F484477

General Info

Members Datasets Scaffolds Average Seq Length
880 368 851 368

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10015684|rootH1_100156842
Length 397
Sequence MRSGIHPLALSLSKGCSAWLRRGFDKLSPNGVWAVLMAVALLGGCASSSKPKPTPLDPLTPTVTPKQIWNSRIDAVQYPLTVAVVGNAFTLAGSDGSVLALDADSGRELWRANAGAKLSAGVGTDGRFAAVVTRDGELIVFEQGQVKWRKPLSARVTTAPLVAGERVFVVGVDRIVRAFDALDGRRIWTLQRPSDPLTLAQAGVLVPFKDTLVVGQGPRMVGVDPTAGTVRWDVPVGSPRGANEIERLADLVAPSARVGNLICARSFQAAVGCVDAQRGATVWSRNIGGTDGVAADAEFVFAADATDRLTAWKTPSGDVAWTSDKYLYRGMSAPVIFGKSVVFGDVEGTVHWFARDTGEAQARQTTDGSAIVTAPVVAGSTMLVVTKNGGLYAYRQP

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221585 Pelomonas sp. Root662 Isolate Unclassified
9 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
10 2643221596 Acidovorax sp. Root70 Isolate Unclassified
11 2643221609 Acidovorax sp. Root217 Isolate Unclassified
12 2643221611 Acidovorax sp. Root219 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
15 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
16 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
17 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
18 2643221652 Acidovorax sp. Root402 Isolate Unclassified
19 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
20 2643221656 Pelomonas sp. Root405 Isolate Unclassified
21 2643221717 Acidovorax sp. Root267 Isolate Unclassified
22 2738541337 Pelomonas sp. BT06 Isolate Unclassified
23 2738543012 Acidovorax sp. CF301 Isolate Unclassified
24 2816332133 Acidovorax radicis 2721A Isolate Unclassified
25 2831864461 Roseateles noduli HZ7 Isolate Nodule
26 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
27 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
28 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
29 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
30 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
31 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
32 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
63 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
119 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
210 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
221 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
224 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
225 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
255 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
256 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
257 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
258 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
259 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
260 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
261 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
262 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
263 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
264 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
265 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
266 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
269 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
277 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
278 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
279 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
292 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
293 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
332 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
333 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
334 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
346 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
347 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
348 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
349 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
350 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
351 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
352 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
353 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
354 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
355 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
356 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
357 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
358 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
359 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
360 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
361 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
362 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
363 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
364 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
365 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
366 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
367 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
368 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0.68
Isolates 3.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.93
Nodule 0.57
Rhizoplane 2.73
Rhizosphere 69.43
Stem 0
Stem Tuber 0
Unclassified 10.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000581 3300002705 Bacteria 20815
2 JGI25157J39369_1000163 3300002741 Bacteria 55914
3 JGI25152J39213_1002264 3300002773 Bacteria 7426
4 JGI25153J46596_10009871 3300003215 Bacteria 4380
5 JGI25153J46596_10012943 3300003215 Bacteria 3561
6 rootH1_10015684 3300003316 Bacteria 2826
7 rootH1_10025577 3300003316 Bacteria 4801
8 rootH1_10027067 3300003316 Bacteria 3617
9 rootH2_10011660 3300003320 Bacteria 8700
10 rootH2_10029880 3300003320 Bacteria 4608
11 rootL2_10000980 3300003322 Bacteria 20057
12 rootL2_10045989 3300003322 Bacteria 5182
13 rootL2_10259464 3300003322 Bacteria 2440
14 rootL2_10274554 3300003322 Bacteria 1247
15 rootL2_10321793 3300003322 Bacteria 1967
16 rootH1_10011477 3300003323 Bacteria 2676
17 rootH1_10036624 3300003323 Bacteria 4780
18 rootH1_10047957 3300003323 Bacteria 2722
19 rootH1_10058315 3300003323 Bacteria 2654
20 rootH1_10058316 3300003323 Bacteria 3331
21 rootH1_10141431 3300003323 Bacteria 2562
22 JGI26128J50194_1000130 3300003347 Bacteria 3187
23 Ga0055539_1000603 3300003752 Bacteria 9936
24 Ga0055539_1000826 3300003752 Bacteria 7281
25 Ga0055533_1000006 3300003756 Bacteria 635559
26 Ga0055525_1000026 3300003759 Bacteria 345798
27 Ga0055525_1000677 3300003759 Bacteria 12912
28 Ga0055535_1000881 3300003761 Bacteria 20958
29 Ga0055529_1000175 3300003763 Bacteria 87829
30 Ga0055526_1010561 3300003771 Bacteria 4278
31 Ga0055524_1000175 3300003775 Bacteria 72850
32 Ga0055524_1020352 3300003775 Bacteria 2237
33 Ga0055530_10005340 3300003791 Bacteria 6149
34 Ga0055540_1000062 3300003792 Bacteria 128474
35 Ga0055531_10000823 3300003794 Bacteria 25703
36 Ga0055531_10010250 3300003794 Bacteria 4685
37 Ga0055531_10024473 3300003794 Bacteria 2227
38 Ga0055531_10025337 3300003794 Bacteria 2158
39 Ga0055543_1002639 3300004625 Bacteria 5769
40 Ga0065165_1000006 3300005262 Bacteria 352298
41 Ga0065165_1002955 3300005262 Bacteria 12945
42 Ga0065165_1003031 3300005262 Bacteria 12647
43 Ga0070658_10016622 3300005327 Bacteria 5888
44 Ga0070658_10092351 3300005327 Bacteria 2496
45 Ga0070658_10100106 3300005327 Bacteria 2395
46 Ga0070658_10126284 3300005327 Bacteria 2129
47 Ga0070658_10157061 3300005327 Bacteria 1907
48 Ga0070676_10004487 3300005328 Bacteria 7346
49 Ga0070676_10007485 3300005328 Bacteria 5861
50 Ga0070676_10010804 3300005328 Bacteria 4953
51 Ga0070683_100024422 3300005329 Bacteria 5414
52 Ga0070683_100045692 3300005329 Bacteria 4043
53 Ga0070683_100083823 3300005329 Bacteria 2986
54 Ga0070690_100006323 3300005330 Bacteria 6717
55 Ga0070690_100025841 3300005330 Bacteria 3618
56 Ga0070690_100214400 3300005330 Bacteria 1346
57 Ga0070670_100011707 3300005331 Bacteria 7503
58 Ga0070670_100028084 3300005331 Bacteria 4841
59 Ga0070670_100099798 3300005331 Bacteria 2498
60 Ga0070670_100156408 3300005331 Bacteria 1974
61 Ga0070677_10005950 3300005333 Bacteria 4042
62 Ga0070677_10008103 3300005333 Bacteria 3526
63 Ga0068869_100006760 3300005334 Bacteria 7289
64 Ga0068869_100009857 3300005334 Bacteria 6204
65 Ga0068869_100013849 3300005334 Bacteria 5376
66 Ga0068869_100015658 3300005334 Bacteria 5093
67 Ga0070666_10009854 3300005335 Bacteria 5965
68 Ga0070666_10099867 3300005335 Bacteria 1999
69 Ga0070682_100045865 3300005337 Bacteria 2711
70 Ga0068868_100015136 3300005338 Bacteria 5699
71 Ga0068868_100015986 3300005338 Bacteria 5564
72 Ga0068868_100024050 3300005338 Bacteria 4618
73 Ga0070660_100038551 3300005339 Bacteria 3628
74 Ga0070689_100163417 3300005340 Bacteria 1801
75 Ga0070687_100006756 3300005343 Bacteria 4728
76 Ga0070661_100000264 3300005344 Bacteria 43037
77 Ga0070661_100007118 3300005344 Bacteria 7718
78 Ga0070661_100109713 3300005344 Bacteria 2059
79 Ga0070692_10081509 3300005345 Bacteria 1744
80 Ga0070668_100003264 3300005347 Bacteria 11958
81 Ga0070668_100038465 3300005347 Bacteria 3656
82 Ga0070668_100054526 3300005347 Bacteria 3084
83 Ga0070668_100289283 3300005347 Bacteria 1371
84 Ga0070669_100006416 3300005353 Bacteria 8464
85 Ga0070669_100023264 3300005353 Bacteria 4438
86 Ga0070669_100032799 3300005353 Bacteria 3752
87 Ga0070669_100047550 3300005353 Bacteria 3130
88 Ga0070675_100007196 3300005354 Bacteria 8576
89 Ga0070675_100010823 3300005354 Bacteria 7134
90 Ga0070675_100013850 3300005354 Bacteria 6349
91 Ga0070675_100028234 3300005354 Bacteria 4515
92 Ga0070675_100041764 3300005354 Bacteria 3746
93 Ga0070675_100050429 3300005354 Bacteria 3417
94 Ga0070675_100090433 3300005354 Bacteria 2564
95 Ga0070675_100111612 3300005354 Bacteria 2314
96 Ga0070671_100003736 3300005355 Bacteria 11951
97 Ga0070671_100012623 3300005355 Bacteria 6809
98 Ga0070671_100023315 3300005355 Bacteria 5064
99 Ga0070671_100025218 3300005355 Bacteria 4877
100 Ga0070671_100044580 3300005355 Bacteria 3685
101 Ga0070671_100070828 3300005355 Bacteria 2909
102 Ga0070671_100075778 3300005355 Bacteria 2811
103 Ga0070671_100174448 3300005355 Bacteria 1818
104 Ga0070671_100229158 3300005355 Bacteria 1576
105 Ga0070671_100250306 3300005355 Unclassified 1505
106 Ga0070674_100000872 3300005356 Bacteria 15687
107 Ga0070674_100007044 3300005356 Bacteria 6610
108 Ga0070674_100014286 3300005356 Bacteria 4934
109 Ga0070674_100075626 3300005356 Bacteria 2392
110 Ga0070674_100263364 3300005356 Bacteria 1359
111 Ga0070673_100002229 3300005364 Bacteria 11725
112 Ga0070673_100002506 3300005364 Bacteria 11201
113 Ga0070673_100055860 3300005364 Bacteria 3112
114 Ga0070673_100056823 3300005364 Bacteria 3089
115 Ga0070673_100083713 3300005364 Bacteria 2592
116 Ga0070673_100089865 3300005364 Bacteria 2508
117 Ga0070673_100153751 3300005364 Bacteria 1950
118 Ga0070673_100169270 3300005364 Bacteria 1864
119 Ga0070688_100150388 3300005365 Bacteria 1591
120 Ga0070659_100000798 3300005366 Bacteria 22978
121 Ga0070659_100004438 3300005366 Bacteria 10024
122 Ga0070659_100008843 3300005366 Bacteria 7379
123 Ga0070667_100001505 3300005367 Bacteria 20850
124 Ga0070667_100022532 3300005367 Bacteria 5222
125 Ga0070667_100033625 3300005367 Bacteria 4287
126 Ga0070667_100316638 3300005367 Bacteria 1407
127 Ga0070701_10016840 3300005438 Bacteria 3406
128 Ga0070663_100002931 3300005455 Bacteria 9711
129 Ga0070663_100006397 3300005455 Bacteria 7082
130 Ga0070663_100053479 3300005455 Bacteria 2883
131 Ga0070663_100133738 3300005455 Bacteria 1886
132 Ga0070678_100010708 3300005456 Bacteria 5615
133 Ga0070678_100037384 3300005456 Bacteria 3409
134 Ga0070662_100004274 3300005457 Bacteria 9015
135 Ga0070662_100011800 3300005457 Bacteria 5773
136 Ga0070662_100030909 3300005457 Bacteria 3752
137 Ga0070662_100072979 3300005457 Bacteria 2535
138 Ga0070662_100091378 3300005457 Bacteria 2286
139 Ga0068867_100000175 3300005459 Bacteria 41852
140 Ga0068867_100000820 3300005459 Bacteria 20957
141 Ga0068867_100004786 3300005459 Bacteria 9528
142 Ga0068867_100006286 3300005459 Bacteria 8400
143 Ga0068867_100024053 3300005459 Bacteria 4364
144 Ga0068867_100033157 3300005459 Bacteria 3738
145 Ga0068867_100057584 3300005459 Bacteria 2878
146 Ga0068867_100107576 3300005459 Bacteria 2137
147 Ga0068867_100212214 3300005459 Bacteria 1555
148 Ga0070706_100000212 3300005467 Bacteria 71525
149 Ga0070698_100108940 3300005471 Bacteria 2737
150 Ga0070679_100000691 3300005530 Bacteria 28927
151 Ga0070679_100102950 3300005530 Bacteria 2841
152 Ga0068853_100052483 3300005539 Bacteria 3512
153 Ga0068853_100124447 3300005539 Bacteria 2303
154 Ga0070672_100002531 3300005543 Bacteria 11641
155 Ga0070672_100017803 3300005543 Bacteria 5121
156 Ga0070672_100017849 3300005543 Bacteria 5116
157 Ga0070672_100082281 3300005543 Bacteria 2583
158 Ga0070672_100155527 3300005543 Bacteria 1894
159 Ga0070672_100294319 3300005543 Bacteria 1375
160 Ga0070693_100044860 3300005547 Bacteria 2503
161 Ga0070665_100018978 3300005548 Bacteria 6898
162 Ga0068855_100011038 3300005563 Bacteria 10902
163 Ga0068855_100097732 3300005563 Bacteria 3382
164 Ga0070664_100003853 3300005564 Bacteria 12108
165 Ga0070664_100014573 3300005564 Bacteria 6413
166 Ga0070664_100047862 3300005564 Bacteria 3614
167 Ga0070664_100088741 3300005564 Bacteria 2673
168 Ga0070664_100092220 3300005564 Bacteria 2622
169 Ga0068857_100020499 3300005577 Bacteria 5815
170 Ga0068857_100113306 3300005577 Bacteria 2438
171 Ga0068854_100001430 3300005578 Bacteria 14430
172 Ga0068854_100055949 3300005578 Bacteria 2842
173 Ga0068854_100061535 3300005578 Bacteria 2720
174 Ga0068856_100001213 3300005614 Bacteria 27067
175 Ga0068856_100008607 3300005614 Bacteria 9922
176 Ga0068852_100034935 3300005616 Bacteria 4187
177 Ga0068852_100067623 3300005616 Bacteria 3124
178 Ga0068852_100072433 3300005616 Bacteria 3028
179 Ga0068852_100108043 3300005616 Bacteria 2525
180 Ga0068852_100111780 3300005616 Bacteria 2485
181 Ga0068852_100147546 3300005616 Bacteria 2183
182 Ga0068859_100060368 3300005617 Bacteria 3821
183 Ga0068859_100069869 3300005617 Bacteria 3547
184 Ga0068859_100113840 3300005617 Bacteria 2769
185 Ga0068859_100275256 3300005617 Bacteria 1776
186 Ga0068864_100002247 3300005618 Bacteria 15969
187 Ga0068864_100014624 3300005618 Bacteria 6518
188 Ga0068864_100031800 3300005618 Bacteria 4479
189 Ga0068864_100036248 3300005618 Bacteria 4203
190 Ga0068864_100093790 3300005618 Bacteria 2652
191 Ga0068864_100104651 3300005618 Bacteria 2514
192 Ga0068866_10067699 3300005718 Bacteria 1875
193 Ga0068866_10084098 3300005718 Bacteria 1716
194 Ga0068861_100000343 3300005719 Bacteria 26498
195 Ga0068861_100006489 3300005719 Bacteria 7972
196 Ga0068861_100038625 3300005719 Bacteria 3558
197 Ga0068861_100043773 3300005719 Bacteria 3363
198 Ga0068861_100054344 3300005719 Bacteria 3050
199 Ga0068861_100155337 3300005719 Bacteria 1881
200 Ga0068861_100161480 3300005719 Bacteria 1849
201 Ga0068851_10002903 3300005834 Bacteria 7573
202 Ga0068851_10009782 3300005834 Bacteria 4466
203 Ga0068851_10018574 3300005834 Bacteria 3350
204 Ga0068870_10061740 3300005840 Bacteria 2016
205 Ga0068863_100007447 3300005841 Bacteria 10712
206 Ga0068863_100062745 3300005841 Bacteria 3514
207 Ga0068863_100103524 3300005841 Bacteria 2708
208 Ga0068858_100001875 3300005842 Bacteria 21440
209 Ga0068858_100002875 3300005842 Bacteria 17315
210 Ga0068858_100005928 3300005842 Bacteria 11931
211 Ga0068858_100266324 3300005842 Bacteria 1630
212 Ga0068860_100000707 3300005843 Bacteria 38265
213 Ga0068860_100000715 3300005843 Bacteria 37986
214 Ga0068860_100006018 3300005843 Bacteria 12209
215 Ga0068860_100120930 3300005843 Bacteria 2507
216 Ga0068860_100132386 3300005843 Bacteria 2394
217 Ga0068862_100047844 3300005844 Bacteria 3650
218 Ga0068862_100048239 3300005844 Bacteria 3636
219 Ga0068862_100053491 3300005844 Bacteria 3456
220 Ga0075365_10009206 3300006038 Bacteria 5664
221 Ga0075365_10044561 3300006038 Bacteria 2907
222 Ga0075368_10005570 3300006042 Bacteria 4339
223 Ga0075368_10026244 3300006042 Bacteria 2241
224 Ga0075363_100112717 3300006048 Bacteria 1513
225 Ga0075364_10009703 3300006051 Bacteria 5785
226 Ga0075364_10043054 3300006051 Bacteria 2935
227 Ga0075362_10006087 3300006177 Bacteria 4469
228 Ga0075362_10014577 3300006177 Bacteria 3175
229 Ga0075367_10002841 3300006178 Bacteria 8043
230 Ga0075367_10021959 3300006178 Bacteria 3573
231 Ga0075367_10022933 3300006178 Bacteria 3507
232 Ga0075367_10055639 3300006178 Bacteria 2349
233 Ga0075369_10012396 3300006186 Bacteria 3368
234 Ga0075369_10016575 3300006186 Bacteria 2976
235 Ga0075366_10000822 3300006195 Bacteria 14915
236 Ga0075366_10002910 3300006195 Bacteria 8897
237 Ga0075366_10023388 3300006195 Bacteria 3599
238 Ga0075366_10027415 3300006195 Bacteria 3342
239 Ga0075366_10028537 3300006195 Bacteria 3275
240 Ga0075366_10031525 3300006195 Bacteria 3120
241 Ga0075366_10063815 3300006195 Bacteria 2190
242 Ga0075366_10077598 3300006195 Bacteria 1982
243 Ga0075366_10105294 3300006195 Bacteria 1695
244 Ga0075366_10118128 3300006195 Bacteria 1597
245 Ga0097621_100034144 3300006237 Bacteria 4055
246 Ga0075370_10000245 3300006353 Bacteria 19479
247 Ga0075370_10000373 3300006353 Bacteria 16463
248 Ga0075370_10001845 3300006353 Bacteria 9489
249 Ga0075370_10003141 3300006353 Bacteria 7799
250 Ga0075370_10006552 3300006353 Bacteria 5865
251 Ga0075370_10007745 3300006353 Bacteria 5485
252 Ga0075370_10030190 3300006353 Bacteria 3023
253 Ga0075370_10040177 3300006353 Bacteria 2638
254 Ga0075370_10041160 3300006353 Bacteria 2608
255 Ga0075370_10048362 3300006353 Bacteria 2409
256 Ga0075370_10086367 3300006353 Bacteria 1807
257 Ga0075370_10116508 3300006353 Bacteria 1553
258 Ga0068871_100007319 3300006358 Bacteria 7878
259 Ga0068871_100051943 3300006358 Bacteria 3318
260 Ga0068871_100077187 3300006358 Bacteria 2753
261 Ga0075430_100030832 3300006846 Bacteria 4554
262 Ga0075429_100003825 3300006880 Bacteria 12856
263 Ga0075429_100044687 3300006880 Bacteria 3853
264 Ga0068865_100007045 3300006881 Bacteria 6901
265 Ga0068865_100062800 3300006881 Bacteria 2608
266 Ga0068865_100097476 3300006881 Bacteria 2146
267 Ga0097620_100060368 3300006931 Bacteria 3821
268 Ga0097620_100069871 3300006931 Bacteria 3547
269 Ga0097620_100113838 3300006931 Bacteria 2769
270 Ga0097620_100275236 3300006931 Bacteria 1776
271 Ga0099823_1001245 3300006944 Bacteria 20453
272 Ga0079104_1000186 3300006946 Bacteria 87104
273 Ga0105240_10007877 3300009093 Bacteria 15365
274 Ga0105240_10018656 3300009093 Bacteria 9298
275 Ga0105240_10203719 3300009093 Bacteria 2317
276 Ga0105240_10276166 3300009093 Bacteria 1933
277 Ga0105245_10044542 3300009098 Bacteria 3961
278 Ga0105245_10045165 3300009098 Bacteria 3933
279 Ga0105245_10058026 3300009098 Bacteria 3483
280 Ga0105243_10000770 3300009148 Bacteria 30670
281 Ga0105243_10071375 3300009148 Bacteria 2807
282 Ga0105243_10207955 3300009148 Bacteria 1721
283 Ga0105248_10002863 3300009177 Bacteria 19149
284 Ga0105248_10003419 3300009177 Bacteria 17638
285 Ga0105248_10040203 3300009177 Bacteria 5243
286 Ga0105248_10103094 3300009177 Bacteria 3215
287 Ga0105248_10252975 3300009177 Bacteria 1983
288 Ga0105237_10000367 3300009545 Bacteria 63983
289 Ga0105237_10010721 3300009545 Bacteria 9723
290 Ga0105238_10009305 3300009551 Bacteria 9837
291 Ga0105238_10019763 3300009551 Bacteria 6858
292 Ga0105238_10080890 3300009551 Bacteria 3238
293 Ga0105249_10030174 3300009553 Bacteria 4900
294 Ga0105239_10000150 3300010375 Bacteria 100349
295 Ga0105239_10019576 3300010375 Bacteria 7471
296 Ga0157319_1000009 3300012497 Bacteria 227971
297 Ga0157371_10216460 3300013102 Bacteria 1375
298 Ga0157369_10006554 3300013105 Bacteria 13478
299 Ga0157369_10131752 3300013105 Bacteria 2649
300 Ga0157369_10167164 3300013105 Bacteria 2319
301 Ga0157374_10004558 3300013296 Bacteria 11622
302 Ga0157374_10050751 3300013296 Bacteria 3857
303 Ga0157374_10066719 3300013296 Bacteria 3382
304 Ga0157374_10148076 3300013296 Bacteria 2281
305 Ga0157378_10009725 3300013297 Bacteria 8376
306 Ga0157378_10168281 3300013297 Bacteria 2054
307 Ga0163162_10002501 3300013306 Bacteria 17377
308 Ga0163162_10005242 3300013306 Bacteria 12495
309 Ga0163162_10064153 3300013306 Bacteria 3718
310 Ga0163162_10066285 3300013306 Bacteria 3659
311 Ga0163162_10511524 3300013306 Bacteria 1331
312 Ga0157372_10033047 3300013307 Bacteria 5678
313 Ga0157375_10001357 3300013308 Bacteria 21138
314 Ga0157375_10069367 3300013308 Bacteria 3531
315 Ga0157375_10075576 3300013308 Bacteria 3394
316 Ga0157375_10084089 3300013308 Bacteria 3230
317 Ga0157375_10183926 3300013308 Bacteria 2242
318 Ga0157380_10051418 3300014326 Bacteria 3259
319 Ga0157377_10000014 3300014745 Bacteria 213961
320 Ga0157377_10026579 3300014745 Bacteria 3099
321 Ga0157379_10000528 3300014968 Bacteria 30947
322 Ga0157379_10000717 3300014968 Bacteria 26869
323 Ga0157379_10004404 3300014968 Bacteria 12063
324 Ga0157379_10016935 3300014968 Bacteria 6412
325 Ga0157379_10066823 3300014968 Bacteria 3215
326 Ga0157379_10146152 3300014968 Bacteria 2132
327 Ga0157379_10288325 3300014968 Bacteria 1495
328 Ga0157376_10026261 3300014969 Bacteria 4599
329 Ga0157376_10026355 3300014969 Bacteria 4593
330 Ga0157376_10284085 3300014969 Bacteria 1560
331 Ga0182007_10030022 3300015262 Bacteria 1859
332 Ga0163161_10017116 3300017792 Bacteria 5071
333 Ga0163161_10042390 3300017792 Bacteria 3273
334 Ga0163161_10043582 3300017792 Bacteria 3231
335 Ga0163161_10052347 3300017792 Bacteria 2959
336 Ga0213872_10000004 3300021361 Bacteria 306230
337 Ga0213872_10000016 3300021361 Bacteria 180524
338 Ga0213872_10021606 3300021361 Bacteria 2965
339 Ga0209674_100003 3300025226 Bacteria 2196646
340 Ga0209563_100005 3300025230 Bacteria 1774893
341 Ga0209563_100010 3300025230 Bacteria 1337457
342 Ga0207427_101024 3300025231 Bacteria 11685
343 Ga0209258_100060 3300025242 Bacteria 319881
344 Ga0209258_100482 3300025242 Bacteria 41643
345 Ga0207425_1000596 3300025245 Bacteria 20990
346 Ga0209646_1000242 3300025246 Bacteria 56037
347 Ga0209026_1000311 3300025250 Bacteria 52155
348 Ga0209677_100274 3300025253 Bacteria 34497
349 Ga0209677_100396 3300025253 Bacteria 26411
350 Ga0209759_1000373 3300025256 Bacteria 56051
351 Ga0209759_1001241 3300025256 Bacteria 15482
352 Ga0209759_1001792 3300025256 Bacteria 10886
353 Ga0209759_1011322 3300025256 Bacteria 2542
354 Ga0209129_1000148 3300025258 Bacteria 114559
355 Ga0209455_1000093 3300025272 Bacteria 220487
356 Ga0209673_1014079 3300025273 Bacteria 3116
357 Ga0209673_1030300 3300025273 Bacteria 1706
358 Ga0209675_1007295 3300025291 Bacteria 4271
359 Ga0209564_1000003 3300025295 Bacteria 1585848
360 Ga0209564_1000251 3300025295 Bacteria 114511
361 Ga0209758_1000387 3300025297 Bacteria 76099
362 Ga0209758_1000439 3300025297 Bacteria 69980
363 Ga0209050_1001091 3300025298 Bacteria 32964
364 Ga0209050_1003695 3300025298 Bacteria 11025
365 Ga0209050_1008655 3300025298 Bacteria 5377
366 Ga0209256_1000024 3300025299 Bacteria 448909
367 Ga0209256_1003497 3300025299 Bacteria 10949
368 Ga0209256_1029936 3300025299 Bacteria 1509
369 Ga0209051_1000063 3300025303 Bacteria 249739
370 Ga0209051_1000674 3300025303 Bacteria 38231
371 Ga0209051_1007021 3300025303 Bacteria 6237
372 Ga0209051_1009412 3300025303 Bacteria 5041
373 Ga0209051_1013119 3300025303 Bacteria 3962
374 Ga0209257_1000118 3300025304 Bacteria 225963
375 Ga0209257_1000354 3300025304 Bacteria 93718
376 Ga0209257_1001690 3300025304 Bacteria 24813
377 Ga0209257_1005187 3300025304 Bacteria 9375
378 Ga0207697_10026681 3300025315 Bacteria 2362
379 Ga0207656_10033570 3300025321 Bacteria 2139
380 Ga0207682_10007000 3300025893 Bacteria 4520
381 Ga0207682_10019819 3300025893 Bacteria 2636
382 Ga0207642_10009348 3300025899 Bacteria 3406
383 Ga0207680_10024481 3300025903 Bacteria 3314
384 Ga0207645_10005371 3300025907 Bacteria 9312
385 Ga0207645_10006398 3300025907 Bacteria 8458
386 Ga0207645_10011247 3300025907 Bacteria 6121
387 Ga0207645_10012047 3300025907 Bacteria 5879
388 Ga0207643_10054635 3300025908 Bacteria 2270
389 Ga0207705_10041475 3300025909 Bacteria 3302
390 Ga0207705_10070454 3300025909 Bacteria 2534
391 Ga0207705_10101472 3300025909 Bacteria 2117
392 Ga0207705_10106674 3300025909 Bacteria 2066
393 Ga0207705_10109683 3300025909 Bacteria 2038
394 Ga0207684_10031655 3300025910 Bacteria 4499
395 Ga0207695_10022061 3300025913 Bacteria 7244
396 Ga0207695_10080409 3300025913 Bacteria 3300
397 Ga0207695_10214074 3300025913 Bacteria 1836
398 Ga0207671_10000808 3300025914 Bacteria 39539
399 Ga0207671_10051031 3300025914 Bacteria 3064
400 Ga0207660_10127668 3300025917 Bacteria 1932
401 Ga0207657_10025575 3300025919 Bacteria 5440
402 Ga0207657_10034414 3300025919 Bacteria 4556
403 Ga0207657_10069954 3300025919 Bacteria 2976
404 Ga0207657_10155427 3300025919 Bacteria 1860
405 Ga0207649_10002218 3300025920 Bacteria 10971
406 Ga0207649_10208085 3300025920 Unclassified 1386
407 Ga0207681_10003342 3300025923 Bacteria 10045
408 Ga0207681_10004604 3300025923 Bacteria 8484
409 Ga0207681_10040916 3300025923 Bacteria 3087
410 Ga0207681_10060654 3300025923 Bacteria 2597
411 Ga0207681_10268752 3300025923 Bacteria 1338
412 Ga0207694_10011050 3300025924 Bacteria 6820
413 Ga0207694_10018782 3300025924 Bacteria 5226
414 Ga0207694_10025116 3300025924 Bacteria 4527
415 Ga0207650_10000913 3300025925 Bacteria 22271
416 Ga0207650_10002352 3300025925 Bacteria 13138
417 Ga0207650_10055543 3300025925 Bacteria 2939
418 Ga0207650_10056571 3300025925 Bacteria 2915
419 Ga0207650_10095532 3300025925 Bacteria 2278
420 Ga0207650_10102942 3300025925 Bacteria 2201
421 Ga0207650_10124723 3300025925 Bacteria 2009
422 Ga0207659_10000189 3300025926 Bacteria 36771
423 Ga0207659_10023299 3300025926 Bacteria 4130
424 Ga0207659_10052768 3300025926 Bacteria 2898
425 Ga0207659_10060534 3300025926 Bacteria 2726
426 Ga0207659_10061752 3300025926 Bacteria 2702
427 Ga0207687_10163203 3300025927 Bacteria 1712
428 Ga0207687_10188937 3300025927 Bacteria 1602
429 Ga0207687_10266671 3300025927 Bacteria 1367
430 Ga0207644_10011782 3300025931 Bacteria 5790
431 Ga0207644_10011940 3300025931 Bacteria 5759
432 Ga0207644_10021306 3300025931 Bacteria 4414
433 Ga0207644_10062647 3300025931 Bacteria 2698
434 Ga0207644_10102739 3300025931 Bacteria 2150
435 Ga0207644_10128780 3300025931 Bacteria 1935
436 Ga0207644_10188502 3300025931 Bacteria 1620
437 Ga0207690_10005208 3300025932 Bacteria 7669
438 Ga0207690_10025524 3300025932 Bacteria 3712
439 Ga0207690_10051255 3300025932 Bacteria 2759
440 Ga0207706_10005764 3300025933 Bacteria 11526
441 Ga0207706_10202053 3300025933 Bacteria 1743
442 Ga0207706_10242710 3300025933 Bacteria 1575
443 Ga0207709_10008507 3300025935 Bacteria 5677
444 Ga0207709_10070045 3300025935 Bacteria 2222
445 Ga0207709_10214020 3300025935 Bacteria 1385
446 Ga0207670_10171453 3300025936 Bacteria 1627
447 Ga0207669_10001563 3300025937 Bacteria 9764
448 Ga0207669_10019506 3300025937 Bacteria 3533
449 Ga0207669_10042973 3300025937 Bacteria 2643
450 Ga0207704_10017226 3300025938 Bacteria 3738
451 Ga0207704_10037398 3300025938 Bacteria 2804
452 Ga0207691_10002491 3300025940 Bacteria 18008
453 Ga0207691_10031896 3300025940 Bacteria 4917
454 Ga0207691_10041039 3300025940 Bacteria 4275
455 Ga0207691_10066755 3300025940 Bacteria 3254
456 Ga0207691_10095480 3300025940 Bacteria 2659
457 Ga0207691_10106688 3300025940 Bacteria 2494
458 Ga0207691_10109068 3300025940 Bacteria 2463
459 Ga0207691_10136583 3300025940 Bacteria 2162
460 Ga0207711_10016270 3300025941 Bacteria 6177
461 Ga0207711_10021818 3300025941 Bacteria 5349
462 Ga0207711_10025880 3300025941 Bacteria 4921
463 Ga0207711_10041959 3300025941 Bacteria 3897
464 Ga0207711_10077719 3300025941 Bacteria 2894
465 Ga0207711_10108033 3300025941 Bacteria 2471
466 Ga0207689_10003071 3300025942 Bacteria 15384
467 Ga0207689_10005946 3300025942 Bacteria 10800
468 Ga0207689_10021427 3300025942 Bacteria 5433
469 Ga0207689_10070391 3300025942 Bacteria 2874
470 Ga0207689_10122290 3300025942 Bacteria 2141
471 Ga0207679_10001861 3300025945 Bacteria 13115
472 Ga0207679_10006511 3300025945 Bacteria 7384
473 Ga0207679_10024938 3300025945 Bacteria 4106
474 Ga0207679_10190752 3300025945 Bacteria 1704
475 Ga0207667_10026613 3300025949 Bacteria 6314
476 Ga0207667_10043775 3300025949 Bacteria 4749
477 Ga0207667_10313796 3300025949 Bacteria 1601
478 Ga0207651_10028921 3300025960 Bacteria 3504
479 Ga0207651_10113617 3300025960 Bacteria 2038
480 Ga0207651_10150055 3300025960 Bacteria 1813
481 Ga0207651_10165821 3300025960 Bacteria 1737
482 Ga0207651_10234102 3300025960 Bacteria 1493
483 Ga0207668_10019001 3300025972 Bacteria 4334
484 Ga0207668_10022822 3300025972 Bacteria 4011
485 Ga0207668_10028021 3300025972 Bacteria 3677
486 Ga0207668_10164836 3300025972 Bacteria 1731
487 Ga0207658_10002880 3300025986 Bacteria 12329
488 Ga0207658_10011427 3300025986 Bacteria 6043
489 Ga0207658_10103090 3300025986 Bacteria 2239
490 Ga0207658_10224549 3300025986 Bacteria 1582
491 Ga0207677_10006940 3300026023 Bacteria 6229
492 Ga0207677_10007467 3300026023 Bacteria 6052
493 Ga0207677_10107360 3300026023 Bacteria 2070
494 Ga0207703_10001371 3300026035 Bacteria 22250
495 Ga0207703_10003102 3300026035 Bacteria 14039
496 Ga0207703_10075044 3300026035 Bacteria 2801
497 Ga0207703_10337194 3300026035 Bacteria 1385
498 Ga0207639_10083633 3300026041 Bacteria 2533
499 Ga0207639_10093223 3300026041 Bacteria 2415
500 Ga0207639_10093396 3300026041 Bacteria 2413
501 Ga0207639_10132862 3300026041 Bacteria 2063
502 Ga0207678_10002552 3300026067 Bacteria 16593
503 Ga0207678_10028588 3300026067 Bacteria 4866
504 Ga0207678_10175820 3300026067 Bacteria 1828
505 Ga0207708_10113340 3300026075 Bacteria 2107
506 Ga0207702_10001598 3300026078 Bacteria 22413
507 Ga0207702_10007455 3300026078 Bacteria 9334
508 Ga0207641_10001848 3300026088 Bacteria 20315
509 Ga0207641_10003303 3300026088 Bacteria 14346
510 Ga0207641_10061733 3300026088 Bacteria 3197
511 Ga0207641_10198703 3300026088 Bacteria 1847
512 Ga0207648_10000142 3300026089 Bacteria 71593
513 Ga0207648_10001050 3300026089 Bacteria 30933
514 Ga0207648_10001133 3300026089 Bacteria 29959
515 Ga0207648_10008497 3300026089 Bacteria 9937
516 Ga0207648_10024671 3300026089 Bacteria 5363
517 Ga0207648_10045451 3300026089 Bacteria 3851
518 Ga0207648_10116109 3300026089 Bacteria 2352
519 Ga0207648_10147811 3300026089 Bacteria 2073
520 Ga0207648_10169411 3300026089 Bacteria 1930
521 Ga0207676_10005300 3300026095 Bacteria 9134
522 Ga0207676_10011402 3300026095 Bacteria 6352
523 Ga0207676_10105908 3300026095 Bacteria 2342
524 Ga0207676_10132508 3300026095 Bacteria 2121
525 Ga0207674_10014389 3300026116 Bacteria 8740
526 Ga0207674_10038360 3300026116 Bacteria 4973
527 Ga0207674_10073745 3300026116 Bacteria 3426
528 Ga0207674_10164584 3300026116 Bacteria 2172
529 Ga0207674_10206732 3300026116 Bacteria 1912
530 Ga0207675_100006272 3300026118 Bacteria 11285
531 Ga0207675_100009210 3300026118 Bacteria 9259
532 Ga0207675_100029352 3300026118 Bacteria 5125
533 Ga0207675_100107068 3300026118 Bacteria 2636
534 Ga0207675_100136627 3300026118 Bacteria 2327
535 Ga0207683_10008770 3300026121 Bacteria 8635
536 Ga0207683_10009813 3300026121 Bacteria 8166
537 Ga0207683_10054604 3300026121 Bacteria 3503
538 Ga0207683_10073314 3300026121 Bacteria 3028
539 Ga0207683_10087122 3300026121 Bacteria 2777
540 Ga0207683_10172117 3300026121 Bacteria 1961
541 Ga0207683_10352355 3300026121 Bacteria 1351
542 Ga0207698_10002851 3300026142 Bacteria 10340
543 Ga0207698_10005667 3300026142 Bacteria 7734
544 Ga0207698_10007500 3300026142 Bacteria 6837
545 Ga0207698_10061866 3300026142 Bacteria 2920
546 Ga0207698_10089223 3300026142 Bacteria 2517
547 Ga0207698_10208000 3300026142 Bacteria 1758
548 Ga0207698_10234734 3300026142 Bacteria 1667
549 Ga0209281_1000442 3300027111 Bacteria 59796
550 Ga0209389_1027328 3300027296 Bacteria 4924
551 Ga0209966_1000004 3300027695 Bacteria 108133
552 Ga0209974_10002124 3300027876 Bacteria 7251
553 Ga0268266_10020171 3300028379 Bacteria 5681
554 Ga0268266_10088313 3300028379 Bacteria 2713
555 Ga0268265_10008626 3300028380 Bacteria 6889
556 Ga0268265_10036142 3300028380 Bacteria 3616
557 Ga0268265_10047867 3300028380 Bacteria 3206
558 Ga0268265_10096698 3300028380 Bacteria 2374
559 Ga0268264_10007839 3300028381 Bacteria 8888
560 Ga0268264_10119005 3300028381 Bacteria 2325
561 Ga0265336_10000062 3300028666 Bacteria 101023
562 Ga0307517_10013803 3300028786 Bacteria 10936
563 Ga0307515_10000022 3300028794 Bacteria 404064
564 Ga0307515_10000191 3300028794 Bacteria 149201
565 Ga0307515_10003517 3300028794 Bacteria 32929
566 Ga0307515_10003519 3300028794 Bacteria 32915
567 Ga0307515_10021930 3300028794 Bacteria 11292
568 Ga0307515_10036215 3300028794 Bacteria 7992
569 Ga0307515_10063975 3300028794 Bacteria 5152
570 Ga0307515_10082008 3300028794 Bacteria 4179
571 Ga0307515_10135477 3300028794 Bacteria 2681
572 Ga0307515_10150616 3300028794 Bacteria 2434
573 Ga0307515_10187724 3300028794 Bacteria 1989
574 Ga0265324_10015589 3300029957 Bacteria 2791
575 Ga0307511_10068954 3300030521 Bacteria 2606
576 Ga0307512_10056761 3300030522 Bacteria 3070
577 Ga0307512_10141375 3300030522 Bacteria 1472
578 Ga0265330_10000032 3300031235 Bacteria 130592
579 Ga0265332_10000001 3300031238 Bacteria 863783
580 Ga0265328_10015973 3300031239 Bacteria 2930
581 Ga0265327_10000043 3300031251 Bacteria 285108
582 Ga0265316_10000151 3300031344 Bacteria 76436
583 Ga0307513_10011299 3300031456 Bacteria 11111
584 Ga0307513_10015357 3300031456 Bacteria 9285
585 Ga0307513_10023996 3300031456 Bacteria 7106
586 Ga0307513_10058698 3300031456 Bacteria 4087
587 Ga0307509_10000215 3300031507 Bacteria 92190
588 Ga0307509_10098502 3300031507 Bacteria 2968
589 Ga0307509_10118652 3300031507 Bacteria 2628
590 Ga0307509_10177294 3300031507 Bacteria 2002
591 Ga0307408_100000008 3300031548 Bacteria 456355
592 Ga0307408_100000513 3300031548 Bacteria 33428
593 Ga0307408_100188771 3300031548 Bacteria 1659
594 Ga0307508_10000017 3300031616 Bacteria 203567
595 Ga0307508_10000094 3300031616 Bacteria 104107
596 Ga0307508_10034900 3300031616 Bacteria 4532
597 Ga0307508_10067005 3300031616 Bacteria 3159
598 Ga0307508_10185848 3300031616 Bacteria 1680
599 Ga0307514_10002966 3300031649 Bacteria 16819
600 Ga0307514_10004466 3300031649 Bacteria 12861
601 Ga0265314_10000022 3300031711 Bacteria 297299
602 Ga0307516_10000254 3300031730 Bacteria 68771
603 Ga0307516_10001811 3300031730 Bacteria 29376
604 Ga0307516_10002501 3300031730 Bacteria 24512
605 Ga0307516_10006776 3300031730 Bacteria 13382
606 Ga0307516_10035350 3300031730 Bacteria 5014
607 Ga0307516_10132006 3300031730 Bacteria 2276
608 Ga0307516_10160601 3300031730 Bacteria 1998
609 Ga0307516_10175088 3300031730 Bacteria 1883
610 Ga0307406_10000279 3300031901 Bacteria 30071
611 Ga0307409_100001509 3300031995 Bacteria 11510
612 Ga0307409_100060955 3300031995 Bacteria 2945
613 Ga0307416_100031303 3300032002 Bacteria 4003
614 Ga0307416_100073842 3300032002 Bacteria 2846
615 Ga0307411_10030308 3300032005 Bacteria 3314
616 Ga0307411_10032183 3300032005 Bacteria 3237
617 Ga0307411_10038304 3300032005 Bacteria 3023
618 Ga0307411_10048742 3300032005 Bacteria 2748
619 Ga0307415_100004973 3300032126 Bacteria 6994
620 Ga0307507_10093838 3300033179 Bacteria 2554
621 Ga0307507_10098962 3300033179 Bacteria 2452
622 Ga0307510_10007507 3300033180 Bacteria 12984
623 Ga0307510_10027415 3300033180 Bacteria 6526
624 Ga0307510_10057953 3300033180 Bacteria 4014
625 Ga0373939_0000164 3300035114 Bacteria 18449
626 Ga0373960_0002111 3300035121 Bacteria 4477
627 Ga0373931_0002571 3300035691 Bacteria 8081
628 Ga0373931_0044183 3300035691 Bacteria 2349
629 Ga0373935_0155852 3300035692 Bacteria 1553
630 Ga0373927_0029351 3300035695 Bacteria 3584
631 Ga0373927_0091127 3300035695 Bacteria 1980
632 Ga0373937_0138413 3300036401 Bacteria 2277
633 Ga0373925_0004683 3300037068 Bacteria 10322
634 Ga0373925_0035343 3300037068 Bacteria 3686
635 Ga0373925_0169558 3300037068 Bacteria 1723
636 Ga0395899_0002565 3300037312 Bacteria 14691
637 Ga0395899_0028348 3300037312 Bacteria 4218
638 Ga0395900_0000188 3300037418 Bacteria 99195
639 Ga0395900_0005484 3300037418 Bacteria 13283
640 Ga0395900_0249015 3300037418 Bacteria 1779
641 Ga0395898_0006418 3300037466 Bacteria 12559
642 Ga0395898_0017271 3300037466 Bacteria 7370
643 Ga0395898_0028321 3300037466 Bacteria 5615
644 Ga0395898_0110946 3300037466 Bacteria 2629
645 Ga0395905_0000106 3300037471 Bacteria 140180
646 Ga0395905_0001392 3300037471 Bacteria 29351
647 Ga0395905_0002852 3300037471 Bacteria 18906
648 Ga0395905_0002964 3300037471 Bacteria 18450
649 Ga0395905_0004837 3300037471 Bacteria 13888
650 Ga0395905_0010220 3300037471 Bacteria 9146
651 Ga0395905_0020704 3300037471 Bacteria 6228
652 Ga0395905_0020789 3300037471 Bacteria 6215
653 Ga0395905_0060299 3300037471 Bacteria 3547
654 Ga0395905_0139665 3300037471 Bacteria 2279
655 Ga0395905_0213324 3300037471 Bacteria 1808
656 Ga0395905_0243284 3300037471 Bacteria 1681
657 Ga0395901_0006203 3300038443 Bacteria 12113
658 Ga0395901_0035718 3300038443 Bacteria 5135
659 Ga0395901_0092099 3300038443 Bacteria 3173
660 Ga0395901_0092493 3300038443 Bacteria 3166
661 Ga0395901_0189875 3300038443 Bacteria 2154
662 Ga0436361_0141959 3300039447 Bacteria 3063
663 Ga0436361_0376061 3300039447 Bacteria 200571
664 Ga0436361_0399628 3300039447 Bacteria 3018
665 Ga0436361_0583521 3300039447 Bacteria 71514
666 Ga0451791_1242034 3300041451 Bacteria 1203
667 Ga0451800_1626932 3300041459 Bacteria 1587
668 Ga0439431_0009009 3300041997 Bacteria 2249
669 Ga0439437_001198 3300042000 Bacteria 2718
670 Ga0450919_000269 3300042121 Bacteria 6030
671 Ga0450920_007520 3300042122 Bacteria 1976
672 Ga0450923_001458 3300042125 Bacteria 3139
673 Ga0450891_000891 3300042129 Bacteria 3126
674 Ga0450889_000608 3300042144 Bacteria 3976
675 Ga0439459_0000228 3300042438 Bacteria 6442
676 Ga0439464_0000764 3300042439 Bacteria 6994
677 Ga0439464_0003749 3300042439 Bacteria 3859
678 Ga0450918_000945 3300042531 Bacteria 6076
679 Ga0450893_0005693 3300042532 Bacteria 2007
680 Ga0451577_0001353 3300042876 Bacteria 33109
681 Ga0466969_0000002 3300044656 Bacteria 178693
682 Ga0466969_0007330 3300044656 Bacteria 5863
683 Ga0466969_0009526 3300044656 Bacteria 5147
684 Ga0466969_0037283 3300044656 Bacteria 2452
685 Ga0466965_0002506 3300044683 Bacteria 7817
686 Ga0466965_0014746 3300044683 Bacteria 3701
687 Ga0466965_0064093 3300044683 Bacteria 1839
688 Ga0466965_0081038 3300044683 Bacteria 1641
689 Ga0466966_0001339 3300044684 Bacteria 15826
690 Ga0466966_0007833 3300044684 Bacteria 7070
691 Ga0466966_0015276 3300044684 Bacteria 5077
692 Ga0466966_0020128 3300044684 Bacteria 4391
693 Ga0466961_0008620 3300044693 Bacteria 6498
694 Ga0466961_0026940 3300044693 Bacteria 3696
695 Ga0466961_0090320 3300044693 Bacteria 1934
696 Ga0466963_0074855 3300044694 Bacteria 2284
697 Ga0466963_0144363 3300044694 Bacteria 1650
698 Ga0466964_0002006 3300044706 Bacteria 7158
699 Ga0453684_0006474 3300044712 Bacteria 22221
700 Ga0453684_0083182 3300044712 Bacteria 3984
701 Ga0466971_0001980 3300044719 Bacteria 8667
702 Ga0466968_0017259 3300044735 Bacteria 2883
703 Ga0466970_0044954 3300044765 Bacteria 2351
704 Ga0466970_0140502 3300044765 Bacteria 1330
705 Ga0466959_0001562 3300045049 Bacteria 14096
706 Ga0466959_0004663 3300045049 Bacteria 9223
707 Ga0466959_0008282 3300045049 Bacteria 7343
708 Ga0451576_0079493 3300045051 Bacteria 3412
709 Ga0451576_0087359 3300045051 Bacteria 3243
710 Ga0451576_0271512 3300045051 Bacteria 1773
711 Ga0451576_0334921 3300045051 Bacteria 1584
712 Ga0466967_0026883 3300045976 Bacteria 4776
713 Ga0466967_0339891 3300045976 Bacteria 1451
714 Ga0495592_0001770 3300046454 Bacteria 15193
715 Ga0495638_0042795 3300046460 Bacteria 2860
716 Ga0495650_0008824 3300046471 Bacteria 5825
717 Ga0495650_0021298 3300046471 Bacteria 3138
718 Ga0495580_0033530 3300046472 Bacteria 3699
719 Ga0495639_0046092 3300046475 Bacteria 1973
720 Ga0495585_0005980 3300046492 Bacteria 7613
721 Ga0495583_0000153 3300046506 Bacteria 115755
722 Ga0495606_0002667 3300046507 Bacteria 20265
723 Ga0495606_0029123 3300046507 Bacteria 3882
724 Ga0495610_0026708 3300046512 Bacteria 3079
725 Ga0495610_0073678 3300046512 Bacteria 1586
726 Ga0495620_0022622 3300046515 Bacteria 3024
727 Ga0495632_0022786 3300046519 Bacteria 3352
728 Ga0495632_0072153 3300046519 Bacteria 1657
729 Ga0495643_0020062 3300046522 Bacteria 3861
730 Ga0495654_0000550 3300046530 Bacteria 30238
731 Ga0495586_0022236 3300046535 Bacteria 3383
732 Ga0495598_0035208 3300046537 Bacteria 1432
733 Ga0495597_0010147 3300046542 Bacteria 4614
734 Ga0495625_0005772 3300046660 Bacteria 11192
735 Ga0495625_0013423 3300046660 Bacteria 6584
736 Ga0495625_0043089 3300046660 Bacteria 3275
737 Ga0495658_0010441 3300046683 Bacteria 4646
738 Ga0495658_0088988 3300046683 Bacteria 1826
739 Ga0495658_0115747 3300046683 Bacteria 1616
740 Ga0495658_0168679 3300046683 Bacteria 1353
741 Ga0495649_0002833 3300046694 Bacteria 12031
742 Ga0495649_0013059 3300046694 Bacteria 4803
743 Ga0495660_0031092 3300046810 Bacteria 3004
744 Ga0495660_0038817 3300046810 Bacteria 2646
745 Ga0495676_0056004 3300047321 Bacteria 3121
746 Ga0495687_002210 3300047443 Bacteria 16075
747 Ga0495684_0177860 3300047471 Bacteria 1579
748 Ga0495686_0060940 3300047472 Bacteria 2345
749 Ga0495626_0078352 3300048091 Bacteria 1472
750 Ga0496102_0020879 3300048905 Bacteria 5789
751 Ga0496102_0026281 3300048905 Bacteria 5190
752 Ga0496102_0046041 3300048905 Bacteria 3961
753 Ga0496104_0008841 3300048907 Bacteria 8953
754 Ga0496105_0107002 3300048908 Bacteria 2309
755 Ga0496106_0089601 3300048909 Bacteria 2372
756 Ga0496108_0073683 3300048911 Bacteria 2882
757 Ga0496108_0118426 3300048911 Bacteria 2270
758 Ga0496108_0143944 3300048911 Bacteria 2054
759 Ga0496108_0229757 3300048911 Bacteria 1613
760 Ga0496109_0013396 3300048912 Bacteria 7111
761 Ga0496109_0125200 3300048912 Bacteria 2396
762 Ga0496109_0243456 3300048912 Bacteria 1693
763 Ga0496110_0073096 3300048913 Bacteria 3043
764 Ga0496111_0076891 3300048914 Bacteria 2433
765 Ga0496113_0032000 3300048916 Bacteria 3821
766 Ga0496113_0099656 3300048916 Bacteria 2250
767 Ga0496114_0003382 3300048917 Bacteria 12248
768 Ga0496114_0073018 3300048917 Bacteria 2887
769 Ga0496114_0122684 3300048917 Bacteria 2236
770 Ga0496114_0136188 3300048917 Bacteria 2124
771 Ga0496115_0057989 3300048918 Bacteria 3115
772 Ga0496121_0022752 3300048924 Bacteria 6064
773 Ga0496124_0000151 3300048927 Bacteria 142761
774 Ga0496124_0008805 3300048927 Bacteria 10481
775 Ga0496125_0005971 3300048928 Bacteria 13330
776 Ga0501309_000516 3300049129 Bacteria 3173
777 Ga0501310_000594 3300049130 Bacteria 3185
778 Ga0501305_003384 3300049161 Bacteria 1802
779 Ga0501312_000367 3300049528 Bacteria 3459
780 Ga0501314_000187 3300049530 Bacteria 3350
781 Ga0501322_000294 3300049538 Bacteria 2207
782 Ga0501034_0140259 3300049571 Bacteria 2397
783 Ga0501043_0000141 3300049579 Bacteria 67326
784 Ga0501046_0000047 3300049580 Bacteria 140344
785 Ga0501047_0000058 3300049581 Bacteria 139202
786 Ga0501048_0015863 3300049582 Bacteria 5559
787 Ga0501198_000002 3300049649 Bacteria 197356
788 Ga0501222_000002 3300049662 Bacteria 169093
789 Ga0501262_001512 3300049759 Bacteria 2609
790 Ga0501267_000119 3300049764 Bacteria 5089
791 Ga0501035_0107232 3300049822 Bacteria 2449
792 nmdc:mga03683_10537_c1 3300050489 Bacteria 3317
793 nmdc:mga03683_8491_c1 3300050489 Bacteria 3615
794 nmdc:mga03n38_39797_c1 3300050490 Bacteria 2040
795 nmdc:mga00v17_12324_c1 3300050491 Bacteria 4716
796 nmdc:mga0k408_11200_c1 3300050493 Bacteria 4877
797 nmdc:mga0k408_1236_c1 3300050493 Bacteria 13975
798 nmdc:mga0k408_140890_c1 3300050493 Bacteria 1435
799 nmdc:mga0k408_1461_c1 3300050493 Bacteria 12750
800 nmdc:mga0k408_23800_c1 3300050493 Bacteria 3459
801 nmdc:mga0k408_40389_c1 3300050493 Bacteria 2685
802 nmdc:mga0k408_41303_c1 3300050493 Bacteria 2655
803 nmdc:mga0k408_64737_c1 3300050493 Bacteria 2128
804 nmdc:mga0k408_7522_c1 3300050493 Bacteria 5818
805 nmdc:mga0k408_777_c1 3300050493 Bacteria 17540
806 nmdc:mga06z11_33118_c1 3300050494 Bacteria 2525
807 nmdc:mga06z11_3424_c1 3300050494 Bacteria 6130
808 nmdc:mga07m45_10379_c1 3300050496 Bacteria 4864
809 nmdc:mga07m45_1634_c1 3300050496 Bacteria 10321
810 nmdc:mga07m45_182_c1 3300050496 Bacteria 25233
811 nmdc:mga07m45_34095_c1 3300050496 Bacteria 2828
812 nmdc:mga07m45_43473_c1 3300050496 Bacteria 2519
813 nmdc:mga07m45_44545_c1 3300050496 Bacteria 2491
814 nmdc:mga07m45_4520_c1 3300050496 Bacteria 6814
815 nmdc:mga07m45_58545_c1 3300050496 Bacteria 2180
816 nmdc:mga07m45_61002_c1 3300050496 Bacteria 2136
817 nmdc:mga07m45_843_c1 3300050496 Bacteria 13299
818 nmdc:mga09592_3371_c1 3300050508 Bacteria 12912
819 nmdc:mga0sz30_31849_c1 3300050516 Bacteria 2184
820 Ga0495601_0030415 3300053077 Bacteria 3353
821 Ga0500635_0000033 3300053080 Bacteria 97175
822 Ga0500635_0061116 3300053080 Bacteria 1315
823 Ga0500578_0000002 3300053086 Bacteria 293507
824 Ga0500578_0043483 3300053086 Bacteria 2884
825 Ga0500644_0034098 3300053088 Bacteria 1640
826 Ga0500646_0004313 3300053090 Bacteria 3604
827 Ga0500646_0023026 3300053090 Bacteria 1669
828 Ga0500583_0011260 3300053092 Bacteria 3362
829 Ga0500583_0058658 3300053092 Bacteria 1811
830 Ga0500651_0009619 3300053093 Bacteria 5757
831 Ga0500593_001202 3300053117 Bacteria 9351
832 Ga0500594_0000251 3300053118 Bacteria 12824
833 Ga0500607_034061 3300053121 Bacteria 2790
834 Ga0500623_057724 3300053127 Bacteria 1929
835 Ga0500652_000102 3300053131 Bacteria 33562
836 Ga0500658_0009139 3300053134 Bacteria 3657
837 Ga0500559_0000392 3300053136 Bacteria 31988
838 Ga0500559_0010715 3300053136 Bacteria 3930
839 Ga0500568_0003681 3300053139 Bacteria 8423
840 Ga0500568_0006565 3300053139 Bacteria 5822
841 Ga0500577_0004869 3300053142 Bacteria 3574
842 Ga0500604_0025337 3300053151 Bacteria 1705
843 Ga0500619_000015 3300053154 Bacteria 54620
844 Ga0500622_0002031 3300053156 Bacteria 15103
845 Ga0500622_0007029 3300053156 Bacteria 6438
846 Ga0500634_0044624 3300053161 Bacteria 2400
847 Ga0500636_0044649 3300053177 Bacteria 2613
848 Ga0500645_006937 3300053730 Bacteria 3994
849 Ga0500587_002000 3300053739 Bacteria 2909
850 Ga0590071_000456 3300059421 Bacteria 11882
851 Ga0466962_0004675 3300061719 Bacteria 6574

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100102950 Ga0070679_1001029502 275
2 3300009093 Ga0105240_10007877 Ga0105240_100078777 275
3 3300009551 Ga0105238_10080890 Ga0105238_100808902 275
4 3300025949 Ga0207667_10043775 Ga0207667_100437754 275
5 3300005353 Ga0070669_100047550 Ga0070669_1000475502 288
6 3300005354 Ga0070675_100090433 Ga0070675_1000904332 288
7 3300005364 Ga0070673_100056823 Ga0070673_1000568233 288
8 3300025923 Ga0207681_10040916 Ga0207681_100409162 288
9 3300025926 Ga0207659_10060534 Ga0207659_100605342 288
10 3300025940 Ga0207691_10066755 Ga0207691_100667551 288
11 3300025960 Ga0207651_10165821 Ga0207651_101658212 288
12 3300013102 Ga0157371_10216460 Ga0157371_102164602 290
13 3300026142 Ga0207698_10089223 Ga0207698_100892232 295
14 3300025925 Ga0207650_10102942 Ga0207650_101029422 300
15 3300005327 Ga0070658_10157061 Ga0070658_101570611 302
16 3300005329 Ga0070683_100024422 Ga0070683_1000244224 302
17 3300005339 Ga0070660_100038551 Ga0070660_1000385513 302
18 3300005344 Ga0070661_100007118 Ga0070661_1000071185 302
19 3300005366 Ga0070659_100004438 Ga0070659_1000044389 302
20 3300005564 Ga0070664_100014573 Ga0070664_1000145735 302
21 3300005577 Ga0068857_100113306 Ga0068857_1001133062 302
22 3300005578 Ga0068854_100001430 Ga0068854_1000014306 302
23 3300005614 Ga0068856_100008607 Ga0068856_1000086074 302
24 3300005834 Ga0068851_10002903 Ga0068851_100029037 302
25 3300006042 Ga0075368_10026244 Ga0075368_100262442 302
26 3300009093 Ga0105240_10203719 Ga0105240_102037192 302
27 3300009551 Ga0105238_10019763 Ga0105238_100197635 302
28 3300013307 Ga0157372_10033047 Ga0157372_100330473 302
29 3300025909 Ga0207705_10070454 Ga0207705_100704543 302
30 3300025913 Ga0207695_10214074 Ga0207695_102140741 302
31 3300025919 Ga0207657_10025575 Ga0207657_100255754 302
32 3300025924 Ga0207694_10025116 Ga0207694_100251162 302
33 3300025932 Ga0207690_10005208 Ga0207690_100052087 302
34 3300026041 Ga0207639_10093223 Ga0207639_100932232 302
35 3300026078 Ga0207702_10007455 Ga0207702_100074554 302
36 3300026116 Ga0207674_10164584 Ga0207674_101645842 302
37 3300026142 Ga0207698_10002851 Ga0207698_100028515 302
38 3300005329 Ga0070683_100045692 Ga0070683_1000456922 304
39 3300005564 Ga0070664_100088741 Ga0070664_1000887413 304
40 3300050496 nmdc:mga07m45_58545_c1 nmdc:mga07m45_58545_c1_108_1076 305
41 3300005364 Ga0070673_100089865 Ga0070673_1000898653 307
42 3300005616 Ga0068852_100111780 Ga0068852_1001117803 307
43 3300006051 Ga0075364_10009703 Ga0075364_100097032 307
44 3300006178 Ga0075367_10022933 Ga0075367_100229332 307
45 3300006353 Ga0075370_10040177 Ga0075370_100401772 307
46 3300009545 Ga0105237_10010721 Ga0105237_100107219 307
47 3300010375 Ga0105239_10019576 Ga0105239_100195767 307
48 3300025914 Ga0207671_10051031 Ga0207671_100510312 307
49 3300025942 Ga0207689_10122290 Ga0207689_101222902 307
50 3300031239 Ga0265328_10015973 Ga0265328_100159732 307
51 3300031251 Ga0265327_10000043 Ga0265327_1000004373 307
52 3300050491 nmdc:mga00v17_12324_c1 nmdc:mga00v17_12324_c1_1790_2950 307
53 3300050493 nmdc:mga0k408_40389_c1 nmdc:mga0k408_40389_c1_805_1965 307
54 3300050494 nmdc:mga06z11_3424_c1 nmdc:mga06z11_3424_c1_2042_3202 307
55 3300050496 nmdc:mga07m45_10379_c1 nmdc:mga07m45_10379_c1_1607_2767 307
56 3300050516 nmdc:mga0sz30_31849_c1 nmdc:mga0sz30_31849_c1_726_1886 307
57 3300006038 Ga0075365_10044561 Ga0075365_100445613 308
58 3300006178 Ga0075367_10055639 Ga0075367_100556393 308
59 3300006186 Ga0075369_10012396 Ga0075369_100123963 308
60 3300006353 Ga0075370_10007745 Ga0075370_100077453 308
61 3300026116 Ga0207674_10038360 Ga0207674_100383605 308
62 3300031730 Ga0307516_10160601 Ga0307516_101606012 308
63 3300044765 Ga0466970_0140502 Ga0466970_0140502_324_1301 308
64 3300046460 Ga0495638_0042795 Ga0495638_0042795_1417_2535 308
65 3300046515 Ga0495620_0022622 Ga0495620_0022622_919_2037 308
66 3300050489 nmdc:mga03683_10537_c1 nmdc:mga03683_10537_c1_1911_3029 308
67 3300050496 nmdc:mga07m45_4520_c1 nmdc:mga07m45_4520_c1_4999_6117 308
68 3300053088 Ga0500644_0034098 Ga0500644_0034098_476_1594 308
69 3300053092 Ga0500583_0058658 Ga0500583_0058658_332_1450 308
70 3300053093 Ga0500651_0009619 Ga0500651_0009619_750_1868 308
71 3300053127 Ga0500623_057724 Ga0500623_057724_544_1662 308
72 3300053131 Ga0500652_000102 Ga0500652_000102_16069_17187 308
73 3300053142 Ga0500577_0004869 Ga0500577_0004869_1167_2285 308
74 3300053151 Ga0500604_0025337 Ga0500604_0025337_348_1466 308
75 3300053156 Ga0500622_0007029 Ga0500622_0007029_4600_5718 308
76 3300046472 Ga0495580_0033530 Ga0495580_0033530_2349_3509 309
77 3300031616 Ga0307508_10067005 Ga0307508_100670054 310
78 3300046537 Ga0495598_0035208 Ga0495598_0035208_83_1186 310
79 3300005356 Ga0070674_100075626 Ga0070674_1000756262 313
80 3300046519 Ga0495632_0022786 Ga0495632_0022786_660_1778 313
81 3300053090 Ga0500646_0004313 Ga0500646_0004313_103_1221 313
82 3300053139 Ga0500568_0003681 Ga0500568_0003681_5283_6401 313
83 3300006195 Ga0075366_10028537 Ga0075366_100285373 315
84 3300048911 Ga0496108_0118426 Ga0496108_0118426_79_1230 315
85 3300048912 Ga0496109_0125200 Ga0496109_0125200_518_1669 315
86 3300050493 nmdc:mga0k408_23800_c1 nmdc:mga0k408_23800_c1_136_1248 315
87 3300005331 Ga0070670_100156408 Ga0070670_1001564082 316
88 3300031730 Ga0307516_10000254 Ga0307516_1000025412 316
89 3300003322 rootL2_10259464 rootL2_102594642 317
90 3300005843 Ga0068860_100132386 Ga0068860_1001323862 318
91 3300041451 Ga0451791_1242034 Ga0451791_1242034_15_1022 318
92 3300045976 Ga0466967_0339891 Ga0466967_0339891_32_1039 318
93 3300053086 Ga0500578_0000002 Ga0500578_0000002_121685_122803 318
94 3300013297 Ga0157378_10168281 Ga0157378_101682812 319
95 3300053154 Ga0500619_000015 Ga0500619_000015_34800_35945 320
96 3300005262 Ga0065165_1003031 Ga0065165_10030316 322
97 3300025299 Ga0209256_1029936 Ga0209256_10299362 322
98 3300002773 JGI25152J39213_1002264 JGI25152J39213_10022645 323
99 3300003215 JGI25153J46596_10012943 JGI25153J46596_100129431 323
100 3300003323 rootH1_10011477 rootH1_100114772 323
101 3300003771 Ga0055526_1010561 Ga0055526_10105614 323
102 3300025245 Ga0207425_1000596 Ga0207425_100059611 323
103 3300025258 Ga0209129_1000148 Ga0209129_100014854 323
104 3300025295 Ga0209564_1000251 Ga0209564_100025161 323
105 3300025297 Ga0209758_1000387 Ga0209758_100038761 323
106 3300025298 Ga0209050_1001091 Ga0209050_10010915 323
107 3300025303 Ga0209051_1013119 Ga0209051_10131193 323
108 3300005331 Ga0070670_100099798 Ga0070670_1000997982 324
109 3300005354 Ga0070675_100050429 Ga0070675_1000504292 324
110 3300025925 Ga0207650_10055543 Ga0207650_100555432 324
111 3300025926 Ga0207659_10023299 Ga0207659_100232992 324
112 3300028379 Ga0268266_10088313 Ga0268266_100883132 324
113 3300031649 Ga0307514_10002966 Ga0307514_1000296614 324
114 3300005367 Ga0070667_100033625 Ga0070667_1000336254 325
115 3300005539 Ga0068853_100124447 Ga0068853_1001244472 325
116 3300005543 Ga0070672_100155527 Ga0070672_1001555272 325
117 3300005842 Ga0068858_100002875 Ga0068858_1000028758 325
118 3300005843 Ga0068860_100006018 Ga0068860_1000060187 325
119 3300013308 Ga0157375_10183926 Ga0157375_101839263 325
120 3300014326 Ga0157380_10051418 Ga0157380_100514182 325
121 3300014968 Ga0157379_10000528 Ga0157379_1000052817 325
122 3300014968 Ga0157379_10146152 Ga0157379_101461522 325
123 3300025986 Ga0207658_10103090 Ga0207658_101030902 325
124 3300026035 Ga0207703_10075044 Ga0207703_100750443 325
125 3300026041 Ga0207639_10132862 Ga0207639_101328622 325
126 3300028381 Ga0268264_10119005 Ga0268264_101190052 325
127 3300005543 Ga0070672_100082281 Ga0070672_1000822812 326
128 3300025940 Ga0207691_10106688 Ga0207691_101066882 326
129 3300025941 Ga0207711_10041959 Ga0207711_100419593 326
130 3300005578 Ga0068854_100055949 Ga0068854_1000559492 327
131 3300005719 Ga0068861_100161480 Ga0068861_1001614801 327
132 3300005844 Ga0068862_100048239 Ga0068862_1000482392 327
133 3300028380 Ga0268265_10008626 Ga0268265_100086263 327
134 3300044712 Ga0453684_0006474 Ga0453684_0006474_9640_10752 328
135 3300003215 JGI25153J46596_10009871 JGI25153J46596_100098712 329
136 3300005327 Ga0070658_10100106 Ga0070658_101001062 329
137 3300005355 Ga0070671_100229158 Ga0070671_1002291582 329
138 3300005364 Ga0070673_100153751 Ga0070673_1001537512 329
139 3300005459 Ga0068867_100057584 Ga0068867_1000575843 329
140 3300005617 Ga0068859_100275256 Ga0068859_1002752562 329
141 3300006931 Ga0097620_100275236 Ga0097620_1002752362 329
142 3300025297 Ga0209758_1000439 Ga0209758_10004392 329
143 3300025315 Ga0207697_10026681 Ga0207697_100266812 329
144 3300025893 Ga0207682_10019819 Ga0207682_100198192 329
145 3300025960 Ga0207651_10150055 Ga0207651_101500552 329
146 3300026075 Ga0207708_10113340 Ga0207708_101133402 329
147 3300028786 Ga0307517_10013803 Ga0307517_100138038 329
148 3300047471 Ga0495684_0177860 Ga0495684_0177860_146_1312 329
149 3300025925 Ga0207650_10124723 Ga0207650_101247232 330
150 3300025960 Ga0207651_10234102 Ga0207651_102341022 330
151 3300028794 Ga0307515_10036215 Ga0307515_100362154 330
152 3300037471 Ga0395905_0213324 Ga0395905_0213324_92_1207 330
153 3300046683 Ga0495658_0010441 Ga0495658_0010441_2297_3463 330
154 3300005353 Ga0070669_100023264 Ga0070669_1000232644 331
155 3300005354 Ga0070675_100111612 Ga0070675_1001116122 331
156 3300005459 Ga0068867_100033157 Ga0068867_1000331574 331
157 3300005718 Ga0068866_10067699 Ga0068866_100676991 331
158 3300005719 Ga0068861_100000343 Ga0068861_1000003438 331
159 3300005843 Ga0068860_100000715 Ga0068860_10000071529 331
160 3300006881 Ga0068865_100007045 Ga0068865_1000070452 331
161 3300013297 Ga0157378_10009725 Ga0157378_100097258 331
162 3300013306 Ga0163162_10005242 Ga0163162_100052424 331
163 3300017792 Ga0163161_10042390 Ga0163161_100423903 331
164 3300025938 Ga0207704_10017226 Ga0207704_100172261 331
165 3300025941 Ga0207711_10108033 Ga0207711_101080333 331
166 3300026089 Ga0207648_10001050 Ga0207648_100010506 331
167 3300026118 Ga0207675_100107068 Ga0207675_1001070681 331
168 3300028380 Ga0268265_10047867 Ga0268265_100478673 331
169 3300028381 Ga0268264_10007839 Ga0268264_100078397 331
170 3300053080 Ga0500635_0061116 Ga0500635_0061116_74_1192 331
171 3300005364 Ga0070673_100083713 Ga0070673_1000837132 332
172 3300005616 Ga0068852_100067623 Ga0068852_1000676232 332
173 3300006353 Ga0075370_10000373 Ga0075370_1000037313 332
174 3300025925 Ga0207650_10095532 Ga0207650_100955322 332
175 3300025931 Ga0207644_10188502 Ga0207644_101885022 332
176 3300025940 Ga0207691_10095480 Ga0207691_100954802 332
177 3300031344 Ga0265316_10000151 Ga0265316_1000015142 332
178 3300044683 Ga0466965_0081038 Ga0466965_0081038_38_1105 332
179 3300048091 Ga0495626_0078352 Ga0495626_0078352_178_1245 332
180 3300049822 Ga0501035_0107232 Ga0501035_0107232_56_1165 332
181 3300003323 rootH1_10141431 rootH1_101414313 333
182 3300005327 Ga0070658_10126284 Ga0070658_101262842 333
183 3300005355 Ga0070671_100025218 Ga0070671_1000252183 333
184 3300014968 Ga0157379_10016935 Ga0157379_100169354 333
185 3300025909 Ga0207705_10101472 Ga0207705_101014722 333
186 3300025931 Ga0207644_10021306 Ga0207644_100213064 333
187 3300059421 Ga0590071_000456 Ga0590071_000456_2482_3633 333
188 3300005543 Ga0070672_100294319 Ga0070672_1002943192 334
189 3300006846 Ga0075430_100030832 Ga0075430_1000308324 334
190 3300006880 Ga0075429_100003825 Ga0075429_1000038259 334
191 3300021361 Ga0213872_10021606 Ga0213872_100216062 334
192 3300039447 Ga0436361_0399628 Ga0436361_0399628_1577_2707 334
193 3300050508 nmdc:mga09592_3371_c1 nmdc:mga09592_3371_c1_8568_9683 334
194 3300006177 Ga0075362_10014577 Ga0075362_100145773 335
195 3300006195 Ga0075366_10077598 Ga0075366_100775982 335
196 3300025321 Ga0207656_10033570 Ga0207656_100335703 335
197 3300025931 Ga0207644_10102739 Ga0207644_101027393 335
198 3300031616 Ga0307508_10000094 Ga0307508_1000009450 335
199 3300046454 Ga0495592_0001770 Ga0495592_0001770_11578_12705 335
200 3300048911 Ga0496108_0229757 Ga0496108_0229757_119_1273 335
201 3300050493 nmdc:mga0k408_11200_c1 nmdc:mga0k408_11200_c1_1386_2504 335
202 3300053161 Ga0500634_0044624 Ga0500634_0044624_607_1680 335
203 3300031507 Ga0307509_10118652 Ga0307509_101186522 336
204 3300045051 Ga0451576_0087359 Ga0451576_0087359_1755_2864 336
205 3300049649 Ga0501198_000002 Ga0501198_000002_43654_44772 336
206 3300049662 Ga0501222_000002 Ga0501222_000002_144187_145305 336
207 3300003316 rootH1_10027067 rootH1_100270675 337
208 3300006195 Ga0075366_10118128 Ga0075366_101181282 337
209 3300006353 Ga0075370_10116508 Ga0075370_101165082 337
210 3300009098 Ga0105245_10058026 Ga0105245_100580263 337
211 3300013296 Ga0157374_10148076 Ga0157374_101480762 337
212 3300013306 Ga0163162_10002501 Ga0163162_1000250112 337
213 3300013308 Ga0157375_10001357 Ga0157375_1000135719 337
214 3300014968 Ga0157379_10000717 Ga0157379_1000071722 337
215 3300050493 nmdc:mga0k408_41303_c1 nmdc:mga0k408_41303_c1_714_1850 337
216 3300050496 nmdc:mga07m45_43473_c1 nmdc:mga07m45_43473_c1_12_1148 337
217 3300013105 Ga0157369_10131752 Ga0157369_101317522 338
218 3300046660 Ga0495625_0005772 Ga0495625_0005772_7328_8404 338
219 3300049579 Ga0501043_0000141 Ga0501043_0000141_32835_33950 338
220 3300049580 Ga0501046_0000047 Ga0501046_0000047_26822_27937 338
221 3300049581 Ga0501047_0000058 Ga0501047_0000058_112810_113925 338
222 3300049582 Ga0501048_0015863 Ga0501048_0015863_389_1504 338
223 3300053090 Ga0500646_0023026 Ga0500646_0023026_559_1632 338
224 3300005335 Ga0070666_10099867 Ga0070666_100998672 339
225 3300031548 Ga0307408_100000008 Ga0307408_100000008221 339
226 3300037471 Ga0395905_0060299 Ga0395905_0060299_295_1455 339
227 3300053177 Ga0500636_0044649 Ga0500636_0044649_613_1776 339
228 3300005333 Ga0070677_10008103 Ga0070677_100081032 340
229 3300005353 Ga0070669_100006416 Ga0070669_1000064164 340
230 3300005354 Ga0070675_100010823 Ga0070675_1000108233 340
231 3300005355 Ga0070671_100023315 Ga0070671_1000233152 340
232 3300005356 Ga0070674_100014286 Ga0070674_1000142865 340
233 3300005364 Ga0070673_100002229 Ga0070673_1000022293 340
234 3300005456 Ga0070678_100037384 Ga0070678_1000373842 340
235 3300005457 Ga0070662_100091378 Ga0070662_1000913782 340
236 3300005459 Ga0068867_100000820 Ga0068867_10000082017 340
237 3300005564 Ga0070664_100047862 Ga0070664_1000478622 340
238 3300005618 Ga0068864_100031800 Ga0068864_1000318004 340
239 3300005834 Ga0068851_10009782 Ga0068851_100097823 340
240 3300006358 Ga0068871_100007319 Ga0068871_1000073193 340
241 3300017792 Ga0163161_10052347 Ga0163161_100523473 340
242 3300025893 Ga0207682_10007000 Ga0207682_100070003 340
243 3300025923 Ga0207681_10004604 Ga0207681_100046048 340
244 3300025925 Ga0207650_10000913 Ga0207650_100009138 340
245 3300025926 Ga0207659_10000189 Ga0207659_1000018917 340
246 3300025931 Ga0207644_10011782 Ga0207644_100117822 340
247 3300025933 Ga0207706_10242710 Ga0207706_102427102 340
248 3300025940 Ga0207691_10002491 Ga0207691_100024919 340
249 3300025945 Ga0207679_10024938 Ga0207679_100249382 340
250 3300026023 Ga0207677_10007467 Ga0207677_100074673 340
251 3300026088 Ga0207641_10061733 Ga0207641_100617333 340
252 3300026089 Ga0207648_10001133 Ga0207648_100011333 340
253 3300026121 Ga0207683_10009813 Ga0207683_100098134 340
254 3300026121 Ga0207683_10054604 Ga0207683_100546043 340
255 3300026121 Ga0207683_10073314 Ga0207683_100733142 340
256 3300046530 Ga0495654_0000550 Ga0495654_0000550_23541_24674 340
257 3300035692 Ga0373935_0155852 Ga0373935_0155852_294_1391 341
258 3300036401 Ga0373937_0138413 Ga0373937_0138413_607_1704 341
259 3300037068 Ga0373925_0169558 Ga0373925_0169558_272_1369 341
260 3300046683 Ga0495658_0115747 Ga0495658_0115747_233_1330 341
261 3300048927 Ga0496124_0000151 Ga0496124_0000151_69714_70859 341
262 3300048928 Ga0496125_0005971 Ga0496125_0005971_10704_11849 341
263 3300053077 Ga0495601_0030415 Ga0495601_0030415_776_1873 341
264 3300005331 Ga0070670_100011707 Ga0070670_1000117076 342
265 3300005355 Ga0070671_100070828 Ga0070671_1000708282 342
266 3300005543 Ga0070672_100017803 Ga0070672_1000178033 342
267 3300006353 Ga0075370_10086367 Ga0075370_100863671 342
268 3300006358 Ga0068871_100077187 Ga0068871_1000771872 342
269 3300013308 Ga0157375_10069367 Ga0157375_100693673 342
270 3300014969 Ga0157376_10026355 Ga0157376_100263554 342
271 3300025925 Ga0207650_10002352 Ga0207650_100023525 342
272 3300025931 Ga0207644_10128780 Ga0207644_101287801 342
273 3300025940 Ga0207691_10031896 Ga0207691_100318963 342
274 3300025945 Ga0207679_10190752 Ga0207679_101907521 342
275 3300028794 Ga0307515_10082008 Ga0307515_100820082 342
276 3300048907 Ga0496104_0008841 Ga0496104_0008841_1377_2513 342
277 3300048912 Ga0496109_0013396 Ga0496109_0013396_456_1598 342
278 3300048917 Ga0496114_0122684 Ga0496114_0122684_644_1780 342
279 3300053092 Ga0500583_0011260 Ga0500583_0011260_692_1828 342
280 3300005530 Ga0070679_100000691 Ga0070679_10000069113 343
281 3300006051 Ga0075364_10043054 Ga0075364_100430543 343
282 3300006177 Ga0075362_10006087 Ga0075362_100060873 343
283 3300006178 Ga0075367_10002841 Ga0075367_100028417 343
284 3300006186 Ga0075369_10016575 Ga0075369_100165752 343
285 3300006353 Ga0075370_10006552 Ga0075370_100065525 343
286 3300025917 Ga0207660_10127668 Ga0207660_101276682 343
287 3300042000 Ga0439437_001198 Ga0439437_001198_699_1844 343
288 3300042129 Ga0450891_000891 Ga0450891_000891_852_1997 343
289 3300042144 Ga0450889_000608 Ga0450889_000608_190_1335 343
290 3300042532 Ga0450893_0005693 Ga0450893_0005693_348_1493 343
291 3300046492 Ga0495585_0005980 Ga0495585_0005980_3777_4907 343
292 3300046507 Ga0495606_0029123 Ga0495606_0029123_214_1344 343
293 3300046512 Ga0495610_0026708 Ga0495610_0026708_1247_2338 343
294 3300046519 Ga0495632_0072153 Ga0495632_0072153_286_1377 343
295 3300048911 Ga0496108_0073683 Ga0496108_0073683_1551_2696 343
296 3300049129 Ga0501309_000516 Ga0501309_000516_655_1800 343
297 3300049130 Ga0501310_000594 Ga0501310_000594_664_1809 343
298 3300049161 Ga0501305_003384 Ga0501305_003384_14_1159 343
299 3300049528 Ga0501312_000367 Ga0501312_000367_631_1776 343
300 3300049530 Ga0501314_000187 Ga0501314_000187_1568_2713 343
301 3300049538 Ga0501322_000294 Ga0501322_000294_404_1549 343
302 3300049759 Ga0501262_001512 Ga0501262_001512_1183_2328 343
303 3300049764 Ga0501267_000119 Ga0501267_000119_2934_4079 343
304 3300050489 nmdc:mga03683_8491_c1 nmdc:mga03683_8491_c1_2157_3293 343
305 3300050490 nmdc:mga03n38_39797_c1 nmdc:mga03n38_39797_c1_323_1459 343
306 3300050493 nmdc:mga0k408_64737_c1 nmdc:mga0k408_64737_c1_150_1241 343
307 3300050493 nmdc:mga0k408_7522_c1 nmdc:mga0k408_7522_c1_420_1556 343
308 3300050496 nmdc:mga07m45_61002_c1 nmdc:mga07m45_61002_c1_737_1828 343
309 3300053739 Ga0500587_002000 Ga0500587_002000_1085_2176 343
310 3300005337 Ga0070682_100045865 Ga0070682_1000458652 344
311 3300005338 Ga0068868_100015136 Ga0068868_1000151363 344
312 3300005616 Ga0068852_100034935 Ga0068852_1000349352 344
313 3300009098 Ga0105245_10044542 Ga0105245_100445424 344
314 3300009177 Ga0105248_10002863 Ga0105248_1000286313 344
315 3300013105 Ga0157369_10167164 Ga0157369_101671642 344
316 3300013296 Ga0157374_10004558 Ga0157374_1000455810 344
317 3300013306 Ga0163162_10064153 Ga0163162_100641532 344
318 3300014745 Ga0157377_10026579 Ga0157377_100265793 344
319 3300014968 Ga0157379_10004404 Ga0157379_100044044 344
320 3300014969 Ga0157376_10026261 Ga0157376_100262614 344
321 3300025923 Ga0207681_10268752 Ga0207681_102687522 344
322 3300026116 Ga0207674_10073745 Ga0207674_100737453 344
323 3300026142 Ga0207698_10005667 Ga0207698_100056674 344
324 3300045051 Ga0451576_0271512 Ga0451576_0271512_107_1252 344
325 3300046810 Ga0495660_0031092 Ga0495660_0031092_1055_2176 344
326 3300048905 Ga0496102_0046041 Ga0496102_0046041_2440_3585 344
327 3300048909 Ga0496106_0089601 Ga0496106_0089601_399_1544 344
328 3300048914 Ga0496111_0076891 Ga0496111_0076891_398_1543 344
329 3300048916 Ga0496113_0099656 Ga0496113_0099656_339_1484 344
330 3300048917 Ga0496114_0073018 Ga0496114_0073018_289_1434 344
331 3300048918 Ga0496115_0057989 Ga0496115_0057989_1180_2325 344
332 iso_pu_bacteria 2643221585 2643936201 344
333 iso_pu_bacteria 2643221639 2644217712 344
334 iso_pu_bacteria 2643221646 2644258550 344
335 iso_pu_bacteria 2643221656 2644316846 344
336 iso_pu_bacteria 2738541337 2739056745 344
337 3300003759 Ga0055525_1000026 Ga0055525_1000026192 345
338 3300006195 Ga0075366_10000822 Ga0075366_100008222 345
339 3300021361 Ga0213872_10000016 Ga0213872_1000001636 345
340 3300025230 Ga0209563_100005 Ga0209563_1000051402 345
341 3300039447 Ga0436361_0376061 Ga0436361_0376061_42838_43953 345
342 3300053139 Ga0500568_0006565 Ga0500568_0006565_4164_5279 345
343 3300005328 Ga0070676_10004487 Ga0070676_100044872 346
344 3300005329 Ga0070683_100083823 Ga0070683_1000838233 346
345 3300005334 Ga0068869_100009857 Ga0068869_1000098574 346
346 3300005344 Ga0070661_100109713 Ga0070661_1001097133 346
347 3300005345 Ga0070692_10081509 Ga0070692_100815092 346
348 3300005347 Ga0070668_100054526 Ga0070668_1000545262 346
349 3300005354 Ga0070675_100013850 Ga0070675_1000138504 346
350 3300005355 Ga0070671_100075778 Ga0070671_1000757783 346
351 3300005366 Ga0070659_100008843 Ga0070659_1000088433 346
352 3300005455 Ga0070663_100006397 Ga0070663_1000063977 346
353 3300005457 Ga0070662_100004274 Ga0070662_1000042748 346
354 3300005459 Ga0068867_100024053 Ga0068867_1000240531 346
355 3300005547 Ga0070693_100044860 Ga0070693_1000448602 346
356 3300005563 Ga0068855_100097732 Ga0068855_1000977322 346
357 3300005578 Ga0068854_100061535 Ga0068854_1000615353 346
358 3300005618 Ga0068864_100014624 Ga0068864_1000146244 346
359 3300005719 Ga0068861_100038625 Ga0068861_1000386253 346
360 3300005834 Ga0068851_10018574 Ga0068851_100185743 346
361 3300006195 Ga0075366_10105294 Ga0075366_101052942 346
362 3300017792 Ga0163161_10043582 Ga0163161_100435822 346
363 3300025907 Ga0207645_10011247 Ga0207645_100112474 346
364 3300025919 Ga0207657_10034414 Ga0207657_100344144 346
365 3300025923 Ga0207681_10060654 Ga0207681_100606542 346
366 3300025926 Ga0207659_10061752 Ga0207659_100617522 346
367 3300025932 Ga0207690_10025524 Ga0207690_100255242 346
368 3300025941 Ga0207711_10025880 Ga0207711_100258804 346
369 3300025942 Ga0207689_10003071 Ga0207689_100030715 346
370 3300025972 Ga0207668_10022822 Ga0207668_100228223 346
371 3300026023 Ga0207677_10006940 Ga0207677_100069404 346
372 3300026041 Ga0207639_10083633 Ga0207639_100836332 346
373 3300026067 Ga0207678_10028588 Ga0207678_100285882 346
374 3300026095 Ga0207676_10011402 Ga0207676_100114026 346
375 3300026118 Ga0207675_100009210 Ga0207675_1000092103 346
376 3300026142 Ga0207698_10007500 Ga0207698_100075003 346
377 3300031730 Ga0307516_10132006 Ga0307516_101320062 346
378 3300035695 Ga0373927_0029351 Ga0373927_0029351_1593_2708 346
379 3300037068 Ga0373925_0004683 Ga0373925_0004683_7975_9090 346
380 3300042876 Ga0451577_0001353 Ga0451577_0001353_29367_30482 346
381 3300046522 Ga0495643_0020062 Ga0495643_0020062_310_1422 346
382 3300046535 Ga0495586_0022236 Ga0495586_0022236_612_1730 346
383 3300046683 Ga0495658_0168679 Ga0495658_0168679_152_1267 346
384 3300050493 nmdc:mga0k408_777_c1 nmdc:mga0k408_777_c1_6852_7967 346
385 3300003322 rootL2_10274554 rootL2_102745541 347
386 3300003323 rootH1_10058316 rootH1_100583162 347
387 3300003794 Ga0055531_10000823 Ga0055531_100008239 347
388 3300005328 Ga0070676_10010804 Ga0070676_100108042 347
389 3300005330 Ga0070690_100006323 Ga0070690_1000063234 347
390 3300005334 Ga0068869_100015658 Ga0068869_1000156584 347
391 3300005335 Ga0070666_10009854 Ga0070666_100098545 347
392 3300005338 Ga0068868_100015986 Ga0068868_1000159865 347
393 3300005340 Ga0070689_100163417 Ga0070689_1001634172 347
394 3300005343 Ga0070687_100006756 Ga0070687_1000067563 347
395 3300005347 Ga0070668_100003264 Ga0070668_1000032644 347
396 3300005353 Ga0070669_100032799 Ga0070669_1000327992 347
397 3300005354 Ga0070675_100041764 Ga0070675_1000417643 347
398 3300005355 Ga0070671_100174448 Ga0070671_1001744482 347
399 3300005356 Ga0070674_100007044 Ga0070674_1000070445 347
400 3300005367 Ga0070667_100001505 Ga0070667_10000150510 347
401 3300005438 Ga0070701_10016840 Ga0070701_100168403 347
402 3300005457 Ga0070662_100030909 Ga0070662_1000309092 347
403 3300005459 Ga0068867_100004786 Ga0068867_1000047863 347
404 3300005543 Ga0070672_100002531 Ga0070672_1000025312 347
405 3300005616 Ga0068852_100072433 Ga0068852_1000724333 347
406 3300005617 Ga0068859_100069869 Ga0068859_1000698692 347
407 3300005618 Ga0068864_100036248 Ga0068864_1000362483 347
408 3300005718 Ga0068866_10084098 Ga0068866_100840982 347
409 3300005719 Ga0068861_100006489 Ga0068861_1000064898 347
410 3300005841 Ga0068863_100062745 Ga0068863_1000627453 347
411 3300005842 Ga0068858_100001875 Ga0068858_1000018758 347
412 3300005843 Ga0068860_100000707 Ga0068860_10000070729 347
413 3300005844 Ga0068862_100053491 Ga0068862_1000534913 347
414 3300006881 Ga0068865_100062800 Ga0068865_1000628002 347
415 3300006931 Ga0097620_100069871 Ga0097620_1000698712 347
416 3300009177 Ga0105248_10252975 Ga0105248_102529752 347
417 3300017792 Ga0163161_10017116 Ga0163161_100171163 347
418 3300025303 Ga0209051_1007021 Ga0209051_10070214 347
419 3300025304 Ga0209257_1000354 Ga0209257_100035450 347
420 3300025899 Ga0207642_10009348 Ga0207642_100093482 347
421 3300025903 Ga0207680_10024481 Ga0207680_100244812 347
422 3300025907 Ga0207645_10005371 Ga0207645_100053714 347
423 3300025923 Ga0207681_10003342 Ga0207681_100033424 347
424 3300025926 Ga0207659_10052768 Ga0207659_100527682 347
425 3300025935 Ga0207709_10070045 Ga0207709_100700453 347
426 3300025936 Ga0207670_10171453 Ga0207670_101714532 347
427 3300025937 Ga0207669_10001563 Ga0207669_100015637 347
428 3300025940 Ga0207691_10041039 Ga0207691_100410393 347
429 3300025942 Ga0207689_10005946 Ga0207689_100059464 347
430 3300025972 Ga0207668_10019001 Ga0207668_100190012 347
431 3300025986 Ga0207658_10011427 Ga0207658_100114275 347
432 3300026023 Ga0207677_10107360 Ga0207677_101073602 347
433 3300026035 Ga0207703_10001371 Ga0207703_1000137119 347
434 3300026088 Ga0207641_10001848 Ga0207641_100018485 347
435 3300026089 Ga0207648_10008497 Ga0207648_100084979 347
436 3300026095 Ga0207676_10132508 Ga0207676_101325082 347
437 3300026118 Ga0207675_100006272 Ga0207675_10000627210 347
438 3300026121 Ga0207683_10172117 Ga0207683_101721172 347
439 3300026142 Ga0207698_10208000 Ga0207698_102080002 347
440 3300028380 Ga0268265_10036142 Ga0268265_100361422 347
441 3300037471 Ga0395905_0004837 Ga0395905_0004837_9996_11132 347
442 3300038443 Ga0395901_0092493 Ga0395901_0092493_1801_2979 347
443 iso_pu_bacteria 2585428057 2587727686 347
444 iso_pu_bacteria 2585428058 2587733061 347
445 iso_pu_bacteria 2588253510 2588291359 347
446 iso_pu_bacteria 2643221544 2643742681 347
447 iso_pu_bacteria 2643221592 2643969506 347
448 iso_pu_bacteria 2643221625 2644143806 347
449 iso_pu_bacteria 2643221648 2644276488 347
450 3300005330 Ga0070690_100025841 Ga0070690_1000258414 348
451 3300005333 Ga0070677_10005950 Ga0070677_100059504 348
452 3300005334 Ga0068869_100006760 Ga0068869_1000067606 348
453 3300005338 Ga0068868_100024050 Ga0068868_1000240504 348
454 3300005347 Ga0070668_100038465 Ga0070668_1000384653 348
455 3300005347 Ga0070668_100289283 Ga0070668_1002892831 348
456 3300005354 Ga0070675_100007196 Ga0070675_1000071967 348
457 3300005355 Ga0070671_100012623 Ga0070671_1000126237 348
458 3300005364 Ga0070673_100002506 Ga0070673_1000025065 348
459 3300005365 Ga0070688_100150388 Ga0070688_1001503882 348
460 3300005367 Ga0070667_100022532 Ga0070667_1000225324 348
461 3300005455 Ga0070663_100053479 Ga0070663_1000534793 348
462 3300005456 Ga0070678_100010708 Ga0070678_1000107084 348
463 3300005459 Ga0068867_100107576 Ga0068867_1001075762 348
464 3300005543 Ga0070672_100017849 Ga0070672_1000178495 348
465 3300005617 Ga0068859_100060368 Ga0068859_1000603683 348
466 3300005618 Ga0068864_100002247 Ga0068864_10000224710 348
467 3300005719 Ga0068861_100054344 Ga0068861_1000543443 348
468 3300005719 Ga0068861_100155337 Ga0068861_1001553372 348
469 3300005841 Ga0068863_100007447 Ga0068863_1000074471 348
470 3300005842 Ga0068858_100005928 Ga0068858_1000059283 348
471 3300005843 Ga0068860_100120930 Ga0068860_1001209302 348
472 3300006195 Ga0075366_10002910 Ga0075366_100029102 348
473 3300006195 Ga0075366_10027415 Ga0075366_100274152 348
474 3300006353 Ga0075370_10003141 Ga0075370_100031418 348
475 3300006358 Ga0068871_100051943 Ga0068871_1000519432 348
476 3300006931 Ga0097620_100060368 Ga0097620_1000603682 348
477 3300009177 Ga0105248_10103094 Ga0105248_101030943 348
478 3300009553 Ga0105249_10030174 Ga0105249_100301742 348
479 3300013296 Ga0157374_10050751 Ga0157374_100507512 348
480 3300013306 Ga0163162_10066285 Ga0163162_100662853 348
481 3300013306 Ga0163162_10511524 Ga0163162_105115241 348
482 3300013308 Ga0157375_10084089 Ga0157375_100840893 348
483 3300014968 Ga0157379_10066823 Ga0157379_100668231 348
484 3300025907 Ga0207645_10006398 Ga0207645_100063988 348
485 3300025925 Ga0207650_10056571 Ga0207650_100565712 348
486 3300025927 Ga0207687_10266671 Ga0207687_102666712 348
487 3300025933 Ga0207706_10202053 Ga0207706_102020532 348
488 3300025937 Ga0207669_10019506 Ga0207669_100195063 348
489 3300025938 Ga0207704_10037398 Ga0207704_100373983 348
490 3300025942 Ga0207689_10070391 Ga0207689_100703912 348
491 3300025972 Ga0207668_10028021 Ga0207668_100280212 348
492 3300025972 Ga0207668_10164836 Ga0207668_101648362 348
493 3300026035 Ga0207703_10003102 Ga0207703_100031028 348
494 3300026067 Ga0207678_10175820 Ga0207678_101758202 348
495 3300026088 Ga0207641_10003303 Ga0207641_100033037 348
496 3300026089 Ga0207648_10045451 Ga0207648_100454512 348
497 3300026089 Ga0207648_10116109 Ga0207648_101161092 348
498 3300026089 Ga0207648_10169411 Ga0207648_101694112 348
499 3300026095 Ga0207676_10005300 Ga0207676_100053002 348
500 3300026118 Ga0207675_100136627 Ga0207675_1001366272 348
501 3300026121 Ga0207683_10008770 Ga0207683_100087703 348
502 3300026121 Ga0207683_10087122 Ga0207683_100871222 348
503 3300026142 Ga0207698_10061866 Ga0207698_100618663 348
504 3300037068 Ga0373925_0035343 Ga0373925_0035343_2337_3503 348
505 3300042439 Ga0439464_0000764 Ga0439464_0000764_1890_3011 348
506 3300044712 Ga0453684_0083182 Ga0453684_0083182_1473_2597 348
507 3300045051 Ga0451576_0079493 Ga0451576_0079493_1240_2376 348
508 3300050493 nmdc:mga0k408_1236_c1 nmdc:mga0k408_1236_c1_6061_7182 348
509 3300050493 nmdc:mga0k408_1461_c1 nmdc:mga0k408_1461_c1_4862_5983 348
510 3300050496 nmdc:mga07m45_843_c1 nmdc:mga07m45_843_c1_6830_7951 348
511 3300003316 rootH1_10025577 rootH1_100255773 349
512 3300003322 rootL2_10045989 rootL2_100459895 349
513 3300003347 JGI26128J50194_1000130 JGI26128J50194_10001302 349
514 3300005844 Ga0068862_100047844 Ga0068862_1000478443 349
515 3300006038 Ga0075365_10009206 Ga0075365_100092064 349
516 3300006195 Ga0075366_10031525 Ga0075366_100315252 349
517 3300006353 Ga0075370_10001845 Ga0075370_100018458 349
518 3300006353 Ga0075370_10041160 Ga0075370_100411602 349
519 3300009148 Ga0105243_10071375 Ga0105243_100713753 349
520 3300009148 Ga0105243_10207955 Ga0105243_102079552 349
521 3300025935 Ga0207709_10214020 Ga0207709_102140202 349
522 3300027695 Ga0209966_1000004 Ga0209966_100000468 349
523 3300028380 Ga0268265_10096698 Ga0268265_100966982 349
524 3300028794 Ga0307515_10000022 Ga0307515_10000022241 349
525 3300028794 Ga0307515_10000191 Ga0307515_1000019116 349
526 3300028794 Ga0307515_10063975 Ga0307515_100639754 349
527 3300028794 Ga0307515_10187724 Ga0307515_101877242 349
528 3300031456 Ga0307513_10011299 Ga0307513_100112999 349
529 3300032005 Ga0307411_10032183 Ga0307411_100321832 349
530 3300035114 Ga0373939_0000164 Ga0373939_0000164_8763_9908 349
531 3300035121 Ga0373960_0002111 Ga0373960_0002111_1207_2352 349
532 3300046512 Ga0495610_0073678 Ga0495610_0073678_16_1140 349
533 3300046694 Ga0495649_0013059 Ga0495649_0013059_2896_4020 349
534 3300046810 Ga0495660_0038817 Ga0495660_0038817_1016_2140 349
535 3300048913 Ga0496110_0073096 Ga0496110_0073096_1837_2979 349
536 3300050493 nmdc:mga0k408_140890_c1 nmdc:mga0k408_140890_c1_159_1274 349
537 3300050496 nmdc:mga07m45_1634_c1 nmdc:mga07m45_1634_c1_5030_6175 349
538 3300053134 Ga0500658_0009139 Ga0500658_0009139_2328_3452 349
539 iso_pu_bacteria 2643221654 2644304852 349
540 iso_pu_bacteria 2881101125 2881102203 349
541 iso_pu_bacteria 2939631187 2939636560 349
542 3300005355 Ga0070671_100003736 Ga0070671_1000037363 350
543 3300009177 Ga0105248_10003419 Ga0105248_1000341914 350
544 3300025273 Ga0209673_1014079 Ga0209673_10140792 350
545 3300025295 Ga0209564_1000003 Ga0209564_1000003509 350
546 3300025931 Ga0207644_10062647 Ga0207644_100626473 350
547 3300025941 Ga0207711_10021818 Ga0207711_100218182 350
548 3300028794 Ga0307515_10003517 Ga0307515_1000351714 350
549 3300028794 Ga0307515_10003519 Ga0307515_1000351920 350
550 3300028794 Ga0307515_10135477 Ga0307515_101354772 350
551 3300030522 Ga0307512_10056761 Ga0307512_100567612 350
552 3300030522 Ga0307512_10141375 Ga0307512_101413752 350
553 3300031456 Ga0307513_10058698 Ga0307513_100586984 350
554 3300031507 Ga0307509_10000215 Ga0307509_1000021579 350
555 3300031616 Ga0307508_10000017 Ga0307508_10000017161 350
556 3300031649 Ga0307514_10004466 Ga0307514_1000446612 350
557 3300031730 Ga0307516_10035350 Ga0307516_100353505 350
558 3300031995 Ga0307409_100001509 Ga0307409_10000150910 350
559 3300032002 Ga0307416_100073842 Ga0307416_1000738423 350
560 3300032005 Ga0307411_10038304 Ga0307411_100383042 350
561 3300032005 Ga0307411_10048742 Ga0307411_100487423 350
562 3300032126 Ga0307415_100004973 Ga0307415_1000049734 350
563 3300033179 Ga0307507_10098962 Ga0307507_100989622 350
564 3300033180 Ga0307510_10007507 Ga0307510_100075076 350
565 3300033180 Ga0307510_10057953 Ga0307510_100579532 350
566 3300037471 Ga0395905_0010220 Ga0395905_0010220_3480_4607 350
567 3300037471 Ga0395905_0139665 Ga0395905_0139665_1081_2211 350
568 3300046660 Ga0495625_0043089 Ga0495625_0043089_641_1768 350
569 3300048908 Ga0496105_0107002 Ga0496105_0107002_1019_2137 350
570 3300048911 Ga0496108_0143944 Ga0496108_0143944_24_1142 350
571 3300048916 Ga0496113_0032000 Ga0496113_0032000_315_1433 350
572 3300053121 Ga0500607_034061 Ga0500607_034061_785_1912 350
573 iso_pu_bacteria 2585428062 2587755169 350
574 iso_pu_bacteria 2738543012 2739241555 350
575 iso_pu_bacteria 2816332133 2816476190 350
576 3300003320 rootH2_10011660 rootH2_100116608 351
577 3300003322 rootL2_10000980 rootL2_100009804 351
578 3300003323 rootH1_10036624 rootH1_100366243 351
579 3300003775 Ga0055524_1020352 Ga0055524_10203523 351
580 3300003794 Ga0055531_10024473 Ga0055531_100244731 351
581 3300003794 Ga0055531_10025337 Ga0055531_100253371 351
582 3300004625 Ga0055543_1002639 Ga0055543_10026395 351
583 3300005262 Ga0065165_1000006 Ga0065165_1000006269 351
584 3300005262 Ga0065165_1002955 Ga0065165_100295512 351
585 3300005327 Ga0070658_10092351 Ga0070658_100923512 351
586 3300005355 Ga0070671_100250306 Ga0070671_1002503061 351
587 3300005455 Ga0070663_100002931 Ga0070663_1000029318 351
588 3300005459 Ga0068867_100000175 Ga0068867_10000017520 351
589 3300005548 Ga0070665_100018978 Ga0070665_1000189785 351
590 3300005617 Ga0068859_100113840 Ga0068859_1001138402 351
591 3300005618 Ga0068864_100093790 Ga0068864_1000937903 351
592 3300005841 Ga0068863_100103524 Ga0068863_1001035242 351
593 3300005842 Ga0068858_100266324 Ga0068858_1002663242 351
594 3300006195 Ga0075366_10063815 Ga0075366_100638152 351
595 3300006353 Ga0075370_10048362 Ga0075370_100483623 351
596 3300006931 Ga0097620_100113838 Ga0097620_1001138382 351
597 3300006944 Ga0099823_1001245 Ga0099823_10012454 351
598 3300009098 Ga0105245_10045165 Ga0105245_100451652 351
599 3300009148 Ga0105243_10000770 Ga0105243_1000077028 351
600 3300012497 Ga0157319_1000009 Ga0157319_1000009137 351
601 3300014745 Ga0157377_10000014 Ga0157377_10000014174 351
602 3300021361 Ga0213872_10000004 Ga0213872_1000000463 351
603 3300025273 Ga0209673_1030300 Ga0209673_10303001 351
604 3300025298 Ga0209050_1008655 Ga0209050_10086554 351
605 3300025299 Ga0209256_1003497 Ga0209256_10034973 351
606 3300025303 Ga0209051_1000674 Ga0209051_10006746 351
607 3300025303 Ga0209051_1009412 Ga0209051_10094125 351
608 3300025304 Ga0209257_1001690 Ga0209257_100169018 351
609 3300025304 Ga0209257_1005187 Ga0209257_10051873 351
610 3300025927 Ga0207687_10163203 Ga0207687_101632032 351
611 3300025935 Ga0207709_10008507 Ga0207709_100085075 351
612 3300026035 Ga0207703_10337194 Ga0207703_103371941 351
613 3300026067 Ga0207678_10002552 Ga0207678_100025528 351
614 3300026088 Ga0207641_10198703 Ga0207641_101987032 351
615 3300026089 Ga0207648_10000142 Ga0207648_1000014249 351
616 3300027296 Ga0209389_1027328 Ga0209389_10273284 351
617 3300028379 Ga0268266_10020171 Ga0268266_100201715 351
618 3300028794 Ga0307515_10150616 Ga0307515_101506162 351
619 3300030521 Ga0307511_10068954 Ga0307511_100689542 351
620 3300031730 Ga0307516_10002501 Ga0307516_100025015 351
621 3300031730 Ga0307516_10175088 Ga0307516_101750882 351
622 3300033180 Ga0307510_10027415 Ga0307510_100274155 351
623 3300037312 Ga0395899_0028348 Ga0395899_0028348_714_1877 351
624 3300037466 Ga0395898_0028321 Ga0395898_0028321_2080_3243 351
625 3300037471 Ga0395905_0243284 Ga0395905_0243284_320_1486 351
626 3300038443 Ga0395901_0035718 Ga0395901_0035718_2939_4102 351
627 3300038443 Ga0395901_0092099 Ga0395901_0092099_1602_2768 351
628 3300039447 Ga0436361_0583521 Ga0436361_0583521_43050_44195 351
629 3300041997 Ga0439431_0009009 Ga0439431_0009009_411_1532 351
630 3300042438 Ga0439459_0000228 Ga0439459_0000228_4989_6134 351
631 3300044656 Ga0466969_0000002 Ga0466969_0000002_161090_162211 351
632 3300044656 Ga0466969_0007330 Ga0466969_0007330_1001_2158 351
633 3300044656 Ga0466969_0009526 Ga0466969_0009526_2935_4095 351
634 3300044656 Ga0466969_0037283 Ga0466969_0037283_701_1822 351
635 3300044683 Ga0466965_0064093 Ga0466965_0064093_125_1246 351
636 3300044684 Ga0466966_0001339 Ga0466966_0001339_2474_3595 351
637 3300044684 Ga0466966_0007833 Ga0466966_0007833_3697_4854 351
638 3300044684 Ga0466966_0015276 Ga0466966_0015276_2221_3342 351
639 3300044684 Ga0466966_0020128 Ga0466966_0020128_1085_2245 351
640 3300044693 Ga0466961_0026940 Ga0466961_0026940_1354_2475 351
641 3300044693 Ga0466961_0090320 Ga0466961_0090320_736_1857 351
642 3300044694 Ga0466963_0144363 Ga0466963_0144363_410_1531 351
643 3300044765 Ga0466970_0044954 Ga0466970_0044954_773_1894 351
644 3300045049 Ga0466959_0001562 Ga0466959_0001562_1643_2764 351
645 3300045049 Ga0466959_0004663 Ga0466959_0004663_7787_8944 351
646 3300045049 Ga0466959_0008282 Ga0466959_0008282_3660_4820 351
647 3300045051 Ga0451576_0334921 Ga0451576_0334921_216_1364 351
648 3300045976 Ga0466967_0026883 Ga0466967_0026883_572_1693 351
649 3300046471 Ga0495650_0008824 Ga0495650_0008824_2363_3478 351
650 3300047472 Ga0495686_0060940 Ga0495686_0060940_270_1400 351
651 3300048905 Ga0496102_0026281 Ga0496102_0026281_2632_3753 351
652 3300048912 Ga0496109_0243456 Ga0496109_0243456_82_1227 351
653 3300048917 Ga0496114_0136188 Ga0496114_0136188_533_1663 351
654 3300048927 Ga0496124_0008805 Ga0496124_0008805_1010_2167 351
655 3300049571 Ga0501034_0140259 Ga0501034_0140259_952_2097 351
656 3300050496 nmdc:mga07m45_34095_c1 nmdc:mga07m45_34095_c1_744_1874 351
657 3300053086 Ga0500578_0043483 Ga0500578_0043483_228_1355 351
658 3300053117 Ga0500593_001202 Ga0500593_001202_5704_6828 351
659 3300053118 Ga0500594_0000251 Ga0500594_0000251_8404_9534 351
660 3300053136 Ga0500559_0000392 Ga0500559_0000392_12742_13872 351
661 3300053156 Ga0500622_0002031 Ga0500622_0002031_2464_3609 351
662 3300053730 Ga0500645_006937 Ga0500645_006937_2358_3485 351
663 iso_pu_bacteria 2831864461 2831866351 351
664 iso_pu_bacteria 2886848708 2886849624 351
665 3300003775 Ga0055524_1000175 Ga0055524_100017516 352
666 3300003791 Ga0055530_10005340 Ga0055530_100053402 352
667 3300003792 Ga0055540_1000062 Ga0055540_100006222 352
668 3300003794 Ga0055531_10010250 Ga0055531_100102504 352
669 3300006880 Ga0075429_100044687 Ga0075429_1000446873 352
670 3300006946 Ga0079104_1000186 Ga0079104_100018622 352
671 3300025291 Ga0209675_1007295 Ga0209675_10072954 352
672 3300025298 Ga0209050_1003695 Ga0209050_10036952 352
673 3300025299 Ga0209256_1000024 Ga0209256_1000024276 352
674 3300025303 Ga0209051_1000063 Ga0209051_1000063204 352
675 3300025304 Ga0209257_1000118 Ga0209257_10001182 352
676 3300027111 Ga0209281_1000442 Ga0209281_100044237 352
677 3300028794 Ga0307515_10021930 Ga0307515_100219305 352
678 3300031235 Ga0265330_10000032 Ga0265330_1000003211 352
679 3300031238 Ga0265332_10000001 Ga0265332_10000001116 352
680 3300031507 Ga0307509_10098502 Ga0307509_100985022 352
681 3300031507 Ga0307509_10177294 Ga0307509_101772942 352
682 3300031616 Ga0307508_10185848 Ga0307508_101858482 352
683 3300031711 Ga0265314_10000022 Ga0265314_10000022116 352
684 3300033179 Ga0307507_10093838 Ga0307507_100938381 352
685 3300035691 Ga0373931_0044183 Ga0373931_0044183_1017_2153 352
686 3300037312 Ga0395899_0002565 Ga0395899_0002565_1608_2774 352
687 3300037418 Ga0395900_0005484 Ga0395900_0005484_9463_10629 352
688 3300037418 Ga0395900_0249015 Ga0395900_0249015_251_1402 352
689 3300037466 Ga0395898_0006418 Ga0395898_0006418_159_1325 352
690 3300037471 Ga0395905_0000106 Ga0395905_0000106_105173_106351 352
691 3300037471 Ga0395905_0002852 Ga0395905_0002852_13425_14591 352
692 3300037471 Ga0395905_0020704 Ga0395905_0020704_2219_3370 352
693 3300038443 Ga0395901_0189875 Ga0395901_0189875_867_2033 352
694 3300042439 Ga0439464_0003749 Ga0439464_0003749_1503_2657 352
695 3300044693 Ga0466961_0008620 Ga0466961_0008620_160_1329 352
696 3300046542 Ga0495597_0010147 Ga0495597_0010147_2507_3640 352
697 3300047321 Ga0495676_0056004 Ga0495676_0056004_766_1902 352
698 3300047443 Ga0495687_002210 Ga0495687_002210_768_1901 352
699 3300048917 Ga0496114_0003382 Ga0496114_0003382_5330_6457 352
700 iso_pu_bacteria 2643221609 2644062361 352
701 iso_pu_bacteria 2643221611 2644075581 352
702 iso_pu_bacteria 2643221644 2644243144 352
703 3300005344 Ga0070661_100000264 Ga0070661_1000002647 353
704 3300005356 Ga0070674_100000872 Ga0070674_1000008729 353
705 3300005366 Ga0070659_100000798 Ga0070659_10000079815 353
706 3300005367 Ga0070667_100316638 Ga0070667_1003166381 353
707 3300005455 Ga0070663_100133738 Ga0070663_1001337382 353
708 3300005457 Ga0070662_100072979 Ga0070662_1000729792 353
709 3300005459 Ga0068867_100212214 Ga0068867_1002122142 353
710 3300005564 Ga0070664_100003853 Ga0070664_1000038537 353
711 3300005564 Ga0070664_100092220 Ga0070664_1000922202 353
712 3300005616 Ga0068852_100108043 Ga0068852_1001080432 353
713 3300006881 Ga0068865_100097476 Ga0068865_1000974761 353
714 3300014968 Ga0157379_10288325 Ga0157379_102883252 353
715 3300025256 Ga0209759_1011322 Ga0209759_10113222 353
716 3300025919 Ga0207657_10155427 Ga0207657_101554273 353
717 3300025920 Ga0207649_10002218 Ga0207649_100022185 353
718 3300025927 Ga0207687_10188937 Ga0207687_101889372 353
719 3300025937 Ga0207669_10042973 Ga0207669_100429732 353
720 3300025945 Ga0207679_10001861 Ga0207679_100018618 353
721 3300025945 Ga0207679_10006511 Ga0207679_100065112 353
722 3300025986 Ga0207658_10002880 Ga0207658_100028804 353
723 3300025986 Ga0207658_10224549 Ga0207658_102245492 353
724 3300031456 Ga0307513_10015357 Ga0307513_100153579 353
725 3300031456 Ga0307513_10023996 Ga0307513_100239963 353
726 3300031548 Ga0307408_100188771 Ga0307408_1001887712 353
727 3300031616 Ga0307508_10034900 Ga0307508_100349002 353
728 3300031730 Ga0307516_10006776 Ga0307516_100067763 353
729 3300031995 Ga0307409_100060955 Ga0307409_1000609552 353
730 3300032002 Ga0307416_100031303 Ga0307416_1000313033 353
731 3300032005 Ga0307411_10030308 Ga0307411_100303082 353
732 3300046660 Ga0495625_0013423 Ga0495625_0013423_43_1206 353
733 3300046683 Ga0495658_0088988 Ga0495658_0088988_472_1590 353
734 3300048905 Ga0496102_0020879 Ga0496102_0020879_4066_5199 353
735 3300048924 Ga0496121_0022752 Ga0496121_0022752_2509_3654 353
736 iso_pu_bacteria 2643221570 2643864733 353
737 iso_pu_bacteria 2643221596 2643991109 353
738 iso_pu_bacteria 2643221652 2644294036 353
739 iso_pu_bacteria 2990710928 2990711808 353
740 3300005328 Ga0070676_10007485 Ga0070676_100074853 354
741 3300005334 Ga0068869_100013849 Ga0068869_1000138493 354
742 3300005354 Ga0070675_100028234 Ga0070675_1000282344 354
743 3300005355 Ga0070671_100044580 Ga0070671_1000445802 354
744 3300005356 Ga0070674_100263364 Ga0070674_1002633641 354
745 3300005364 Ga0070673_100055860 Ga0070673_1000558603 354
746 3300005457 Ga0070662_100011800 Ga0070662_1000118003 354
747 3300005459 Ga0068867_100006286 Ga0068867_1000062862 354
748 3300005467 Ga0070706_100000212 Ga0070706_10000021221 354
749 3300005471 Ga0070698_100108940 Ga0070698_1001089402 354
750 3300005840 Ga0068870_10061740 Ga0068870_100617402 354
751 3300006042 Ga0075368_10005570 Ga0075368_100055704 354
752 3300006048 Ga0075363_100112717 Ga0075363_1001127172 354
753 3300006178 Ga0075367_10021959 Ga0075367_100219593 354
754 3300006195 Ga0075366_10023388 Ga0075366_100233882 354
755 3300006353 Ga0075370_10030190 Ga0075370_100301902 354
756 3300025907 Ga0207645_10012047 Ga0207645_100120473 354
757 3300025908 Ga0207643_10054635 Ga0207643_100546352 354
758 3300025910 Ga0207684_10031655 Ga0207684_100316554 354
759 3300025933 Ga0207706_10005764 Ga0207706_100057648 354
760 3300025942 Ga0207689_10021427 Ga0207689_100214274 354
761 3300025960 Ga0207651_10028921 Ga0207651_100289213 354
762 3300026089 Ga0207648_10024671 Ga0207648_100246713 354
763 3300037418 Ga0395900_0000188 Ga0395900_0000188_61006_62142 354
764 3300037466 Ga0395898_0017271 Ga0395898_0017271_3263_4399 354
765 3300037471 Ga0395905_0020789 Ga0395905_0020789_2534_3691 354
766 3300044683 Ga0466965_0002506 Ga0466965_0002506_3832_4989 354
767 3300044694 Ga0466963_0074855 Ga0466963_0074855_653_1810 354
768 3300044706 Ga0466964_0002006 Ga0466964_0002006_3392_4549 354
769 3300044719 Ga0466971_0001980 Ga0466971_0001980_5446_6603 354
770 3300044735 Ga0466968_0017259 Ga0466968_0017259_16_1173 354
771 3300050494 nmdc:mga06z11_33118_c1 nmdc:mga06z11_33118_c1_653_1798 354
772 3300050496 nmdc:mga07m45_44545_c1 nmdc:mga07m45_44545_c1_342_1487 354
773 3300061719 Ga0466962_0004675 Ga0466962_0004675_952_2109 354
774 iso_pu_bacteria 2547132374 2548500242 354
775 iso_pu_bacteria 2643221717 2644644441 354
776 3300003316 rootH1_10015684 rootH1_100156842 355
777 3300005364 Ga0070673_100169270 Ga0070673_1001692701 355
778 3300005618 Ga0068864_100104651 Ga0068864_1001046512 355
779 3300006237 Ga0097621_100034144 Ga0097621_1000341444 355
780 3300009177 Ga0105248_10040203 Ga0105248_100402033 355
781 3300013296 Ga0157374_10066719 Ga0157374_100667193 355
782 3300013308 Ga0157375_10075576 Ga0157375_100755763 355
783 3300014969 Ga0157376_10284085 Ga0157376_102840852 355
784 3300025931 Ga0207644_10011940 Ga0207644_100119405 355
785 3300025940 Ga0207691_10109068 Ga0207691_101090682 355
786 3300025941 Ga0207711_10016270 Ga0207711_100162702 355
787 3300025960 Ga0207651_10113617 Ga0207651_101136172 355
788 3300026089 Ga0207648_10147811 Ga0207648_101478112 355
789 3300026095 Ga0207676_10105908 Ga0207676_101059082 355
790 3300026121 Ga0207683_10352355 Ga0207683_103523552 355
791 3300027876 Ga0209974_10002124 Ga0209974_100021247 355
792 3300031548 Ga0307408_100000513 Ga0307408_1000005139 355
793 3300031901 Ga0307406_10000279 Ga0307406_1000027923 355
794 3300035691 Ga0373931_0002571 Ga0373931_0002571_1851_2981 355
795 3300037471 Ga0395905_0001392 Ga0395905_0001392_15609_16784 355
796 3300039447 Ga0436361_0141959 Ga0436361_0141959_451_1578 355
797 3300042121 Ga0450919_000269 Ga0450919_000269_4534_5679 355
798 3300042122 Ga0450920_007520 Ga0450920_007520_182_1327 355
799 3300042125 Ga0450923_001458 Ga0450923_001458_522_1688 355
800 3300042531 Ga0450918_000945 Ga0450918_000945_2141_3286 355
801 3300044683 Ga0466965_0014746 Ga0466965_0014746_208_1368 355
802 3300005539 Ga0068853_100052483 Ga0068853_1000524833 356
803 3300009093 Ga0105240_10018656 Ga0105240_100186564 356
804 3300009545 Ga0105237_10000367 Ga0105237_1000036756 356
805 3300009551 Ga0105238_10009305 Ga0105238_100093057 356
806 3300010375 Ga0105239_10000150 Ga0105239_1000015070 356
807 3300025913 Ga0207695_10022061 Ga0207695_100220614 356
808 3300025914 Ga0207671_10000808 Ga0207671_1000080813 356
809 3300025924 Ga0207694_10011050 Ga0207694_100110502 356
810 3300037471 Ga0395905_0002964 Ga0395905_0002964_2600_3781 356
811 3300005331 Ga0070670_100028084 Ga0070670_1000280844 357
812 3300025920 Ga0207649_10208085 Ga0207649_102080852 357
813 3300025940 Ga0207691_10136583 Ga0207691_101365832 357
814 3300025941 Ga0207711_10077719 Ga0207711_100777192 357
815 3300041459 Ga0451800_1626932 Ga0451800_1626932_130_1290 357
816 3300035695 Ga0373927_0091127 Ga0373927_0091127_100_1263 358
817 3300050496 nmdc:mga07m45_182_c1 nmdc:mga07m45_182_c1_9489_10640 359
818 3300025256 Ga0209759_1001241 Ga0209759_10012419 360
819 3300025909 Ga0207705_10041475 Ga0207705_100414752 360
820 3300031730 Ga0307516_10001811 Ga0307516_1000181114 360
821 3300046475 Ga0495639_0046092 Ga0495639_0046092_717_1898 360
822 3300003752 Ga0055539_1000603 Ga0055539_10006037 361
823 3300003756 Ga0055533_1000006 Ga0055533_100000657 361
824 3300003759 Ga0055525_1000677 Ga0055525_10006777 361
825 3300025226 Ga0209674_100003 Ga0209674_1000031279 361
826 3300025230 Ga0209563_100010 Ga0209563_1000101007 361
827 3300025231 Ga0207427_101024 Ga0207427_1010248 361
828 3300025253 Ga0209677_100274 Ga0209677_1002749 361
829 3300025913 Ga0207695_10080409 Ga0207695_100804093 361
830 3300006353 Ga0075370_10000245 Ga0075370_100002459 363
831 3300046471 Ga0495650_0021298 Ga0495650_0021298_436_1617 363
832 3300053136 Ga0500559_0010715 Ga0500559_0010715_889_2070 365
833 3300003761 Ga0055535_1000881 Ga0055535_100088113 367
834 3300003763 Ga0055529_1000175 Ga0055529_100017520 367
835 3300015262 Ga0182007_10030022 Ga0182007_100300222 367
836 3300025242 Ga0209258_100060 Ga0209258_100060197 367
837 3300025256 Ga0209759_1001792 Ga0209759_10017924 367
838 3300025272 Ga0209455_1000093 Ga0209455_100009341 367
839 3300025919 Ga0207657_10069954 Ga0207657_100699542 367
840 3300025932 Ga0207690_10051255 Ga0207690_100512552 367
841 3300046506 Ga0495583_0000153 Ga0495583_0000153_34410_35573 368
842 3300046507 Ga0495606_0002667 Ga0495606_0002667_11910_13073 368
843 3300046694 Ga0495649_0002833 Ga0495649_0002833_9239_10402 368
844 3300053080 Ga0500635_0000033 Ga0500635_0000033_9160_10332 368
845 3300003320 rootH2_10029880 rootH2_100298803 369
846 3300025909 Ga0207705_10109683 Ga0207705_101096832 369
847 3300025949 Ga0207667_10313796 Ga0207667_103137962 369
848 3300037466 Ga0395898_0110946 Ga0395898_0110946_281_1441 369
849 3300038443 Ga0395901_0006203 Ga0395901_0006203_5521_6681 369
850 3300002705 JGI25156J39149_1000581 JGI25156J39149_100058113 370
851 3300002741 JGI25157J39369_1000163 JGI25157J39369_100016330 370
852 3300003322 rootL2_10321793 rootL2_103217931 370
853 3300003323 rootH1_10047957 rootH1_100479573 370
854 3300003323 rootH1_10058315 rootH1_100583153 370
855 3300003752 Ga0055539_1000826 Ga0055539_10008265 370
856 3300005327 Ga0070658_10016622 Ga0070658_100166224 370
857 3300005330 Ga0070690_100214400 Ga0070690_1002144001 370
858 3300005563 Ga0068855_100011038 Ga0068855_1000110382 370
859 3300005577 Ga0068857_100020499 Ga0068857_1000204994 370
860 3300005614 Ga0068856_100001213 Ga0068856_1000012138 370
861 3300005616 Ga0068852_100147546 Ga0068852_1001475462 370
862 3300005719 Ga0068861_100043773 Ga0068861_1000437734 370
863 3300009093 Ga0105240_10276166 Ga0105240_102761662 370
864 3300013105 Ga0157369_10006554 Ga0157369_1000655410 370
865 3300025242 Ga0209258_100482 Ga0209258_1004828 370
866 3300025246 Ga0209646_1000242 Ga0209646_100024229 370
867 3300025250 Ga0209026_1000311 Ga0209026_100031129 370
868 3300025253 Ga0209677_100396 Ga0209677_1003969 370
869 3300025256 Ga0209759_1000373 Ga0209759_100037313 370
870 3300025909 Ga0207705_10106674 Ga0207705_101066742 370
871 3300025924 Ga0207694_10018782 Ga0207694_100187822 370
872 3300025949 Ga0207667_10026613 Ga0207667_100266135 370
873 3300026041 Ga0207639_10093396 Ga0207639_100933961 370
874 3300026078 Ga0207702_10001598 Ga0207702_1000159817 370
875 3300026116 Ga0207674_10014389 Ga0207674_100143899 370
876 3300026116 Ga0207674_10206732 Ga0207674_102067322 370
877 3300026118 Ga0207675_100029352 Ga0207675_1000293523 370
878 3300026142 Ga0207698_10234734 Ga0207698_102347342 370
879 3300028666 Ga0265336_10000062 Ga0265336_1000006258 370
880 3300029957 Ga0265324_10015589 Ga0265324_100155892 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13360

PQQ_2

PQQ-like domain

94

323

0.99

PF13570

PQQ_3

PQQ-like domain

144

183

0.97

PF01011

PQQ

PQQ enzyme repeat

86

124

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hdj-assembly1.cif.gz_A crystal structure of bamb from pseudomonas aeruginosa 0.8807 31 369
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8637 72 186
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.847 150 223
4imm-assembly1.cif.gz_A the crystal structure of bamb from moraxella catarrhalis 0.8417 43 368
4hdj-assembly1.cif.gz_A crystal structure of bamb from pseudomonas aeruginosa 0.841 31 369
ID Description Score Start End Superfamily
4hdjA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8807 31 369 2.130.10.10
2ymsA00 Mainly Beta;Beta Barrel;Lipocalin; 0.8637 72 186 2.40.128.630
af_Q9FKT5_7_165_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8577 77 150 2.130.10.10
af_P77774_21_391_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8556 26 368 2.130.10.10
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.847 150 223 2.40.10.480
ID Description Score Start End GO Terms
AF-A0A7S1MWQ3-F1-model_v4 Outer membrane protein assembly factor BamB 0.9748 191 349
AF-A0A519IAL8-F1-model_v4 Outer membrane protein assembly factor BamB 0.971 134 356
AF-A0A7S1MWQ3-F1-model_v4 Outer membrane protein assembly factor BamB 0.9688 191 349
AF-A0A7V8BLV1-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9684 86 364
AF-A0A7C9J9B4-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9592 86 370

Feature Viewer

pLDDT pTM Quality
88.13 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map