F484354
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 876 | 360 | 876 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10088252|Ga0157374_100882522 |
| Length | 222 |
| Sequence | LGEKTNCRLAERRPGWRHRTSDQIPKELQMSDRLQGKKIAILVANEGVEQVELTSPRDALREAGADLDLLAPEEDEIQAFNHLDKGDTFTPDKAVGKADPDDYDGLVLPGGVANPDQLRTDTDSVQFVRSFFEAGKPVGVICHGPWTLINAGVVDGRTLTSWPSLQTDLRNAGAEWVDEEVHVDQGLVSSRKPDDLEAFNAKIVEEFAEGVHEGQREATASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 11 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 131 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 226 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 236 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 240 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 241 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 242 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 243 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 246 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 247 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 250 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 312 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 313 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 316 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 355 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 356 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.72 |
| Metatranscriptomes | 6.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.2 |
| Nodule | 0 |
| Rhizoplane | 10.05 |
| Rhizosphere | 84.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010169 | 3300001979 | Bacteria | 3637 |
| 2 | JGI24748J21848_1001174 | 3300002074 | Bacteria | 2859 |
| 3 | JGI24744J21845_10036099 | 3300002077 | Bacteria | 934 |
| 4 | JGI24034J26672_10000090 | 3300002239 | Bacteria | 17113 |
| 5 | JGI24034J26672_10000145 | 3300002239 | Bacteria | 10311 |
| 6 | JGI24742J22300_10000813 | 3300002244 | Bacteria | 4761 |
| 7 | JGI25150J39212_1000023 | 3300002774 | Bacteria | 130663 |
| 8 | JGI25151J46595_10000082 | 3300003187 | Bacteria | 130832 |
| 9 | JGI25153J46596_10000060 | 3300003215 | Bacteria | 131744 |
| 10 | Ga0006777J48905_1038789 | 3300003308 | Bacteria | 1161 |
| 11 | JGI25407J50210_10013120 | 3300003373 | Bacteria | 2128 |
| 12 | Ga0006781J51513_1016641 | 3300003568 | Bacteria | 1173 |
| 13 | Ga0007416J51690_1082693 | 3300003577 | Bacteria | 666 |
| 14 | Ga0007429J51699_1024122 | 3300003579 | Bacteria | 1334 |
| 15 | Ga0007429J51699_1040927 | 3300003579 | Bacteria | 761 |
| 16 | Ga0007429J51699_1058940 | 3300003579 | Bacteria | 859 |
| 17 | Ga0032354_1046428 | 3300003693 | Bacteria | 720 |
| 18 | Ga0058861_10735126 | 3300004800 | Bacteria | 582 |
| 19 | Ga0065714_10002668 | 3300005288 | Bacteria | 15815 |
| 20 | Ga0065714_10009648 | 3300005288 | Bacteria | 4454 |
| 21 | Ga0070683_100000534 | 3300005329 | Bacteria | 26797 |
| 22 | Ga0070683_100000888 | 3300005329 | Bacteria | 22212 |
| 23 | Ga0070683_100002079 | 3300005329 | Bacteria | 15807 |
| 24 | Ga0070683_100013741 | 3300005329 | Bacteria | 7068 |
| 25 | Ga0070683_100022176 | 3300005329 | Bacteria | 5674 |
| 26 | Ga0070683_100097447 | 3300005329 | Bacteria | 2766 |
| 27 | Ga0070683_100173974 | 3300005329 | Bacteria | 2044 |
| 28 | Ga0070690_100377100 | 3300005330 | Bacteria | 1036 |
| 29 | Ga0070670_100012696 | 3300005331 | Bacteria | 7212 |
| 30 | Ga0070670_100092750 | 3300005331 | Bacteria | 2597 |
| 31 | Ga0070677_10000081 | 3300005333 | Bacteria | 30569 |
| 32 | Ga0068869_100124005 | 3300005334 | Bacteria | 1979 |
| 33 | Ga0068869_100207910 | 3300005334 | Bacteria | 1546 |
| 34 | Ga0070680_100761350 | 3300005336 | Bacteria | 834 |
| 35 | Ga0070682_100000102 | 3300005337 | Bacteria | 76457 |
| 36 | Ga0070682_100000556 | 3300005337 | Bacteria | 23033 |
| 37 | Ga0070682_100001507 | 3300005337 | Bacteria | 13059 |
| 38 | Ga0070682_100007875 | 3300005337 | Bacteria | 5996 |
| 39 | Ga0068868_100000634 | 3300005338 | Bacteria | 23652 |
| 40 | Ga0068868_100001874 | 3300005338 | Bacteria | 14438 |
| 41 | Ga0068868_100006732 | 3300005338 | Bacteria | 8158 |
| 42 | Ga0068868_100015451 | 3300005338 | Bacteria | 5647 |
| 43 | Ga0068868_100181876 | 3300005338 | Bacteria | 1744 |
| 44 | Ga0068868_100738622 | 3300005338 | Bacteria | 883 |
| 45 | Ga0070660_100038941 | 3300005339 | Bacteria | 3612 |
| 46 | Ga0070660_100513137 | 3300005339 | Bacteria | 998 |
| 47 | Ga0070689_100015468 | 3300005340 | Bacteria | 5565 |
| 48 | Ga0070689_100333038 | 3300005340 | Bacteria | 1270 |
| 49 | Ga0070691_10000064 | 3300005341 | Bacteria | 29794 |
| 50 | Ga0070691_10006974 | 3300005341 | Bacteria | 5175 |
| 51 | Ga0070691_10151049 | 3300005341 | Bacteria | 1191 |
| 52 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 53 | Ga0070661_100009995 | 3300005344 | Bacteria | 6585 |
| 54 | Ga0070692_10012328 | 3300005345 | Bacteria | 3953 |
| 55 | Ga0070692_10040923 | 3300005345 | Bacteria | 2372 |
| 56 | Ga0070668_100022553 | 3300005347 | Bacteria | 4760 |
| 57 | Ga0070668_100050286 | 3300005347 | Bacteria | 3209 |
| 58 | Ga0070668_100113504 | 3300005347 | Bacteria | 2158 |
| 59 | Ga0070669_100141831 | 3300005353 | Bacteria | 1853 |
| 60 | Ga0070675_100000078 | 3300005354 | Bacteria | 56469 |
| 61 | Ga0070675_100010461 | 3300005354 | Bacteria | 7248 |
| 62 | Ga0070675_100119336 | 3300005354 | Bacteria | 2240 |
| 63 | Ga0070675_100226255 | 3300005354 | Bacteria | 1630 |
| 64 | Ga0070674_100008538 | 3300005356 | Bacteria | 6107 |
| 65 | Ga0070673_100010697 | 3300005364 | Bacteria | 6222 |
| 66 | Ga0070673_100069826 | 3300005364 | Bacteria | 2817 |
| 67 | Ga0070688_100000705 | 3300005365 | Bacteria | 16441 |
| 68 | Ga0070688_100000989 | 3300005365 | Bacteria | 14241 |
| 69 | Ga0070688_100034871 | 3300005365 | Bacteria | 3052 |
| 70 | Ga0070688_100044102 | 3300005365 | Bacteria | 2751 |
| 71 | Ga0070659_100001523 | 3300005366 | Bacteria | 16707 |
| 72 | Ga0070659_100002700 | 3300005366 | Bacteria | 12615 |
| 73 | Ga0070659_100030992 | 3300005366 | Bacteria | 4140 |
| 74 | Ga0070659_100039854 | 3300005366 | Bacteria | 3669 |
| 75 | Ga0070659_100055816 | 3300005366 | Bacteria | 3114 |
| 76 | Ga0070659_100176187 | 3300005366 | Bacteria | 1753 |
| 77 | Ga0070659_100408704 | 3300005366 | Bacteria | 1147 |
| 78 | Ga0070667_100388345 | 3300005367 | Bacteria | 1269 |
| 79 | Ga0070714_100001023 | 3300005435 | Bacteria | 19974 |
| 80 | Ga0070714_100074817 | 3300005435 | Bacteria | 2937 |
| 81 | Ga0070714_100770019 | 3300005435 | Bacteria | 931 |
| 82 | Ga0070713_100000005 | 3300005436 | Bacteria | 201526 |
| 83 | Ga0070701_10214389 | 3300005438 | Bacteria | 1145 |
| 84 | Ga0070711_100178853 | 3300005439 | Bacteria | 1623 |
| 85 | Ga0070705_100018095 | 3300005440 | Bacteria | 3688 |
| 86 | Ga0070705_100108681 | 3300005440 | Bacteria | 1767 |
| 87 | Ga0070705_100114521 | 3300005440 | Bacteria | 1730 |
| 88 | Ga0070700_100031852 | 3300005441 | Bacteria | 3164 |
| 89 | Ga0070700_100046229 | 3300005441 | Bacteria | 2689 |
| 90 | Ga0070700_100184149 | 3300005441 | Bacteria | 1456 |
| 91 | Ga0070694_100466781 | 3300005444 | Bacteria | 999 |
| 92 | Ga0070694_100510655 | 3300005444 | Bacteria | 957 |
| 93 | Ga0070708_100404217 | 3300005445 | Bacteria | 1288 |
| 94 | Ga0070663_100007026 | 3300005455 | Bacteria | 6821 |
| 95 | Ga0070663_100009721 | 3300005455 | Bacteria | 5969 |
| 96 | Ga0070663_100013544 | 3300005455 | Bacteria | 5205 |
| 97 | Ga0070663_100583445 | 3300005455 | Bacteria | 938 |
| 98 | Ga0070663_100708643 | 3300005455 | Bacteria | 856 |
| 99 | Ga0070678_100054845 | 3300005456 | Bacteria | 2907 |
| 100 | Ga0070662_100007829 | 3300005457 | Bacteria | 6941 |
| 101 | Ga0070662_100276367 | 3300005457 | Bacteria | 1358 |
| 102 | Ga0070681_10111778 | 3300005458 | Bacteria | 2671 |
| 103 | Ga0070681_10299487 | 3300005458 | Bacteria | 1518 |
| 104 | Ga0068867_100000278 | 3300005459 | Bacteria | 33730 |
| 105 | Ga0068867_100028276 | 3300005459 | Bacteria | 4036 |
| 106 | Ga0070685_10000012 | 3300005466 | Bacteria | 128823 |
| 107 | Ga0070685_10001134 | 3300005466 | Bacteria | 14241 |
| 108 | Ga0070685_10008752 | 3300005466 | Bacteria | 5211 |
| 109 | Ga0070706_100308291 | 3300005467 | Bacteria | 1477 |
| 110 | Ga0070679_100011522 | 3300005530 | Bacteria | 8429 |
| 111 | Ga0070684_100001038 | 3300005535 | Bacteria | 19838 |
| 112 | Ga0070684_100004844 | 3300005535 | Bacteria | 10285 |
| 113 | Ga0070684_100007134 | 3300005535 | Bacteria | 8680 |
| 114 | Ga0070684_100010265 | 3300005535 | Bacteria | 7413 |
| 115 | Ga0070684_100015887 | 3300005535 | Bacteria | 6144 |
| 116 | Ga0070684_100060185 | 3300005535 | Bacteria | 3321 |
| 117 | Ga0070684_100086257 | 3300005535 | Bacteria | 2786 |
| 118 | Ga0070684_100128128 | 3300005535 | Bacteria | 2288 |
| 119 | Ga0070684_100321377 | 3300005535 | Bacteria | 1422 |
| 120 | Ga0068853_100049531 | 3300005539 | Bacteria | 3610 |
| 121 | Ga0068853_100304048 | 3300005539 | Bacteria | 1475 |
| 122 | Ga0068853_100371266 | 3300005539 | Bacteria | 1334 |
| 123 | Ga0070672_100107935 | 3300005543 | Bacteria | 2266 |
| 124 | Ga0070672_100159022 | 3300005543 | Bacteria | 1873 |
| 125 | Ga0070672_101094733 | 3300005543 | Bacteria | 708 |
| 126 | Ga0070686_100190739 | 3300005544 | Bacteria | 1463 |
| 127 | Ga0070696_100115792 | 3300005546 | Bacteria | 1935 |
| 128 | Ga0070696_100290466 | 3300005546 | Bacteria | 1249 |
| 129 | Ga0070693_100015108 | 3300005547 | Bacteria | 3970 |
| 130 | Ga0070665_100000604 | 3300005548 | Bacteria | 49409 |
| 131 | Ga0070665_100217538 | 3300005548 | Bacteria | 1911 |
| 132 | Ga0068855_100316178 | 3300005563 | Bacteria | 1727 |
| 133 | Ga0068855_100446339 | 3300005563 | Bacteria | 1412 |
| 134 | Ga0070664_100022449 | 3300005564 | Bacteria | 5203 |
| 135 | Ga0070664_100052767 | 3300005564 | Bacteria | 3444 |
| 136 | Ga0070664_100224471 | 3300005564 | Bacteria | 1682 |
| 137 | Ga0070664_100325015 | 3300005564 | Bacteria | 1394 |
| 138 | Ga0070664_100955056 | 3300005564 | Bacteria | 805 |
| 139 | Ga0068857_100025723 | 3300005577 | Bacteria | 5182 |
| 140 | Ga0068857_100131984 | 3300005577 | Bacteria | 2253 |
| 141 | Ga0068857_100592034 | 3300005577 | Bacteria | 1048 |
| 142 | Ga0068854_100000062 | 3300005578 | Bacteria | 78159 |
| 143 | Ga0068854_100322363 | 3300005578 | Bacteria | 1256 |
| 144 | Ga0068856_100000377 | 3300005614 | Bacteria | 48877 |
| 145 | Ga0068856_100005163 | 3300005614 | Bacteria | 12894 |
| 146 | Ga0068856_100007632 | 3300005614 | Bacteria | 10556 |
| 147 | Ga0068856_100028080 | 3300005614 | Bacteria | 5492 |
| 148 | Ga0070702_100019981 | 3300005615 | Bacteria | 3502 |
| 149 | Ga0070702_100086548 | 3300005615 | Bacteria | 1890 |
| 150 | Ga0070702_100094861 | 3300005615 | Bacteria | 1817 |
| 151 | Ga0070702_100098954 | 3300005615 | Bacteria | 1785 |
| 152 | Ga0070702_100137091 | 3300005615 | Bacteria | 1554 |
| 153 | Ga0068852_100000022 | 3300005616 | Bacteria | 125196 |
| 154 | Ga0068852_100012477 | 3300005616 | Bacteria | 6454 |
| 155 | Ga0068852_100103195 | 3300005616 | Bacteria | 2578 |
| 156 | Ga0068852_100556184 | 3300005616 | Bacteria | 1148 |
| 157 | Ga0068852_100622780 | 3300005616 | Bacteria | 1085 |
| 158 | Ga0068852_100941234 | 3300005616 | Bacteria | 882 |
| 159 | Ga0068859_101001881 | 3300005617 | Bacteria | 917 |
| 160 | Ga0068859_101174610 | 3300005617 | Bacteria | 845 |
| 161 | Ga0068859_101729063 | 3300005617 | Bacteria | 691 |
| 162 | Ga0068864_100052452 | 3300005618 | Bacteria | 3515 |
| 163 | Ga0068866_10095277 | 3300005718 | Bacteria | 1630 |
| 164 | Ga0068866_10172042 | 3300005718 | Bacteria | 1272 |
| 165 | Ga0068861_100315762 | 3300005719 | Bacteria | 1359 |
| 166 | Ga0068861_100601683 | 3300005719 | Bacteria | 1009 |
| 167 | Ga0068861_100992264 | 3300005719 | Bacteria | 801 |
| 168 | Ga0068851_10000297 | 3300005834 | Bacteria | 22748 |
| 169 | Ga0068851_10024779 | 3300005834 | Bacteria | 2939 |
| 170 | Ga0068851_10091962 | 3300005834 | Bacteria | 1598 |
| 171 | Ga0068870_10150456 | 3300005840 | Bacteria | 1371 |
| 172 | Ga0068863_100000032 | 3300005841 | Bacteria | 172402 |
| 173 | Ga0068863_100021805 | 3300005841 | Bacteria | 6113 |
| 174 | Ga0068863_100160081 | 3300005841 | Bacteria | 2156 |
| 175 | Ga0068858_100000343 | 3300005842 | Bacteria | 49409 |
| 176 | Ga0068858_100059212 | 3300005842 | Bacteria | 3540 |
| 177 | Ga0068858_100071409 | 3300005842 | Bacteria | 3220 |
| 178 | Ga0068858_100091683 | 3300005842 | Bacteria | 2828 |
| 179 | Ga0068858_100252309 | 3300005842 | Bacteria | 1676 |
| 180 | Ga0068860_100238767 | 3300005843 | Bacteria | 1767 |
| 181 | Ga0068862_100025482 | 3300005844 | Bacteria | 4966 |
| 182 | Ga0068862_100086672 | 3300005844 | Bacteria | 2723 |
| 183 | Ga0068862_100785944 | 3300005844 | Bacteria | 928 |
| 184 | Ga0081455_10025637 | 3300005937 | Bacteria | 5438 |
| 185 | Ga0081455_10269259 | 3300005937 | Bacteria | 1237 |
| 186 | Ga0081538_10002334 | 3300005981 | Bacteria | 18714 |
| 187 | Ga0081538_10002916 | 3300005981 | Bacteria | 16307 |
| 188 | Ga0081538_10008690 | 3300005981 | Bacteria | 8583 |
| 189 | Ga0081538_10009623 | 3300005981 | Bacteria | 8037 |
| 190 | Ga0081538_10025242 | 3300005981 | Bacteria | 4199 |
| 191 | Ga0081538_10134014 | 3300005981 | Bacteria | 1158 |
| 192 | Ga0081538_10165413 | 3300005981 | Bacteria | 975 |
| 193 | Ga0081540_1084274 | 3300005983 | Bacteria | 1419 |
| 194 | Ga0081539_10074225 | 3300005985 | Bacteria | 1812 |
| 195 | Ga0081539_10150133 | 3300005985 | Bacteria | 1122 |
| 196 | Ga0081539_10253126 | 3300005985 | Bacteria | 781 |
| 197 | Ga0075365_10000884 | 3300006038 | Bacteria | 12532 |
| 198 | Ga0075365_10009869 | 3300006038 | Bacteria | 5523 |
| 199 | Ga0075365_10078115 | 3300006038 | Bacteria | 2237 |
| 200 | Ga0075363_100009250 | 3300006048 | Bacteria | 4628 |
| 201 | Ga0075364_10055657 | 3300006051 | Bacteria | 2588 |
| 202 | Ga0075364_10068968 | 3300006051 | Bacteria | 2326 |
| 203 | Ga0075364_10332394 | 3300006051 | Bacteria | 1035 |
| 204 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 205 | Ga0070716_100107080 | 3300006173 | Bacteria | 1725 |
| 206 | Ga0070712_100000009 | 3300006175 | Bacteria | 143615 |
| 207 | Ga0070712_100007920 | 3300006175 | Bacteria | 6662 |
| 208 | Ga0070712_100115984 | 3300006175 | Bacteria | 2008 |
| 209 | Ga0075367_10227532 | 3300006178 | Bacteria | 1168 |
| 210 | Ga0075367_10268715 | 3300006178 | Bacteria | 1071 |
| 211 | Ga0097621_100549664 | 3300006237 | Bacteria | 1051 |
| 212 | Ga0075428_100130007 | 3300006844 | Bacteria | 2739 |
| 213 | Ga0075430_100129532 | 3300006846 | Bacteria | 2103 |
| 214 | Ga0075433_10431955 | 3300006852 | Bacteria | 1161 |
| 215 | Ga0075434_100333981 | 3300006871 | Bacteria | 1536 |
| 216 | Ga0068865_100000135 | 3300006881 | Bacteria | 38521 |
| 217 | Ga0068865_100044332 | 3300006881 | Bacteria | 3044 |
| 218 | Ga0068865_100167621 | 3300006881 | Bacteria | 1681 |
| 219 | Ga0068865_100246995 | 3300006881 | Bacteria | 1407 |
| 220 | Ga0068865_100327960 | 3300006881 | Bacteria | 1233 |
| 221 | Ga0068865_100753233 | 3300006881 | Bacteria | 837 |
| 222 | Ga0097620_101001848 | 3300006931 | Bacteria | 917 |
| 223 | Ga0097620_101174635 | 3300006931 | Bacteria | 845 |
| 224 | Ga0097620_101728702 | 3300006931 | Bacteria | 691 |
| 225 | Ga0075435_100655607 | 3300007076 | Bacteria | 911 |
| 226 | Ga0105240_10341615 | 3300009093 | Bacteria | 1700 |
| 227 | Ga0105240_11186786 | 3300009093 | Bacteria | 809 |
| 228 | Ga0111539_10005936 | 3300009094 | Bacteria | 15772 |
| 229 | Ga0111539_10069371 | 3300009094 | Bacteria | 4162 |
| 230 | Ga0111539_10092681 | 3300009094 | Bacteria | 3550 |
| 231 | Ga0105245_10000022 | 3300009098 | Bacteria | 181225 |
| 232 | Ga0105245_10000023 | 3300009098 | Bacteria | 180844 |
| 233 | Ga0105245_10000975 | 3300009098 | Bacteria | 26135 |
| 234 | Ga0105245_10001336 | 3300009098 | Bacteria | 22321 |
| 235 | Ga0105245_10003920 | 3300009098 | Bacteria | 13225 |
| 236 | Ga0105245_10004839 | 3300009098 | Bacteria | 11864 |
| 237 | Ga0105245_10734819 | 3300009098 | Bacteria | 1022 |
| 238 | Ga0105247_10311119 | 3300009101 | Bacteria | 1096 |
| 239 | Ga0114129_10229197 | 3300009147 | Bacteria | 2503 |
| 240 | Ga0114129_11708635 | 3300009147 | Bacteria | 768 |
| 241 | Ga0105243_10008888 | 3300009148 | Bacteria | 7686 |
| 242 | Ga0105243_10046939 | 3300009148 | Bacteria | 3399 |
| 243 | Ga0105243_10209647 | 3300009148 | Bacteria | 1715 |
| 244 | Ga0105243_10280006 | 3300009148 | Bacteria | 1502 |
| 245 | Ga0105241_10040715 | 3300009174 | Bacteria | 3508 |
| 246 | Ga0105241_10716217 | 3300009174 | Bacteria | 915 |
| 247 | Ga0105242_10000034 | 3300009176 | Bacteria | 95536 |
| 248 | Ga0105242_10085386 | 3300009176 | Bacteria | 2647 |
| 249 | Ga0105242_10196366 | 3300009176 | Bacteria | 1790 |
| 250 | Ga0105248_10000245 | 3300009177 | Bacteria | 62951 |
| 251 | Ga0105248_10058896 | 3300009177 | Bacteria | 4314 |
| 252 | Ga0105248_10491642 | 3300009177 | Bacteria | 1383 |
| 253 | Ga0105248_11588538 | 3300009177 | Bacteria | 741 |
| 254 | Ga0105237_10534592 | 3300009545 | Bacteria | 1179 |
| 255 | Ga0105238_10000028 | 3300009551 | Bacteria | 188361 |
| 256 | Ga0105238_10313308 | 3300009551 | Bacteria | 1554 |
| 257 | Ga0105238_10566905 | 3300009551 | Bacteria | 1141 |
| 258 | Ga0105238_11351692 | 3300009551 | Bacteria | 739 |
| 259 | Ga0105249_10000181 | 3300009553 | Bacteria | 73946 |
| 260 | Ga0105249_10065721 | 3300009553 | Bacteria | 3337 |
| 261 | Ga0105249_10308920 | 3300009553 | Bacteria | 1589 |
| 262 | Ga0105249_11104708 | 3300009553 | Bacteria | 863 |
| 263 | Ga0105249_11262741 | 3300009553 | Bacteria | 810 |
| 264 | Ga0105239_10014181 | 3300010375 | Bacteria | 8844 |
| 265 | Ga0105239_10048810 | 3300010375 | Bacteria | 4641 |
| 266 | Ga0105239_10133333 | 3300010375 | Bacteria | 2764 |
| 267 | Ga0105239_10200112 | 3300010375 | Bacteria | 2238 |
| 268 | Ga0105239_10375416 | 3300010375 | Bacteria | 1607 |
| 269 | Ga0105239_10941013 | 3300010375 | Bacteria | 992 |
| 270 | Ga0105246_10102252 | 3300011119 | Bacteria | 2089 |
| 271 | Ga0105246_10236673 | 3300011119 | Bacteria | 1441 |
| 272 | Ga0154014_151005 | 3300013052 | Bacteria | 836 |
| 273 | Ga0157373_10001726 | 3300013100 | Bacteria | 16609 |
| 274 | Ga0157373_10089132 | 3300013100 | Bacteria | 2173 |
| 275 | Ga0157371_10004879 | 3300013102 | Bacteria | 11527 |
| 276 | Ga0157370_10002276 | 3300013104 | Bacteria | 23284 |
| 277 | Ga0157370_10003533 | 3300013104 | Bacteria | 18310 |
| 278 | Ga0157370_10135255 | 3300013104 | Bacteria | 2298 |
| 279 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 280 | Ga0157369_10552697 | 3300013105 | Bacteria | 1190 |
| 281 | Ga0157374_10001500 | 3300013296 | Bacteria | 19673 |
| 282 | Ga0157374_10003363 | 3300013296 | Bacteria | 13434 |
| 283 | Ga0157374_10088252 | 3300013296 | Bacteria | 2953 |
| 284 | Ga0157374_10201302 | 3300013296 | Bacteria | 1950 |
| 285 | Ga0157378_10001375 | 3300013297 | Bacteria | 21833 |
| 286 | Ga0157378_10396402 | 3300013297 | Bacteria | 1359 |
| 287 | Ga0163162_10066169 | 3300013306 | Bacteria | 3662 |
| 288 | Ga0163162_10194466 | 3300013306 | Bacteria | 2157 |
| 289 | Ga0157372_10000550 | 3300013307 | Bacteria | 41234 |
| 290 | Ga0157372_10001751 | 3300013307 | Bacteria | 23533 |
| 291 | Ga0157375_10000127 | 3300013308 | Bacteria | 75142 |
| 292 | Ga0157375_10000765 | 3300013308 | Bacteria | 28141 |
| 293 | Ga0157375_10005447 | 3300013308 | Bacteria | 11066 |
| 294 | Ga0157375_10096174 | 3300013308 | Bacteria | 3034 |
| 295 | Ga0157375_10104038 | 3300013308 | Bacteria | 2927 |
| 296 | Ga0157375_10255339 | 3300013308 | Bacteria | 1914 |
| 297 | Ga0157375_10388873 | 3300013308 | Bacteria | 1562 |
| 298 | Ga0157375_10917946 | 3300013308 | Bacteria | 1019 |
| 299 | Ga0163163_10050696 | 3300014325 | Bacteria | 4088 |
| 300 | Ga0163163_10840061 | 3300014325 | Bacteria | 982 |
| 301 | Ga0157380_10014388 | 3300014326 | Bacteria | 5787 |
| 302 | Ga0157380_10090973 | 3300014326 | Bacteria | 2518 |
| 303 | Ga0157380_10361637 | 3300014326 | Bacteria | 1362 |
| 304 | Ga0157377_10002140 | 3300014745 | Bacteria | 8681 |
| 305 | Ga0157377_10012344 | 3300014745 | Bacteria | 4295 |
| 306 | Ga0157377_10029745 | 3300014745 | Bacteria | 2953 |
| 307 | Ga0157377_10042863 | 3300014745 | Bacteria | 2515 |
| 308 | Ga0157377_10344517 | 3300014745 | Bacteria | 998 |
| 309 | Ga0157379_10005332 | 3300014968 | Bacteria | 11046 |
| 310 | Ga0157379_10459290 | 3300014968 | Bacteria | 1177 |
| 311 | Ga0157376_10176956 | 3300014969 | Bacteria | 1947 |
| 312 | Ga0157376_11170484 | 3300014969 | Bacteria | 796 |
| 313 | Ga0163161_10000013 | 3300017792 | Bacteria | 258747 |
| 314 | Ga0163161_10263457 | 3300017792 | Bacteria | 1347 |
| 315 | Ga0163161_10794421 | 3300017792 | Bacteria | 795 |
| 316 | Ga0163161_10997194 | 3300017792 | Bacteria | 715 |
| 317 | Ga0197907_10308920 | 3300020069 | Bacteria | 1033 |
| 318 | Ga0197907_10601346 | 3300020069 | Bacteria | 733 |
| 319 | Ga0197907_10816812 | 3300020069 | Bacteria | 1300 |
| 320 | Ga0197907_11146121 | 3300020069 | Bacteria | 1599 |
| 321 | Ga0197907_11376416 | 3300020069 | Bacteria | 623 |
| 322 | Ga0197907_11450979 | 3300020069 | Bacteria | 1083 |
| 323 | Ga0206356_10943150 | 3300020070 | Bacteria | 1641 |
| 324 | Ga0206356_11357271 | 3300020070 | Bacteria | 1214 |
| 325 | Ga0206356_11573056 | 3300020070 | Bacteria | 1318 |
| 326 | Ga0206356_11579150 | 3300020070 | Bacteria | 768 |
| 327 | Ga0206356_11861396 | 3300020070 | Bacteria | 1439 |
| 328 | Ga0206349_1042634 | 3300020075 | Bacteria | 1896 |
| 329 | Ga0206349_1072408 | 3300020075 | Bacteria | 956 |
| 330 | Ga0206349_1144720 | 3300020075 | Bacteria | 949 |
| 331 | Ga0206349_1166632 | 3300020075 | Bacteria | 1196 |
| 332 | Ga0206349_1841112 | 3300020075 | Bacteria | 640 |
| 333 | Ga0206349_1866038 | 3300020075 | Bacteria | 1354 |
| 334 | Ga0206355_1701321 | 3300020076 | Bacteria | 1219 |
| 335 | Ga0206351_10727604 | 3300020077 | Bacteria | 707 |
| 336 | Ga0206351_10912576 | 3300020077 | Bacteria | 644 |
| 337 | Ga0206351_10977218 | 3300020077 | Bacteria | 674 |
| 338 | Ga0206352_10098428 | 3300020078 | Bacteria | 1370 |
| 339 | Ga0206352_10263854 | 3300020078 | Bacteria | 1046 |
| 340 | Ga0206352_11263724 | 3300020078 | Bacteria | 782 |
| 341 | Ga0206350_10174780 | 3300020080 | Bacteria | 908 |
| 342 | Ga0206350_10388591 | 3300020080 | Bacteria | 969 |
| 343 | Ga0206350_10519099 | 3300020080 | Bacteria | 783 |
| 344 | Ga0206350_10624272 | 3300020080 | Bacteria | 852 |
| 345 | Ga0206350_10662425 | 3300020080 | Bacteria | 1025 |
| 346 | Ga0206350_10849943 | 3300020080 | Bacteria | 732 |
| 347 | Ga0206354_10628115 | 3300020081 | Bacteria | 1414 |
| 348 | Ga0206354_10816607 | 3300020081 | Bacteria | 1160 |
| 349 | Ga0206354_11397997 | 3300020081 | Bacteria | 1442 |
| 350 | Ga0206354_11539976 | 3300020081 | Bacteria | 1516 |
| 351 | Ga0206353_10346301 | 3300020082 | Bacteria | 701 |
| 352 | Ga0206353_10543008 | 3300020082 | Bacteria | 1240 |
| 353 | Ga0206353_10602801 | 3300020082 | Bacteria | 1115 |
| 354 | Ga0206353_11205913 | 3300020082 | Bacteria | 1285 |
| 355 | Ga0206353_11695836 | 3300020082 | Bacteria | 1409 |
| 356 | Ga0224712_10016960 | 3300022467 | Bacteria | 2405 |
| 357 | Ga0224712_10178143 | 3300022467 | Bacteria | 956 |
| 358 | Ga0224712_10203642 | 3300022467 | Bacteria | 900 |
| 359 | Ga0224712_10218733 | 3300022467 | Bacteria | 871 |
| 360 | Ga0224712_10277737 | 3300022467 | Bacteria | 779 |
| 361 | Ga0224712_10351005 | 3300022467 | Bacteria | 697 |
| 362 | Ga0207425_1000051 | 3300025245 | Bacteria | 166795 |
| 363 | Ga0209129_1000121 | 3300025258 | Bacteria | 135404 |
| 364 | Ga0209025_1000160 | 3300025294 | Bacteria | 166795 |
| 365 | Ga0209758_1000147 | 3300025297 | Bacteria | 166795 |
| 366 | Ga0207656_10000084 | 3300025321 | Bacteria | 35284 |
| 367 | Ga0207656_10012836 | 3300025321 | Bacteria | 3190 |
| 368 | Ga0207653_10156476 | 3300025885 | Bacteria | 841 |
| 369 | Ga0207682_10000327 | 3300025893 | Bacteria | 21656 |
| 370 | Ga0207692_10119988 | 3300025898 | Bacteria | 1471 |
| 371 | Ga0207688_10001154 | 3300025901 | Bacteria | 13616 |
| 372 | Ga0207688_10007117 | 3300025901 | Bacteria | 6085 |
| 373 | Ga0207688_10063636 | 3300025901 | Bacteria | 2081 |
| 374 | Ga0207688_10104859 | 3300025901 | Bacteria | 1636 |
| 375 | Ga0207647_10147180 | 3300025904 | Bacteria | 1378 |
| 376 | Ga0207685_10000005 | 3300025905 | Bacteria | 289944 |
| 377 | Ga0207645_10254228 | 3300025907 | Bacteria | 1163 |
| 378 | Ga0207645_10266828 | 3300025907 | Bacteria | 1134 |
| 379 | Ga0207643_10057698 | 3300025908 | Bacteria | 2211 |
| 380 | Ga0207643_10090946 | 3300025908 | Bacteria | 1779 |
| 381 | Ga0207643_10153756 | 3300025908 | Bacteria | 1381 |
| 382 | Ga0207705_10652835 | 3300025909 | Bacteria | 818 |
| 383 | Ga0207684_10191537 | 3300025910 | Bacteria | 1764 |
| 384 | Ga0207654_10024265 | 3300025911 | Bacteria | 3258 |
| 385 | Ga0207707_10088518 | 3300025912 | Bacteria | 2705 |
| 386 | Ga0207707_10203577 | 3300025912 | Bacteria | 1725 |
| 387 | Ga0207695_10188864 | 3300025913 | Bacteria | 1978 |
| 388 | Ga0207695_10357716 | 3300025913 | Bacteria | 1346 |
| 389 | Ga0207693_10000036 | 3300025915 | Bacteria | 109562 |
| 390 | Ga0207693_10036252 | 3300025915 | Bacteria | 3888 |
| 391 | Ga0207693_10040330 | 3300025915 | Bacteria | 3678 |
| 392 | Ga0207693_10054303 | 3300025915 | Bacteria | 3143 |
| 393 | Ga0207663_10057935 | 3300025916 | Bacteria | 2443 |
| 394 | Ga0207663_10308964 | 3300025916 | Bacteria | 1184 |
| 395 | Ga0207660_10008879 | 3300025917 | Bacteria | 6497 |
| 396 | Ga0207660_10705803 | 3300025917 | Bacteria | 823 |
| 397 | Ga0207657_10003298 | 3300025919 | Bacteria | 17254 |
| 398 | Ga0207657_10058617 | 3300025919 | Bacteria | 3312 |
| 399 | Ga0207657_10077543 | 3300025919 | Bacteria | 2800 |
| 400 | Ga0207657_10082550 | 3300025919 | Bacteria | 2697 |
| 401 | Ga0207657_10086996 | 3300025919 | Bacteria | 2615 |
| 402 | Ga0207657_10130274 | 3300025919 | Bacteria | 2062 |
| 403 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 404 | Ga0207649_10493771 | 3300025920 | Bacteria | 930 |
| 405 | Ga0207652_10008003 | 3300025921 | Bacteria | 8483 |
| 406 | Ga0207652_10065133 | 3300025921 | Bacteria | 3155 |
| 407 | Ga0207681_10134586 | 3300025923 | Bacteria | 1832 |
| 408 | Ga0207681_10722438 | 3300025923 | Bacteria | 829 |
| 409 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 410 | Ga0207694_10126216 | 3300025924 | Bacteria | 2047 |
| 411 | Ga0207694_10186853 | 3300025924 | Bacteria | 1682 |
| 412 | Ga0207694_10310107 | 3300025924 | Bacteria | 1301 |
| 413 | Ga0207650_10567390 | 3300025925 | Bacteria | 952 |
| 414 | Ga0207650_10584826 | 3300025925 | Bacteria | 938 |
| 415 | Ga0207659_10000018 | 3300025926 | Bacteria | 156920 |
| 416 | Ga0207659_10006926 | 3300025926 | Bacteria | 6966 |
| 417 | Ga0207659_10048959 | 3300025926 | Bacteria | 2996 |
| 418 | Ga0207659_10197705 | 3300025926 | Bacteria | 1603 |
| 419 | Ga0207687_10000015 | 3300025927 | Bacteria | 261701 |
| 420 | Ga0207687_10000039 | 3300025927 | Bacteria | 114303 |
| 421 | Ga0207687_10007940 | 3300025927 | Bacteria | 6948 |
| 422 | Ga0207687_10027612 | 3300025927 | Bacteria | 3810 |
| 423 | Ga0207687_10033552 | 3300025927 | Bacteria | 3482 |
| 424 | Ga0207687_10049069 | 3300025927 | Bacteria | 2934 |
| 425 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 426 | Ga0207664_10000013 | 3300025929 | Bacteria | 260716 |
| 427 | Ga0207664_10035621 | 3300025929 | Bacteria | 3842 |
| 428 | Ga0207664_10223474 | 3300025929 | Bacteria | 1634 |
| 429 | Ga0207664_10600991 | 3300025929 | Bacteria | 988 |
| 430 | Ga0207690_10000064 | 3300025932 | Bacteria | 95169 |
| 431 | Ga0207690_10007587 | 3300025932 | Bacteria | 6436 |
| 432 | Ga0207690_10020231 | 3300025932 | Bacteria | 4109 |
| 433 | Ga0207690_10164392 | 3300025932 | Bacteria | 1657 |
| 434 | Ga0207690_10193428 | 3300025932 | Bacteria | 1540 |
| 435 | Ga0207690_10285246 | 3300025932 | Bacteria | 1287 |
| 436 | Ga0207706_10001985 | 3300025933 | Bacteria | 20065 |
| 437 | Ga0207706_10042627 | 3300025933 | Bacteria | 4022 |
| 438 | Ga0207706_10137784 | 3300025933 | Bacteria | 2147 |
| 439 | Ga0207706_10509477 | 3300025933 | Bacteria | 1038 |
| 440 | Ga0207686_10483811 | 3300025934 | Bacteria | 958 |
| 441 | Ga0207709_10097972 | 3300025935 | Bacteria | 1932 |
| 442 | Ga0207709_10114728 | 3300025935 | Bacteria | 1808 |
| 443 | Ga0207709_10195429 | 3300025935 | Bacteria | 1441 |
| 444 | Ga0207709_10515015 | 3300025935 | Bacteria | 936 |
| 445 | Ga0207709_10696105 | 3300025935 | Bacteria | 813 |
| 446 | Ga0207670_10093933 | 3300025936 | Bacteria | 2127 |
| 447 | Ga0207670_10249857 | 3300025936 | Bacteria | 1370 |
| 448 | Ga0207670_10255572 | 3300025936 | Bacteria | 1356 |
| 449 | Ga0207670_10354993 | 3300025936 | Bacteria | 1162 |
| 450 | Ga0207669_10133727 | 3300025937 | Bacteria | 1709 |
| 451 | Ga0207669_10231327 | 3300025937 | Bacteria | 1364 |
| 452 | Ga0207669_10555855 | 3300025937 | Bacteria | 927 |
| 453 | Ga0207704_10000026 | 3300025938 | Bacteria | 123892 |
| 454 | Ga0207704_10008364 | 3300025938 | Bacteria | 4943 |
| 455 | Ga0207704_10141477 | 3300025938 | Bacteria | 1684 |
| 456 | Ga0207704_10788847 | 3300025938 | Bacteria | 792 |
| 457 | Ga0207665_10032210 | 3300025939 | Bacteria | 3470 |
| 458 | Ga0207691_10078513 | 3300025940 | Bacteria | 2971 |
| 459 | Ga0207691_10142893 | 3300025940 | Bacteria | 2108 |
| 460 | Ga0207691_10151705 | 3300025940 | Bacteria | 2037 |
| 461 | Ga0207691_10591091 | 3300025940 | Bacteria | 940 |
| 462 | Ga0207711_10000192 | 3300025941 | Bacteria | 65599 |
| 463 | Ga0207711_10015551 | 3300025941 | Bacteria | 6315 |
| 464 | Ga0207711_11060061 | 3300025941 | Bacteria | 751 |
| 465 | Ga0207689_10094424 | 3300025942 | Bacteria | 2456 |
| 466 | Ga0207689_10155091 | 3300025942 | Bacteria | 1887 |
| 467 | Ga0207661_10000235 | 3300025944 | Bacteria | 36349 |
| 468 | Ga0207661_10000247 | 3300025944 | Bacteria | 35222 |
| 469 | Ga0207661_10001056 | 3300025944 | Bacteria | 18313 |
| 470 | Ga0207661_10004455 | 3300025944 | Bacteria | 9840 |
| 471 | Ga0207661_10062212 | 3300025944 | Bacteria | 3019 |
| 472 | Ga0207661_10075358 | 3300025944 | Bacteria | 2768 |
| 473 | Ga0207661_10313874 | 3300025944 | Bacteria | 1408 |
| 474 | Ga0207679_10014783 | 3300025945 | Bacteria | 5141 |
| 475 | Ga0207679_10122831 | 3300025945 | Bacteria | 2070 |
| 476 | Ga0207679_10529617 | 3300025945 | Bacteria | 1055 |
| 477 | Ga0207667_10479701 | 3300025949 | Bacteria | 1263 |
| 478 | Ga0207667_10515925 | 3300025949 | Bacteria | 1211 |
| 479 | Ga0207667_10782920 | 3300025949 | Bacteria | 952 |
| 480 | Ga0207651_10007137 | 3300025960 | Bacteria | 5935 |
| 481 | Ga0207651_10133326 | 3300025960 | Bacteria | 1906 |
| 482 | Ga0207651_10370071 | 3300025960 | Bacteria | 1212 |
| 483 | Ga0207712_10000067 | 3300025961 | Bacteria | 130079 |
| 484 | Ga0207712_10044596 | 3300025961 | Bacteria | 3066 |
| 485 | Ga0207712_10706224 | 3300025961 | Bacteria | 880 |
| 486 | Ga0207668_10013940 | 3300025972 | Bacteria | 4966 |
| 487 | Ga0207668_10256541 | 3300025972 | Bacteria | 1423 |
| 488 | Ga0207668_10385800 | 3300025972 | Bacteria | 1180 |
| 489 | Ga0207640_10000074 | 3300025981 | Bacteria | 78164 |
| 490 | Ga0207640_10220445 | 3300025981 | Bacteria | 1452 |
| 491 | Ga0207640_10225193 | 3300025981 | Bacteria | 1438 |
| 492 | Ga0207658_10702128 | 3300025986 | Bacteria | 914 |
| 493 | Ga0207677_10000308 | 3300026023 | Bacteria | 35929 |
| 494 | Ga0207677_10000534 | 3300026023 | Bacteria | 24018 |
| 495 | Ga0207677_10054993 | 3300026023 | Bacteria | 2719 |
| 496 | Ga0207677_10322903 | 3300026023 | Bacteria | 1283 |
| 497 | Ga0207703_10004225 | 3300026035 | Bacteria | 11837 |
| 498 | Ga0207703_10042528 | 3300026035 | Bacteria | 3644 |
| 499 | Ga0207703_10835798 | 3300026035 | Bacteria | 880 |
| 500 | Ga0207639_10007308 | 3300026041 | Bacteria | 7525 |
| 501 | Ga0207639_10034486 | 3300026041 | Bacteria | 3740 |
| 502 | Ga0207639_10039100 | 3300026041 | Bacteria | 3533 |
| 503 | Ga0207639_10090967 | 3300026041 | Bacteria | 2442 |
| 504 | Ga0207639_10149626 | 3300026041 | Bacteria | 1954 |
| 505 | Ga0207678_10014788 | 3300026067 | Bacteria | 6867 |
| 506 | Ga0207678_10023321 | 3300026067 | Bacteria | 5412 |
| 507 | Ga0207678_10038610 | 3300026067 | Bacteria | 4148 |
| 508 | Ga0207678_10438116 | 3300026067 | Bacteria | 1135 |
| 509 | Ga0207708_10001934 | 3300026075 | Bacteria | 15275 |
| 510 | Ga0207708_10006175 | 3300026075 | Bacteria | 8881 |
| 511 | Ga0207708_10008298 | 3300026075 | Bacteria | 7695 |
| 512 | Ga0207708_10069382 | 3300026075 | Bacteria | 2699 |
| 513 | Ga0207708_10179606 | 3300026075 | Bacteria | 1680 |
| 514 | Ga0207702_10000085 | 3300026078 | Bacteria | 106728 |
| 515 | Ga0207702_10002252 | 3300026078 | Bacteria | 18493 |
| 516 | Ga0207702_10030239 | 3300026078 | Bacteria | 4513 |
| 517 | Ga0207702_10072197 | 3300026078 | Bacteria | 2974 |
| 518 | Ga0207641_10000071 | 3300026088 | Bacteria | 151812 |
| 519 | Ga0207641_10016922 | 3300026088 | Bacteria | 5969 |
| 520 | Ga0207641_10046202 | 3300026088 | Bacteria | 3670 |
| 521 | Ga0207641_10791072 | 3300026088 | Bacteria | 938 |
| 522 | Ga0207648_10000630 | 3300026089 | Bacteria | 39502 |
| 523 | Ga0207648_10060218 | 3300026089 | Bacteria | 3311 |
| 524 | Ga0207648_10097076 | 3300026089 | Bacteria | 2579 |
| 525 | Ga0207648_10316424 | 3300026089 | Bacteria | 1402 |
| 526 | Ga0207648_10893434 | 3300026089 | Bacteria | 830 |
| 527 | Ga0207676_10046013 | 3300026095 | Bacteria | 3374 |
| 528 | Ga0207674_10035690 | 3300026116 | Bacteria | 5189 |
| 529 | Ga0207674_10131165 | 3300026116 | Bacteria | 2469 |
| 530 | Ga0207674_10646821 | 3300026116 | Bacteria | 1021 |
| 531 | Ga0207675_100006762 | 3300026118 | Bacteria | 10846 |
| 532 | Ga0207675_100045768 | 3300026118 | Bacteria | 4087 |
| 533 | Ga0207675_100214990 | 3300026118 | Bacteria | 1850 |
| 534 | Ga0207675_100343729 | 3300026118 | Bacteria | 1461 |
| 535 | Ga0207683_10010330 | 3300026121 | Bacteria | 7962 |
| 536 | Ga0207683_10044763 | 3300026121 | Bacteria | 3869 |
| 537 | Ga0207698_10000043 | 3300026142 | Bacteria | 96553 |
| 538 | Ga0207698_10414479 | 3300026142 | Bacteria | 1291 |
| 539 | Ga0207698_10794627 | 3300026142 | Bacteria | 948 |
| 540 | Ga0207698_10842700 | 3300026142 | Bacteria | 921 |
| 541 | Ga0207428_10006750 | 3300027907 | Bacteria | 10529 |
| 542 | Ga0207428_10007997 | 3300027907 | Bacteria | 9600 |
| 543 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 544 | Ga0268266_10303321 | 3300028379 | Bacteria | 1490 |
| 545 | Ga0268265_10016898 | 3300028380 | Bacteria | 5023 |
| 546 | Ga0268265_10176211 | 3300028380 | Bacteria | 1833 |
| 547 | Ga0268265_10404622 | 3300028380 | Bacteria | 1263 |
| 548 | Ga0268265_10808168 | 3300028380 | Bacteria | 914 |
| 549 | Ga0268265_11434589 | 3300028380 | Bacteria | 693 |
| 550 | Ga0268264_10025099 | 3300028381 | Bacteria | 4870 |
| 551 | Ga0268264_11331960 | 3300028381 | Bacteria | 728 |
| 552 | Ga0265319_1000035 | 3300028563 | Bacteria | 117269 |
| 553 | Ga0265334_10103940 | 3300028573 | Bacteria | 1026 |
| 554 | Ga0265338_10000171 | 3300028800 | Bacteria | 120054 |
| 555 | Ga0307511_10041190 | 3300030521 | Bacteria | 3905 |
| 556 | Ga0265325_10027704 | 3300031241 | Bacteria | 3060 |
| 557 | Ga0265316_10367578 | 3300031344 | Bacteria | 1039 |
| 558 | Ga0307408_100205850 | 3300031548 | Bacteria | 1596 |
| 559 | Ga0307408_100719889 | 3300031548 | Bacteria | 899 |
| 560 | Ga0316576_10101640 | 3300031727 | Bacteria | 2149 |
| 561 | Ga0316578_10211794 | 3300031728 | Bacteria | 1166 |
| 562 | Ga0307405_10567330 | 3300031731 | Bacteria | 921 |
| 563 | Ga0316577_10050570 | 3300031733 | Bacteria | 2320 |
| 564 | Ga0307413_10165871 | 3300031824 | Bacteria | 1558 |
| 565 | Ga0307413_10292913 | 3300031824 | Bacteria | 1230 |
| 566 | Ga0307410_10031793 | 3300031852 | Bacteria | 3391 |
| 567 | Ga0307406_10013575 | 3300031901 | Bacteria | 4668 |
| 568 | Ga0307406_10135001 | 3300031901 | Bacteria | 1738 |
| 569 | Ga0307406_10483738 | 3300031901 | Bacteria | 1000 |
| 570 | Ga0307407_10199790 | 3300031903 | Bacteria | 1339 |
| 571 | Ga0307412_10081196 | 3300031911 | Bacteria | 2242 |
| 572 | Ga0307412_10685716 | 3300031911 | Bacteria | 878 |
| 573 | Ga0307409_100117154 | 3300031995 | Bacteria | 2247 |
| 574 | Ga0307409_100381919 | 3300031995 | Bacteria | 1339 |
| 575 | Ga0307409_100632681 | 3300031995 | Bacteria | 1061 |
| 576 | Ga0307416_100030344 | 3300032002 | Bacteria | 4055 |
| 577 | Ga0307416_100189500 | 3300032002 | Bacteria | 1938 |
| 578 | Ga0307416_100708770 | 3300032002 | Bacteria | 1096 |
| 579 | Ga0307414_10219882 | 3300032004 | Bacteria | 1559 |
| 580 | Ga0307414_10936097 | 3300032004 | Bacteria | 796 |
| 581 | Ga0307411_10047028 | 3300032005 | Bacteria | 2787 |
| 582 | Ga0307411_10898499 | 3300032005 | Bacteria | 787 |
| 583 | Ga0307415_100042215 | 3300032126 | Bacteria | 3034 |
| 584 | Ga0307415_100068875 | 3300032126 | Bacteria | 2478 |
| 585 | Ga0307415_100073134 | 3300032126 | Bacteria | 2417 |
| 586 | Ga0307415_100155804 | 3300032126 | Bacteria | 1764 |
| 587 | Ga0307415_100576123 | 3300032126 | Bacteria | 998 |
| 588 | Ga0307415_100841642 | 3300032126 | Bacteria | 841 |
| 589 | Ga0316580_10061032 | 3300032139 | Bacteria | 1158 |
| 590 | Ga0316596_1169424 | 3300033541 | Bacteria | 602 |
| 591 | Ga0373955_0111673 | 3300035172 | Bacteria | 1581 |
| 592 | Ga0316574_0113609 | 3300035398 | Bacteria | 1736 |
| 593 | Ga0373937_0033761 | 3300036401 | Bacteria | 4650 |
| 594 | Ga0373937_0091159 | 3300036401 | Bacteria | 2824 |
| 595 | Ga0316584_0148014 | 3300036712 | Bacteria | 1749 |
| 596 | Ga0373925_1070097 | 3300037068 | Bacteria | 664 |
| 597 | Ga0395900_0615622 | 3300037418 | Bacteria | 1025 |
| 598 | Ga0395898_0524336 | 3300037466 | Bacteria | 1126 |
| 599 | Ga0395905_0052992 | 3300037471 | Bacteria | 3798 |
| 600 | Ga0395905_0439532 | 3300037471 | Bacteria | 1202 |
| 601 | Ga0395901_0028426 | 3300038443 | Bacteria | 5750 |
| 602 | Ga0395901_0031752 | 3300038443 | Bacteria | 5445 |
| 603 | Ga0395901_0347602 | 3300038443 | Bacteria | 1531 |
| 604 | Ga0395901_0405552 | 3300038443 | Bacteria | 1400 |
| 605 | Ga0451793_0656212 | 3300041452 | Bacteria | 2199 |
| 606 | Ga0451800_0120947 | 3300041459 | Bacteria | 1031 |
| 607 | Ga0451807_2744985 | 3300041486 | Bacteria | 1345 |
| 608 | Ga0451833_0301983 | 3300041491 | Bacteria | 711 |
| 609 | Ga0451843_1480200 | 3300041509 | Bacteria | 1920 |
| 610 | Ga0451853_0233585 | 3300041512 | Bacteria | 848 |
| 611 | Ga0451853_0402524 | 3300041512 | Bacteria | 820 |
| 612 | Ga0451853_1789901 | 3300041512 | Bacteria | 683 |
| 613 | Ga0451853_3323498 | 3300041512 | Bacteria | 1546 |
| 614 | Ga0451853_3894616 | 3300041512 | Bacteria | 1030 |
| 615 | Ga0439451_017501 | 3300042009 | Bacteria | 1445 |
| 616 | Ga0439456_025827 | 3300042013 | Bacteria | 1248 |
| 617 | Ga0439460_0001189 | 3300042461 | Bacteria | 6122 |
| 618 | Ga0466969_0106065 | 3300044656 | Bacteria | 1319 |
| 619 | Ga0466972_0157187 | 3300044658 | Bacteria | 1068 |
| 620 | Ga0466965_0120059 | 3300044683 | Bacteria | 1357 |
| 621 | Ga0466965_0198880 | 3300044683 | Bacteria | 1062 |
| 622 | Ga0466965_0448394 | 3300044683 | Bacteria | 718 |
| 623 | Ga0466966_0095308 | 3300044684 | Bacteria | 1844 |
| 624 | Ga0466963_0000274 | 3300044694 | Bacteria | 22920 |
| 625 | Ga0466963_0015396 | 3300044694 | Bacteria | 4735 |
| 626 | Ga0466964_0038924 | 3300044706 | Bacteria | 1914 |
| 627 | Ga0466957_0002465 | 3300044842 | Bacteria | 9942 |
| 628 | Ga0466957_0182976 | 3300044842 | Bacteria | 1369 |
| 629 | Ga0466960_0041902 | 3300044901 | Bacteria | 2171 |
| 630 | Ga0466960_0118967 | 3300044901 | Bacteria | 1381 |
| 631 | Ga0466960_0127917 | 3300044901 | Bacteria | 1337 |
| 632 | Ga0466960_0221998 | 3300044901 | Bacteria | 1040 |
| 633 | Ga0466959_0096876 | 3300045049 | Bacteria | 2115 |
| 634 | Ga0466958_0351858 | 3300045836 | Bacteria | 948 |
| 635 | Ga0466967_0000199 | 3300045976 | Bacteria | 25095 |
| 636 | Ga0466967_0004422 | 3300045976 | Bacteria | 9471 |
| 637 | Ga0466967_0039393 | 3300045976 | Bacteria | 4063 |
| 638 | Ga0466967_0085426 | 3300045976 | Bacteria | 2857 |
| 639 | Ga0466967_0150502 | 3300045976 | Bacteria | 2174 |
| 640 | Ga0466967_0200430 | 3300045976 | Bacteria | 1890 |
| 641 | Ga0466967_0326091 | 3300045976 | Bacteria | 1482 |
| 642 | Ga0466967_0768412 | 3300045976 | Bacteria | 956 |
| 643 | Ga0495592_0001677 | 3300046454 | Bacteria | 15524 |
| 644 | Ga0495592_0156179 | 3300046454 | Bacteria | 1573 |
| 645 | Ga0495603_0004130 | 3300046455 | Bacteria | 8648 |
| 646 | Ga0495629_0001345 | 3300046459 | Bacteria | 19361 |
| 647 | Ga0495629_0019045 | 3300046459 | Bacteria | 4909 |
| 648 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 649 | Ga0495641_0100097 | 3300046461 | Bacteria | 1293 |
| 650 | Ga0495653_0113273 | 3300046463 | Bacteria | 1946 |
| 651 | Ga0495653_0612144 | 3300046463 | Bacteria | 668 |
| 652 | Ga0495650_0000035 | 3300046471 | Bacteria | 403799 |
| 653 | Ga0495639_0018661 | 3300046475 | Bacteria | 3022 |
| 654 | Ga0495662_0000043 | 3300046476 | Bacteria | 42697 |
| 655 | Ga0495608_0000035 | 3300046511 | Bacteria | 133011 |
| 656 | Ga0495608_0000184 | 3300046511 | Bacteria | 44478 |
| 657 | Ga0495608_0084436 | 3300046511 | Bacteria | 2060 |
| 658 | Ga0495608_0219288 | 3300046511 | Bacteria | 1194 |
| 659 | Ga0495608_0258813 | 3300046511 | Bacteria | 1084 |
| 660 | Ga0495618_0000072 | 3300046514 | Bacteria | 72012 |
| 661 | Ga0495620_0002270 | 3300046515 | Bacteria | 11125 |
| 662 | Ga0495628_0047930 | 3300046516 | Bacteria | 3388 |
| 663 | Ga0495628_0143147 | 3300046516 | Bacteria | 1824 |
| 664 | Ga0495630_0000007 | 3300046517 | Bacteria | 376915 |
| 665 | Ga0495630_0008497 | 3300046517 | Bacteria | 7371 |
| 666 | Ga0495630_0194583 | 3300046517 | Bacteria | 1547 |
| 667 | Ga0495631_0393952 | 3300046518 | Bacteria | 590 |
| 668 | Ga0495644_0000618 | 3300046523 | Bacteria | 14879 |
| 669 | Ga0495644_0068226 | 3300046523 | Bacteria | 1336 |
| 670 | Ga0495663_0099372 | 3300046525 | Bacteria | 957 |
| 671 | Ga0495587_0166468 | 3300046536 | Bacteria | 1253 |
| 672 | Ga0495587_0501554 | 3300046536 | Bacteria | 671 |
| 673 | Ga0495645_0136928 | 3300046543 | Bacteria | 1712 |
| 674 | Ga0495667_0125589 | 3300046559 | Bacteria | 1656 |
| 675 | Ga0495656_0000217 | 3300046615 | Bacteria | 20479 |
| 676 | Ga0495657_0000026 | 3300046675 | Bacteria | 133011 |
| 677 | Ga0495657_0002934 | 3300046675 | Bacteria | 14139 |
| 678 | Ga0495657_0152540 | 3300046675 | Bacteria | 1434 |
| 679 | Ga0495599_0081169 | 3300046678 | Bacteria | 2025 |
| 680 | Ga0495623_0114912 | 3300046679 | Bacteria | 1627 |
| 681 | Ga0495647_0001511 | 3300046681 | Bacteria | 7198 |
| 682 | Ga0495658_0001081 | 3300046683 | Bacteria | 14347 |
| 683 | Ga0495669_0001240 | 3300046684 | Bacteria | 10598 |
| 684 | Ga0495669_0011127 | 3300046684 | Bacteria | 3813 |
| 685 | Ga0495613_0000083 | 3300046689 | Bacteria | 90138 |
| 686 | Ga0495613_0170409 | 3300046689 | Bacteria | 1545 |
| 687 | Ga0495624_0000028 | 3300046690 | Bacteria | 93474 |
| 688 | Ga0495649_0006233 | 3300046694 | Bacteria | 7439 |
| 689 | Ga0495600_0000634 | 3300046809 | Bacteria | 18143 |
| 690 | Ga0495600_0059109 | 3300046809 | Bacteria | 2504 |
| 691 | Ga0495581_0495493 | 3300047315 | Bacteria | 710 |
| 692 | Ga0495604_0080501 | 3300047317 | Bacteria | 2440 |
| 693 | Ga0495604_0215730 | 3300047317 | Bacteria | 1324 |
| 694 | Ga0495676_0057014 | 3300047321 | Bacteria | 3085 |
| 695 | Ga0495676_0084493 | 3300047321 | Bacteria | 2395 |
| 696 | Ga0495680_0000990 | 3300047322 | Bacteria | 31628 |
| 697 | Ga0495675_0000015 | 3300047444 | Bacteria | 133004 |
| 698 | Ga0495685_010679 | 3300047447 | Bacteria | 3085 |
| 699 | Ga0495686_0058967 | 3300047472 | Bacteria | 2391 |
| 700 | Ga0495593_0035395 | 3300047673 | Bacteria | 2712 |
| 701 | Ga0495602_0000041 | 3300048088 | Bacteria | 126954 |
| 702 | Ga0495602_0005861 | 3300048088 | Bacteria | 12897 |
| 703 | Ga0495602_0177096 | 3300048088 | Bacteria | 1649 |
| 704 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 705 | Ga0496100_0000049 | 3300048903 | Bacteria | 75590 |
| 706 | Ga0496100_0029070 | 3300048903 | Bacteria | 3415 |
| 707 | Ga0496100_0166003 | 3300048903 | Bacteria | 1586 |
| 708 | Ga0496100_0456279 | 3300048903 | Bacteria | 980 |
| 709 | Ga0496100_0699495 | 3300048903 | Bacteria | 791 |
| 710 | Ga0496101_0000010 | 3300048904 | Bacteria | 281990 |
| 711 | Ga0496101_0000101 | 3300048904 | Bacteria | 89424 |
| 712 | Ga0496101_0002517 | 3300048904 | Bacteria | 11251 |
| 713 | Ga0496101_0035526 | 3300048904 | Bacteria | 3525 |
| 714 | Ga0496102_0000075 | 3300048905 | Bacteria | 147013 |
| 715 | Ga0496102_0017006 | 3300048905 | Bacteria | 6365 |
| 716 | Ga0496102_0118625 | 3300048905 | Bacteria | 2469 |
| 717 | Ga0496102_0159882 | 3300048905 | Bacteria | 2119 |
| 718 | Ga0496102_0403502 | 3300048905 | Bacteria | 1285 |
| 719 | Ga0496102_0812079 | 3300048905 | Bacteria | 857 |
| 720 | Ga0496103_0000329 | 3300048906 | Bacteria | 43481 |
| 721 | Ga0496103_0009420 | 3300048906 | Bacteria | 5787 |
| 722 | Ga0496103_0013294 | 3300048906 | Bacteria | 4879 |
| 723 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 724 | Ga0496104_0004549 | 3300048907 | Bacteria | 12084 |
| 725 | Ga0496104_0011315 | 3300048907 | Bacteria | 7987 |
| 726 | Ga0496104_0248307 | 3300048907 | Bacteria | 1692 |
| 727 | Ga0496104_0630956 | 3300048907 | Bacteria | 981 |
| 728 | Ga0496104_0637938 | 3300048907 | Bacteria | 974 |
| 729 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 730 | Ga0496105_0043980 | 3300048908 | Bacteria | 3682 |
| 731 | Ga0496105_0063040 | 3300048908 | Bacteria | 3059 |
| 732 | Ga0496105_0107930 | 3300048908 | Bacteria | 2298 |
| 733 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 734 | Ga0496106_0000554 | 3300048909 | Bacteria | 26600 |
| 735 | Ga0496106_0001085 | 3300048909 | Bacteria | 20088 |
| 736 | Ga0496106_0074346 | 3300048909 | Bacteria | 2601 |
| 737 | Ga0496106_0103285 | 3300048909 | Bacteria | 2212 |
| 738 | Ga0496106_0415300 | 3300048909 | Bacteria | 1081 |
| 739 | Ga0496107_0000011 | 3300048910 | Bacteria | 201631 |
| 740 | Ga0496107_0000032 | 3300048910 | Bacteria | 99848 |
| 741 | Ga0496107_0001550 | 3300048910 | Bacteria | 14280 |
| 742 | Ga0496107_0274185 | 3300048910 | Bacteria | 1255 |
| 743 | Ga0496107_0730069 | 3300048910 | Bacteria | 727 |
| 744 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 745 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 746 | Ga0496108_0000383 | 3300048911 | Bacteria | 36765 |
| 747 | Ga0496108_0006122 | 3300048911 | Bacteria | 9734 |
| 748 | Ga0496108_0024974 | 3300048911 | Bacteria | 4923 |
| 749 | Ga0496108_1075027 | 3300048911 | Bacteria | 685 |
| 750 | Ga0496108_1324797 | 3300048911 | Bacteria | 605 |
| 751 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 752 | Ga0496109_0000036 | 3300048912 | Bacteria | 153972 |
| 753 | Ga0496109_0000365 | 3300048912 | Bacteria | 42078 |
| 754 | Ga0496109_0005502 | 3300048912 | Bacteria | 10606 |
| 755 | Ga0496109_0013316 | 3300048912 | Bacteria | 7127 |
| 756 | Ga0496109_0019747 | 3300048912 | Bacteria | 5945 |
| 757 | Ga0496109_0026713 | 3300048912 | Bacteria | 5150 |
| 758 | Ga0496109_0201552 | 3300048912 | Bacteria | 1871 |
| 759 | Ga0496109_0337214 | 3300048912 | Bacteria | 1424 |
| 760 | Ga0496110_0004721 | 3300048913 | Bacteria | 10604 |
| 761 | Ga0496110_0005716 | 3300048913 | Bacteria | 9768 |
| 762 | Ga0496110_0006918 | 3300048913 | Bacteria | 9019 |
| 763 | Ga0496110_0051026 | 3300048913 | Bacteria | 3634 |
| 764 | Ga0496110_0067135 | 3300048913 | Bacteria | 3173 |
| 765 | Ga0496110_0287321 | 3300048913 | Bacteria | 1498 |
| 766 | Ga0496110_0314426 | 3300048913 | Bacteria | 1426 |
| 767 | Ga0496110_0837646 | 3300048913 | Bacteria | 825 |
| 768 | Ga0496111_0001935 | 3300048914 | Bacteria | 12260 |
| 769 | Ga0496111_0006969 | 3300048914 | Bacteria | 7378 |
| 770 | Ga0496111_0058662 | 3300048914 | Bacteria | 2787 |
| 771 | Ga0496111_0058756 | 3300048914 | Bacteria | 2784 |
| 772 | Ga0496111_0290537 | 3300048914 | Bacteria | 1212 |
| 773 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 774 | Ga0496112_0000280 | 3300048915 | Bacteria | 33010 |
| 775 | Ga0496112_0001978 | 3300048915 | Bacteria | 16196 |
| 776 | Ga0496112_0021899 | 3300048915 | Bacteria | 6082 |
| 777 | Ga0496112_0389642 | 3300048915 | Bacteria | 1334 |
| 778 | Ga0496112_0399097 | 3300048915 | Bacteria | 1315 |
| 779 | Ga0496112_0834687 | 3300048915 | Bacteria | 845 |
| 780 | Ga0496112_0980362 | 3300048915 | Bacteria | 765 |
| 781 | Ga0496113_0000001 | 3300048916 | Bacteria | 224977 |
| 782 | Ga0496113_0025990 | 3300048916 | Bacteria | 4182 |
| 783 | Ga0496113_0299216 | 3300048916 | Bacteria | 1288 |
| 784 | Ga0496114_0120061 | 3300048917 | Bacteria | 2260 |
| 785 | Ga0496114_0150239 | 3300048917 | Bacteria | 2020 |
| 786 | Ga0496114_0184654 | 3300048917 | Bacteria | 1822 |
| 787 | Ga0496114_0355334 | 3300048917 | Bacteria | 1296 |
| 788 | Ga0496115_0034307 | 3300048918 | Bacteria | 4010 |
| 789 | Ga0496117_0004973 | 3300048920 | Bacteria | 14262 |
| 790 | Ga0496117_0230174 | 3300048920 | Bacteria | 1025 |
| 791 | Ga0496118_0001190 | 3300048921 | Bacteria | 40072 |
| 792 | Ga0496119_0131214 | 3300048922 | Bacteria | 1365 |
| 793 | Ga0496121_0201715 | 3300048924 | Bacteria | 1417 |
| 794 | Ga0496121_0362727 | 3300048924 | Bacteria | 961 |
| 795 | Ga0496121_0382486 | 3300048924 | Bacteria | 928 |
| 796 | Ga0496124_0256085 | 3300048927 | Bacteria | 1291 |
| 797 | Ga0496124_0472301 | 3300048927 | Bacteria | 849 |
| 798 | Ga0496125_0040716 | 3300048928 | Bacteria | 3982 |
| 799 | Ga0496125_0063483 | 3300048928 | Bacteria | 2945 |
| 800 | Ga0496125_0509833 | 3300048928 | Bacteria | 675 |
| 801 | Ga0501031_0118196 | 3300049568 | Bacteria | 1732 |
| 802 | Ga0501031_0212825 | 3300049568 | Bacteria | 1259 |
| 803 | Ga0501032_0243262 | 3300049569 | Bacteria | 1169 |
| 804 | Ga0501034_0003584 | 3300049571 | Bacteria | 17630 |
| 805 | Ga0501034_0005460 | 3300049571 | Bacteria | 13884 |
| 806 | Ga0501034_0012842 | 3300049571 | Bacteria | 8638 |
| 807 | Ga0501036_0233078 | 3300049572 | Bacteria | 1545 |
| 808 | Ga0501036_0986755 | 3300049572 | Bacteria | 690 |
| 809 | Ga0501037_0018416 | 3300049573 | Bacteria | 5148 |
| 810 | Ga0501039_0010474 | 3300049575 | Bacteria | 7065 |
| 811 | Ga0501039_0348269 | 3300049575 | Bacteria | 1164 |
| 812 | Ga0501039_0360574 | 3300049575 | Bacteria | 1142 |
| 813 | Ga0501040_0087454 | 3300049576 | Bacteria | 2164 |
| 814 | Ga0501042_0032510 | 3300049578 | Bacteria | 3695 |
| 815 | Ga0501042_0325357 | 3300049578 | Bacteria | 1111 |
| 816 | Ga0501042_0543911 | 3300049578 | Bacteria | 844 |
| 817 | Ga0501043_0154530 | 3300049579 | Bacteria | 1795 |
| 818 | Ga0501047_0036161 | 3300049581 | Bacteria | 4771 |
| 819 | Ga0501068_0001258 | 3300049584 | Bacteria | 13450 |
| 820 | Ga0501068_0146682 | 3300049584 | Bacteria | 1481 |
| 821 | Ga0501068_0328237 | 3300049584 | Bacteria | 981 |
| 822 | Ga0501069_0189804 | 3300049585 | Bacteria | 1189 |
| 823 | Ga0501070_0009330 | 3300049586 | Bacteria | 8297 |
| 824 | Ga0501070_0018324 | 3300049586 | Bacteria | 5873 |
| 825 | Ga0501070_0040260 | 3300049586 | Bacteria | 3897 |
| 826 | Ga0501070_0259727 | 3300049586 | Bacteria | 1420 |
| 827 | Ga0501070_0335678 | 3300049586 | Bacteria | 1228 |
| 828 | Ga0501070_0380715 | 3300049586 | Bacteria | 1143 |
| 829 | Ga0501072_0008971 | 3300049588 | Bacteria | 7604 |
| 830 | Ga0501072_0214020 | 3300049588 | Bacteria | 1536 |
| 831 | Ga0501073_0004270 | 3300049589 | Bacteria | 10712 |
| 832 | Ga0501074_0024121 | 3300049590 | Bacteria | 4420 |
| 833 | Ga0501075_0496733 | 3300049591 | Bacteria | 931 |
| 834 | Ga0501076_0409517 | 3300049592 | Bacteria | 1115 |
| 835 | Ga0501083_0028215 | 3300049744 | Bacteria | 3870 |
| 836 | Ga0501083_0038464 | 3300049744 | Bacteria | 3252 |
| 837 | Ga0501035_0712634 | 3300049822 | Bacteria | 808 |
| 838 | Ga0501044_0027876 | 3300049823 | Bacteria | 5962 |
| 839 | Ga0501045_0092816 | 3300049824 | Bacteria | 2233 |
| 840 | nmdc:mga03n38_367087_c1 | 3300050490 | Bacteria | 786 |
| 841 | nmdc:mga03n38_7559_c1 | 3300050490 | Bacteria | 3850 |
| 842 | nmdc:mga00v17_319016_c1 | 3300050491 | Bacteria | 1010 |
| 843 | nmdc:mga00v17_91979_c1 | 3300050491 | Bacteria | 1906 |
| 844 | nmdc:mga0yw44_1021_c1 | 3300050492 | Bacteria | 10722 |
| 845 | nmdc:mga0yw44_265577_c1 | 3300050492 | Bacteria | 1145 |
| 846 | nmdc:mga06z11_270400_c1 | 3300050494 | Bacteria | 1005 |
| 847 | nmdc:mga05p37_144245_c1 | 3300050507 | Bacteria | 2916 |
| 848 | nmdc:mga05p37_634025_c1 | 3300050507 | Bacteria | 1200 |
| 849 | nmdc:mga09592_395571_c1 | 3300050508 | Bacteria | 1194 |
| 850 | nmdc:mga0qj67_610351_c1 | 3300050509 | Bacteria | 872 |
| 851 | nmdc:mga06r32_519915_c1 | 3300050510 | Bacteria | 1166 |
| 852 | nmdc:mga08y16_105703_c1 | 3300050511 | Bacteria | 2930 |
| 853 | nmdc:mga08y16_57307_c1 | 3300050511 | Bacteria | 4072 |
| 854 | nmdc:mga08y16_66134_c1 | 3300050511 | Bacteria | 3773 |
| 855 | nmdc:mga08y16_82624_c1 | 3300050511 | Bacteria | 3348 |
| 856 | nmdc:mga0n895_146335_c1 | 3300050512 | Bacteria | 2392 |
| 857 | Ga0495601_0000131 | 3300053077 | Bacteria | 42431 |
| 858 | Ga0495601_0014155 | 3300053077 | Bacteria | 4806 |
| 859 | Ga0495612_0001358 | 3300053078 | Bacteria | 10075 |
| 860 | Ga0495612_0002321 | 3300053078 | Bacteria | 7836 |
| 861 | Ga0495612_0028742 | 3300053078 | Bacteria | 2239 |
| 862 | Ga0495595_0000017 | 3300053084 | Bacteria | 133011 |
| 863 | Ga0495595_0005801 | 3300053084 | Bacteria | 4999 |
| 864 | Ga0495619_0000054 | 3300053085 | Bacteria | 97928 |
| 865 | Ga0495619_0000101 | 3300053085 | Bacteria | 64377 |
| 866 | Ga0495619_0022877 | 3300053085 | Bacteria | 4002 |
| 867 | Ga0500566_0000572 | 3300053094 | Bacteria | 20728 |
| 868 | Ga0500641_0005057 | 3300053096 | Bacteria | 4675 |
| 869 | Ga0500595_035427 | 3300053119 | Bacteria | 1643 |
| 870 | Ga0500614_001780 | 3300053123 | Bacteria | 4997 |
| 871 | Ga0500616_0013239 | 3300053153 | Bacteria | 4798 |
| 872 | Ga0501084_0306131 | 3300054114 | Bacteria | 1342 |
| 873 | Ga0501084_1015117 | 3300054114 | Bacteria | 697 |
| 874 | Ga0501082_0229423 | 3300060353 | Bacteria | 1616 |
| 875 | Ga0501082_0918992 | 3300060353 | Bacteria | 765 |
| 876 | Ga0530510_0529558 | 3300061734 | Bacteria | 894 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041512 | Ga0451853_3894616 | Ga0451853_3894616_191_733 | 176 |
| 2 | 3300046518 | Ga0495631_0393952 | Ga0495631_0393952_24_572 | 177 |
| 3 | 3300009098 | Ga0105245_10003920 | Ga0105245_1000392012 | 178 |
| 4 | 3300009176 | Ga0105242_10000034 | Ga0105242_1000003449 | 178 |
| 5 | 3300014969 | Ga0157376_10176956 | Ga0157376_101769562 | 178 |
| 6 | 3300049571 | Ga0501034_0003584 | Ga0501034_0003584_13059_13610 | 178 |
| 7 | 3300049573 | Ga0501037_0018416 | Ga0501037_0018416_3403_3954 | 178 |
| 8 | 3300049584 | Ga0501068_0001258 | Ga0501068_0001258_9477_10028 | 178 |
| 9 | 3300049586 | Ga0501070_0018324 | Ga0501070_0018324_1906_2457 | 178 |
| 10 | 3300049588 | Ga0501072_0008971 | Ga0501072_0008971_3425_3976 | 178 |
| 11 | 3300049589 | Ga0501073_0004270 | Ga0501073_0004270_8456_9007 | 178 |
| 12 | 3300049590 | Ga0501074_0024121 | Ga0501074_0024121_2225_2776 | 178 |
| 13 | 3300010375 | Ga0105239_10014181 | Ga0105239_1001418110 | 179 |
| 14 | 3300011119 | Ga0105246_10236673 | Ga0105246_102366732 | 179 |
| 15 | 3300017792 | Ga0163161_10794421 | Ga0163161_107944211 | 179 |
| 16 | 3300022467 | Ga0224712_10277737 | Ga0224712_102777371 | 179 |
| 17 | 3300025908 | Ga0207643_10153756 | Ga0207643_101537562 | 179 |
| 18 | 3300041491 | Ga0451833_0301983 | Ga0451833_0301983_106_645 | 179 |
| 19 | 3300041512 | Ga0451853_0233585 | Ga0451853_0233585_16_555 | 179 |
| 20 | 3300045976 | Ga0466967_0085426 | Ga0466967_0085426_792_1340 | 179 |
| 21 | 3300049575 | Ga0501039_0348269 | Ga0501039_0348269_382_972 | 179 |
| 22 | 3300049578 | Ga0501042_0543911 | Ga0501042_0543911_152_742 | 179 |
| 23 | 3300060353 | Ga0501082_0229423 | Ga0501082_0229423_978_1568 | 179 |
| 24 | 3300002774 | JGI25150J39212_1000023 | JGI25150J39212_100002351 | 180 |
| 25 | 3300003187 | JGI25151J46595_10000082 | JGI25151J46595_1000008251 | 180 |
| 26 | 3300003215 | JGI25153J46596_10000060 | JGI25153J46596_1000006052 | 180 |
| 27 | 3300005288 | Ga0065714_10002668 | Ga0065714_1000266822 | 180 |
| 28 | 3300005288 | Ga0065714_10009648 | Ga0065714_100096484 | 180 |
| 29 | 3300005617 | Ga0068859_101729063 | Ga0068859_1017290631 | 180 |
| 30 | 3300006931 | Ga0097620_101728702 | Ga0097620_1017287021 | 180 |
| 31 | 3300013100 | Ga0157373_10001726 | Ga0157373_1000172616 | 180 |
| 32 | 3300013105 | Ga0157369_10552697 | Ga0157369_105526971 | 180 |
| 33 | 3300013308 | Ga0157375_10388873 | Ga0157375_103888732 | 180 |
| 34 | 3300020077 | Ga0206351_10912576 | Ga0206351_109125761 | 180 |
| 35 | 3300020080 | Ga0206350_10849943 | Ga0206350_108499431 | 180 |
| 36 | 3300025245 | Ga0207425_1000051 | Ga0207425_100005184 | 180 |
| 37 | 3300025258 | Ga0209129_1000121 | Ga0209129_100012151 | 180 |
| 38 | 3300025294 | Ga0209025_1000160 | Ga0209025_100016076 | 180 |
| 39 | 3300025297 | Ga0209758_1000147 | Ga0209758_100014776 | 180 |
| 40 | 3300031911 | Ga0307412_10081196 | Ga0307412_100811965 | 180 |
| 41 | 3300046511 | Ga0495608_0258813 | Ga0495608_0258813_484_1068 | 180 |
| 42 | 3300046536 | Ga0495587_0166468 | Ga0495587_0166468_146_730 | 180 |
| 43 | 3300047472 | Ga0495686_0058967 | Ga0495686_0058967_680_1231 | 180 |
| 44 | 3300048088 | Ga0495602_0005861 | Ga0495602_0005861_10254_10838 | 180 |
| 45 | 3300049571 | Ga0501034_0012842 | Ga0501034_0012842_2228_2788 | 180 |
| 46 | 3300049586 | Ga0501070_0335678 | Ga0501070_0335678_352_912 | 180 |
| 47 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001441 | 181 |
| 48 | 3300025905 | Ga0207685_10000005 | Ga0207685_10000005291 | 181 |
| 49 | 3300049579 | Ga0501043_0154530 | Ga0501043_0154530_347_892 | 181 |
| 50 | 3300025927 | Ga0207687_10033552 | Ga0207687_100335524 | 182 |
| 51 | 3300026089 | Ga0207648_10316424 | Ga0207648_103164241 | 182 |
| 52 | 3300005331 | Ga0070670_100092750 | Ga0070670_1000927502 | 183 |
| 53 | 3300005334 | Ga0068869_100207910 | Ga0068869_1002079102 | 183 |
| 54 | 3300005338 | Ga0068868_100015451 | Ga0068868_1000154514 | 183 |
| 55 | 3300005344 | Ga0070661_100009995 | Ga0070661_1000099952 | 183 |
| 56 | 3300005353 | Ga0070669_100141831 | Ga0070669_1001418311 | 183 |
| 57 | 3300005354 | Ga0070675_100010461 | Ga0070675_1000104613 | 183 |
| 58 | 3300005366 | Ga0070659_100039854 | Ga0070659_1000398543 | 183 |
| 59 | 3300005441 | Ga0070700_100031852 | Ga0070700_1000318523 | 183 |
| 60 | 3300005455 | Ga0070663_100007026 | Ga0070663_1000070265 | 183 |
| 61 | 3300005535 | Ga0070684_100004844 | Ga0070684_1000048447 | 183 |
| 62 | 3300005543 | Ga0070672_101094733 | Ga0070672_1010947331 | 183 |
| 63 | 3300005564 | Ga0070664_100325015 | Ga0070664_1003250152 | 183 |
| 64 | 3300005577 | Ga0068857_100025723 | Ga0068857_1000257232 | 183 |
| 65 | 3300005615 | Ga0070702_100137091 | Ga0070702_1001370912 | 183 |
| 66 | 3300005719 | Ga0068861_100601683 | Ga0068861_1006016832 | 183 |
| 67 | 3300005842 | Ga0068858_100071409 | Ga0068858_1000714092 | 183 |
| 68 | 3300005844 | Ga0068862_100025482 | Ga0068862_1000254822 | 183 |
| 69 | 3300006881 | Ga0068865_100167621 | Ga0068865_1001676212 | 183 |
| 70 | 3300009094 | Ga0111539_10005936 | Ga0111539_100059363 | 183 |
| 71 | 3300009098 | Ga0105245_10001336 | Ga0105245_100013364 | 183 |
| 72 | 3300009148 | Ga0105243_10209647 | Ga0105243_102096472 | 183 |
| 73 | 3300009551 | Ga0105238_10313308 | Ga0105238_103133082 | 183 |
| 74 | 3300014326 | Ga0157380_10090973 | Ga0157380_100909732 | 183 |
| 75 | 3300014745 | Ga0157377_10012344 | Ga0157377_100123442 | 183 |
| 76 | 3300025901 | Ga0207688_10063636 | Ga0207688_100636362 | 183 |
| 77 | 3300025907 | Ga0207645_10254228 | Ga0207645_102542282 | 183 |
| 78 | 3300025919 | Ga0207657_10082550 | Ga0207657_100825502 | 183 |
| 79 | 3300025923 | Ga0207681_10134586 | Ga0207681_101345861 | 183 |
| 80 | 3300025924 | Ga0207694_10186853 | Ga0207694_101868532 | 183 |
| 81 | 3300025925 | Ga0207650_10567390 | Ga0207650_105673902 | 183 |
| 82 | 3300025926 | Ga0207659_10006926 | Ga0207659_100069264 | 183 |
| 83 | 3300025927 | Ga0207687_10027612 | Ga0207687_100276122 | 183 |
| 84 | 3300025932 | Ga0207690_10020231 | Ga0207690_100202313 | 183 |
| 85 | 3300025938 | Ga0207704_10141477 | Ga0207704_101414772 | 183 |
| 86 | 3300025940 | Ga0207691_10591091 | Ga0207691_105910911 | 183 |
| 87 | 3300025942 | Ga0207689_10094424 | Ga0207689_100944242 | 183 |
| 88 | 3300025944 | Ga0207661_10075358 | Ga0207661_100753582 | 183 |
| 89 | 3300025945 | Ga0207679_10122831 | Ga0207679_101228311 | 183 |
| 90 | 3300025972 | Ga0207668_10256541 | Ga0207668_102565412 | 183 |
| 91 | 3300026023 | Ga0207677_10054993 | Ga0207677_100549932 | 183 |
| 92 | 3300026035 | Ga0207703_10042528 | Ga0207703_100425283 | 183 |
| 93 | 3300026067 | Ga0207678_10014788 | Ga0207678_100147882 | 183 |
| 94 | 3300026075 | Ga0207708_10069382 | Ga0207708_100693822 | 183 |
| 95 | 3300026116 | Ga0207674_10035690 | Ga0207674_100356902 | 183 |
| 96 | 3300026118 | Ga0207675_100214990 | Ga0207675_1002149901 | 183 |
| 97 | 3300026142 | Ga0207698_10842700 | Ga0207698_108427002 | 183 |
| 98 | 3300027907 | Ga0207428_10006750 | Ga0207428_100067502 | 183 |
| 99 | 3300028380 | Ga0268265_10016898 | Ga0268265_100168983 | 183 |
| 100 | 3300041512 | Ga0451853_0402524 | Ga0451853_0402524_238_789 | 183 |
| 101 | 3300049584 | Ga0501068_0328237 | Ga0501068_0328237_243_794 | 183 |
| 102 | 3300050508 | nmdc:mga09592_395571_c1 | nmdc:mga09592_395571_c1_615_1175 | 183 |
| 103 | 3300050511 | nmdc:mga08y16_57307_c1 | nmdc:mga08y16_57307_c1_768_1328 | 183 |
| 104 | 3300004800 | Ga0058861_10735126 | Ga0058861_107351261 | 184 |
| 105 | 3300005364 | Ga0070673_100010697 | Ga0070673_1000106973 | 184 |
| 106 | 3300020069 | Ga0197907_11376416 | Ga0197907_113764161 | 184 |
| 107 | 3300025960 | Ga0207651_10007137 | Ga0207651_100071374 | 184 |
| 108 | 3300031727 | Ga0316576_10101640 | Ga0316576_101016402 | 184 |
| 109 | 3300031728 | Ga0316578_10211794 | Ga0316578_102117941 | 184 |
| 110 | 3300031733 | Ga0316577_10050570 | Ga0316577_100505701 | 184 |
| 111 | 3300032139 | Ga0316580_10061032 | Ga0316580_100610321 | 184 |
| 112 | 3300033541 | Ga0316596_1169424 | Ga0316596_11694241 | 184 |
| 113 | 3300035398 | Ga0316574_0113609 | Ga0316574_0113609_1122_1685 | 184 |
| 114 | 3300036712 | Ga0316584_0148014 | Ga0316584_0148014_889_1452 | 184 |
| 115 | 3300037068 | Ga0373925_1070097 | Ga0373925_1070097_78_635 | 184 |
| 116 | 3300046463 | Ga0495653_0612144 | Ga0495653_0612144_12_569 | 184 |
| 117 | 3300046511 | Ga0495608_0084436 | Ga0495608_0084436_393_947 | 184 |
| 118 | 3300046511 | Ga0495608_0219288 | Ga0495608_0219288_69_626 | 184 |
| 119 | 3300046517 | Ga0495630_0194583 | Ga0495630_0194583_392_946 | 184 |
| 120 | 3300046523 | Ga0495644_0068226 | Ga0495644_0068226_534_1091 | 184 |
| 121 | 3300046543 | Ga0495645_0136928 | Ga0495645_0136928_352_906 | 184 |
| 122 | 3300046559 | Ga0495667_0125589 | Ga0495667_0125589_864_1421 | 184 |
| 123 | 3300046675 | Ga0495657_0152540 | Ga0495657_0152540_679_1236 | 184 |
| 124 | 3300047322 | Ga0495680_0000990 | Ga0495680_0000990_17011_17565 | 184 |
| 125 | 3300048088 | Ga0495602_0177096 | Ga0495602_0177096_510_1067 | 184 |
| 126 | 3300048913 | Ga0496110_0006918 | Ga0496110_0006918_6303_6857 | 184 |
| 127 | 3300053077 | Ga0495601_0000131 | Ga0495601_0000131_18468_19022 | 184 |
| 128 | 3300053078 | Ga0495612_0028742 | Ga0495612_0028742_48_605 | 184 |
| 129 | 3300005440 | Ga0070705_100114521 | Ga0070705_1001145213 | 185 |
| 130 | 3300005445 | Ga0070708_100404217 | Ga0070708_1004042172 | 185 |
| 131 | 3300005467 | Ga0070706_100308291 | Ga0070706_1003082912 | 185 |
| 132 | 3300005546 | Ga0070696_100290466 | Ga0070696_1002904662 | 185 |
| 133 | 3300006881 | Ga0068865_100753233 | Ga0068865_1007532332 | 185 |
| 134 | 3300010375 | Ga0105239_10941013 | Ga0105239_109410132 | 185 |
| 135 | 3300013308 | Ga0157375_10104038 | Ga0157375_101040383 | 185 |
| 136 | 3300020069 | Ga0197907_10816812 | Ga0197907_108168122 | 185 |
| 137 | 3300020077 | Ga0206351_10727604 | Ga0206351_107276041 | 185 |
| 138 | 3300025910 | Ga0207684_10191537 | Ga0207684_101915372 | 185 |
| 139 | 3300025912 | Ga0207707_10203577 | Ga0207707_102035772 | 185 |
| 140 | 3300026089 | Ga0207648_10893434 | Ga0207648_108934342 | 185 |
| 141 | 3300045976 | Ga0466967_0326091 | Ga0466967_0326091_372_935 | 185 |
| 142 | 3300046684 | Ga0495669_0011127 | Ga0495669_0011127_366_929 | 185 |
| 143 | 3300048911 | Ga0496108_1324797 | Ga0496108_1324797_16_579 | 185 |
| 144 | 3300048913 | Ga0496110_0287321 | Ga0496110_0287321_767_1342 | 185 |
| 145 | 3300005435 | Ga0070714_100001023 | Ga0070714_1000010236 | 186 |
| 146 | 3300005718 | Ga0068866_10095277 | Ga0068866_100952772 | 186 |
| 147 | 3300006846 | Ga0075430_100129532 | Ga0075430_1001295321 | 186 |
| 148 | 3300025929 | Ga0207664_10000013 | Ga0207664_10000013134 | 186 |
| 149 | 3300028380 | Ga0268265_11434589 | Ga0268265_114345891 | 186 |
| 150 | 3300031995 | Ga0307409_100117154 | Ga0307409_1001171542 | 186 |
| 151 | 3300049585 | Ga0501069_0189804 | Ga0501069_0189804_422_982 | 186 |
| 152 | 3300050510 | nmdc:mga06r32_519915_c1 | nmdc:mga06r32_519915_c1_78_656 | 186 |
| 153 | 3300053153 | Ga0500616_0013239 | Ga0500616_0013239_609_1169 | 186 |
| 154 | 3300005329 | Ga0070683_100022176 | Ga0070683_1000221764 | 187 |
| 155 | 3300005330 | Ga0070690_100377100 | Ga0070690_1003771002 | 187 |
| 156 | 3300005535 | Ga0070684_100015887 | Ga0070684_1000158873 | 187 |
| 157 | 3300005985 | Ga0081539_10253126 | Ga0081539_102531261 | 187 |
| 158 | 3300025944 | Ga0207661_10062212 | Ga0207661_100622122 | 187 |
| 159 | 3300044901 | Ga0466960_0041902 | Ga0466960_0041902_211_783 | 187 |
| 160 | 3300048905 | Ga0496102_0000075 | Ga0496102_0000075_17249_17821 | 187 |
| 161 | 3300048906 | Ga0496103_0000329 | Ga0496103_0000329_17475_18047 | 187 |
| 162 | 3300002077 | JGI24744J21845_10036099 | JGI24744J21845_100360992 | 188 |
| 163 | 3300003373 | JGI25407J50210_10013120 | JGI25407J50210_100131202 | 188 |
| 164 | 3300005329 | Ga0070683_100013741 | Ga0070683_1000137415 | 188 |
| 165 | 3300005329 | Ga0070683_100097447 | Ga0070683_1000974472 | 188 |
| 166 | 3300005334 | Ga0068869_100124005 | Ga0068869_1001240052 | 188 |
| 167 | 3300005336 | Ga0070680_100761350 | Ga0070680_1007613501 | 188 |
| 168 | 3300005337 | Ga0070682_100001507 | Ga0070682_10000150712 | 188 |
| 169 | 3300005337 | Ga0070682_100007875 | Ga0070682_1000078753 | 188 |
| 170 | 3300005338 | Ga0068868_100006732 | Ga0068868_1000067325 | 188 |
| 171 | 3300005338 | Ga0068868_100181876 | Ga0068868_1001818762 | 188 |
| 172 | 3300005339 | Ga0070660_100038941 | Ga0070660_1000389412 | 188 |
| 173 | 3300005340 | Ga0070689_100015468 | Ga0070689_1000154684 | 188 |
| 174 | 3300005340 | Ga0070689_100333038 | Ga0070689_1003330381 | 188 |
| 175 | 3300005341 | Ga0070691_10006974 | Ga0070691_100069746 | 188 |
| 176 | 3300005341 | Ga0070691_10151049 | Ga0070691_101510492 | 188 |
| 177 | 3300005345 | Ga0070692_10012328 | Ga0070692_100123285 | 188 |
| 178 | 3300005347 | Ga0070668_100022553 | Ga0070668_1000225535 | 188 |
| 179 | 3300005354 | Ga0070675_100119336 | Ga0070675_1001193362 | 188 |
| 180 | 3300005356 | Ga0070674_100008538 | Ga0070674_1000085382 | 188 |
| 181 | 3300005364 | Ga0070673_100069826 | Ga0070673_1000698263 | 188 |
| 182 | 3300005365 | Ga0070688_100034871 | Ga0070688_1000348713 | 188 |
| 183 | 3300005365 | Ga0070688_100044102 | Ga0070688_1000441021 | 188 |
| 184 | 3300005366 | Ga0070659_100001523 | Ga0070659_10000152318 | 188 |
| 185 | 3300005366 | Ga0070659_100002700 | Ga0070659_1000027004 | 188 |
| 186 | 3300005366 | Ga0070659_100055816 | Ga0070659_1000558163 | 188 |
| 187 | 3300005367 | Ga0070667_100388345 | Ga0070667_1003883452 | 188 |
| 188 | 3300005438 | Ga0070701_10214389 | Ga0070701_102143892 | 188 |
| 189 | 3300005439 | Ga0070711_100178853 | Ga0070711_1001788532 | 188 |
| 190 | 3300005440 | Ga0070705_100108681 | Ga0070705_1001086812 | 188 |
| 191 | 3300005441 | Ga0070700_100046229 | Ga0070700_1000462292 | 188 |
| 192 | 3300005455 | Ga0070663_100009721 | Ga0070663_1000097214 | 188 |
| 193 | 3300005455 | Ga0070663_100013544 | Ga0070663_1000135443 | 188 |
| 194 | 3300005456 | Ga0070678_100054845 | Ga0070678_1000548453 | 188 |
| 195 | 3300005457 | Ga0070662_100007829 | Ga0070662_1000078296 | 188 |
| 196 | 3300005458 | Ga0070681_10299487 | Ga0070681_102994872 | 188 |
| 197 | 3300005459 | Ga0068867_100028276 | Ga0068867_1000282765 | 188 |
| 198 | 3300005466 | Ga0070685_10008752 | Ga0070685_100087522 | 188 |
| 199 | 3300005535 | Ga0070684_100001038 | Ga0070684_1000010385 | 188 |
| 200 | 3300005535 | Ga0070684_100007134 | Ga0070684_1000071343 | 188 |
| 201 | 3300005535 | Ga0070684_100321377 | Ga0070684_1003213772 | 188 |
| 202 | 3300005539 | Ga0068853_100049531 | Ga0068853_1000495313 | 188 |
| 203 | 3300005543 | Ga0070672_100107935 | Ga0070672_1001079352 | 188 |
| 204 | 3300005543 | Ga0070672_100159022 | Ga0070672_1001590222 | 188 |
| 205 | 3300005544 | Ga0070686_100190739 | Ga0070686_1001907392 | 188 |
| 206 | 3300005547 | Ga0070693_100015108 | Ga0070693_1000151082 | 188 |
| 207 | 3300005548 | Ga0070665_100217538 | Ga0070665_1002175382 | 188 |
| 208 | 3300005564 | Ga0070664_100052767 | Ga0070664_1000527674 | 188 |
| 209 | 3300005564 | Ga0070664_100224471 | Ga0070664_1002244711 | 188 |
| 210 | 3300005564 | Ga0070664_100955056 | Ga0070664_1009550562 | 188 |
| 211 | 3300005577 | Ga0068857_100592034 | Ga0068857_1005920342 | 188 |
| 212 | 3300005614 | Ga0068856_100005163 | Ga0068856_10000516311 | 188 |
| 213 | 3300005615 | Ga0070702_100019981 | Ga0070702_1000199813 | 188 |
| 214 | 3300005616 | Ga0068852_100012477 | Ga0068852_1000124775 | 188 |
| 215 | 3300005616 | Ga0068852_100941234 | Ga0068852_1009412341 | 188 |
| 216 | 3300005617 | Ga0068859_101174610 | Ga0068859_1011746101 | 188 |
| 217 | 3300005618 | Ga0068864_100052452 | Ga0068864_1000524523 | 188 |
| 218 | 3300005719 | Ga0068861_100992264 | Ga0068861_1009922641 | 188 |
| 219 | 3300005834 | Ga0068851_10091962 | Ga0068851_100919622 | 188 |
| 220 | 3300005840 | Ga0068870_10150456 | Ga0068870_101504562 | 188 |
| 221 | 3300005842 | Ga0068858_100091683 | Ga0068858_1000916833 | 188 |
| 222 | 3300005842 | Ga0068858_100252309 | Ga0068858_1002523093 | 188 |
| 223 | 3300005844 | Ga0068862_100086672 | Ga0068862_1000866722 | 188 |
| 224 | 3300005937 | Ga0081455_10025637 | Ga0081455_100256373 | 188 |
| 225 | 3300005981 | Ga0081538_10002334 | Ga0081538_1000233413 | 188 |
| 226 | 3300005981 | Ga0081538_10009623 | Ga0081538_100096233 | 188 |
| 227 | 3300005981 | Ga0081538_10025242 | Ga0081538_100252422 | 188 |
| 228 | 3300006038 | Ga0075365_10009869 | Ga0075365_100098696 | 188 |
| 229 | 3300006038 | Ga0075365_10078115 | Ga0075365_100781152 | 188 |
| 230 | 3300006048 | Ga0075363_100009250 | Ga0075363_1000092506 | 188 |
| 231 | 3300006051 | Ga0075364_10055657 | Ga0075364_100556574 | 188 |
| 232 | 3300006051 | Ga0075364_10068968 | Ga0075364_100689684 | 188 |
| 233 | 3300006051 | Ga0075364_10332394 | Ga0075364_103323941 | 188 |
| 234 | 3300006175 | Ga0070712_100000009 | Ga0070712_10000000949 | 188 |
| 235 | 3300006175 | Ga0070712_100115984 | Ga0070712_1001159843 | 188 |
| 236 | 3300006178 | Ga0075367_10227532 | Ga0075367_102275322 | 188 |
| 237 | 3300006178 | Ga0075367_10268715 | Ga0075367_102687152 | 188 |
| 238 | 3300006881 | Ga0068865_100044332 | Ga0068865_1000443322 | 188 |
| 239 | 3300006931 | Ga0097620_101174635 | Ga0097620_1011746351 | 188 |
| 240 | 3300009093 | Ga0105240_10341615 | Ga0105240_103416152 | 188 |
| 241 | 3300009093 | Ga0105240_11186786 | Ga0105240_111867861 | 188 |
| 242 | 3300009094 | Ga0111539_10092681 | Ga0111539_100926812 | 188 |
| 243 | 3300009098 | Ga0105245_10000975 | Ga0105245_1000097512 | 188 |
| 244 | 3300009147 | Ga0114129_11708635 | Ga0114129_117086352 | 188 |
| 245 | 3300009148 | Ga0105243_10008888 | Ga0105243_100088886 | 188 |
| 246 | 3300009176 | Ga0105242_10196366 | Ga0105242_101963663 | 188 |
| 247 | 3300009177 | Ga0105248_10058896 | Ga0105248_100588962 | 188 |
| 248 | 3300009551 | Ga0105238_10566905 | Ga0105238_105669052 | 188 |
| 249 | 3300009551 | Ga0105238_11351692 | Ga0105238_113516921 | 188 |
| 250 | 3300009553 | Ga0105249_10065721 | Ga0105249_100657211 | 188 |
| 251 | 3300010375 | Ga0105239_10200112 | Ga0105239_102001122 | 188 |
| 252 | 3300011119 | Ga0105246_10102252 | Ga0105246_101022523 | 188 |
| 253 | 3300013296 | Ga0157374_10003363 | Ga0157374_100033637 | 188 |
| 254 | 3300013297 | Ga0157378_10396402 | Ga0157378_103964022 | 188 |
| 255 | 3300013306 | Ga0163162_10066169 | Ga0163162_100661692 | 188 |
| 256 | 3300013306 | Ga0163162_10194466 | Ga0163162_101944663 | 188 |
| 257 | 3300013307 | Ga0157372_10001751 | Ga0157372_1000175114 | 188 |
| 258 | 3300013308 | Ga0157375_10005447 | Ga0157375_100054476 | 188 |
| 259 | 3300013308 | Ga0157375_10255339 | Ga0157375_102553391 | 188 |
| 260 | 3300014325 | Ga0163163_10840061 | Ga0163163_108400612 | 188 |
| 261 | 3300014326 | Ga0157380_10014388 | Ga0157380_100143886 | 188 |
| 262 | 3300014745 | Ga0157377_10002140 | Ga0157377_100021405 | 188 |
| 263 | 3300014745 | Ga0157377_10029745 | Ga0157377_100297452 | 188 |
| 264 | 3300020069 | Ga0197907_10601346 | Ga0197907_106013461 | 188 |
| 265 | 3300020069 | Ga0197907_11450979 | Ga0197907_114509792 | 188 |
| 266 | 3300020070 | Ga0206356_11579150 | Ga0206356_115791501 | 188 |
| 267 | 3300020075 | Ga0206349_1072408 | Ga0206349_10724082 | 188 |
| 268 | 3300020075 | Ga0206349_1841112 | Ga0206349_18411121 | 188 |
| 269 | 3300020077 | Ga0206351_10977218 | Ga0206351_109772181 | 188 |
| 270 | 3300020078 | Ga0206352_10263854 | Ga0206352_102638541 | 188 |
| 271 | 3300020078 | Ga0206352_11263724 | Ga0206352_112637241 | 188 |
| 272 | 3300020080 | Ga0206350_10174780 | Ga0206350_101747802 | 188 |
| 273 | 3300020081 | Ga0206354_10628115 | Ga0206354_106281152 | 188 |
| 274 | 3300020081 | Ga0206354_10816607 | Ga0206354_108166072 | 188 |
| 275 | 3300020082 | Ga0206353_10346301 | Ga0206353_103463011 | 188 |
| 276 | 3300020082 | Ga0206353_10543008 | Ga0206353_105430082 | 188 |
| 277 | 3300020082 | Ga0206353_10602801 | Ga0206353_106028012 | 188 |
| 278 | 3300022467 | Ga0224712_10178143 | Ga0224712_101781432 | 188 |
| 279 | 3300022467 | Ga0224712_10218733 | Ga0224712_102187331 | 188 |
| 280 | 3300025885 | Ga0207653_10156476 | Ga0207653_101564762 | 188 |
| 281 | 3300025898 | Ga0207692_10119988 | Ga0207692_101199883 | 188 |
| 282 | 3300025901 | Ga0207688_10001154 | Ga0207688_100011543 | 188 |
| 283 | 3300025901 | Ga0207688_10007117 | Ga0207688_100071175 | 188 |
| 284 | 3300025908 | Ga0207643_10090946 | Ga0207643_100909462 | 188 |
| 285 | 3300025909 | Ga0207705_10652835 | Ga0207705_106528351 | 188 |
| 286 | 3300025913 | Ga0207695_10357716 | Ga0207695_103577162 | 188 |
| 287 | 3300025915 | Ga0207693_10000036 | Ga0207693_1000003686 | 188 |
| 288 | 3300025915 | Ga0207693_10040330 | Ga0207693_100403303 | 188 |
| 289 | 3300025916 | Ga0207663_10308964 | Ga0207663_103089642 | 188 |
| 290 | 3300025917 | Ga0207660_10705803 | Ga0207660_107058032 | 188 |
| 291 | 3300025919 | Ga0207657_10003298 | Ga0207657_100032983 | 188 |
| 292 | 3300025919 | Ga0207657_10058617 | Ga0207657_100586174 | 188 |
| 293 | 3300025919 | Ga0207657_10086996 | Ga0207657_100869962 | 188 |
| 294 | 3300025924 | Ga0207694_10310107 | Ga0207694_103101072 | 188 |
| 295 | 3300025926 | Ga0207659_10048959 | Ga0207659_100489594 | 188 |
| 296 | 3300025926 | Ga0207659_10197705 | Ga0207659_101977052 | 188 |
| 297 | 3300025927 | Ga0207687_10049069 | Ga0207687_100490692 | 188 |
| 298 | 3300025929 | Ga0207664_10035621 | Ga0207664_100356212 | 188 |
| 299 | 3300025932 | Ga0207690_10000064 | Ga0207690_1000006469 | 188 |
| 300 | 3300025932 | Ga0207690_10164392 | Ga0207690_101643921 | 188 |
| 301 | 3300025933 | Ga0207706_10001985 | Ga0207706_1000198510 | 188 |
| 302 | 3300025933 | Ga0207706_10042627 | Ga0207706_100426274 | 188 |
| 303 | 3300025934 | Ga0207686_10483811 | Ga0207686_104838111 | 188 |
| 304 | 3300025935 | Ga0207709_10195429 | Ga0207709_101954291 | 188 |
| 305 | 3300025936 | Ga0207670_10255572 | Ga0207670_102555721 | 188 |
| 306 | 3300025937 | Ga0207669_10133727 | Ga0207669_101337272 | 188 |
| 307 | 3300025938 | Ga0207704_10008364 | Ga0207704_100083644 | 188 |
| 308 | 3300025940 | Ga0207691_10142893 | Ga0207691_101428932 | 188 |
| 309 | 3300025941 | Ga0207711_10015551 | Ga0207711_100155513 | 188 |
| 310 | 3300025942 | Ga0207689_10155091 | Ga0207689_101550913 | 188 |
| 311 | 3300025944 | Ga0207661_10004455 | Ga0207661_100044552 | 188 |
| 312 | 3300025945 | Ga0207679_10529617 | Ga0207679_105296172 | 188 |
| 313 | 3300025949 | Ga0207667_10515925 | Ga0207667_105159252 | 188 |
| 314 | 3300025960 | Ga0207651_10133326 | Ga0207651_101333262 | 188 |
| 315 | 3300025960 | Ga0207651_10370071 | Ga0207651_103700712 | 188 |
| 316 | 3300025986 | Ga0207658_10702128 | Ga0207658_107021282 | 188 |
| 317 | 3300026023 | Ga0207677_10322903 | Ga0207677_103229031 | 188 |
| 318 | 3300026035 | Ga0207703_10835798 | Ga0207703_108357981 | 188 |
| 319 | 3300026041 | Ga0207639_10039100 | Ga0207639_100391004 | 188 |
| 320 | 3300026067 | Ga0207678_10023321 | Ga0207678_100233216 | 188 |
| 321 | 3300026067 | Ga0207678_10038610 | Ga0207678_100386104 | 188 |
| 322 | 3300026075 | Ga0207708_10006175 | Ga0207708_100061753 | 188 |
| 323 | 3300026075 | Ga0207708_10008298 | Ga0207708_100082986 | 188 |
| 324 | 3300026078 | Ga0207702_10072197 | Ga0207702_100721973 | 188 |
| 325 | 3300026088 | Ga0207641_10046202 | Ga0207641_100462024 | 188 |
| 326 | 3300026089 | Ga0207648_10060218 | Ga0207648_100602182 | 188 |
| 327 | 3300026095 | Ga0207676_10046013 | Ga0207676_100460133 | 188 |
| 328 | 3300026116 | Ga0207674_10131165 | Ga0207674_101311653 | 188 |
| 329 | 3300026116 | Ga0207674_10646821 | Ga0207674_106468212 | 188 |
| 330 | 3300026121 | Ga0207683_10010330 | Ga0207683_100103302 | 188 |
| 331 | 3300026142 | Ga0207698_10794627 | Ga0207698_107946272 | 188 |
| 332 | 3300028379 | Ga0268266_10303321 | Ga0268266_103033212 | 188 |
| 333 | 3300031548 | Ga0307408_100205850 | Ga0307408_1002058502 | 188 |
| 334 | 3300031901 | Ga0307406_10135001 | Ga0307406_101350012 | 188 |
| 335 | 3300031911 | Ga0307412_10685716 | Ga0307412_106857162 | 188 |
| 336 | 3300032002 | Ga0307416_100708770 | Ga0307416_1007087702 | 188 |
| 337 | 3300032004 | Ga0307414_10936097 | Ga0307414_109360972 | 188 |
| 338 | 3300032126 | Ga0307415_100576123 | Ga0307415_1005761232 | 188 |
| 339 | 3300037418 | Ga0395900_0615622 | Ga0395900_0615622_438_1004 | 188 |
| 340 | 3300038443 | Ga0395901_0031752 | Ga0395901_0031752_4539_5117 | 188 |
| 341 | 3300038443 | Ga0395901_0347602 | Ga0395901_0347602_884_1450 | 188 |
| 342 | 3300042009 | Ga0439451_017501 | Ga0439451_017501_210_788 | 188 |
| 343 | 3300042013 | Ga0439456_025827 | Ga0439456_025827_611_1234 | 188 |
| 344 | 3300042461 | Ga0439460_0001189 | Ga0439460_0001189_4667_5245 | 188 |
| 345 | 3300044684 | Ga0466966_0095308 | Ga0466966_0095308_811_1401 | 188 |
| 346 | 3300044706 | Ga0466964_0038924 | Ga0466964_0038924_615_1199 | 188 |
| 347 | 3300044901 | Ga0466960_0118967 | Ga0466960_0118967_711_1295 | 188 |
| 348 | 3300044901 | Ga0466960_0127917 | Ga0466960_0127917_52_636 | 188 |
| 349 | 3300045976 | Ga0466967_0004422 | Ga0466967_0004422_4063_4647 | 188 |
| 350 | 3300045976 | Ga0466967_0768412 | Ga0466967_0768412_328_894 | 188 |
| 351 | 3300046471 | Ga0495650_0000035 | Ga0495650_0000035_94540_95106 | 188 |
| 352 | 3300048903 | Ga0496100_0029070 | Ga0496100_0029070_2227_2793 | 188 |
| 353 | 3300048904 | Ga0496101_0035526 | Ga0496101_0035526_314_880 | 188 |
| 354 | 3300048905 | Ga0496102_0017006 | Ga0496102_0017006_3718_4284 | 188 |
| 355 | 3300048905 | Ga0496102_0118625 | Ga0496102_0118625_1707_2273 | 188 |
| 356 | 3300048906 | Ga0496103_0009420 | Ga0496103_0009420_1670_2236 | 188 |
| 357 | 3300048906 | Ga0496103_0013294 | Ga0496103_0013294_2343_2909 | 188 |
| 358 | 3300048907 | Ga0496104_0004549 | Ga0496104_0004549_4821_5387 | 188 |
| 359 | 3300048907 | Ga0496104_0630956 | Ga0496104_0630956_139_705 | 188 |
| 360 | 3300048909 | Ga0496106_0103285 | Ga0496106_0103285_1414_1980 | 188 |
| 361 | 3300048909 | Ga0496106_0415300 | Ga0496106_0415300_400_966 | 188 |
| 362 | 3300048910 | Ga0496107_0274185 | Ga0496107_0274185_557_1123 | 188 |
| 363 | 3300048911 | Ga0496108_0006122 | Ga0496108_0006122_7997_8563 | 188 |
| 364 | 3300048912 | Ga0496109_0005502 | Ga0496109_0005502_4618_5184 | 188 |
| 365 | 3300048912 | Ga0496109_0019747 | Ga0496109_0019747_3888_4454 | 188 |
| 366 | 3300048913 | Ga0496110_0004721 | Ga0496110_0004721_3856_4422 | 188 |
| 367 | 3300048913 | Ga0496110_0051026 | Ga0496110_0051026_2901_3467 | 188 |
| 368 | 3300048914 | Ga0496111_0001935 | Ga0496111_0001935_9507_10073 | 188 |
| 369 | 3300048915 | Ga0496112_0000280 | Ga0496112_0000280_11178_11744 | 188 |
| 370 | 3300048915 | Ga0496112_0021899 | Ga0496112_0021899_3182_3748 | 188 |
| 371 | 3300048916 | Ga0496113_0025990 | Ga0496113_0025990_1086_1652 | 188 |
| 372 | 3300048916 | Ga0496113_0299216 | Ga0496113_0299216_506_1072 | 188 |
| 373 | 3300048920 | Ga0496117_0004973 | Ga0496117_0004973_10423_10989 | 188 |
| 374 | 3300048920 | Ga0496117_0230174 | Ga0496117_0230174_43_609 | 188 |
| 375 | 3300048921 | Ga0496118_0001190 | Ga0496118_0001190_2473_3039 | 188 |
| 376 | 3300048922 | Ga0496119_0131214 | Ga0496119_0131214_109_675 | 188 |
| 377 | 3300048924 | Ga0496121_0362727 | Ga0496121_0362727_378_944 | 188 |
| 378 | 3300048924 | Ga0496121_0382486 | Ga0496121_0382486_290_856 | 188 |
| 379 | 3300048927 | Ga0496124_0256085 | Ga0496124_0256085_259_825 | 188 |
| 380 | 3300048927 | Ga0496124_0472301 | Ga0496124_0472301_59_625 | 188 |
| 381 | 3300048928 | Ga0496125_0063483 | Ga0496125_0063483_1247_1813 | 188 |
| 382 | 3300048928 | Ga0496125_0509833 | Ga0496125_0509833_21_587 | 188 |
| 383 | 3300049568 | Ga0501031_0212825 | Ga0501031_0212825_469_1035 | 188 |
| 384 | 3300049575 | Ga0501039_0360574 | Ga0501039_0360574_170_736 | 188 |
| 385 | 3300049581 | Ga0501047_0036161 | Ga0501047_0036161_4192_4758 | 188 |
| 386 | 3300049584 | Ga0501068_0146682 | Ga0501068_0146682_462_1028 | 188 |
| 387 | 3300049586 | Ga0501070_0009330 | Ga0501070_0009330_6491_7057 | 188 |
| 388 | 3300049586 | Ga0501070_0259727 | Ga0501070_0259727_817_1383 | 188 |
| 389 | 3300049588 | Ga0501072_0214020 | Ga0501072_0214020_474_1040 | 188 |
| 390 | 3300049744 | Ga0501083_0028215 | Ga0501083_0028215_1539_2105 | 188 |
| 391 | 3300049822 | Ga0501035_0712634 | Ga0501035_0712634_215_781 | 188 |
| 392 | 3300049823 | Ga0501044_0027876 | Ga0501044_0027876_3129_3695 | 188 |
| 393 | 3300050490 | nmdc:mga03n38_7559_c1 | nmdc:mga03n38_7559_c1_3003_3569 | 188 |
| 394 | 3300050491 | nmdc:mga00v17_319016_c1 | nmdc:mga00v17_319016_c1_387_953 | 188 |
| 395 | 3300050491 | nmdc:mga00v17_91979_c1 | nmdc:mga00v17_91979_c1_95_661 | 188 |
| 396 | 3300050492 | nmdc:mga0yw44_1021_c1 | nmdc:mga0yw44_1021_c1_40_606 | 188 |
| 397 | 3300050494 | nmdc:mga06z11_270400_c1 | nmdc:mga06z11_270400_c1_367_933 | 188 |
| 398 | 3300050511 | nmdc:mga08y16_105703_c1 | nmdc:mga08y16_105703_c1_1504_2070 | 188 |
| 399 | 3300050511 | nmdc:mga08y16_82624_c1 | nmdc:mga08y16_82624_c1_2304_2870 | 188 |
| 400 | 3300053119 | Ga0500595_035427 | Ga0500595_035427_363_929 | 188 |
| 401 | 3300060353 | Ga0501082_0918992 | Ga0501082_0918992_145_711 | 188 |
| 402 | 3300005337 | Ga0070682_100000102 | Ga0070682_10000010234 | 189 |
| 403 | 3300005338 | Ga0068868_100738622 | Ga0068868_1007386221 | 189 |
| 404 | 3300005347 | Ga0070668_100113504 | Ga0070668_1001135042 | 189 |
| 405 | 3300005366 | Ga0070659_100176187 | Ga0070659_1001761872 | 189 |
| 406 | 3300005366 | Ga0070659_100408704 | Ga0070659_1004087042 | 189 |
| 407 | 3300005435 | Ga0070714_100074817 | Ga0070714_1000748172 | 189 |
| 408 | 3300005440 | Ga0070705_100018095 | Ga0070705_1000180957 | 189 |
| 409 | 3300005441 | Ga0070700_100184149 | Ga0070700_1001841492 | 189 |
| 410 | 3300005444 | Ga0070694_100510655 | Ga0070694_1005106552 | 189 |
| 411 | 3300005457 | Ga0070662_100276367 | Ga0070662_1002763672 | 189 |
| 412 | 3300005539 | Ga0068853_100371266 | Ga0068853_1003712662 | 189 |
| 413 | 3300005546 | Ga0070696_100115792 | Ga0070696_1001157922 | 189 |
| 414 | 3300005563 | Ga0068855_100446339 | Ga0068855_1004463394 | 189 |
| 415 | 3300005615 | Ga0070702_100086548 | Ga0070702_1000865482 | 189 |
| 416 | 3300005615 | Ga0070702_100094861 | Ga0070702_1000948612 | 189 |
| 417 | 3300005615 | Ga0070702_100098954 | Ga0070702_1000989541 | 189 |
| 418 | 3300005616 | Ga0068852_100103195 | Ga0068852_1001031952 | 189 |
| 419 | 3300005616 | Ga0068852_100622780 | Ga0068852_1006227802 | 189 |
| 420 | 3300005617 | Ga0068859_101001881 | Ga0068859_1010018812 | 189 |
| 421 | 3300005841 | Ga0068863_100160081 | Ga0068863_1001600812 | 189 |
| 422 | 3300005842 | Ga0068858_100059212 | Ga0068858_1000592127 | 189 |
| 423 | 3300005843 | Ga0068860_100238767 | Ga0068860_1002387673 | 189 |
| 424 | 3300005844 | Ga0068862_100785944 | Ga0068862_1007859441 | 189 |
| 425 | 3300005985 | Ga0081539_10150133 | Ga0081539_101501332 | 189 |
| 426 | 3300006173 | Ga0070716_100107080 | Ga0070716_1001070803 | 189 |
| 427 | 3300006871 | Ga0075434_100333981 | Ga0075434_1003339812 | 189 |
| 428 | 3300006881 | Ga0068865_100246995 | Ga0068865_1002469953 | 189 |
| 429 | 3300006881 | Ga0068865_100327960 | Ga0068865_1003279602 | 189 |
| 430 | 3300006931 | Ga0097620_101001848 | Ga0097620_1010018482 | 189 |
| 431 | 3300009098 | Ga0105245_10734819 | Ga0105245_107348192 | 189 |
| 432 | 3300009101 | Ga0105247_10311119 | Ga0105247_103111192 | 189 |
| 433 | 3300009174 | Ga0105241_10716217 | Ga0105241_107162171 | 189 |
| 434 | 3300009176 | Ga0105242_10085386 | Ga0105242_100853862 | 189 |
| 435 | 3300009177 | Ga0105248_10491642 | Ga0105248_104916422 | 189 |
| 436 | 3300009545 | Ga0105237_10534592 | Ga0105237_105345921 | 189 |
| 437 | 3300009553 | Ga0105249_11104708 | Ga0105249_111047082 | 189 |
| 438 | 3300009553 | Ga0105249_11262741 | Ga0105249_112627411 | 189 |
| 439 | 3300010375 | Ga0105239_10375416 | Ga0105239_103754162 | 189 |
| 440 | 3300013296 | Ga0157374_10201302 | Ga0157374_102013022 | 189 |
| 441 | 3300013308 | Ga0157375_10917946 | Ga0157375_109179462 | 189 |
| 442 | 3300014745 | Ga0157377_10042863 | Ga0157377_100428636 | 189 |
| 443 | 3300014969 | Ga0157376_11170484 | Ga0157376_111704841 | 189 |
| 444 | 3300020080 | Ga0206350_10388591 | Ga0206350_103885911 | 189 |
| 445 | 3300020080 | Ga0206350_10624272 | Ga0206350_106242722 | 189 |
| 446 | 3300022467 | Ga0224712_10351005 | Ga0224712_103510051 | 189 |
| 447 | 3300025901 | Ga0207688_10104859 | Ga0207688_101048592 | 189 |
| 448 | 3300025904 | Ga0207647_10147180 | Ga0207647_101471802 | 189 |
| 449 | 3300025908 | Ga0207643_10057698 | Ga0207643_100576982 | 189 |
| 450 | 3300025915 | Ga0207693_10054303 | Ga0207693_100543032 | 189 |
| 451 | 3300025916 | Ga0207663_10057935 | Ga0207663_100579354 | 189 |
| 452 | 3300025919 | Ga0207657_10077543 | Ga0207657_100775436 | 189 |
| 453 | 3300025919 | Ga0207657_10130274 | Ga0207657_101302741 | 189 |
| 454 | 3300025920 | Ga0207649_10493771 | Ga0207649_104937711 | 189 |
| 455 | 3300025921 | Ga0207652_10065133 | Ga0207652_100651336 | 189 |
| 456 | 3300025923 | Ga0207681_10722438 | Ga0207681_107224381 | 189 |
| 457 | 3300025924 | Ga0207694_10126216 | Ga0207694_101262163 | 189 |
| 458 | 3300025929 | Ga0207664_10223474 | Ga0207664_102234742 | 189 |
| 459 | 3300025932 | Ga0207690_10285246 | Ga0207690_102852462 | 189 |
| 460 | 3300025933 | Ga0207706_10137784 | Ga0207706_101377843 | 189 |
| 461 | 3300025933 | Ga0207706_10509477 | Ga0207706_105094772 | 189 |
| 462 | 3300025935 | Ga0207709_10515015 | Ga0207709_105150151 | 189 |
| 463 | 3300025935 | Ga0207709_10696105 | Ga0207709_106961052 | 189 |
| 464 | 3300025936 | Ga0207670_10249857 | Ga0207670_102498572 | 189 |
| 465 | 3300025936 | Ga0207670_10354993 | Ga0207670_103549932 | 189 |
| 466 | 3300025937 | Ga0207669_10231327 | Ga0207669_102313272 | 189 |
| 467 | 3300025937 | Ga0207669_10555855 | Ga0207669_105558552 | 189 |
| 468 | 3300025938 | Ga0207704_10788847 | Ga0207704_107888471 | 189 |
| 469 | 3300025939 | Ga0207665_10032210 | Ga0207665_100322104 | 189 |
| 470 | 3300025940 | Ga0207691_10151705 | Ga0207691_101517053 | 189 |
| 471 | 3300025949 | Ga0207667_10479701 | Ga0207667_104797012 | 189 |
| 472 | 3300025949 | Ga0207667_10782920 | Ga0207667_107829202 | 189 |
| 473 | 3300025961 | Ga0207712_10044596 | Ga0207712_100445967 | 189 |
| 474 | 3300025972 | Ga0207668_10385800 | Ga0207668_103858002 | 189 |
| 475 | 3300025981 | Ga0207640_10225193 | Ga0207640_102251932 | 189 |
| 476 | 3300026041 | Ga0207639_10149626 | Ga0207639_101496262 | 189 |
| 477 | 3300026075 | Ga0207708_10179606 | Ga0207708_101796062 | 189 |
| 478 | 3300026089 | Ga0207648_10097076 | Ga0207648_100970762 | 189 |
| 479 | 3300026118 | Ga0207675_100045768 | Ga0207675_1000457687 | 189 |
| 480 | 3300026142 | Ga0207698_10414479 | Ga0207698_104144791 | 189 |
| 481 | 3300028380 | Ga0268265_10404622 | Ga0268265_104046222 | 189 |
| 482 | 3300028380 | Ga0268265_10808168 | Ga0268265_108081682 | 189 |
| 483 | 3300031731 | Ga0307405_10567330 | Ga0307405_105673302 | 189 |
| 484 | 3300031824 | Ga0307413_10165871 | Ga0307413_101658712 | 189 |
| 485 | 3300031824 | Ga0307413_10292913 | Ga0307413_102929131 | 189 |
| 486 | 3300031852 | Ga0307410_10031793 | Ga0307410_100317934 | 189 |
| 487 | 3300031901 | Ga0307406_10013575 | Ga0307406_100135752 | 189 |
| 488 | 3300031901 | Ga0307406_10483738 | Ga0307406_104837381 | 189 |
| 489 | 3300031903 | Ga0307407_10199790 | Ga0307407_101997902 | 189 |
| 490 | 3300031995 | Ga0307409_100381919 | Ga0307409_1003819191 | 189 |
| 491 | 3300031995 | Ga0307409_100632681 | Ga0307409_1006326812 | 189 |
| 492 | 3300032002 | Ga0307416_100030344 | Ga0307416_1000303443 | 189 |
| 493 | 3300032004 | Ga0307414_10219882 | Ga0307414_102198821 | 189 |
| 494 | 3300032005 | Ga0307411_10047028 | Ga0307411_100470282 | 189 |
| 495 | 3300032126 | Ga0307415_100042215 | Ga0307415_1000422153 | 189 |
| 496 | 3300032126 | Ga0307415_100068875 | Ga0307415_1000688754 | 189 |
| 497 | 3300032126 | Ga0307415_100073134 | Ga0307415_1000731341 | 189 |
| 498 | 3300032126 | Ga0307415_100841642 | Ga0307415_1008416422 | 189 |
| 499 | 3300035172 | Ga0373955_0111673 | Ga0373955_0111673_358_1029 | 189 |
| 500 | 3300037471 | Ga0395905_0052992 | Ga0395905_0052992_738_1343 | 189 |
| 501 | 3300041452 | Ga0451793_0656212 | Ga0451793_0656212_467_1036 | 189 |
| 502 | 3300041509 | Ga0451843_1480200 | Ga0451843_1480200_818_1387 | 189 |
| 503 | 3300044683 | Ga0466965_0448394 | Ga0466965_0448394_121_702 | 189 |
| 504 | 3300044842 | Ga0466957_0182976 | Ga0466957_0182976_300_884 | 189 |
| 505 | 3300045836 | Ga0466958_0351858 | Ga0466958_0351858_151_726 | 189 |
| 506 | 3300045976 | Ga0466967_0039393 | Ga0466967_0039393_2720_3307 | 189 |
| 507 | 3300045976 | Ga0466967_0150502 | Ga0466967_0150502_1297_1869 | 189 |
| 508 | 3300046525 | Ga0495663_0099372 | Ga0495663_0099372_101_679 | 189 |
| 509 | 3300046615 | Ga0495656_0000217 | Ga0495656_0000217_83_667 | 189 |
| 510 | 3300048903 | Ga0496100_0166003 | Ga0496100_0166003_163_750 | 189 |
| 511 | 3300048903 | Ga0496100_0456279 | Ga0496100_0456279_71_679 | 189 |
| 512 | 3300048903 | Ga0496100_0699495 | Ga0496100_0699495_178_765 | 189 |
| 513 | 3300048904 | Ga0496101_0002517 | Ga0496101_0002517_1648_2235 | 189 |
| 514 | 3300048905 | Ga0496102_0159882 | Ga0496102_0159882_1297_1884 | 189 |
| 515 | 3300048905 | Ga0496102_0403502 | Ga0496102_0403502_277_885 | 189 |
| 516 | 3300048905 | Ga0496102_0812079 | Ga0496102_0812079_208_795 | 189 |
| 517 | 3300048907 | Ga0496104_0248307 | Ga0496104_0248307_217_798 | 189 |
| 518 | 3300048907 | Ga0496104_0637938 | Ga0496104_0637938_309_890 | 189 |
| 519 | 3300048908 | Ga0496105_0063040 | Ga0496105_0063040_2415_2996 | 189 |
| 520 | 3300048908 | Ga0496105_0107930 | Ga0496105_0107930_1492_2073 | 189 |
| 521 | 3300048909 | Ga0496106_0074346 | Ga0496106_0074346_1756_2343 | 189 |
| 522 | 3300048910 | Ga0496107_0001550 | Ga0496107_0001550_10235_10822 | 189 |
| 523 | 3300048910 | Ga0496107_0730069 | Ga0496107_0730069_113_700 | 189 |
| 524 | 3300048911 | Ga0496108_0024974 | Ga0496108_0024974_2226_2813 | 189 |
| 525 | 3300048911 | Ga0496108_1075027 | Ga0496108_1075027_34_615 | 189 |
| 526 | 3300048912 | Ga0496109_0026713 | Ga0496109_0026713_4366_4953 | 189 |
| 527 | 3300048913 | Ga0496110_0314426 | Ga0496110_0314426_470_1057 | 189 |
| 528 | 3300048913 | Ga0496110_0837646 | Ga0496110_0837646_92_673 | 189 |
| 529 | 3300048914 | Ga0496111_0058662 | Ga0496111_0058662_1415_1996 | 189 |
| 530 | 3300048914 | Ga0496111_0290537 | Ga0496111_0290537_165_752 | 189 |
| 531 | 3300048915 | Ga0496112_0001978 | Ga0496112_0001978_19_597 | 189 |
| 532 | 3300048915 | Ga0496112_0399097 | Ga0496112_0399097_163_744 | 189 |
| 533 | 3300048915 | Ga0496112_0834687 | Ga0496112_0834687_178_765 | 189 |
| 534 | 3300048915 | Ga0496112_0980362 | Ga0496112_0980362_41_628 | 189 |
| 535 | 3300048916 | Ga0496113_0000001 | Ga0496113_0000001_51534_52112 | 189 |
| 536 | 3300048917 | Ga0496114_0120061 | Ga0496114_0120061_986_1594 | 189 |
| 537 | 3300048917 | Ga0496114_0150239 | Ga0496114_0150239_489_1070 | 189 |
| 538 | 3300048917 | Ga0496114_0355334 | Ga0496114_0355334_137_724 | 189 |
| 539 | 3300049572 | Ga0501036_0233078 | Ga0501036_0233078_602_1183 | 189 |
| 540 | 3300049586 | Ga0501070_0380715 | Ga0501070_0380715_215_796 | 189 |
| 541 | 3300049591 | Ga0501075_0496733 | Ga0501075_0496733_80_658 | 189 |
| 542 | 3300050507 | nmdc:mga05p37_634025_c1 | nmdc:mga05p37_634025_c1_315_902 | 189 |
| 543 | 3300050512 | nmdc:mga0n895_146335_c1 | nmdc:mga0n895_146335_c1_1523_2101 | 189 |
| 544 | 3300001979 | JGI24740J21852_10010169 | JGI24740J21852_100101692 | 190 |
| 545 | 3300002074 | JGI24748J21848_1001174 | JGI24748J21848_10011742 | 190 |
| 546 | 3300002239 | JGI24034J26672_10000090 | JGI24034J26672_1000009025 | 190 |
| 547 | 3300002239 | JGI24034J26672_10000145 | JGI24034J26672_100001452 | 190 |
| 548 | 3300002244 | JGI24742J22300_10000813 | JGI24742J22300_1000081311 | 190 |
| 549 | 3300003308 | Ga0006777J48905_1038789 | Ga0006777J48905_10387892 | 190 |
| 550 | 3300003568 | Ga0006781J51513_1016641 | Ga0006781J51513_10166412 | 190 |
| 551 | 3300003577 | Ga0007416J51690_1082693 | Ga0007416J51690_10826931 | 190 |
| 552 | 3300003579 | Ga0007429J51699_1024122 | Ga0007429J51699_10241222 | 190 |
| 553 | 3300003579 | Ga0007429J51699_1040927 | Ga0007429J51699_10409271 | 190 |
| 554 | 3300003579 | Ga0007429J51699_1058940 | Ga0007429J51699_10589401 | 190 |
| 555 | 3300003693 | Ga0032354_1046428 | Ga0032354_10464281 | 190 |
| 556 | 3300005329 | Ga0070683_100000534 | Ga0070683_10000053422 | 190 |
| 557 | 3300005329 | Ga0070683_100000888 | Ga0070683_10000088815 | 190 |
| 558 | 3300005329 | Ga0070683_100002079 | Ga0070683_10000207914 | 190 |
| 559 | 3300005329 | Ga0070683_100173974 | Ga0070683_1001739743 | 190 |
| 560 | 3300005331 | Ga0070670_100012696 | Ga0070670_1000126964 | 190 |
| 561 | 3300005333 | Ga0070677_10000081 | Ga0070677_1000008129 | 190 |
| 562 | 3300005337 | Ga0070682_100000556 | Ga0070682_1000005563 | 190 |
| 563 | 3300005338 | Ga0068868_100000634 | Ga0068868_10000063428 | 190 |
| 564 | 3300005338 | Ga0068868_100001874 | Ga0068868_1000018749 | 190 |
| 565 | 3300005339 | Ga0070660_100513137 | Ga0070660_1005131372 | 190 |
| 566 | 3300005341 | Ga0070691_10000064 | Ga0070691_1000006413 | 190 |
| 567 | 3300005344 | Ga0070661_100000004 | Ga0070661_10000000460 | 190 |
| 568 | 3300005345 | Ga0070692_10040923 | Ga0070692_100409231 | 190 |
| 569 | 3300005347 | Ga0070668_100050286 | Ga0070668_1000502862 | 190 |
| 570 | 3300005354 | Ga0070675_100000078 | Ga0070675_10000007822 | 190 |
| 571 | 3300005354 | Ga0070675_100226255 | Ga0070675_1002262551 | 190 |
| 572 | 3300005365 | Ga0070688_100000705 | Ga0070688_10000070516 | 190 |
| 573 | 3300005365 | Ga0070688_100000989 | Ga0070688_1000009899 | 190 |
| 574 | 3300005366 | Ga0070659_100030992 | Ga0070659_1000309922 | 190 |
| 575 | 3300005435 | Ga0070714_100770019 | Ga0070714_1007700192 | 190 |
| 576 | 3300005436 | Ga0070713_100000005 | Ga0070713_100000005215 | 190 |
| 577 | 3300005444 | Ga0070694_100466781 | Ga0070694_1004667812 | 190 |
| 578 | 3300005455 | Ga0070663_100583445 | Ga0070663_1005834452 | 190 |
| 579 | 3300005455 | Ga0070663_100708643 | Ga0070663_1007086431 | 190 |
| 580 | 3300005458 | Ga0070681_10111778 | Ga0070681_101117785 | 190 |
| 581 | 3300005459 | Ga0068867_100000278 | Ga0068867_10000027836 | 190 |
| 582 | 3300005466 | Ga0070685_10000012 | Ga0070685_1000001230 | 190 |
| 583 | 3300005466 | Ga0070685_10001134 | Ga0070685_100011349 | 190 |
| 584 | 3300005530 | Ga0070679_100011522 | Ga0070679_1000115227 | 190 |
| 585 | 3300005535 | Ga0070684_100010265 | Ga0070684_1000102653 | 190 |
| 586 | 3300005535 | Ga0070684_100060185 | Ga0070684_1000601854 | 190 |
| 587 | 3300005535 | Ga0070684_100086257 | Ga0070684_1000862573 | 190 |
| 588 | 3300005535 | Ga0070684_100128128 | Ga0070684_1001281283 | 190 |
| 589 | 3300005539 | Ga0068853_100304048 | Ga0068853_1003040482 | 190 |
| 590 | 3300005548 | Ga0070665_100000604 | Ga0070665_1000006049 | 190 |
| 591 | 3300005563 | Ga0068855_100316178 | Ga0068855_1003161784 | 190 |
| 592 | 3300005564 | Ga0070664_100022449 | Ga0070664_1000224494 | 190 |
| 593 | 3300005577 | Ga0068857_100131984 | Ga0068857_1001319841 | 190 |
| 594 | 3300005578 | Ga0068854_100000062 | Ga0068854_10000006238 | 190 |
| 595 | 3300005578 | Ga0068854_100322363 | Ga0068854_1003223632 | 190 |
| 596 | 3300005614 | Ga0068856_100000377 | Ga0068856_10000037739 | 190 |
| 597 | 3300005614 | Ga0068856_100007632 | Ga0068856_10000763215 | 190 |
| 598 | 3300005614 | Ga0068856_100028080 | Ga0068856_1000280807 | 190 |
| 599 | 3300005616 | Ga0068852_100000022 | Ga0068852_100000022106 | 190 |
| 600 | 3300005616 | Ga0068852_100556184 | Ga0068852_1005561843 | 190 |
| 601 | 3300005718 | Ga0068866_10172042 | Ga0068866_101720422 | 190 |
| 602 | 3300005719 | Ga0068861_100315762 | Ga0068861_1003157622 | 190 |
| 603 | 3300005834 | Ga0068851_10000297 | Ga0068851_1000029714 | 190 |
| 604 | 3300005834 | Ga0068851_10024779 | Ga0068851_100247792 | 190 |
| 605 | 3300005841 | Ga0068863_100000032 | Ga0068863_10000003246 | 190 |
| 606 | 3300005841 | Ga0068863_100021805 | Ga0068863_1000218056 | 190 |
| 607 | 3300005842 | Ga0068858_100000343 | Ga0068858_1000003439 | 190 |
| 608 | 3300005937 | Ga0081455_10269259 | Ga0081455_102692592 | 190 |
| 609 | 3300005981 | Ga0081538_10002916 | Ga0081538_1000291613 | 190 |
| 610 | 3300005981 | Ga0081538_10008690 | Ga0081538_100086904 | 190 |
| 611 | 3300005981 | Ga0081538_10134014 | Ga0081538_101340142 | 190 |
| 612 | 3300005981 | Ga0081538_10165413 | Ga0081538_101654132 | 190 |
| 613 | 3300005983 | Ga0081540_1084274 | Ga0081540_10842742 | 190 |
| 614 | 3300005985 | Ga0081539_10074225 | Ga0081539_100742253 | 190 |
| 615 | 3300006038 | Ga0075365_10000884 | Ga0075365_1000088410 | 190 |
| 616 | 3300006175 | Ga0070712_100007920 | Ga0070712_1000079205 | 190 |
| 617 | 3300006237 | Ga0097621_100549664 | Ga0097621_1005496641 | 190 |
| 618 | 3300006844 | Ga0075428_100130007 | Ga0075428_1001300072 | 190 |
| 619 | 3300006852 | Ga0075433_10431955 | Ga0075433_104319552 | 190 |
| 620 | 3300006881 | Ga0068865_100000135 | Ga0068865_10000013533 | 190 |
| 621 | 3300007076 | Ga0075435_100655607 | Ga0075435_1006556072 | 190 |
| 622 | 3300009094 | Ga0111539_10069371 | Ga0111539_100693713 | 190 |
| 623 | 3300009098 | Ga0105245_10000022 | Ga0105245_10000022151 | 190 |
| 624 | 3300009098 | Ga0105245_10000023 | Ga0105245_1000002326 | 190 |
| 625 | 3300009098 | Ga0105245_10004839 | Ga0105245_1000483914 | 190 |
| 626 | 3300009147 | Ga0114129_10229197 | Ga0114129_102291973 | 190 |
| 627 | 3300009148 | Ga0105243_10046939 | Ga0105243_100469394 | 190 |
| 628 | 3300009148 | Ga0105243_10280006 | Ga0105243_102800062 | 190 |
| 629 | 3300009174 | Ga0105241_10040715 | Ga0105241_100407152 | 190 |
| 630 | 3300009177 | Ga0105248_10000245 | Ga0105248_1000024550 | 190 |
| 631 | 3300009177 | Ga0105248_11588538 | Ga0105248_115885381 | 190 |
| 632 | 3300009551 | Ga0105238_10000028 | Ga0105238_10000028137 | 190 |
| 633 | 3300009553 | Ga0105249_10000181 | Ga0105249_1000018155 | 190 |
| 634 | 3300009553 | Ga0105249_10308920 | Ga0105249_103089202 | 190 |
| 635 | 3300010375 | Ga0105239_10048810 | Ga0105239_100488102 | 190 |
| 636 | 3300010375 | Ga0105239_10133333 | Ga0105239_101333332 | 190 |
| 637 | 3300013052 | Ga0154014_151005 | Ga0154014_1510052 | 190 |
| 638 | 3300013100 | Ga0157373_10089132 | Ga0157373_100891321 | 190 |
| 639 | 3300013102 | Ga0157371_10004879 | Ga0157371_1000487911 | 190 |
| 640 | 3300013104 | Ga0157370_10002276 | Ga0157370_1000227615 | 190 |
| 641 | 3300013104 | Ga0157370_10003533 | Ga0157370_1000353314 | 190 |
| 642 | 3300013104 | Ga0157370_10135255 | Ga0157370_101352552 | 190 |
| 643 | 3300013105 | Ga0157369_10000014 | Ga0157369_10000014201 | 190 |
| 644 | 3300013296 | Ga0157374_10001500 | Ga0157374_1000150023 | 190 |
| 645 | 3300013296 | Ga0157374_10088252 | Ga0157374_100882522 | 190 |
| 646 | 3300013297 | Ga0157378_10001375 | Ga0157378_1000137515 | 190 |
| 647 | 3300013307 | Ga0157372_10000550 | Ga0157372_1000055037 | 190 |
| 648 | 3300013308 | Ga0157375_10000127 | Ga0157375_1000012772 | 190 |
| 649 | 3300013308 | Ga0157375_10000765 | Ga0157375_1000076527 | 190 |
| 650 | 3300013308 | Ga0157375_10096174 | Ga0157375_100961742 | 190 |
| 651 | 3300014325 | Ga0163163_10050696 | Ga0163163_100506962 | 190 |
| 652 | 3300014326 | Ga0157380_10361637 | Ga0157380_103616372 | 190 |
| 653 | 3300014745 | Ga0157377_10344517 | Ga0157377_103445172 | 190 |
| 654 | 3300014968 | Ga0157379_10005332 | Ga0157379_100053329 | 190 |
| 655 | 3300014968 | Ga0157379_10459290 | Ga0157379_104592902 | 190 |
| 656 | 3300017792 | Ga0163161_10000013 | Ga0163161_10000013204 | 190 |
| 657 | 3300017792 | Ga0163161_10263457 | Ga0163161_102634572 | 190 |
| 658 | 3300017792 | Ga0163161_10997194 | Ga0163161_109971941 | 190 |
| 659 | 3300020069 | Ga0197907_10308920 | Ga0197907_103089202 | 190 |
| 660 | 3300020069 | Ga0197907_11146121 | Ga0197907_111461214 | 190 |
| 661 | 3300020070 | Ga0206356_10943150 | Ga0206356_109431503 | 190 |
| 662 | 3300020070 | Ga0206356_11357271 | Ga0206356_113572711 | 190 |
| 663 | 3300020070 | Ga0206356_11573056 | Ga0206356_115730561 | 190 |
| 664 | 3300020070 | Ga0206356_11861396 | Ga0206356_118613963 | 190 |
| 665 | 3300020075 | Ga0206349_1042634 | Ga0206349_10426341 | 190 |
| 666 | 3300020075 | Ga0206349_1144720 | Ga0206349_11447201 | 190 |
| 667 | 3300020075 | Ga0206349_1166632 | Ga0206349_11666321 | 190 |
| 668 | 3300020075 | Ga0206349_1866038 | Ga0206349_18660381 | 190 |
| 669 | 3300020076 | Ga0206355_1701321 | Ga0206355_17013211 | 190 |
| 670 | 3300020078 | Ga0206352_10098428 | Ga0206352_100984283 | 190 |
| 671 | 3300020080 | Ga0206350_10519099 | Ga0206350_105190991 | 190 |
| 672 | 3300020080 | Ga0206350_10662425 | Ga0206350_106624251 | 190 |
| 673 | 3300020081 | Ga0206354_11397997 | Ga0206354_113979971 | 190 |
| 674 | 3300020081 | Ga0206354_11539976 | Ga0206354_115399761 | 190 |
| 675 | 3300020082 | Ga0206353_11205913 | Ga0206353_112059133 | 190 |
| 676 | 3300020082 | Ga0206353_11695836 | Ga0206353_116958361 | 190 |
| 677 | 3300022467 | Ga0224712_10016960 | Ga0224712_100169605 | 190 |
| 678 | 3300022467 | Ga0224712_10203642 | Ga0224712_102036422 | 190 |
| 679 | 3300025321 | Ga0207656_10000084 | Ga0207656_1000008415 | 190 |
| 680 | 3300025321 | Ga0207656_10012836 | Ga0207656_100128362 | 190 |
| 681 | 3300025893 | Ga0207682_10000327 | Ga0207682_1000032719 | 190 |
| 682 | 3300025907 | Ga0207645_10266828 | Ga0207645_102668282 | 190 |
| 683 | 3300025911 | Ga0207654_10024265 | Ga0207654_100242652 | 190 |
| 684 | 3300025912 | Ga0207707_10088518 | Ga0207707_100885185 | 190 |
| 685 | 3300025913 | Ga0207695_10188864 | Ga0207695_101888642 | 190 |
| 686 | 3300025915 | Ga0207693_10036252 | Ga0207693_100362523 | 190 |
| 687 | 3300025917 | Ga0207660_10008879 | Ga0207660_100088797 | 190 |
| 688 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003199 | 190 |
| 689 | 3300025921 | Ga0207652_10008003 | Ga0207652_100080037 | 190 |
| 690 | 3300025924 | Ga0207694_10000008 | Ga0207694_10000008424 | 190 |
| 691 | 3300025925 | Ga0207650_10584826 | Ga0207650_105848261 | 190 |
| 692 | 3300025926 | Ga0207659_10000018 | Ga0207659_10000018116 | 190 |
| 693 | 3300025927 | Ga0207687_10000015 | Ga0207687_10000015155 | 190 |
| 694 | 3300025927 | Ga0207687_10000039 | Ga0207687_1000003982 | 190 |
| 695 | 3300025927 | Ga0207687_10007940 | Ga0207687_100079408 | 190 |
| 696 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003404 | 190 |
| 697 | 3300025929 | Ga0207664_10600991 | Ga0207664_106009912 | 190 |
| 698 | 3300025932 | Ga0207690_10007587 | Ga0207690_100075876 | 190 |
| 699 | 3300025932 | Ga0207690_10193428 | Ga0207690_101934283 | 190 |
| 700 | 3300025935 | Ga0207709_10097972 | Ga0207709_100979723 | 190 |
| 701 | 3300025935 | Ga0207709_10114728 | Ga0207709_101147282 | 190 |
| 702 | 3300025936 | Ga0207670_10093933 | Ga0207670_100939333 | 190 |
| 703 | 3300025938 | Ga0207704_10000026 | Ga0207704_1000002673 | 190 |
| 704 | 3300025940 | Ga0207691_10078513 | Ga0207691_100785135 | 190 |
| 705 | 3300025941 | Ga0207711_10000192 | Ga0207711_1000019250 | 190 |
| 706 | 3300025941 | Ga0207711_11060061 | Ga0207711_110600611 | 190 |
| 707 | 3300025944 | Ga0207661_10000235 | Ga0207661_1000023526 | 190 |
| 708 | 3300025944 | Ga0207661_10000247 | Ga0207661_1000024726 | 190 |
| 709 | 3300025944 | Ga0207661_10001056 | Ga0207661_1000105615 | 190 |
| 710 | 3300025944 | Ga0207661_10313874 | Ga0207661_103138743 | 190 |
| 711 | 3300025945 | Ga0207679_10014783 | Ga0207679_100147834 | 190 |
| 712 | 3300025961 | Ga0207712_10000067 | Ga0207712_1000006791 | 190 |
| 713 | 3300025961 | Ga0207712_10706224 | Ga0207712_107062241 | 190 |
| 714 | 3300025972 | Ga0207668_10013940 | Ga0207668_100139407 | 190 |
| 715 | 3300025981 | Ga0207640_10000074 | Ga0207640_1000007438 | 190 |
| 716 | 3300025981 | Ga0207640_10220445 | Ga0207640_102204452 | 190 |
| 717 | 3300026023 | Ga0207677_10000308 | Ga0207677_1000030830 | 190 |
| 718 | 3300026023 | Ga0207677_10000534 | Ga0207677_100005343 | 190 |
| 719 | 3300026035 | Ga0207703_10004225 | Ga0207703_100042259 | 190 |
| 720 | 3300026041 | Ga0207639_10007308 | Ga0207639_100073081 | 190 |
| 721 | 3300026041 | Ga0207639_10034486 | Ga0207639_100344865 | 190 |
| 722 | 3300026041 | Ga0207639_10090967 | Ga0207639_100909672 | 190 |
| 723 | 3300026067 | Ga0207678_10438116 | Ga0207678_104381162 | 190 |
| 724 | 3300026075 | Ga0207708_10001934 | Ga0207708_100019345 | 190 |
| 725 | 3300026078 | Ga0207702_10000085 | Ga0207702_1000008550 | 190 |
| 726 | 3300026078 | Ga0207702_10002252 | Ga0207702_1000225217 | 190 |
| 727 | 3300026078 | Ga0207702_10030239 | Ga0207702_100302393 | 190 |
| 728 | 3300026088 | Ga0207641_10000071 | Ga0207641_1000007147 | 190 |
| 729 | 3300026088 | Ga0207641_10016922 | Ga0207641_100169225 | 190 |
| 730 | 3300026088 | Ga0207641_10791072 | Ga0207641_107910721 | 190 |
| 731 | 3300026089 | Ga0207648_10000630 | Ga0207648_100006302 | 190 |
| 732 | 3300026118 | Ga0207675_100006762 | Ga0207675_10000676210 | 190 |
| 733 | 3300026118 | Ga0207675_100343729 | Ga0207675_1003437292 | 190 |
| 734 | 3300026121 | Ga0207683_10044763 | Ga0207683_100447634 | 190 |
| 735 | 3300026142 | Ga0207698_10000043 | Ga0207698_1000004319 | 190 |
| 736 | 3300027907 | Ga0207428_10007997 | Ga0207428_100079977 | 190 |
| 737 | 3300028379 | Ga0268266_10000020 | Ga0268266_10000020516 | 190 |
| 738 | 3300028380 | Ga0268265_10176211 | Ga0268265_101762113 | 190 |
| 739 | 3300028381 | Ga0268264_10025099 | Ga0268264_100250992 | 190 |
| 740 | 3300028381 | Ga0268264_11331960 | Ga0268264_113319601 | 190 |
| 741 | 3300028563 | Ga0265319_1000035 | Ga0265319_100003557 | 190 |
| 742 | 3300028573 | Ga0265334_10103940 | Ga0265334_101039402 | 190 |
| 743 | 3300028800 | Ga0265338_10000171 | Ga0265338_1000017160 | 190 |
| 744 | 3300030521 | Ga0307511_10041190 | Ga0307511_100411905 | 190 |
| 745 | 3300031241 | Ga0265325_10027704 | Ga0265325_100277043 | 190 |
| 746 | 3300031344 | Ga0265316_10367578 | Ga0265316_103675781 | 190 |
| 747 | 3300031548 | Ga0307408_100719889 | Ga0307408_1007198891 | 190 |
| 748 | 3300032002 | Ga0307416_100189500 | Ga0307416_1001895002 | 190 |
| 749 | 3300032005 | Ga0307411_10898499 | Ga0307411_108984991 | 190 |
| 750 | 3300032126 | Ga0307415_100155804 | Ga0307415_1001558042 | 190 |
| 751 | 3300036401 | Ga0373937_0033761 | Ga0373937_0033761_2215_2799 | 190 |
| 752 | 3300036401 | Ga0373937_0091159 | Ga0373937_0091159_1523_2191 | 190 |
| 753 | 3300037466 | Ga0395898_0524336 | Ga0395898_0524336_211_789 | 190 |
| 754 | 3300037471 | Ga0395905_0439532 | Ga0395905_0439532_19_597 | 190 |
| 755 | 3300038443 | Ga0395901_0028426 | Ga0395901_0028426_2770_3354 | 190 |
| 756 | 3300038443 | Ga0395901_0405552 | Ga0395901_0405552_808_1389 | 190 |
| 757 | 3300041459 | Ga0451800_0120947 | Ga0451800_0120947_258_839 | 190 |
| 758 | 3300041486 | Ga0451807_2744985 | Ga0451807_2744985_232_813 | 190 |
| 759 | 3300041512 | Ga0451853_1789901 | Ga0451853_1789901_62_643 | 190 |
| 760 | 3300041512 | Ga0451853_3323498 | Ga0451853_3323498_393_965 | 190 |
| 761 | 3300044656 | Ga0466969_0106065 | Ga0466969_0106065_635_1210 | 190 |
| 762 | 3300044658 | Ga0466972_0157187 | Ga0466972_0157187_246_824 | 190 |
| 763 | 3300044683 | Ga0466965_0120059 | Ga0466965_0120059_307_882 | 190 |
| 764 | 3300044683 | Ga0466965_0198880 | Ga0466965_0198880_211_789 | 190 |
| 765 | 3300044694 | Ga0466963_0000274 | Ga0466963_0000274_8019_8597 | 190 |
| 766 | 3300044694 | Ga0466963_0015396 | Ga0466963_0015396_2029_2610 | 190 |
| 767 | 3300044842 | Ga0466957_0002465 | Ga0466957_0002465_1950_2531 | 190 |
| 768 | 3300044901 | Ga0466960_0221998 | Ga0466960_0221998_388_975 | 190 |
| 769 | 3300045049 | Ga0466959_0096876 | Ga0466959_0096876_417_992 | 190 |
| 770 | 3300045976 | Ga0466967_0000199 | Ga0466967_0000199_20057_20638 | 190 |
| 771 | 3300045976 | Ga0466967_0200430 | Ga0466967_0200430_140_718 | 190 |
| 772 | 3300046454 | Ga0495592_0001677 | Ga0495592_0001677_11497_12081 | 190 |
| 773 | 3300046454 | Ga0495592_0156179 | Ga0495592_0156179_350_934 | 190 |
| 774 | 3300046455 | Ga0495603_0004130 | Ga0495603_0004130_3605_4189 | 190 |
| 775 | 3300046459 | Ga0495629_0001345 | Ga0495629_0001345_3356_3940 | 190 |
| 776 | 3300046459 | Ga0495629_0019045 | Ga0495629_0019045_2588_3169 | 190 |
| 777 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_390793_391377 | 190 |
| 778 | 3300046461 | Ga0495641_0100097 | Ga0495641_0100097_650_1234 | 190 |
| 779 | 3300046463 | Ga0495653_0113273 | Ga0495653_0113273_1292_1876 | 190 |
| 780 | 3300046475 | Ga0495639_0018661 | Ga0495639_0018661_2383_2964 | 190 |
| 781 | 3300046476 | Ga0495662_0000043 | Ga0495662_0000043_9713_10297 | 190 |
| 782 | 3300046511 | Ga0495608_0000035 | Ga0495608_0000035_72920_73501 | 190 |
| 783 | 3300046511 | Ga0495608_0000184 | Ga0495608_0000184_23963_24550 | 190 |
| 784 | 3300046514 | Ga0495618_0000072 | Ga0495618_0000072_58539_59123 | 190 |
| 785 | 3300046515 | Ga0495620_0002270 | Ga0495620_0002270_3984_4574 | 190 |
| 786 | 3300046516 | Ga0495628_0047930 | Ga0495628_0047930_1426_2010 | 190 |
| 787 | 3300046516 | Ga0495628_0143147 | Ga0495628_0143147_520_1104 | 190 |
| 788 | 3300046517 | Ga0495630_0000007 | Ga0495630_0000007_278073_278657 | 190 |
| 789 | 3300046517 | Ga0495630_0008497 | Ga0495630_0008497_2922_3506 | 190 |
| 790 | 3300046523 | Ga0495644_0000618 | Ga0495644_0000618_6511_7095 | 190 |
| 791 | 3300046536 | Ga0495587_0501554 | Ga0495587_0501554_64_645 | 190 |
| 792 | 3300046675 | Ga0495657_0000026 | Ga0495657_0000026_59511_60092 | 190 |
| 793 | 3300046675 | Ga0495657_0002934 | Ga0495657_0002934_7486_8070 | 190 |
| 794 | 3300046678 | Ga0495599_0081169 | Ga0495599_0081169_852_1436 | 190 |
| 795 | 3300046679 | Ga0495623_0114912 | Ga0495623_0114912_708_1292 | 190 |
| 796 | 3300046681 | Ga0495647_0001511 | Ga0495647_0001511_1449_2033 | 190 |
| 797 | 3300046683 | Ga0495658_0001081 | Ga0495658_0001081_8259_8840 | 190 |
| 798 | 3300046684 | Ga0495669_0001240 | Ga0495669_0001240_6876_7460 | 190 |
| 799 | 3300046689 | Ga0495613_0000083 | Ga0495613_0000083_79169_79753 | 190 |
| 800 | 3300046689 | Ga0495613_0170409 | Ga0495613_0170409_573_1157 | 190 |
| 801 | 3300046690 | Ga0495624_0000028 | Ga0495624_0000028_43175_43759 | 190 |
| 802 | 3300046694 | Ga0495649_0006233 | Ga0495649_0006233_3293_3874 | 190 |
| 803 | 3300046809 | Ga0495600_0000634 | Ga0495600_0000634_10286_10870 | 190 |
| 804 | 3300046809 | Ga0495600_0059109 | Ga0495600_0059109_1896_2480 | 190 |
| 805 | 3300047315 | Ga0495581_0495493 | Ga0495581_0495493_52_636 | 190 |
| 806 | 3300047317 | Ga0495604_0080501 | Ga0495604_0080501_1217_1795 | 190 |
| 807 | 3300047317 | Ga0495604_0215730 | Ga0495604_0215730_113_697 | 190 |
| 808 | 3300047321 | Ga0495676_0057014 | Ga0495676_0057014_1425_2006 | 190 |
| 809 | 3300047321 | Ga0495676_0084493 | Ga0495676_0084493_564_1148 | 190 |
| 810 | 3300047444 | Ga0495675_0000015 | Ga0495675_0000015_59504_60085 | 190 |
| 811 | 3300047447 | Ga0495685_010679 | Ga0495685_010679_1517_2101 | 190 |
| 812 | 3300047673 | Ga0495593_0035395 | Ga0495593_0035395_1893_2474 | 190 |
| 813 | 3300048088 | Ga0495602_0000041 | Ga0495602_0000041_51773_52351 | 190 |
| 814 | 3300048903 | Ga0496100_0000005 | Ga0496100_0000005_249528_250100 | 190 |
| 815 | 3300048903 | Ga0496100_0000049 | Ga0496100_0000049_9518_10102 | 190 |
| 816 | 3300048904 | Ga0496101_0000010 | Ga0496101_0000010_90458_91042 | 190 |
| 817 | 3300048904 | Ga0496101_0000101 | Ga0496101_0000101_80954_81526 | 190 |
| 818 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_594384_594968 | 190 |
| 819 | 3300048907 | Ga0496104_0011315 | Ga0496104_0011315_4838_5422 | 190 |
| 820 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_591153_591737 | 190 |
| 821 | 3300048908 | Ga0496105_0043980 | Ga0496105_0043980_1377_1961 | 190 |
| 822 | 3300048909 | Ga0496106_0000013 | Ga0496106_0000013_134445_135029 | 190 |
| 823 | 3300048909 | Ga0496106_0000554 | Ga0496106_0000554_8842_9426 | 190 |
| 824 | 3300048909 | Ga0496106_0001085 | Ga0496106_0001085_7838_8410 | 190 |
| 825 | 3300048910 | Ga0496107_0000011 | Ga0496107_0000011_61783_62355 | 190 |
| 826 | 3300048910 | Ga0496107_0000032 | Ga0496107_0000032_8855_9439 | 190 |
| 827 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_103347_103922 | 190 |
| 828 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_187346_187927 | 190 |
| 829 | 3300048911 | Ga0496108_0000383 | Ga0496108_0000383_24300_24893 | 190 |
| 830 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_347165_347746 | 190 |
| 831 | 3300048912 | Ga0496109_0000036 | Ga0496109_0000036_50052_50627 | 190 |
| 832 | 3300048912 | Ga0496109_0000365 | Ga0496109_0000365_32184_32777 | 190 |
| 833 | 3300048912 | Ga0496109_0013316 | Ga0496109_0013316_6081_6662 | 190 |
| 834 | 3300048912 | Ga0496109_0201552 | Ga0496109_0201552_1166_1753 | 190 |
| 835 | 3300048912 | Ga0496109_0337214 | Ga0496109_0337214_226_810 | 190 |
| 836 | 3300048913 | Ga0496110_0005716 | Ga0496110_0005716_5357_5944 | 190 |
| 837 | 3300048913 | Ga0496110_0067135 | Ga0496110_0067135_1341_1916 | 190 |
| 838 | 3300048914 | Ga0496111_0006969 | Ga0496111_0006969_3109_3696 | 190 |
| 839 | 3300048914 | Ga0496111_0058756 | Ga0496111_0058756_764_1339 | 190 |
| 840 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_200107_200691 | 190 |
| 841 | 3300048915 | Ga0496112_0389642 | Ga0496112_0389642_342_929 | 190 |
| 842 | 3300048917 | Ga0496114_0184654 | Ga0496114_0184654_973_1548 | 190 |
| 843 | 3300048918 | Ga0496115_0034307 | Ga0496115_0034307_2702_3283 | 190 |
| 844 | 3300048924 | Ga0496121_0201715 | Ga0496121_0201715_290_892 | 190 |
| 845 | 3300048928 | Ga0496125_0040716 | Ga0496125_0040716_3064_3639 | 190 |
| 846 | 3300049568 | Ga0501031_0118196 | Ga0501031_0118196_522_1094 | 190 |
| 847 | 3300049569 | Ga0501032_0243262 | Ga0501032_0243262_469_1041 | 190 |
| 848 | 3300049571 | Ga0501034_0005460 | Ga0501034_0005460_3777_4376 | 190 |
| 849 | 3300049572 | Ga0501036_0986755 | Ga0501036_0986755_20_598 | 190 |
| 850 | 3300049575 | Ga0501039_0010474 | Ga0501039_0010474_3862_4434 | 190 |
| 851 | 3300049576 | Ga0501040_0087454 | Ga0501040_0087454_540_1112 | 190 |
| 852 | 3300049578 | Ga0501042_0032510 | Ga0501042_0032510_966_1547 | 190 |
| 853 | 3300049578 | Ga0501042_0325357 | Ga0501042_0325357_158_730 | 190 |
| 854 | 3300049586 | Ga0501070_0040260 | Ga0501070_0040260_1906_2478 | 190 |
| 855 | 3300049592 | Ga0501076_0409517 | Ga0501076_0409517_395_985 | 190 |
| 856 | 3300049744 | Ga0501083_0038464 | Ga0501083_0038464_1320_1898 | 190 |
| 857 | 3300049824 | Ga0501045_0092816 | Ga0501045_0092816_169_768 | 190 |
| 858 | 3300050490 | nmdc:mga03n38_367087_c1 | nmdc:mga03n38_367087_c1_196_774 | 190 |
| 859 | 3300050492 | nmdc:mga0yw44_265577_c1 | nmdc:mga0yw44_265577_c1_28_612 | 190 |
| 860 | 3300050507 | nmdc:mga05p37_144245_c1 | nmdc:mga05p37_144245_c1_936_1520 | 190 |
| 861 | 3300050509 | nmdc:mga0qj67_610351_c1 | nmdc:mga0qj67_610351_c1_60_644 | 190 |
| 862 | 3300050511 | nmdc:mga08y16_66134_c1 | nmdc:mga08y16_66134_c1_1653_2237 | 190 |
| 863 | 3300053077 | Ga0495601_0014155 | Ga0495601_0014155_1157_1741 | 190 |
| 864 | 3300053078 | Ga0495612_0001358 | Ga0495612_0001358_2470_3045 | 190 |
| 865 | 3300053078 | Ga0495612_0002321 | Ga0495612_0002321_2235_2819 | 190 |
| 866 | 3300053084 | Ga0495595_0000017 | Ga0495595_0000017_59511_60092 | 190 |
| 867 | 3300053084 | Ga0495595_0005801 | Ga0495595_0005801_2075_2653 | 190 |
| 868 | 3300053085 | Ga0495619_0000054 | Ga0495619_0000054_69417_69995 | 190 |
| 869 | 3300053085 | Ga0495619_0000101 | Ga0495619_0000101_59511_60092 | 190 |
| 870 | 3300053085 | Ga0495619_0022877 | Ga0495619_0022877_611_1195 | 190 |
| 871 | 3300053094 | Ga0500566_0000572 | Ga0500566_0000572_3554_4138 | 190 |
| 872 | 3300053096 | Ga0500641_0005057 | Ga0500641_0005057_3567_4151 | 190 |
| 873 | 3300053123 | Ga0500614_001780 | Ga0500614_001780_525_1109 | 190 |
| 874 | 3300054114 | Ga0501084_0306131 | Ga0501084_0306131_642_1214 | 190 |
| 875 | 3300054114 | Ga0501084_1015117 | Ga0501084_1015117_99_680 | 190 |
| 876 | 3300061734 | Ga0530510_0529558 | Ga0530510_0529558_210_791 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l18-assembly1.cif.gz_B | ton1285, an intracellular protease from thermococcus onnurineus na1 | 0.9854 | 7 | 177 |
| 6q3t-assembly1.cif.gz_A | structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device | 0.9828 | 9 | 176 |
| 6f2f-assembly1.cif.gz_A | crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. | 0.9825 | 9 | 176 |
| 7r66-assembly1.cif.gz_A | structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution | 0.9811 | 9 | 177 |
| 2vrn-assembly1.cif.gz_B | the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily | 0.9804 | 5 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6f2fA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9825 | 9 | 176 | 3.40.50.880 |
| 2vrnB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9785 | 5 | 189 | 3.40.50.880 |
| 3fseB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9701 | 7 | 176 | 3.40.50.880 |
| 1oi4B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9619 | 7 | 177 | 3.40.50.880 |
| 2vrnB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9576 | 5 | 189 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N9YJY4-F1-model_v4 | Type 1 glutamine amidotransferase | 1 | 2 | 183 |
GO:0016740
|
| AF-A0A6N7Z6T4-F1-model_v4 | DJ-1/PfpI/YhbO family deglycase/protease | 1 | 3 | 186 |
GO:0006508
GO:0008233 |
| AF-A0A7V9QL38-F1-model_v4 | DJ-1/PfpI family protein | 1 | 89 | 189 |
|
| AF-A0A7K2MGU3-F1-model_v4 | Protease | 0.9999 | 9 | 148 |
GO:0006508
GO:0008233 |
| AF-A0A4Q5YZT0-F1-model_v4 | deleted | 0.9996 | 2 | 99 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar