | Ga0496115_0057989_1180_2325 | 344 |
| 332 | iso_pu_bacteria | 2643221585 | 2643936201 | 344 |
| 333 | iso_pu_bacteria | 2643221639 | 2644217712 | 344 |
| 334 | iso_pu_bacteria | 2643221646 | 2644258550 | 344 |
| 335 | iso_pu_bacteria | 2643221656 | 2644316846 | 344 |
| 336 | iso_pu_bacteria | 2738541337 | 2739056745 | 344 |
| 337 | 3300003759 | Ga0055525_1000026 | Ga0055525_1000026192 | 345 |
| 338 | 3300006195 | Ga0075366_10000822 | Ga0075366_100008222 | 345 |
| 339 | 3300021361 | Ga0213872_10000016 | Ga0213872_1000001636 | 345 |
| 340 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051402 | 345 |
| 341 | 3300039447 | Ga0436361_0376061 | Ga0436361_0376061_42838_43953 | 345 |
| 342 | 3300053139 | Ga0500568_0006565 | Ga0500568_0006565_4164_5279 | 345 |
| 343 | 3300005328 | Ga0070676_10004487 | Ga0070676_100044872 | 346 |
| 344 | 3300005329 | Ga0070683_100083823 | Ga0070683_1000838233 | 346 |
| 345 | 3300005334 | Ga0068869_100009857 | Ga0068869_1000098574 | 346 |
| 346 | 3300005344 | Ga0070661_100109713 | Ga0070661_1001097133 | 346 |
| 347 | 3300005345 | Ga0070692_10081509 | Ga0070692_100815092 | 346 |
| 348 | 3300005347 | Ga0070668_100054526 | Ga0070668_1000545262 | 346 |
| 349 | 3300005354 | Ga0070675_100013850 | Ga0070675_1000138504 | 346 |
| 350 | 3300005355 | Ga0070671_100075778 | Ga0070671_1000757783 | 346 |
| 351 | 3300005366 | Ga0070659_100008843 | Ga0070659_1000088433 | 346 |
| 352 | 3300005455 | Ga0070663_100006397 | Ga0070663_1000063977 | 346 |
| 353 | 3300005457 | Ga0070662_100004274 | Ga0070662_1000042748 | 346 |
| 354 | 3300005459 | Ga0068867_100024053 | Ga0068867_1000240531 | 346 |
| 355 | 3300005547 | Ga0070693_100044860 | Ga0070693_1000448602 | 346 |
| 356 | 3300005563 | Ga0068855_100097732 | Ga0068855_1000977322 | 346 |
| 357 | 3300005578 | Ga0068854_100061535 | Ga0068854_1000615353 | 346 |
| 358 | 3300005618 | Ga0068864_100014624 | Ga0068864_1000146244 | 346 |
| 359 | 3300005719 | Ga0068861_100038625 | Ga0068861_1000386253 | 346 |
| 360 | 3300005834 | Ga0068851_10018574 | Ga0068851_100185743 | 346 |
| 361 | 3300006195 | Ga0075366_10105294 | Ga0075366_101052942 | 346 |
| 362 | 3300017792 | Ga0163161_10043582 | Ga0163161_100435822 | 346 |
| 363 | 3300025907 | Ga0207645_10011247 | Ga0207645_100112474 | 346 |
| 364 | 3300025919 | Ga0207657_10034414 | Ga0207657_100344144 | 346 |
| 365 | 3300025923 | Ga0207681_10060654 | Ga0207681_100606542 | 346 |
| 366 | 3300025926 | Ga0207659_10061752 | Ga0207659_100617522 | 346 |
| 367 | 3300025932 | Ga0207690_10025524 | Ga0207690_100255242 | 346 |
| 368 | 3300025941 | Ga0207711_10025880 | Ga0207711_100258804 | 346 |
| 369 | 3300025942 | Ga0207689_10003071 | Ga0207689_100030715 | 346 |
| 370 | 3300025972 | Ga0207668_10022822 | Ga0207668_100228223 | 346 |
| 371 | 3300026023 | Ga0207677_10006940 | Ga0207677_100069404 | 346 |
| 372 | 3300026041 | Ga0207639_10083633 | Ga0207639_100836332 | 346 |
| 373 | 3300026067 | Ga0207678_10028588 | Ga0207678_100285882 | 346 |
| 374 | 3300026095 | Ga0207676_10011402 | Ga0207676_100114026 | 346 |
| 375 | 3300026118 | Ga0207675_100009210 | Ga0207675_1000092103 | 346 |
| 376 | 3300026142 | Ga0207698_10007500 | Ga0207698_100075003 | 346 |
| 377 | 3300031730 | Ga0307516_10132006 | Ga0307516_101320062 | 346 |
| 378 | 3300035695 | Ga0373927_0029351 | Ga0373927_0029351_1593_2708 | 346 |
| 379 | 3300037068 | Ga0373925_0004683 | Ga0373925_0004683_7975_9090 | 346 |
| 380 | 3300042876 | Ga0451577_0001353 | Ga0451577_0001353_29367_30482 | 346 |
| 381 | 3300046522 | Ga0495643_0020062 | Ga0495643_0020062_310_1422 | 346 |
| 382 | 3300046535 | Ga0495586_0022236 | Ga0495586_0022236_612_1730 | 346 |
| 383 | 3300046683 | Ga0495658_0168679 | Ga0495658_0168679_152_1267 | 346 |
| 384 | 3300050493 | nmdc:mga0k408_777_c1 | nmdc:mga0k408_777_c1_6852_7967 | 346 |
| 385 | 3300003322 | rootL2_10274554 | rootL2_102745541 | 347 |
| 386 | 3300003323 | rootH1_10058316 | rootH1_100583162 | 347 |
| 387 | 3300003794 | Ga0055531_10000823 | Ga0055531_100008239 | 347 |
| 388 | 3300005328 | Ga0070676_10010804 | Ga0070676_100108042 | 347 |
| 389 | 3300005330 | Ga0070690_100006323 | Ga0070690_1000063234 | 347 |
| 390 | 3300005334 | Ga0068869_100015658 | Ga0068869_1000156584 | 347 |
| 391 | 3300005335 | Ga0070666_10009854 | Ga0070666_100098545 | 347 |
| 392 | 3300005338 | Ga0068868_100015986 | Ga0068868_1000159865 | 347 |
| 393 | 3300005340 | Ga0070689_100163417 | Ga0070689_1001634172 | 347 |
| 394 | 3300005343 | Ga0070687_100006756 | Ga0070687_1000067563 | 347 |
| 395 | 3300005347 | Ga0070668_100003264 | Ga0070668_1000032644 | 347 |
| 396 | 3300005353 | Ga0070669_100032799 | Ga0070669_1000327992 | 347 |
| 397 | 3300005354 | Ga0070675_100041764 | Ga0070675_1000417643 | 347 |
| 398 | 3300005355 | Ga0070671_100174448 | Ga0070671_1001744482 | 347 |
| 399 | 3300005356 | Ga0070674_100007044 | Ga0070674_1000070445 | 347 |
| 400 | 3300005367 | Ga0070667_100001505 | Ga0070667_10000150510 | 347 |
| 401 | 3300005438 | Ga0070701_10016840 | Ga0070701_100168403 | 347 |
| 402 | 3300005457 | Ga0070662_100030909 | Ga0070662_1000309092 | 347 |
| 403 | 3300005459 | Ga0068867_100004786 | Ga0068867_1000047863 | 347 |
| 404 | 3300005543 | Ga0070672_100002531 | Ga0070672_1000025312 | 347 |
| 405 | 3300005616 | Ga0068852_100072433 | Ga0068852_1000724333 | 347 |
| 406 | 3300005617 | Ga0068859_100069869 | Ga0068859_1000698692 | 347 |
| 407 | 3300005618 | Ga0068864_100036248 | Ga0068864_1000362483 | 347 |
| 408 | 3300005718 | Ga0068866_10084098 | Ga0068866_100840982 | 347 |
| 409 | 3300005719 | Ga0068861_100006489 | Ga0068861_1000064898 | 347 |
| 410 | 3300005841 | Ga0068863_100062745 | Ga0068863_1000627453 | 347 |
| 411 | 3300005842 | Ga0068858_100001875 | Ga0068858_1000018758 | 347 |
| 412 | 3300005843 | Ga0068860_100000707 | Ga0068860_10000070729 | 347 |
| 413 | 3300005844 | Ga0068862_100053491 | Ga0068862_1000534913 | 347 |
| 414 | 3300006881 | Ga0068865_100062800 | Ga0068865_1000628002 | 347 |
| 415 | 3300006931 | Ga0097620_100069871 | Ga0097620_1000698712 | 347 |
| 416 | 3300009177 | Ga0105248_10252975 | Ga0105248_102529752 | 347 |
| 417 | 3300017792 | Ga0163161_10017116 | Ga0163161_100171163 | 347 |
| 418 | 3300025303 | Ga0209051_1007021 | Ga0209051_10070214 | 347 |
| 419 | 3300025304 | Ga0209257_1000354 | Ga0209257_100035450 | 347 |
| 420 | 3300025899 | Ga0207642_10009348 | Ga0207642_100093482 | 347 |
| 421 | 3300025903 | Ga0207680_10024481 | Ga0207680_100244812 | 347 |
| 422 | 3300025907 | Ga0207645_10005371 | Ga0207645_100053714 | 347 |
| 423 | 3300025923 | Ga0207681_10003342 | Ga0207681_100033424 | 347 |
| 424 | 3300025926 | Ga0207659_10052768 | Ga0207659_100527682 | 347 |
| 425 | 3300025935 | Ga0207709_10070045 | Ga0207709_100700453 | 347 |
| 426 | 3300025936 | Ga0207670_10171453 | Ga0207670_101714532 | 347 |
| 427 | 3300025937 | Ga0207669_10001563 | Ga0207669_100015637 | 347 |
| 428 | 3300025940 | Ga0207691_10041039 | Ga0207691_100410393 | 347 |
| 429 | 3300025942 | Ga0207689_10005946 | Ga0207689_100059464 | 347 |
| 430 | 3300025972 | Ga0207668_10019001 | Ga0207668_100190012 | 347 |
| 431 | 3300025986 | Ga0207658_10011427 | Ga0207658_100114275 | 347 |
| 432 | 3300026023 | Ga0207677_10107360 | Ga0207677_101073602 | 347 |
| 433 | 3300026035 | Ga0207703_10001371 | Ga0207703_1000137119 | 347 |
| 434 | 3300026088 | Ga0207641_10001848 | Ga0207641_100018485 | 347 |
| 435 | 3300026089 | Ga0207648_10008497 | Ga0207648_100084979 | 347 |
| 436 | 3300026095 | Ga0207676_10132508 | Ga0207676_101325082 | 347 |
| 437 | 3300026118 | Ga0207675_100006272 | Ga0207675_10000627210 | 347 |
| 438 | 3300026121 | Ga0207683_10172117 | Ga0207683_101721172 | 347 |
| 439 | 3300026142 | Ga0207698_10208000 | Ga0207698_102080002 | 347 |
| 440 | 3300028380 | Ga0268265_10036142 | Ga0268265_100361422 | 347 |
| 441 | 3300037471 | Ga0395905_0004837 | Ga0395905_0004837_9996_11132 | 347 |
| 442 | 3300038443 | Ga0395901_0092493 | Ga0395901_0092493_1801_2979 | 347 |
| 443 | iso_pu_bacteria | 2585428057 | 2587727686 | 347 |
| 444 | iso_pu_bacteria | 2585428058 | 2587733061 | 347 |
| 445 | iso_pu_bacteria | 2588253510 | 2588291359 | 347 |
| 446 | iso_pu_bacteria | 2643221544 | 2643742681 | 347 |
| 447 | iso_pu_bacteria | 2643221592 | 2643969506 | 347 |
| 448 | iso_pu_bacteria | 2643221625 | 2644143806 | 347 |
| 449 | iso_pu_bacteria | 2643221648 | 2644276488 | 347 |
| 450 | 3300005330 | Ga0070690_100025841 | Ga0070690_1000258414 | 348 |
| 451 | 3300005333 | Ga0070677_10005950 | Ga0070677_100059504 | 348 |
| 452 | 3300005334 | Ga0068869_100006760 | Ga0068869_1000067606 | 348 |
| 453 | 3300005338 | Ga0068868_100024050 | Ga0068868_1000240504 | 348 |
| 454 | 3300005347 | Ga0070668_100038465 | Ga0070668_1000384653 | 348 |
| 455 | 3300005347 | Ga0070668_100289283 | Ga0070668_1002892831 | 348 |
| 456 | 3300005354 | Ga0070675_100007196 | Ga0070675_1000071967 | 348 |
| 457 | 3300005355 | Ga0070671_100012623 | Ga0070671_1000126237 | 348 |
| 458 | 3300005364 | Ga0070673_100002506 | Ga0070673_1000025065 | 348 |
| 459 | 3300005365 | Ga0070688_100150388 | Ga0070688_1001503882 | 348 |
| 460 | 3300005367 | Ga0070667_100022532 | Ga0070667_1000225324 | 348 |
| 461 | 3300005455 | Ga0070663_100053479 | Ga0070663_1000534793 | 348 |
| 462 | 3300005456 | Ga0070678_100010708 | Ga0070678_1000107084 | 348 |
| 463 | 3300005459 | Ga0068867_100107576 | Ga0068867_1001075762 | 348 |
| 464 | 3300005543 | Ga0070672_100017849 | Ga0070672_1000178495 | 348 |
| 465 | 3300005617 | Ga0068859_100060368 | Ga0068859_1000603683 | 348 |
| 466 | 3300005618 | Ga0068864_100002247 | Ga0068864_10000224710 | 348 |
| 467 | 3300005719 | Ga0068861_100054344 | Ga0068861_1000543443 | 348 |
| 468 | 3300005719 | Ga0068861_100155337 | Ga0068861_1001553372 | 348 |
| 469 | 3300005841 | Ga0068863_100007447 | Ga0068863_1000074471 | 348 |
| 470 | 3300005842 | Ga0068858_100005928 | Ga0068858_1000059283 | 348 |
| 471 | 3300005843 | Ga0068860_100120930 | Ga0068860_1001209302 | 348 |
| 472 | 3300006195 | Ga0075366_10002910 | Ga0075366_100029102 | 348 |
| 473 | 3300006195 | Ga0075366_10027415 | Ga0075366_100274152 | 348 |
| 474 | 3300006353 | Ga0075370_10003141 | Ga0075370_100031418 | 348 |
| 475 | 3300006358 | Ga0068871_100051943 | Ga0068871_1000519432 | 348 |
| 476 | 3300006931 | Ga0097620_100060368 | Ga0097620_1000603682 | 348 |
| 477 | 3300009177 | Ga0105248_10103094 | Ga0105248_101030943 | 348 |
| 478 | 3300009553 | Ga0105249_10030174 | Ga0105249_100301742 | 348 |
| 479 | 3300013296 | Ga0157374_10050751 | Ga0157374_100507512 | 348 |
| 480 | 3300013306 | Ga0163162_10066285 | Ga0163162_100662853 | 348 |
| 481 | 3300013306 | Ga0163162_10511524 | Ga0163162_105115241 | 348 |
| 482 | 3300013308 | Ga0157375_10084089 | Ga0157375_100840893 | 348 |
| 483 | 3300014968 | Ga0157379_10066823 | Ga0157379_100668231 | 348 |
| 484 | 3300025907 | Ga0207645_10006398 | Ga0207645_100063988 | 348 |
| 485 | 3300025925 | Ga0207650_10056571 | Ga0207650_100565712 | 348 |
| 486 | 3300025927 | Ga0207687_10266671 | Ga0207687_102666712 | 348 |
| 487 | 3300025933 | Ga0207706_10202053 | Ga0207706_102020532 | 348 |
| 488 | 3300025937 | Ga0207669_10019506 | Ga0207669_100195063 | 348 |
| 489 | 3300025938 | Ga0207704_10037398 | Ga0207704_100373983 | 348 |
| 490 | 3300025942 | Ga0207689_10070391 | Ga0207689_100703912 | 348 |
| 491 | 3300025972 | Ga0207668_10028021 | Ga0207668_100280212 | 348 |
| 492 | 3300025972 | Ga0207668_10164836 | Ga0207668_101648362 | 348 |
| 493 | 3300026035 | Ga0207703_10003102 | Ga0207703_100031028 | 348 |
| 494 | 3300026067 | Ga0207678_10175820 | Ga0207678_101758202 | 348 |
| 495 | 3300026088 | Ga0207641_10003303 | Ga0207641_100033037 | 348 |
| 496 | 3300026089 | Ga0207648_10045451 | Ga0207648_100454512 | 348 |
| 497 | 3300026089 | Ga0207648_10116109 | Ga0207648_101161092 | 348 |
| 498 | 3300026089 | Ga0207648_10169411 | Ga0207648_101694112 | 348 |
| 499 | 3300026095 | Ga0207676_10005300 | Ga0207676_100053002 | 348 |
| 500 | 3300026118 | Ga0207675_100136627 | Ga0207675_1001366272 | 348 |
| 501 | 3300026121 | Ga0207683_10008770 | Ga0207683_100087703 | 348 |
| 502 | 3300026121 | Ga0207683_10087122 | Ga0207683_100871222 | 348 |
| 503 | 3300026142 | Ga0207698_10061866 | Ga0207698_100618663 | 348 |
| 504 | 3300037068 | Ga0373925_0035343 | Ga0373925_0035343_2337_3503 | 348 |
| 505 | 3300042439 | Ga0439464_0000764 | Ga0439464_0000764_1890_3011 | 348 |
| 506 | 3300044712 | Ga0453684_0083182 | Ga0453684_0083182_1473_2597 | 348 |
| 507 | 3300045051 | Ga0451576_0079493 | Ga0451576_0079493_1240_2376 | 348 |
| 508 | 3300050493 | nmdc:mga0k408_1236_c1 | nmdc:mga0k408_1236_c1_6061_7182 | 348 |
| 509 | 3300050493 | nmdc:mga0k408_1461_c1 | nmdc:mga0k408_1461_c1_4862_5983 | 348 |
| 510 | 3300050496 | nmdc:mga07m45_843_c1 | nmdc:mga07m45_843_c1_6830_7951 | 348 |
| 511 | 3300003316 | rootH1_10025577 | rootH1_100255773 | 349 |
| 512 | 3300003322 | rootL2_10045989 | rootL2_100459895 | 349 |
| 513 | 3300003347 | JGI26128J50194_1000130 | JGI26128J50194_10001302 | 349 |
| 514 | 3300005844 | Ga0068862_100047844 | Ga0068862_1000478443 | 349 |
| 515 | 3300006038 | Ga0075365_10009206 | Ga0075365_100092064 | 349 |
| 516 | 3300006195 | Ga0075366_10031525 | Ga0075366_100315252 | 349 |
| 517 | 3300006353 | Ga0075370_10001845 | Ga0075370_100018458 | 349 |
| 518 | 3300006353 | Ga0075370_10041160 | Ga0075370_100411602 | 349 |
| 519 | 3300009148 | Ga0105243_10071375 | Ga0105243_100713753 | 349 |
| 520 | 3300009148 | Ga0105243_10207955 | Ga0105243_102079552 | 349 |
| 521 | 3300025935 | Ga0207709_10214020 | Ga0207709_102140202 | 349 |
| 522 | 3300027695 | Ga0209966_1000004 | Ga0209966_100000468 | 349 |
| 523 | 3300028380 | Ga0268265_10096698 | Ga0268265_100966982 | 349 |
| 524 | 3300028794 | Ga0307515_10000022 | Ga0307515_10000022241 | 349 |
| 525 | 3300028794 | Ga0307515_10000191 | Ga0307515_1000019116 | 349 |
| 526 | 3300028794 | Ga0307515_10063975 | Ga0307515_100639754 | 349 |
| 527 | 3300028794 | Ga0307515_10187724 | Ga0307515_101877242 | 349 |
| 528 | 3300031456 | Ga0307513_10011299 | Ga0307513_100112999 | 349 |
| 529 | 3300032005 | Ga0307411_10032183 | Ga0307411_100321832 | 349 |
| 530 | 3300035114 | Ga0373939_0000164 | Ga0373939_0000164_8763_9908 | 349 |
| 531 | 3300035121 | Ga0373960_0002111 | Ga0373960_0002111_1207_2352 | 349 |
| 532 | 3300046512 | Ga0495610_0073678 | Ga0495610_0073678_16_1140 | 349 |
| 533 | 3300046694 | Ga0495649_0013059 | Ga0495649_0013059_2896_4020 | 349 |
| 534 | 3300046810 | Ga0495660_0038817 | Ga0495660_0038817_1016_2140 | 349 |
| 535 | 3300048913 | Ga0496110_0073096 | Ga0496110_0073096_1837_2979 | 349 |
| 536 | 3300050493 | nmdc:mga0k408_140890_c1 | nmdc:mga0k408_140890_c1_159_1274 | 349 |
| 537 | 3300050496 | nmdc:mga07m45_1634_c1 | nmdc:mga07m45_1634_c1_5030_6175 | 349 |
| 538 | 3300053134 | Ga0500658_0009139 | Ga0500658_0009139_2328_3452 | 349 |
| 539 | iso_pu_bacteria | 2643221654 | 2644304852 | 349 |
| 540 | iso_pu_bacteria | 2881101125 | 2881102203 | 349 |
| 541 | iso_pu_bacteria | 2939631187 | 2939636560 | 349 |
| 542 | 3300005355 | Ga0070671_100003736 | Ga0070671_1000037363 | 350 |
| 543 | 3300009177 | Ga0105248_10003419 | Ga0105248_1000341914 | 350 |
| 544 | 3300025273 | Ga0209673_1014079 | Ga0209673_10140792 | 350 |
| 545 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003509 | 350 |
| 546 | 3300025931 | Ga0207644_10062647 | Ga0207644_100626473 | 350 |
| 547 | 3300025941 | Ga0207711_10021818 | Ga0207711_100218182 | 350 |
| 548 | 3300028794 | Ga0307515_10003517 | Ga0307515_1000351714 | 350 |
| 549 | 3300028794 | Ga0307515_10003519 | Ga0307515_1000351920 | 350 |
| 550 | 3300028794 | Ga0307515_10135477 | Ga0307515_101354772 | 350 |
| 551 | 3300030522 | Ga0307512_10056761 | Ga0307512_100567612 | 350 |
| 552 | 3300030522 | Ga0307512_10141375 | Ga0307512_101413752 | 350 |
| 553 | 3300031456 | Ga0307513_10058698 | Ga0307513_100586984 | 350 |
| 554 | 3300031507 | Ga0307509_10000215 | Ga0307509_1000021579 | 350 |
| 555 | 3300031616 | Ga0307508_10000017 | Ga0307508_10000017161 | 350 |
| 556 | 3300031649 | Ga0307514_10004466 | Ga0307514_1000446612 | 350 |
| 557 | 3300031730 | Ga0307516_10035350 | Ga0307516_100353505 | 350 |
| 558 | 3300031995 | Ga0307409_100001509 | Ga0307409_10000150910 | 350 |
| 559 | 3300032002 | Ga0307416_100073842 | Ga0307416_1000738423 | 350 |
| 560 | 3300032005 | Ga0307411_10038304 | Ga0307411_100383042 | 350 |
| 561 | 3300032005 | Ga0307411_10048742 | Ga0307411_100487423 | 350 |
| 562 | 3300032126 | Ga0307415_100004973 | Ga0307415_1000049734 | 350 |
| 563 | 3300033179 | Ga0307507_10098962 | Ga0307507_100989622 | 350 |
| 564 | 3300033180 | Ga0307510_10007507 | Ga0307510_100075076 | 350 |
| 565 | 3300033180 | Ga0307510_10057953 | Ga0307510_100579532 | 350 |
| 566 | 3300037471 | Ga0395905_0010220 | Ga0395905_0010220_3480_4607 | 350 |
| 567 | 3300037471 | Ga0395905_0139665 | Ga0395905_0139665_1081_2211 | 350 |
| 568 | 3300046660 | Ga0495625_0043089 | Ga0495625_0043089_641_1768 | 350 |
| 569 | 3300048908 | Ga0496105_0107002 | Ga0496105_0107002_1019_2137 | 350 |
| 570 | 3300048911 | Ga0496108_0143944 | Ga0496108_0143944_24_1142 | 350 |
| 571 | 3300048916 | Ga0496113_0032000 | Ga0496113_0032000_315_1433 | 350 |
| 572 | 3300053121 | Ga0500607_034061 | Ga0500607_034061_785_1912 | 350 |
| 573 | iso_pu_bacteria | 2585428062 | 2587755169 | 350 |
| 574 | iso_pu_bacteria | 2738543012 | 2739241555 | 350 |
| 575 | iso_pu_bacteria | 2816332133 | 2816476190 | 350 |
| 576 | 3300003320 | rootH2_10011660 | rootH2_100116608 | 351 |
| 577 | 3300003322 | rootL2_10000980 | rootL2_100009804 | 351 |
| 578 | 3300003323 | rootH1_10036624 | rootH1_100366243 | 351 |
| 579 | 3300003775 | Ga0055524_1020352 | Ga0055524_10203523 | 351 |
| 580 | 3300003794 | Ga0055531_10024473 | Ga0055531_100244731 | 351 |
| 581 | 3300003794 | Ga0055531_10025337 | Ga0055531_100253371 | 351 |
| 582 | 3300004625 | Ga0055543_1002639 | Ga0055543_10026395 | 351 |
| 583 | 3300005262 | Ga0065165_1000006 | Ga0065165_1000006269 | 351 |
| 584 | 3300005262 | Ga0065165_1002955 | Ga0065165_100295512 | 351 |
| 585 | 3300005327 | Ga0070658_10092351 | Ga0070658_100923512 | 351 |
| 586 | 3300005355 | Ga0070671_100250306 | Ga0070671_1002503061 | 351 |
| 587 | 3300005455 | Ga0070663_100002931 | Ga0070663_1000029318 | 351 |
| 588 | 3300005459 | Ga0068867_100000175 | Ga0068867_10000017520 | 351 |
| 589 | 3300005548 | Ga0070665_100018978 | Ga0070665_1000189785 | 351 |
| 590 | 3300005617 | Ga0068859_100113840 | Ga0068859_1001138402 | 351 |
| 591 | 3300005618 | Ga0068864_100093790 | Ga0068864_1000937903 | 351 |
| 592 | 3300005841 | Ga0068863_100103524 | Ga0068863_1001035242 | 351 |
| 593 | 3300005842 | Ga0068858_100266324 | Ga0068858_1002663242 | 351 |
| 594 | 3300006195 | Ga0075366_10063815 | Ga0075366_100638152 | 351 |
| 595 | 3300006353 | Ga0075370_10048362 | Ga0075370_100483623 | 351 |
| 596 | 3300006931 | Ga0097620_100113838 | Ga0097620_1001138382 | 351 |
| 597 | 3300006944 | Ga0099823_1001245 | Ga0099823_10012454 | 351 |
| 598 | 3300009098 | Ga0105245_10045165 | Ga0105245_100451652 | 351 |
| 599 | 3300009148 | Ga0105243_10000770 | Ga0105243_1000077028 | 351 |
| 600 | 3300012497 | Ga0157319_1000009 | Ga0157319_1000009137 | 351 |
| 601 | 3300014745 | Ga0157377_10000014 | Ga0157377_10000014174 | 351 |
| 602 | 3300021361 | Ga0213872_10000004 | Ga0213872_1000000463 | 351 |
| 603 | 3300025273 | Ga0209673_1030300 | Ga0209673_10303001 | 351 |
| 604 | 3300025298 | Ga0209050_1008655 | Ga0209050_10086554 | 351 |
| 605 | 3300025299 | Ga0209256_1003497 | Ga0209256_10034973 | 351 |
| 606 | 3300025303 | Ga0209051_1000674 | Ga0209051_10006746 | 351 |
| 607 | 3300025303 | Ga0209051_1009412 | Ga0209051_10094125 | 351 |
| 608 | 3300025304 | Ga0209257_1001690 | Ga0209257_100169018 | 351 |
| 609 | 3300025304 | Ga0209257_1005187 | Ga0209257_10051873 | 351 |
| 610 | 3300025927 | Ga0207687_10163203 | Ga0207687_101632032 | 351 |
| 611 | 3300025935 | Ga0207709_10008507 | Ga0207709_100085075 | 351 |
| 612 | 3300026035 | Ga0207703_10337194 | Ga0207703_103371941 | 351 |
| 613 | 3300026067 | Ga0207678_10002552 | Ga0207678_100025528 | 351 |
| 614 | 3300026088 | Ga0207641_10198703 | Ga0207641_101987032 | 351 |
| 615 | 3300026089 | Ga0207648_10000142 | Ga0207648_1000014249 | 351 |
| 616 | 3300027296 | Ga0209389_1027328 | Ga0209389_10273284 | 351 |
| 617 | 3300028379 | Ga0268266_10020171 | Ga0268266_100201715 | 351 |
| 618 | 3300028794 | Ga0307515_10150616 | Ga0307515_101506162 | 351 |
| 619 | 3300030521 | Ga0307511_10068954 | Ga0307511_100689542 | 351 |
| 620 | 3300031730 | Ga0307516_10002501 | Ga0307516_100025015 | 351 |
| 621 | 3300031730 | Ga0307516_10175088 | Ga0307516_101750882 | 351 |
| 622 | 3300033180 | Ga0307510_10027415 | Ga0307510_100274155 | 351 |
| 623 | 3300037312 | Ga0395899_0028348 | Ga0395899_0028348_714_1877 | 351 |
| 624 | 3300037466 | Ga0395898_0028321 | Ga0395898_0028321_2080_3243 | 351 |
| 625 | 3300037471 | Ga0395905_0243284 | Ga0395905_0243284_320_1486 | 351 |
| 626 | 3300038443 | Ga0395901_0035718 | Ga0395901_0035718_2939_4102 | 351 |
| 627 | 3300038443 | Ga0395901_0092099 | Ga0395901_0092099_1602_2768 | 351 |
| 628 | 3300039447 | Ga0436361_0583521 | Ga0436361_0583521_43050_44195 | 351 |
| 629 | 3300041997 | Ga0439431_0009009 | Ga0439431_0009009_411_1532 | 351 |
| 630 | 3300042438 | Ga0439459_0000228 | Ga0439459_0000228_4989_6134 | 351 |
| 631 | 3300044656 | Ga0466969_0000002 | Ga0466969_0000002_161090_162211 | 351 |
| 632 | 3300044656 | Ga0466969_0007330 | Ga0466969_0007330_1001_2158 | 351 |
| 633 | 3300044656 | Ga0466969_0009526 | Ga0466969_0009526_2935_4095 | 351 |
| 634 | 3300044656 | Ga0466969_0037283 | Ga0466969_0037283_701_1822 | 351 |
| 635 | 3300044683 | Ga0466965_0064093 | Ga0466965_0064093_125_1246 | 351 |
| 636 | 3300044684 | Ga0466966_0001339 | Ga0466966_0001339_2474_3595 | 351 |
| 637 | 3300044684 | Ga0466966_0007833 | Ga0466966_0007833_3697_4854 | 351 |
| 638 | 3300044684 | Ga0466966_0015276 | Ga0466966_0015276_2221_3342 | 351 |
| 639 | 3300044684 | Ga0466966_0020128 | Ga0466966_0020128_1085_2245 | 351 |
| 640 | 3300044693 | Ga0466961_0026940 | Ga0466961_0026940_1354_2475 | 351 |
| 641 | 3300044693 | Ga0466961_0090320 | Ga0466961_0090320_736_1857 | 351 |
| 642 | 3300044694 | Ga0466963_0144363 | Ga0466963_0144363_410_1531 | 351 |
| 643 | 3300044765 | Ga0466970_0044954 | Ga0466970_0044954_773_1894 | 351 |
| 644 | 3300045049 | Ga0466959_0001562 | Ga0466959_0001562_1643_2764 | 351 |
| 645 | 3300045049 | Ga0466959_0004663 | Ga0466959_0004663_7787_8944 | 351 |
| 646 | 3300045049 | Ga0466959_0008282 | Ga0466959_0008282_3660_4820 | 351 |
| 647 | 3300045051 | Ga0451576_0334921 | Ga0451576_0334921_216_1364 | 351 |
| 648 | 3300045976 | Ga0466967_0026883 | Ga0466967_0026883_572_1693 | 351 |
| 649 | 3300046471 | Ga0495650_0008824 | Ga0495650_0008824_2363_3478 | 351 |
| 650 | 3300047472 | Ga0495686_0060940 | Ga0495686_0060940_270_1400 | 351 |
| 651 | 3300048905 | Ga0496102_0026281 | Ga0496102_0026281_2632_3753 | 351 |
| 652 | 3300048912 | Ga0496109_0243456 | Ga0496109_0243456_82_1227 | 351 |
| 653 | 3300048917 | Ga0496114_0136188 | Ga0496114_0136188_533_1663 | 351 |
| 654 | 3300048927 | Ga0496124_0008805 | Ga0496124_0008805_1010_2167 | 351 |
| 655 | 3300049571 | Ga0501034_0140259 | Ga0501034_0140259_952_2097 | 351 |
| 656 | 3300050496 | nmdc:mga07m45_34095_c1 | nmdc:mga07m45_34095_c1_744_1874 | 351 |
| 657 | 3300053086 | Ga0500578_0043483 | Ga0500578_0043483_228_1355 | 351 |
| 658 | 3300053117 | Ga0500593_001202 | Ga0500593_001202_5704_6828 | 351 |
| 659 | 3300053118 | Ga0500594_0000251 | Ga0500594_0000251_8404_9534 | 351 |
| 660 | 3300053136 | Ga0500559_0000392 | Ga0500559_0000392_12742_13872 | 351 |
| 661 | 3300053156 | Ga0500622_0002031 | Ga0500622_0002031_2464_3609 | 351 |
| 662 | 3300053730 | Ga0500645_006937 | Ga0500645_006937_2358_3485 | 351 |
| 663 | iso_pu_bacteria | 2831864461 | 2831866351 | 351 |
| 664 | iso_pu_bacteria | 2886848708 | 2886849624 | 351 |
| 665 | 3300003775 | Ga0055524_1000175 | Ga0055524_100017516 | 352 |
| 666 | 3300003791 | Ga0055530_10005340 | Ga0055530_100053402 | 352 |
| 667 | 3300003792 | Ga0055540_1000062 | Ga0055540_100006222 | 352 |
| 668 | 3300003794 | Ga0055531_10010250 | Ga0055531_100102504 | 352 |
| 669 | 3300006880 | Ga0075429_100044687 | Ga0075429_1000446873 | 352 |
| 670 | 3300006946 | Ga0079104_1000186 | Ga0079104_100018622 | 352 |
| 671 | 3300025291 | Ga0209675_1007295 | Ga0209675_10072954 | 352 |
| 672 | 3300025298 | Ga0209050_1003695 | Ga0209050_10036952 | 352 |
| 673 | 3300025299 | Ga0209256_1000024 | Ga0209256_1000024276 | 352 |
| 674 | 3300025303 | Ga0209051_1000063 | Ga0209051_1000063204 | 352 |
| 675 | 3300025304 | Ga0209257_1000118 | Ga0209257_10001182 | 352 |
| 676 | 3300027111 | Ga0209281_1000442 | Ga0209281_100044237 | 352 |
| 677 | 3300028794 | Ga0307515_10021930 | Ga0307515_100219305 | 352 |
| 678 | 3300031235 | Ga0265330_10000032 | Ga0265330_1000003211 | 352 |
| 679 | 3300031238 | Ga0265332_10000001 | Ga0265332_10000001116 | 352 |
| 680 | 3300031507 | Ga0307509_10098502 | Ga0307509_100985022 | 352 |
| 681 | 3300031507 | Ga0307509_10177294 | Ga0307509_101772942 | 352 |
| 682 | 3300031616 | Ga0307508_10185848 | Ga0307508_101858482 | 352 |
| 683 | 3300031711 | Ga0265314_10000022 | Ga0265314_10000022116 | 352 |
| 684 | 3300033179 | Ga0307507_10093838 | Ga0307507_100938381 | 352 |
| 685 | 3300035691 | Ga0373931_0044183 | Ga0373931_0044183_1017_2153 | 352 |
| 686 | 3300037312 | Ga0395899_0002565 | Ga0395899_0002565_1608_2774 | 352 |
| 687 | 3300037418 | Ga0395900_0005484 | Ga0395900_0005484_9463_10629 | 352 |
| 688 | 3300037418 | Ga0395900_0249015 | Ga0395900_0249015_251_1402 | 352 |
| 689 | 3300037466 | Ga0395898_0006418 | Ga0395898_0006418_159_1325 | 352 |
| 690 | 3300037471 | Ga0395905_0000106 | Ga0395905_0000106_105173_106351 | 352 |
| 691 | 3300037471 | Ga0395905_0002852 | Ga0395905_0002852_13425_14591 | 352 |
| 692 | 3300037471 | Ga0395905_0020704 | Ga0395905_0020704_2219_3370 | 352 |
| 693 | 3300038443 | Ga0395901_0189875 | Ga0395901_0189875_867_2033 | 352 |
| 694 | 3300042439 | Ga0439464_0003749 | Ga0439464_0003749_1503_2657 | 352 |
| 695 | 3300044693 | Ga0466961_0008620 | Ga0466961_0008620_160_1329 | 352 |
| 696 | 3300046542 | Ga0495597_0010147 | Ga0495597_0010147_2507_3640 | 352 |
| 697 | 3300047321 | Ga0495676_0056004 | Ga0495676_0056004_766_1902 | 352 |
| 698 | 3300047443 | Ga0495687_002210 | Ga0495687_002210_768_1901 | 352 |
| 699 | 3300048917 | Ga0496114_0003382 | Ga0496114_0003382_5330_6457 | 352 |
| 700 | iso_pu_bacteria | 2643221609 | 2644062361 | 352 |
| 701 | iso_pu_bacteria | 2643221611 | 2644075581 | 352 |
| 702 | iso_pu_bacteria | 2643221644 | 2644243144 | 352 |
| 703 | 3300005344 | Ga0070661_100000264 | Ga0070661_1000002647 | 353 |
| 704 | 3300005356 | Ga0070674_100000872 | Ga0070674_1000008729 | 353 |
| 705 | 3300005366 | Ga0070659_100000798 | Ga0070659_10000079815 | 353 |
| 706 | 3300005367 | Ga0070667_100316638 | Ga0070667_1003166381 | 353 |
| 707 | 3300005455 | Ga0070663_100133738 | Ga0070663_1001337382 | 353 |
| 708 | 3300005457 | Ga0070662_100072979 | Ga0070662_1000729792 | 353 |
| 709 | 3300005459 | Ga0068867_100212214 | Ga0068867_1002122142 | 353 |
| 710 | 3300005564 | Ga0070664_100003853 | Ga0070664_1000038537 | 353 |
| 711 | 3300005564 | Ga0070664_100092220 | Ga0070664_1000922202 | 353 |
| 712 | 3300005616 | Ga0068852_100108043 | Ga0068852_1001080432 | 353 |
| 713 | 3300006881 | Ga0068865_100097476 | Ga0068865_1000974761 | 353 |
| 714 | 3300014968 | Ga0157379_10288325 | Ga0157379_102883252 | 353 |
| 715 | 3300025256 | Ga0209759_1011322 | Ga0209759_10113222 | 353 |
| 716 | 3300025919 | Ga0207657_10155427 | Ga0207657_101554273 | 353 |
| 717 | 3300025920 | Ga0207649_10002218 | Ga0207649_100022185 | 353 |
| 718 | 3300025927 | Ga0207687_10188937 | Ga0207687_101889372 | 353 |
| 719 | 3300025937 | Ga0207669_10042973 | Ga0207669_100429732 | 353 |
| 720 | 3300025945 | Ga0207679_10001861 | Ga0207679_100018618 | 353 |
| 721 | 3300025945 | Ga0207679_10006511 | Ga0207679_100065112 | 353 |
| 722 | 3300025986 | Ga0207658_10002880 | Ga0207658_100028804 | 353 |
| 723 | 3300025986 | Ga0207658_10224549 | Ga0207658_102245492 | 353 |
| 724 | 3300031456 | Ga0307513_10015357 | Ga0307513_100153579 | 353 |
| 725 | 3300031456 | Ga0307513_10023996 | Ga0307513_100239963 | 353 |
| 726 | 3300031548 | Ga0307408_100188771 | Ga0307408_1001887712 | 353 |
| 727 | 3300031616 | Ga0307508_10034900 | Ga0307508_100349002 | 353 |
| 728 | 3300031730 | Ga0307516_10006776 | Ga0307516_100067763 | 353 |
| 729 | 3300031995 | Ga0307409_100060955 | Ga0307409_1000609552 | 353 |
| 730 | 3300032002 | Ga0307416_100031303 | Ga0307416_1000313033 | 353 |
| 731 | 3300032005 | Ga0307411_10030308 | Ga0307411_100303082 | 353 |
| 732 | 3300046660 | Ga0495625_0013423 | Ga0495625_0013423_43_1206 | 353 |
| 733 | 3300046683 | Ga0495658_0088988 | Ga0495658_0088988_472_1590 | 353 |
| 734 | 3300048905 | Ga0496102_0020879 | Ga0496102_0020879_4066_5199 | 353 |
| 735 | 3300048924 | Ga0496121_0022752 | Ga0496121_0022752_2509_3654 | 353 |
| 736 | iso_pu_bacteria | 2643221570 | 2643864733 | 353 |
| 737 | iso_pu_bacteria | 2643221596 | 2643991109 | 353 |
| 738 | iso_pu_bacteria | 2643221652 | 2644294036 | 353 |
| 739 | iso_pu_bacteria | 2990710928 | 2990711808 | 353 |
| 740 | 3300005328 | Ga0070676_10007485 | Ga0070676_100074853 | 354 |
| 741 | 3300005334 | Ga0068869_100013849 | Ga0068869_1000138493 | 354 |
| 742 | 3300005354 | Ga0070675_100028234 | Ga0070675_1000282344 | 354 |
| 743 | 3300005355 | Ga0070671_100044580 | Ga0070671_1000445802 | 354 |
| 744 | 3300005356 | Ga0070674_100263364 | Ga0070674_1002633641 | 354 |
| 745 | 3300005364 | Ga0070673_100055860 | Ga0070673_1000558603 | 354 |
| 746 | 3300005457 | Ga0070662_100011800 | Ga0070662_1000118003 | 354 |
| 747 | 3300005459 | Ga0068867_100006286 | Ga0068867_1000062862 | 354 |
| 748 | 3300005467 | Ga0070706_100000212 | Ga0070706_10000021221 | 354 |
| 749 | 3300005471 | Ga0070698_100108940 | Ga0070698_1001089402 | 354 |
| 750 | 3300005840 | Ga0068870_10061740 | Ga0068870_100617402 | 354 |
| 751 | 3300006042 | Ga0075368_10005570 | Ga0075368_100055704 | 354 |
| 752 | 3300006048 | Ga0075363_100112717 | Ga0075363_1001127172 | 354 |
| 753 | 3300006178 | Ga0075367_10021959 | Ga0075367_100219593 | 354 |
| 754 | 3300006195 | Ga0075366_10023388 | Ga0075366_100233882 | 354 |
| 755 | 3300006353 | Ga0075370_10030190 | Ga0075370_100301902 | 354 |
| 756 | 3300025907 | Ga0207645_10012047 | Ga0207645_100120473 | 354 |
| 757 | 3300025908 | Ga0207643_10054635 | Ga0207643_100546352 | 354 |
| 758 | 3300025910 | Ga0207684_10031655 | Ga0207684_100316554 | 354 |
| 759 | 3300025933 | Ga0207706_10005764 | Ga0207706_100057648 | 354 |
| 760 | 3300025942 | Ga0207689_10021427 | Ga0207689_100214274 | 354 |
| 761 | 3300025960 | Ga0207651_10028921 | Ga0207651_100289213 | 354 |
| 762 | 3300026089 | Ga0207648_10024671 | Ga0207648_100246713 | 354 |
| 763 | 3300037418 | Ga0395900_0000188 | Ga0395900_0000188_61006_62142 | 354 |
| 764 | 3300037466 | Ga0395898_0017271 | Ga0395898_0017271_3263_4399 | 354 |
| 765 | 3300037471 | Ga0395905_0020789 | Ga0395905_0020789_2534_3691 | 354 |
| 766 | 3300044683 | Ga0466965_0002506 | Ga0466965_0002506_3832_4989 | 354 |
| 767 | 3300044694 | Ga0466963_0074855 | Ga0466963_0074855_653_1810 | 354 |
| 768 | 3300044706 | Ga0466964_0002006 | Ga0466964_0002006_3392_4549 | 354 |
| 769 | 3300044719 | Ga0466971_0001980 | Ga0466971_0001980_5446_6603 | 354 |
| 770 | 3300044735 | Ga0466968_0017259 | Ga0466968_0017259_16_1173 | 354 |
| 771 | 3300050494 | nmdc:mga06z11_33118_c1 | nmdc:mga06z11_33118_c1_653_1798 | 354 |
| 772 | 3300050496 | nmdc:mga07m45_44545_c1 | nmdc:mga07m45_44545_c1_342_1487 | 354 |
| 773 | 3300061719 | Ga0466962_0004675 | Ga0466962_0004675_952_2109 | 354 |
| 774 | iso_pu_bacteria | 2547132374 | 2548500242 | 354 |
| 775 | iso_pu_bacteria | 2643221717 | 2644644441 | 354 |
| 776 | 3300003316 | rootH1_10015684 | rootH1_100156842 | 355 |
| 777 | 3300005364 | Ga0070673_100169270 | Ga0070673_1001692701 | 355 |
| 778 | 3300005618 | Ga0068864_100104651 | Ga0068864_1001046512 | 355 |
| 779 | 3300006237 | Ga0097621_100034144 | Ga0097621_1000341444 | 355 |
| 780 | 3300009177 | Ga0105248_10040203 | Ga0105248_100402033 | 355 |
| 781 | 3300013296 | Ga0157374_10066719 | Ga0157374_100667193 | 355 |
| 782 | 3300013308 | Ga0157375_10075576 | Ga0157375_100755763 | 355 |
| 783 | 3300014969 | Ga0157376_10284085 | Ga0157376_102840852 | 355 |
| 784 | 3300025931 | Ga0207644_10011940 | Ga0207644_100119405 | 355 |
| 785 | 3300025940 | Ga0207691_10109068 | Ga0207691_101090682 | 355 |
| 786 | 3300025941 | Ga0207711_10016270 | Ga0207711_100162702 | 355 |
| 787 | 3300025960 | Ga0207651_10113617 | Ga0207651_101136172 | 355 |
| 788 | 3300026089 | Ga0207648_10147811 | Ga0207648_101478112 | 355 |
| 789 | 3300026095 | Ga0207676_10105908 | Ga0207676_101059082 | 355 |
| 790 | 3300026121 | Ga0207683_10352355 | Ga0207683_103523552 | 355 |
| 791 | 3300027876 | Ga0209974_10002124 | Ga0209974_100021247 | 355 |
| 792 | 3300031548 | Ga0307408_100000513 | Ga0307408_1000005139 | 355 |
| 793 | 3300031901 | Ga0307406_10000279 | Ga0307406_1000027923 | 355 |
| 794 | 3300035691 | Ga0373931_0002571 | Ga0373931_0002571_1851_2981 | 355 |
| 795 | 3300037471 | Ga0395905_0001392 | Ga0395905_0001392_15609_16784 | 355 |
| 796 | 3300039447 | Ga0436361_0141959 | Ga0436361_0141959_451_1578 | 355 |
| 797 | 3300042121 | Ga0450919_000269 | Ga0450919_000269_4534_5679 | 355 |
| 798 | 3300042122 | Ga0450920_007520 | Ga0450920_007520_182_1327 | 355 |
| 799 | 3300042125 | Ga0450923_001458 | Ga0450923_001458_522_1688 | 355 |
| 800 | 3300042531 | Ga0450918_000945 | Ga0450918_000945_2141_3286 | 355 |
| 801 | 3300044683 | Ga0466965_0014746 | Ga0466965_0014746_208_1368 | 355 |
| 802 | 3300005539 | Ga0068853_100052483 | Ga0068853_1000524833 | 356 |
| 803 | 3300009093 | Ga0105240_10018656 | Ga0105240_100186564 | 356 |
| 804 | 3300009545 | Ga0105237_10000367 | Ga0105237_1000036756 | 356 |
| 805 | 3300009551 | Ga0105238_10009305 | Ga0105238_100093057 | 356 |
| 806 | 3300010375 | Ga0105239_10000150 | Ga0105239_1000015070 | 356 |
| 807 | 3300025913 | Ga0207695_10022061 | Ga0207695_100220614 | 356 |
| 808 | 3300025914 | Ga0207671_10000808 | Ga0207671_1000080813 | 356 |
| 809 | 3300025924 | Ga0207694_10011050 | Ga0207694_100110502 | 356 |
| 810 | 3300037471 | Ga0395905_0002964 | Ga0395905_0002964_2600_3781 | 356 |
| 811 | 3300005331 | Ga0070670_100028084 | Ga0070670_1000280844 | 357 |
| 812 | 3300025920 | Ga0207649_10208085 | Ga0207649_102080852 | 357 |
| 813 | 3300025940 | Ga0207691_10136583 | Ga0207691_101365832 | 357 |
| 814 | 3300025941 | Ga0207711_10077719 | Ga0207711_100777192 | 357 |
| 815 | 3300041459 | Ga0451800_1626932 | Ga0451800_1626932_130_1290 | 357 |
| 816 | 3300035695 | Ga0373927_0091127 | Ga0373927_0091127_100_1263 | 358 |
| 817 | 3300050496 | nmdc:mga07m45_182_c1 | nmdc:mga07m45_182_c1_9489_10640 | 359 |
| 818 | 3300025256 | Ga0209759_1001241 | Ga0209759_10012419 | 360 |
| 819 | 3300025909 | Ga0207705_10041475 | Ga0207705_100414752 | 360 |
| 820 | 3300031730 | Ga0307516_10001811 | Ga0307516_1000181114 | 360 |
| 821 | 3300046475 | Ga0495639_0046092 | Ga0495639_0046092_717_1898 | 360 |
| 822 | 3300003752 | Ga0055539_1000603 | Ga0055539_10006037 | 361 |
| 823 | 3300003756 | Ga0055533_1000006 | Ga0055533_100000657 | 361 |
| 824 | 3300003759 | Ga0055525_1000677 | Ga0055525_10006777 | 361 |
| 825 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031279 | 361 |
| 826 | 3300025230 | Ga0209563_100010 | Ga0209563_1000101007 | 361 |
| 827 | 3300025231 | Ga0207427_101024 | Ga0207427_1010248 | 361 |
| 828 | 3300025253 | Ga0209677_100274 | Ga0209677_1002749 | 361 |
| 829 | 3300025913 | Ga0207695_10080409 | Ga0207695_100804093 | 361 |
| 830 | 3300006353 | Ga0075370_10000245 | Ga0075370_100002459 | 363 |
| 831 | 3300046471 | Ga0495650_0021298 | Ga0495650_0021298_436_1617 | 363 |
| 832 | 3300053136 | Ga0500559_0010715 | Ga0500559_0010715_889_2070 | 365 |
| 833 | 3300003761 | Ga0055535_1000881 | Ga0055535_100088113 | 367 |
| 834 | 3300003763 | Ga0055529_1000175 | Ga0055529_100017520 | 367 |
| 835 | 3300015262 | Ga0182007_10030022 | Ga0182007_100300222 | 367 |
| 836 | 3300025242 | Ga0209258_100060 | Ga0209258_100060197 | 367 |
| 837 | 3300025256 | Ga0209759_1001792 | Ga0209759_10017924 | 367 |
| 838 | 3300025272 | Ga0209455_1000093 | Ga0209455_100009341 | 367 |
| 839 | 3300025919 | Ga0207657_10069954 | Ga0207657_100699542 | 367 |
| 840 | 3300025932 | Ga0207690_10051255 | Ga0207690_100512552 | 367 |
| 841 | 3300046506 | Ga0495583_0000153 | Ga0495583_0000153_34410_35573 | 368 |
| 842 | 3300046507 | Ga0495606_0002667 | Ga0495606_0002667_11910_13073 | 368 |
| 843 | 3300046694 | Ga0495649_0002833 | Ga0495649_0002833_9239_10402 | 368 |
| 844 | 3300053080 | Ga0500635_0000033 | Ga0500635_0000033_9160_10332 | 368 |
| 845 | 3300003320 | rootH2_10029880 | rootH2_100298803 | 369 |
| 846 | 3300025909 | Ga0207705_10109683 | Ga0207705_101096832 | 369 |
| 847 | 3300025949 | Ga0207667_10313796 | Ga0207667_103137962 | 369 |
| 848 | 3300037466 | Ga0395898_0110946 | Ga0395898_0110946_281_1441 | 369 |
| 849 | 3300038443 | Ga0395901_0006203 | Ga0395901_0006203_5521_6681 | 369 |
| 850 | 3300002705 | JGI25156J39149_1000581 | JGI25156J39149_100058113 | 370 |
| 851 | 3300002741 | JGI25157J39369_1000163 | JGI25157J39369_100016330 | 370 |
| 852 | 3300003322 | rootL2_10321793 | rootL2_103217931 | 370 |
| 853 | 3300003323 | rootH1_10047957 | rootH1_100479573 | 370 |
| 854 | 3300003323 | rootH1_10058315 | rootH1_100583153 | 370 |
| 855 | 3300003752 | Ga0055539_1000826 | Ga0055539_10008265 | 370 |
| 856 | 3300005327 | Ga0070658_10016622 | Ga0070658_100166224 | 370 |
| 857 | 3300005330 | Ga0070690_100214400 | Ga0070690_1002144001 | 370 |
| 858 | 3300005563 | Ga0068855_100011038 | Ga0068855_1000110382 | 370 |
| 859 | 3300005577 | Ga0068857_100020499 | Ga0068857_1000204994 | 370 |
| 860 | 3300005614 | Ga0068856_100001213 | Ga0068856_1000012138 | 370 |
| 861 | 3300005616 | Ga0068852_100147546 | Ga0068852_1001475462 | 370 |
| 862 | 3300005719 | Ga0068861_100043773 | Ga0068861_1000437734 | 370 |
| 863 | 3300009093 | Ga0105240_10276166 | Ga0105240_102761662 | 370 |
| 864 | 3300013105 | Ga0157369_10006554 | Ga0157369_1000655410 | 370 |
| 865 | 3300025242 | Ga0209258_100482 | Ga0209258_1004828 | 370 |
| 866 | 3300025246 | Ga0209646_1000242 | Ga0209646_100024229 | 370 |
| 867 | 3300025250 | Ga0209026_1000311 | Ga0209026_100031129 | 370 |
| 868 | 3300025253 | Ga0209677_100396 | Ga0209677_1003969 | 370 |
| 869 | 3300025256 | Ga0209759_1000373 | Ga0209759_100037313 | 370 |
| 870 | 3300025909 | Ga0207705_10106674 | Ga0207705_101066742 | 370 |
| 871 | 3300025924 | Ga0207694_10018782 | Ga0207694_100187822 | 370 |
| 872 | 3300025949 | Ga0207667_10026613 | Ga0207667_100266135 | 370 |
| 873 | 3300026041 | Ga0207639_10093396 | Ga0207639_100933961 | 370 |
| 874 | 3300026078 | Ga0207702_10001598 | Ga0207702_1000159817 | 370 |
| 875 | 3300026116 | Ga0207674_10014389 | Ga0207674_100143899 | 370 |
| 876 | 3300026116 | Ga0207674_10206732 | Ga0207674_102067322 | 370 |
| 877 | 3300026118 | Ga0207675_100029352 | Ga0207675_1000293523 | 370 |
| 878 | 3300026142 | Ga0207698_10234734 | Ga0207698_102347342 | 370 |
| 879 | 3300028666 | Ga0265336_10000062 | Ga0265336_1000006258 | 370 |
| 880 | 3300029957 | Ga0265324_10015589 | Ga0265324_100155892 | 370 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hdj-assembly1.cif.gz_A | crystal structure of bamb from pseudomonas aeruginosa | 0.8807 | 31 | 369 |
| 2yms-assembly1.cif.gz_A | structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif | 0.8637 | 72 | 186 |
| 2yms-assembly1.cif.gz_B | structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif | 0.847 | 150 | 223 |
| 4imm-assembly1.cif.gz_A | the crystal structure of bamb from moraxella catarrhalis | 0.8417 | 43 | 368 |
| 4hdj-assembly1.cif.gz_A | crystal structure of bamb from pseudomonas aeruginosa | 0.841 | 31 | 369 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hdjA00 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8807 | 31 | 369 | 2.130.10.10 |
| 2ymsA00 | Mainly Beta;Beta Barrel;Lipocalin; | 0.8637 | 72 | 186 | 2.40.128.630 |
| af_Q9FKT5_7_165_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8577 | 77 | 150 | 2.130.10.10 |
| af_P77774_21_391_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8556 | 26 | 368 | 2.130.10.10 |
| 2ymsB00 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.847 | 150 | 223 | 2.40.10.480 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S1MWQ3-F1-model_v4 | Outer membrane protein assembly factor BamB | 0.9748 | 191 | 349 |
|
| AF-A0A519IAL8-F1-model_v4 | Outer membrane protein assembly factor BamB | 0.971 | 134 | 356 |
|
| AF-A0A7S1MWQ3-F1-model_v4 | Outer membrane protein assembly factor BamB | 0.9688 | 191 | 349 |
|
| AF-A0A7V8BLV1-F1-model_v4 | PQQ-binding-like beta-propeller repeat protein | 0.9684 | 86 | 364 |
|
| AF-A0A7C9J9B4-F1-model_v4 | PQQ-binding-like beta-propeller repeat protein | 0.9592 | 86 | 370 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar