F484354

General Info

Members Datasets Scaffolds Average Seq Length
876 360 876 191

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10088252|Ga0157374_100882522
Length 222
Sequence LGEKTNCRLAERRPGWRHRTSDQIPKELQMSDRLQGKKIAILVANEGVEQVELTSPRDALREAGADLDLLAPEEDEIQAFNHLDKGDTFTPDKAVGKADPDDYDGLVLPGGVANPDQLRTDTDSVQFVRSFFEAGKPVGVICHGPWTLINAGVVDGRTLTSWPSLQTDLRNAGAEWVDEEVHVDQGLVSSRKPDDLEAFNAKIVEEFAEGVHEGQREATASA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
131 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
205 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
226 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
238 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
239 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
240 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
241 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
242 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
243 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
291 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
329 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
354 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
355 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
356 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.72
Metatranscriptomes 6.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 10.05
Rhizosphere 84.47
Stem 0
Stem Tuber 0
Unclassified 2.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010169 3300001979 Bacteria 3637
2 JGI24748J21848_1001174 3300002074 Bacteria 2859
3 JGI24744J21845_10036099 3300002077 Bacteria 934
4 JGI24034J26672_10000090 3300002239 Bacteria 17113
5 JGI24034J26672_10000145 3300002239 Bacteria 10311
6 JGI24742J22300_10000813 3300002244 Bacteria 4761
7 JGI25150J39212_1000023 3300002774 Bacteria 130663
8 JGI25151J46595_10000082 3300003187 Bacteria 130832
9 JGI25153J46596_10000060 3300003215 Bacteria 131744
10 Ga0006777J48905_1038789 3300003308 Bacteria 1161
11 JGI25407J50210_10013120 3300003373 Bacteria 2128
12 Ga0006781J51513_1016641 3300003568 Bacteria 1173
13 Ga0007416J51690_1082693 3300003577 Bacteria 666
14 Ga0007429J51699_1024122 3300003579 Bacteria 1334
15 Ga0007429J51699_1040927 3300003579 Bacteria 761
16 Ga0007429J51699_1058940 3300003579 Bacteria 859
17 Ga0032354_1046428 3300003693 Bacteria 720
18 Ga0058861_10735126 3300004800 Bacteria 582
19 Ga0065714_10002668 3300005288 Bacteria 15815
20 Ga0065714_10009648 3300005288 Bacteria 4454
21 Ga0070683_100000534 3300005329 Bacteria 26797
22 Ga0070683_100000888 3300005329 Bacteria 22212
23 Ga0070683_100002079 3300005329 Bacteria 15807
24 Ga0070683_100013741 3300005329 Bacteria 7068
25 Ga0070683_100022176 3300005329 Bacteria 5674
26 Ga0070683_100097447 3300005329 Bacteria 2766
27 Ga0070683_100173974 3300005329 Bacteria 2044
28 Ga0070690_100377100 3300005330 Bacteria 1036
29 Ga0070670_100012696 3300005331 Bacteria 7212
30 Ga0070670_100092750 3300005331 Bacteria 2597
31 Ga0070677_10000081 3300005333 Bacteria 30569
32 Ga0068869_100124005 3300005334 Bacteria 1979
33 Ga0068869_100207910 3300005334 Bacteria 1546
34 Ga0070680_100761350 3300005336 Bacteria 834
35 Ga0070682_100000102 3300005337 Bacteria 76457
36 Ga0070682_100000556 3300005337 Bacteria 23033
37 Ga0070682_100001507 3300005337 Bacteria 13059
38 Ga0070682_100007875 3300005337 Bacteria 5996
39 Ga0068868_100000634 3300005338 Bacteria 23652
40 Ga0068868_100001874 3300005338 Bacteria 14438
41 Ga0068868_100006732 3300005338 Bacteria 8158
42 Ga0068868_100015451 3300005338 Bacteria 5647
43 Ga0068868_100181876 3300005338 Bacteria 1744
44 Ga0068868_100738622 3300005338 Bacteria 883
45 Ga0070660_100038941 3300005339 Bacteria 3612
46 Ga0070660_100513137 3300005339 Bacteria 998
47 Ga0070689_100015468 3300005340 Bacteria 5565
48 Ga0070689_100333038 3300005340 Bacteria 1270
49 Ga0070691_10000064 3300005341 Bacteria 29794
50 Ga0070691_10006974 3300005341 Bacteria 5175
51 Ga0070691_10151049 3300005341 Bacteria 1191
52 Ga0070661_100000004 3300005344 Bacteria 243876
53 Ga0070661_100009995 3300005344 Bacteria 6585
54 Ga0070692_10012328 3300005345 Bacteria 3953
55 Ga0070692_10040923 3300005345 Bacteria 2372
56 Ga0070668_100022553 3300005347 Bacteria 4760
57 Ga0070668_100050286 3300005347 Bacteria 3209
58 Ga0070668_100113504 3300005347 Bacteria 2158
59 Ga0070669_100141831 3300005353 Bacteria 1853
60 Ga0070675_100000078 3300005354 Bacteria 56469
61 Ga0070675_100010461 3300005354 Bacteria 7248
62 Ga0070675_100119336 3300005354 Bacteria 2240
63 Ga0070675_100226255 3300005354 Bacteria 1630
64 Ga0070674_100008538 3300005356 Bacteria 6107
65 Ga0070673_100010697 3300005364 Bacteria 6222
66 Ga0070673_100069826 3300005364 Bacteria 2817
67 Ga0070688_100000705 3300005365 Bacteria 16441
68 Ga0070688_100000989 3300005365 Bacteria 14241
69 Ga0070688_100034871 3300005365 Bacteria 3052
70 Ga0070688_100044102 3300005365 Bacteria 2751
71 Ga0070659_100001523 3300005366 Bacteria 16707
72 Ga0070659_100002700 3300005366 Bacteria 12615
73 Ga0070659_100030992 3300005366 Bacteria 4140
74 Ga0070659_100039854 3300005366 Bacteria 3669
75 Ga0070659_100055816 3300005366 Bacteria 3114
76 Ga0070659_100176187 3300005366 Bacteria 1753
77 Ga0070659_100408704 3300005366 Bacteria 1147
78 Ga0070667_100388345 3300005367 Bacteria 1269
79 Ga0070714_100001023 3300005435 Bacteria 19974
80 Ga0070714_100074817 3300005435 Bacteria 2937
81 Ga0070714_100770019 3300005435 Bacteria 931
82 Ga0070713_100000005 3300005436 Bacteria 201526
83 Ga0070701_10214389 3300005438 Bacteria 1145
84 Ga0070711_100178853 3300005439 Bacteria 1623
85 Ga0070705_100018095 3300005440 Bacteria 3688
86 Ga0070705_100108681 3300005440 Bacteria 1767
87 Ga0070705_100114521 3300005440 Bacteria 1730
88 Ga0070700_100031852 3300005441 Bacteria 3164
89 Ga0070700_100046229 3300005441 Bacteria 2689
90 Ga0070700_100184149 3300005441 Bacteria 1456
91 Ga0070694_100466781 3300005444 Bacteria 999
92 Ga0070694_100510655 3300005444 Bacteria 957
93 Ga0070708_100404217 3300005445 Bacteria 1288
94 Ga0070663_100007026 3300005455 Bacteria 6821
95 Ga0070663_100009721 3300005455 Bacteria 5969
96 Ga0070663_100013544 3300005455 Bacteria 5205
97 Ga0070663_100583445 3300005455 Bacteria 938
98 Ga0070663_100708643 3300005455 Bacteria 856
99 Ga0070678_100054845 3300005456 Bacteria 2907
100 Ga0070662_100007829 3300005457 Bacteria 6941
101 Ga0070662_100276367 3300005457 Bacteria 1358
102 Ga0070681_10111778 3300005458 Bacteria 2671
103 Ga0070681_10299487 3300005458 Bacteria 1518
104 Ga0068867_100000278 3300005459 Bacteria 33730
105 Ga0068867_100028276 3300005459 Bacteria 4036
106 Ga0070685_10000012 3300005466 Bacteria 128823
107 Ga0070685_10001134 3300005466 Bacteria 14241
108 Ga0070685_10008752 3300005466 Bacteria 5211
109 Ga0070706_100308291 3300005467 Bacteria 1477
110 Ga0070679_100011522 3300005530 Bacteria 8429
111 Ga0070684_100001038 3300005535 Bacteria 19838
112 Ga0070684_100004844 3300005535 Bacteria 10285
113 Ga0070684_100007134 3300005535 Bacteria 8680
114 Ga0070684_100010265 3300005535 Bacteria 7413
115 Ga0070684_100015887 3300005535 Bacteria 6144
116 Ga0070684_100060185 3300005535 Bacteria 3321
117 Ga0070684_100086257 3300005535 Bacteria 2786
118 Ga0070684_100128128 3300005535 Bacteria 2288
119 Ga0070684_100321377 3300005535 Bacteria 1422
120 Ga0068853_100049531 3300005539 Bacteria 3610
121 Ga0068853_100304048 3300005539 Bacteria 1475
122 Ga0068853_100371266 3300005539 Bacteria 1334
123 Ga0070672_100107935 3300005543 Bacteria 2266
124 Ga0070672_100159022 3300005543 Bacteria 1873
125 Ga0070672_101094733 3300005543 Bacteria 708
126 Ga0070686_100190739 3300005544 Bacteria 1463
127 Ga0070696_100115792 3300005546 Bacteria 1935
128 Ga0070696_100290466 3300005546 Bacteria 1249
129 Ga0070693_100015108 3300005547 Bacteria 3970
130 Ga0070665_100000604 3300005548 Bacteria 49409
131 Ga0070665_100217538 3300005548 Bacteria 1911
132 Ga0068855_100316178 3300005563 Bacteria 1727
133 Ga0068855_100446339 3300005563 Bacteria 1412
134 Ga0070664_100022449 3300005564 Bacteria 5203
135 Ga0070664_100052767 3300005564 Bacteria 3444
136 Ga0070664_100224471 3300005564 Bacteria 1682
137 Ga0070664_100325015 3300005564 Bacteria 1394
138 Ga0070664_100955056 3300005564 Bacteria 805
139 Ga0068857_100025723 3300005577 Bacteria 5182
140 Ga0068857_100131984 3300005577 Bacteria 2253
141 Ga0068857_100592034 3300005577 Bacteria 1048
142 Ga0068854_100000062 3300005578 Bacteria 78159
143 Ga0068854_100322363 3300005578 Bacteria 1256
144 Ga0068856_100000377 3300005614 Bacteria 48877
145 Ga0068856_100005163 3300005614 Bacteria 12894
146 Ga0068856_100007632 3300005614 Bacteria 10556
147 Ga0068856_100028080 3300005614 Bacteria 5492
148 Ga0070702_100019981 3300005615 Bacteria 3502
149 Ga0070702_100086548 3300005615 Bacteria 1890
150 Ga0070702_100094861 3300005615 Bacteria 1817
151 Ga0070702_100098954 3300005615 Bacteria 1785
152 Ga0070702_100137091 3300005615 Bacteria 1554
153 Ga0068852_100000022 3300005616 Bacteria 125196
154 Ga0068852_100012477 3300005616 Bacteria 6454
155 Ga0068852_100103195 3300005616 Bacteria 2578
156 Ga0068852_100556184 3300005616 Bacteria 1148
157 Ga0068852_100622780 3300005616 Bacteria 1085
158 Ga0068852_100941234 3300005616 Bacteria 882
159 Ga0068859_101001881 3300005617 Bacteria 917
160 Ga0068859_101174610 3300005617 Bacteria 845
161 Ga0068859_101729063 3300005617 Bacteria 691
162 Ga0068864_100052452 3300005618 Bacteria 3515
163 Ga0068866_10095277 3300005718 Bacteria 1630
164 Ga0068866_10172042 3300005718 Bacteria 1272
165 Ga0068861_100315762 3300005719 Bacteria 1359
166 Ga0068861_100601683 3300005719 Bacteria 1009
167 Ga0068861_100992264 3300005719 Bacteria 801
168 Ga0068851_10000297 3300005834 Bacteria 22748
169 Ga0068851_10024779 3300005834 Bacteria 2939
170 Ga0068851_10091962 3300005834 Bacteria 1598
171 Ga0068870_10150456 3300005840 Bacteria 1371
172 Ga0068863_100000032 3300005841 Bacteria 172402
173 Ga0068863_100021805 3300005841 Bacteria 6113
174 Ga0068863_100160081 3300005841 Bacteria 2156
175 Ga0068858_100000343 3300005842 Bacteria 49409
176 Ga0068858_100059212 3300005842 Bacteria 3540
177 Ga0068858_100071409 3300005842 Bacteria 3220
178 Ga0068858_100091683 3300005842 Bacteria 2828
179 Ga0068858_100252309 3300005842 Bacteria 1676
180 Ga0068860_100238767 3300005843 Bacteria 1767
181 Ga0068862_100025482 3300005844 Bacteria 4966
182 Ga0068862_100086672 3300005844 Bacteria 2723
183 Ga0068862_100785944 3300005844 Bacteria 928
184 Ga0081455_10025637 3300005937 Bacteria 5438
185 Ga0081455_10269259 3300005937 Bacteria 1237
186 Ga0081538_10002334 3300005981 Bacteria 18714
187 Ga0081538_10002916 3300005981 Bacteria 16307
188 Ga0081538_10008690 3300005981 Bacteria 8583
189 Ga0081538_10009623 3300005981 Bacteria 8037
190 Ga0081538_10025242 3300005981 Bacteria 4199
191 Ga0081538_10134014 3300005981 Bacteria 1158
192 Ga0081538_10165413 3300005981 Bacteria 975
193 Ga0081540_1084274 3300005983 Bacteria 1419
194 Ga0081539_10074225 3300005985 Bacteria 1812
195 Ga0081539_10150133 3300005985 Bacteria 1122
196 Ga0081539_10253126 3300005985 Bacteria 781
197 Ga0075365_10000884 3300006038 Bacteria 12532
198 Ga0075365_10009869 3300006038 Bacteria 5523
199 Ga0075365_10078115 3300006038 Bacteria 2237
200 Ga0075363_100009250 3300006048 Bacteria 4628
201 Ga0075364_10055657 3300006051 Bacteria 2588
202 Ga0075364_10068968 3300006051 Bacteria 2326
203 Ga0075364_10332394 3300006051 Bacteria 1035
204 Ga0070715_10000001 3300006163 Bacteria 693690
205 Ga0070716_100107080 3300006173 Bacteria 1725
206 Ga0070712_100000009 3300006175 Bacteria 143615
207 Ga0070712_100007920 3300006175 Bacteria 6662
208 Ga0070712_100115984 3300006175 Bacteria 2008
209 Ga0075367_10227532 3300006178 Bacteria 1168
210 Ga0075367_10268715 3300006178 Bacteria 1071
211 Ga0097621_100549664 3300006237 Bacteria 1051
212 Ga0075428_100130007 3300006844 Bacteria 2739
213 Ga0075430_100129532 3300006846 Bacteria 2103
214 Ga0075433_10431955 3300006852 Bacteria 1161
215 Ga0075434_100333981 3300006871 Bacteria 1536
216 Ga0068865_100000135 3300006881 Bacteria 38521
217 Ga0068865_100044332 3300006881 Bacteria 3044
218 Ga0068865_100167621 3300006881 Bacteria 1681
219 Ga0068865_100246995 3300006881 Bacteria 1407
220 Ga0068865_100327960 3300006881 Bacteria 1233
221 Ga0068865_100753233 3300006881 Bacteria 837
222 Ga0097620_101001848 3300006931 Bacteria 917
223 Ga0097620_101174635 3300006931 Bacteria 845
224 Ga0097620_101728702 3300006931 Bacteria 691
225 Ga0075435_100655607 3300007076 Bacteria 911
226 Ga0105240_10341615 3300009093 Bacteria 1700
227 Ga0105240_11186786 3300009093 Bacteria 809
228 Ga0111539_10005936 3300009094 Bacteria 15772
229 Ga0111539_10069371 3300009094 Bacteria 4162
230 Ga0111539_10092681 3300009094 Bacteria 3550
231 Ga0105245_10000022 3300009098 Bacteria 181225
232 Ga0105245_10000023 3300009098 Bacteria 180844
233 Ga0105245_10000975 3300009098 Bacteria 26135
234 Ga0105245_10001336 3300009098 Bacteria 22321
235 Ga0105245_10003920 3300009098 Bacteria 13225
236 Ga0105245_10004839 3300009098 Bacteria 11864
237 Ga0105245_10734819 3300009098 Bacteria 1022
238 Ga0105247_10311119 3300009101 Bacteria 1096
239 Ga0114129_10229197 3300009147 Bacteria 2503
240 Ga0114129_11708635 3300009147 Bacteria 768
241 Ga0105243_10008888 3300009148 Bacteria 7686
242 Ga0105243_10046939 3300009148 Bacteria 3399
243 Ga0105243_10209647 3300009148 Bacteria 1715
244 Ga0105243_10280006 3300009148 Bacteria 1502
245 Ga0105241_10040715 3300009174 Bacteria 3508
246 Ga0105241_10716217 3300009174 Bacteria 915
247 Ga0105242_10000034 3300009176 Bacteria 95536
248 Ga0105242_10085386 3300009176 Bacteria 2647
249 Ga0105242_10196366 3300009176 Bacteria 1790
250 Ga0105248_10000245 3300009177 Bacteria 62951
251 Ga0105248_10058896 3300009177 Bacteria 4314
252 Ga0105248_10491642 3300009177 Bacteria 1383
253 Ga0105248_11588538 3300009177 Bacteria 741
254 Ga0105237_10534592 3300009545 Bacteria 1179
255 Ga0105238_10000028 3300009551 Bacteria 188361
256 Ga0105238_10313308 3300009551 Bacteria 1554
257 Ga0105238_10566905 3300009551 Bacteria 1141
258 Ga0105238_11351692 3300009551 Bacteria 739
259 Ga0105249_10000181 3300009553 Bacteria 73946
260 Ga0105249_10065721 3300009553 Bacteria 3337
261 Ga0105249_10308920 3300009553 Bacteria 1589
262 Ga0105249_11104708 3300009553 Bacteria 863
263 Ga0105249_11262741 3300009553 Bacteria 810
264 Ga0105239_10014181 3300010375 Bacteria 8844
265 Ga0105239_10048810 3300010375 Bacteria 4641
266 Ga0105239_10133333 3300010375 Bacteria 2764
267 Ga0105239_10200112 3300010375 Bacteria 2238
268 Ga0105239_10375416 3300010375 Bacteria 1607
269 Ga0105239_10941013 3300010375 Bacteria 992
270 Ga0105246_10102252 3300011119 Bacteria 2089
271 Ga0105246_10236673 3300011119 Bacteria 1441
272 Ga0154014_151005 3300013052 Bacteria 836
273 Ga0157373_10001726 3300013100 Bacteria 16609
274 Ga0157373_10089132 3300013100 Bacteria 2173
275 Ga0157371_10004879 3300013102 Bacteria 11527
276 Ga0157370_10002276 3300013104 Bacteria 23284
277 Ga0157370_10003533 3300013104 Bacteria 18310
278 Ga0157370_10135255 3300013104 Bacteria 2298
279 Ga0157369_10000014 3300013105 Bacteria 266411
280 Ga0157369_10552697 3300013105 Bacteria 1190
281 Ga0157374_10001500 3300013296 Bacteria 19673
282 Ga0157374_10003363 3300013296 Bacteria 13434
283 Ga0157374_10088252 3300013296 Bacteria 2953
284 Ga0157374_10201302 3300013296 Bacteria 1950
285 Ga0157378_10001375 3300013297 Bacteria 21833
286 Ga0157378_10396402 3300013297 Bacteria 1359
287 Ga0163162_10066169 3300013306 Bacteria 3662
288 Ga0163162_10194466 3300013306 Bacteria 2157
289 Ga0157372_10000550 3300013307 Bacteria 41234
290 Ga0157372_10001751 3300013307 Bacteria 23533
291 Ga0157375_10000127 3300013308 Bacteria 75142
292 Ga0157375_10000765 3300013308 Bacteria 28141
293 Ga0157375_10005447 3300013308 Bacteria 11066
294 Ga0157375_10096174 3300013308 Bacteria 3034
295 Ga0157375_10104038 3300013308 Bacteria 2927
296 Ga0157375_10255339 3300013308 Bacteria 1914
297 Ga0157375_10388873 3300013308 Bacteria 1562
298 Ga0157375_10917946 3300013308 Bacteria 1019
299 Ga0163163_10050696 3300014325 Bacteria 4088
300 Ga0163163_10840061 3300014325 Bacteria 982
301 Ga0157380_10014388 3300014326 Bacteria 5787
302 Ga0157380_10090973 3300014326 Bacteria 2518
303 Ga0157380_10361637 3300014326 Bacteria 1362
304 Ga0157377_10002140 3300014745 Bacteria 8681
305 Ga0157377_10012344 3300014745 Bacteria 4295
306 Ga0157377_10029745 3300014745 Bacteria 2953
307 Ga0157377_10042863 3300014745 Bacteria 2515
308 Ga0157377_10344517 3300014745 Bacteria 998
309 Ga0157379_10005332 3300014968 Bacteria 11046
310 Ga0157379_10459290 3300014968 Bacteria 1177
311 Ga0157376_10176956 3300014969 Bacteria 1947
312 Ga0157376_11170484 3300014969 Bacteria 796
313 Ga0163161_10000013 3300017792 Bacteria 258747
314 Ga0163161_10263457 3300017792 Bacteria 1347
315 Ga0163161_10794421 3300017792 Bacteria 795
316 Ga0163161_10997194 3300017792 Bacteria 715
317 Ga0197907_10308920 3300020069 Bacteria 1033
318 Ga0197907_10601346 3300020069 Bacteria 733
319 Ga0197907_10816812 3300020069 Bacteria 1300
320 Ga0197907_11146121 3300020069 Bacteria 1599
321 Ga0197907_11376416 3300020069 Bacteria 623
322 Ga0197907_11450979 3300020069 Bacteria 1083
323 Ga0206356_10943150 3300020070 Bacteria 1641
324 Ga0206356_11357271 3300020070 Bacteria 1214
325 Ga0206356_11573056 3300020070 Bacteria 1318
326 Ga0206356_11579150 3300020070 Bacteria 768
327 Ga0206356_11861396 3300020070 Bacteria 1439
328 Ga0206349_1042634 3300020075 Bacteria 1896
329 Ga0206349_1072408 3300020075 Bacteria 956
330 Ga0206349_1144720 3300020075 Bacteria 949
331 Ga0206349_1166632 3300020075 Bacteria 1196
332 Ga0206349_1841112 3300020075 Bacteria 640
333 Ga0206349_1866038 3300020075 Bacteria 1354
334 Ga0206355_1701321 3300020076 Bacteria 1219
335 Ga0206351_10727604 3300020077 Bacteria 707
336 Ga0206351_10912576 3300020077 Bacteria 644
337 Ga0206351_10977218 3300020077 Bacteria 674
338 Ga0206352_10098428 3300020078 Bacteria 1370
339 Ga0206352_10263854 3300020078 Bacteria 1046
340 Ga0206352_11263724 3300020078 Bacteria 782
341 Ga0206350_10174780 3300020080 Bacteria 908
342 Ga0206350_10388591 3300020080 Bacteria 969
343 Ga0206350_10519099 3300020080 Bacteria 783
344 Ga0206350_10624272 3300020080 Bacteria 852
345 Ga0206350_10662425 3300020080 Bacteria 1025
346 Ga0206350_10849943 3300020080 Bacteria 732
347 Ga0206354_10628115 3300020081 Bacteria 1414
348 Ga0206354_10816607 3300020081 Bacteria 1160
349 Ga0206354_11397997 3300020081 Bacteria 1442
350 Ga0206354_11539976 3300020081 Bacteria 1516
351 Ga0206353_10346301 3300020082 Bacteria 701
352 Ga0206353_10543008 3300020082 Bacteria 1240
353 Ga0206353_10602801 3300020082 Bacteria 1115
354 Ga0206353_11205913 3300020082 Bacteria 1285
355 Ga0206353_11695836 3300020082 Bacteria 1409
356 Ga0224712_10016960 3300022467 Bacteria 2405
357 Ga0224712_10178143 3300022467 Bacteria 956
358 Ga0224712_10203642 3300022467 Bacteria 900
359 Ga0224712_10218733 3300022467 Bacteria 871
360 Ga0224712_10277737 3300022467 Bacteria 779
361 Ga0224712_10351005 3300022467 Bacteria 697
362 Ga0207425_1000051 3300025245 Bacteria 166795
363 Ga0209129_1000121 3300025258 Bacteria 135404
364 Ga0209025_1000160 3300025294 Bacteria 166795
365 Ga0209758_1000147 3300025297 Bacteria 166795
366 Ga0207656_10000084 3300025321 Bacteria 35284
367 Ga0207656_10012836 3300025321 Bacteria 3190
368 Ga0207653_10156476 3300025885 Bacteria 841
369 Ga0207682_10000327 3300025893 Bacteria 21656
370 Ga0207692_10119988 3300025898 Bacteria 1471
371 Ga0207688_10001154 3300025901 Bacteria 13616
372 Ga0207688_10007117 3300025901 Bacteria 6085
373 Ga0207688_10063636 3300025901 Bacteria 2081
374 Ga0207688_10104859 3300025901 Bacteria 1636
375 Ga0207647_10147180 3300025904 Bacteria 1378
376 Ga0207685_10000005 3300025905 Bacteria 289944
377 Ga0207645_10254228 3300025907 Bacteria 1163
378 Ga0207645_10266828 3300025907 Bacteria 1134
379 Ga0207643_10057698 3300025908 Bacteria 2211
380 Ga0207643_10090946 3300025908 Bacteria 1779
381 Ga0207643_10153756 3300025908 Bacteria 1381
382 Ga0207705_10652835 3300025909 Bacteria 818
383 Ga0207684_10191537 3300025910 Bacteria 1764
384 Ga0207654_10024265 3300025911 Bacteria 3258
385 Ga0207707_10088518 3300025912 Bacteria 2705
386 Ga0207707_10203577 3300025912 Bacteria 1725
387 Ga0207695_10188864 3300025913 Bacteria 1978
388 Ga0207695_10357716 3300025913 Bacteria 1346
389 Ga0207693_10000036 3300025915 Bacteria 109562
390 Ga0207693_10036252 3300025915 Bacteria 3888
391 Ga0207693_10040330 3300025915 Bacteria 3678
392 Ga0207693_10054303 3300025915 Bacteria 3143
393 Ga0207663_10057935 3300025916 Bacteria 2443
394 Ga0207663_10308964 3300025916 Bacteria 1184
395 Ga0207660_10008879 3300025917 Bacteria 6497
396 Ga0207660_10705803 3300025917 Bacteria 823
397 Ga0207657_10003298 3300025919 Bacteria 17254
398 Ga0207657_10058617 3300025919 Bacteria 3312
399 Ga0207657_10077543 3300025919 Bacteria 2800
400 Ga0207657_10082550 3300025919 Bacteria 2697
401 Ga0207657_10086996 3300025919 Bacteria 2615
402 Ga0207657_10130274 3300025919 Bacteria 2062
403 Ga0207649_10000003 3300025920 Bacteria 388908
404 Ga0207649_10493771 3300025920 Bacteria 930
405 Ga0207652_10008003 3300025921 Bacteria 8483
406 Ga0207652_10065133 3300025921 Bacteria 3155
407 Ga0207681_10134586 3300025923 Bacteria 1832
408 Ga0207681_10722438 3300025923 Bacteria 829
409 Ga0207694_10000008 3300025924 Bacteria 484902
410 Ga0207694_10126216 3300025924 Bacteria 2047
411 Ga0207694_10186853 3300025924 Bacteria 1682
412 Ga0207694_10310107 3300025924 Bacteria 1301
413 Ga0207650_10567390 3300025925 Bacteria 952
414 Ga0207650_10584826 3300025925 Bacteria 938
415 Ga0207659_10000018 3300025926 Bacteria 156920
416 Ga0207659_10006926 3300025926 Bacteria 6966
417 Ga0207659_10048959 3300025926 Bacteria 2996
418 Ga0207659_10197705 3300025926 Bacteria 1603
419 Ga0207687_10000015 3300025927 Bacteria 261701
420 Ga0207687_10000039 3300025927 Bacteria 114303
421 Ga0207687_10007940 3300025927 Bacteria 6948
422 Ga0207687_10027612 3300025927 Bacteria 3810
423 Ga0207687_10033552 3300025927 Bacteria 3482
424 Ga0207687_10049069 3300025927 Bacteria 2934
425 Ga0207700_10000003 3300025928 Bacteria 500797
426 Ga0207664_10000013 3300025929 Bacteria 260716
427 Ga0207664_10035621 3300025929 Bacteria 3842
428 Ga0207664_10223474 3300025929 Bacteria 1634
429 Ga0207664_10600991 3300025929 Bacteria 988
430 Ga0207690_10000064 3300025932 Bacteria 95169
431 Ga0207690_10007587 3300025932 Bacteria 6436
432 Ga0207690_10020231 3300025932 Bacteria 4109
433 Ga0207690_10164392 3300025932 Bacteria 1657
434 Ga0207690_10193428 3300025932 Bacteria 1540
435 Ga0207690_10285246 3300025932 Bacteria 1287
436 Ga0207706_10001985 3300025933 Bacteria 20065
437 Ga0207706_10042627 3300025933 Bacteria 4022
438 Ga0207706_10137784 3300025933 Bacteria 2147
439 Ga0207706_10509477 3300025933 Bacteria 1038
440 Ga0207686_10483811 3300025934 Bacteria 958
441 Ga0207709_10097972 3300025935 Bacteria 1932
442 Ga0207709_10114728 3300025935 Bacteria 1808
443 Ga0207709_10195429 3300025935 Bacteria 1441
444 Ga0207709_10515015 3300025935 Bacteria 936
445 Ga0207709_10696105 3300025935 Bacteria 813
446 Ga0207670_10093933 3300025936 Bacteria 2127
447 Ga0207670_10249857 3300025936 Bacteria 1370
448 Ga0207670_10255572 3300025936 Bacteria 1356
449 Ga0207670_10354993 3300025936 Bacteria 1162
450 Ga0207669_10133727 3300025937 Bacteria 1709
451 Ga0207669_10231327 3300025937 Bacteria 1364
452 Ga0207669_10555855 3300025937 Bacteria 927
453 Ga0207704_10000026 3300025938 Bacteria 123892
454 Ga0207704_10008364 3300025938 Bacteria 4943
455 Ga0207704_10141477 3300025938 Bacteria 1684
456 Ga0207704_10788847 3300025938 Bacteria 792
457 Ga0207665_10032210 3300025939 Bacteria 3470
458 Ga0207691_10078513 3300025940 Bacteria 2971
459 Ga0207691_10142893 3300025940 Bacteria 2108
460 Ga0207691_10151705 3300025940 Bacteria 2037
461 Ga0207691_10591091 3300025940 Bacteria 940
462 Ga0207711_10000192 3300025941 Bacteria 65599
463 Ga0207711_10015551 3300025941 Bacteria 6315
464 Ga0207711_11060061 3300025941 Bacteria 751
465 Ga0207689_10094424 3300025942 Bacteria 2456
466 Ga0207689_10155091 3300025942 Bacteria 1887
467 Ga0207661_10000235 3300025944 Bacteria 36349
468 Ga0207661_10000247 3300025944 Bacteria 35222
469 Ga0207661_10001056 3300025944 Bacteria 18313
470 Ga0207661_10004455 3300025944 Bacteria 9840
471 Ga0207661_10062212 3300025944 Bacteria 3019
472 Ga0207661_10075358 3300025944 Bacteria 2768
473 Ga0207661_10313874 3300025944 Bacteria 1408
474 Ga0207679_10014783 3300025945 Bacteria 5141
475 Ga0207679_10122831 3300025945 Bacteria 2070
476 Ga0207679_10529617 3300025945 Bacteria 1055
477 Ga0207667_10479701 3300025949 Bacteria 1263
478 Ga0207667_10515925 3300025949 Bacteria 1211
479 Ga0207667_10782920 3300025949 Bacteria 952
480 Ga0207651_10007137 3300025960 Bacteria 5935
481 Ga0207651_10133326 3300025960 Bacteria 1906
482 Ga0207651_10370071 3300025960 Bacteria 1212
483 Ga0207712_10000067 3300025961 Bacteria 130079
484 Ga0207712_10044596 3300025961 Bacteria 3066
485 Ga0207712_10706224 3300025961 Bacteria 880
486 Ga0207668_10013940 3300025972 Bacteria 4966
487 Ga0207668_10256541 3300025972 Bacteria 1423
488 Ga0207668_10385800 3300025972 Bacteria 1180
489 Ga0207640_10000074 3300025981 Bacteria 78164
490 Ga0207640_10220445 3300025981 Bacteria 1452
491 Ga0207640_10225193 3300025981 Bacteria 1438
492 Ga0207658_10702128 3300025986 Bacteria 914
493 Ga0207677_10000308 3300026023 Bacteria 35929
494 Ga0207677_10000534 3300026023 Bacteria 24018
495 Ga0207677_10054993 3300026023 Bacteria 2719
496 Ga0207677_10322903 3300026023 Bacteria 1283
497 Ga0207703_10004225 3300026035 Bacteria 11837
498 Ga0207703_10042528 3300026035 Bacteria 3644
499 Ga0207703_10835798 3300026035 Bacteria 880
500 Ga0207639_10007308 3300026041 Bacteria 7525
501 Ga0207639_10034486 3300026041 Bacteria 3740
502 Ga0207639_10039100 3300026041 Bacteria 3533
503 Ga0207639_10090967 3300026041 Bacteria 2442
504 Ga0207639_10149626 3300026041 Bacteria 1954
505 Ga0207678_10014788 3300026067 Bacteria 6867
506 Ga0207678_10023321 3300026067 Bacteria 5412
507 Ga0207678_10038610 3300026067 Bacteria 4148
508 Ga0207678_10438116 3300026067 Bacteria 1135
509 Ga0207708_10001934 3300026075 Bacteria 15275
510 Ga0207708_10006175 3300026075 Bacteria 8881
511 Ga0207708_10008298 3300026075 Bacteria 7695
512 Ga0207708_10069382 3300026075 Bacteria 2699
513 Ga0207708_10179606 3300026075 Bacteria 1680
514 Ga0207702_10000085 3300026078 Bacteria 106728
515 Ga0207702_10002252 3300026078 Bacteria 18493
516 Ga0207702_10030239 3300026078 Bacteria 4513
517 Ga0207702_10072197 3300026078 Bacteria 2974
518 Ga0207641_10000071 3300026088 Bacteria 151812
519 Ga0207641_10016922 3300026088 Bacteria 5969
520 Ga0207641_10046202 3300026088 Bacteria 3670
521 Ga0207641_10791072 3300026088 Bacteria 938
522 Ga0207648_10000630 3300026089 Bacteria 39502
523 Ga0207648_10060218 3300026089 Bacteria 3311
524 Ga0207648_10097076 3300026089 Bacteria 2579
525 Ga0207648_10316424 3300026089 Bacteria 1402
526 Ga0207648_10893434 3300026089 Bacteria 830
527 Ga0207676_10046013 3300026095 Bacteria 3374
528 Ga0207674_10035690 3300026116 Bacteria 5189
529 Ga0207674_10131165 3300026116 Bacteria 2469
530 Ga0207674_10646821 3300026116 Bacteria 1021
531 Ga0207675_100006762 3300026118 Bacteria 10846
532 Ga0207675_100045768 3300026118 Bacteria 4087
533 Ga0207675_100214990 3300026118 Bacteria 1850
534 Ga0207675_100343729 3300026118 Bacteria 1461
535 Ga0207683_10010330 3300026121 Bacteria 7962
536 Ga0207683_10044763 3300026121 Bacteria 3869
537 Ga0207698_10000043 3300026142 Bacteria 96553
538 Ga0207698_10414479 3300026142 Bacteria 1291
539 Ga0207698_10794627 3300026142 Bacteria 948
540 Ga0207698_10842700 3300026142 Bacteria 921
541 Ga0207428_10006750 3300027907 Bacteria 10529
542 Ga0207428_10007997 3300027907 Bacteria 9600
543 Ga0268266_10000020 3300028379 Bacteria 527065
544 Ga0268266_10303321 3300028379 Bacteria 1490
545 Ga0268265_10016898 3300028380 Bacteria 5023
546 Ga0268265_10176211 3300028380 Bacteria 1833
547 Ga0268265_10404622 3300028380 Bacteria 1263
548 Ga0268265_10808168 3300028380 Bacteria 914
549 Ga0268265_11434589 3300028380 Bacteria 693
550 Ga0268264_10025099 3300028381 Bacteria 4870
551 Ga0268264_11331960 3300028381 Bacteria 728
552 Ga0265319_1000035 3300028563 Bacteria 117269
553 Ga0265334_10103940 3300028573 Bacteria 1026
554 Ga0265338_10000171 3300028800 Bacteria 120054
555 Ga0307511_10041190 3300030521 Bacteria 3905
556 Ga0265325_10027704 3300031241 Bacteria 3060
557 Ga0265316_10367578 3300031344 Bacteria 1039
558 Ga0307408_100205850 3300031548 Bacteria 1596
559 Ga0307408_100719889 3300031548 Bacteria 899
560 Ga0316576_10101640 3300031727 Bacteria 2149
561 Ga0316578_10211794 3300031728 Bacteria 1166
562 Ga0307405_10567330 3300031731 Bacteria 921
563 Ga0316577_10050570 3300031733 Bacteria 2320
564 Ga0307413_10165871 3300031824 Bacteria 1558
565 Ga0307413_10292913 3300031824 Bacteria 1230
566 Ga0307410_10031793 3300031852 Bacteria 3391
567 Ga0307406_10013575 3300031901 Bacteria 4668
568 Ga0307406_10135001 3300031901 Bacteria 1738
569 Ga0307406_10483738 3300031901 Bacteria 1000
570 Ga0307407_10199790 3300031903 Bacteria 1339
571 Ga0307412_10081196 3300031911 Bacteria 2242
572 Ga0307412_10685716 3300031911 Bacteria 878
573 Ga0307409_100117154 3300031995 Bacteria 2247
574 Ga0307409_100381919 3300031995 Bacteria 1339
575 Ga0307409_100632681 3300031995 Bacteria 1061
576 Ga0307416_100030344 3300032002 Bacteria 4055
577 Ga0307416_100189500 3300032002 Bacteria 1938
578 Ga0307416_100708770 3300032002 Bacteria 1096
579 Ga0307414_10219882 3300032004 Bacteria 1559
580 Ga0307414_10936097 3300032004 Bacteria 796
581 Ga0307411_10047028 3300032005 Bacteria 2787
582 Ga0307411_10898499 3300032005 Bacteria 787
583 Ga0307415_100042215 3300032126 Bacteria 3034
584 Ga0307415_100068875 3300032126 Bacteria 2478
585 Ga0307415_100073134 3300032126 Bacteria 2417
586 Ga0307415_100155804 3300032126 Bacteria 1764
587 Ga0307415_100576123 3300032126 Bacteria 998
588 Ga0307415_100841642 3300032126 Bacteria 841
589 Ga0316580_10061032 3300032139 Bacteria 1158
590 Ga0316596_1169424 3300033541 Bacteria 602
591 Ga0373955_0111673 3300035172 Bacteria 1581
592 Ga0316574_0113609 3300035398 Bacteria 1736
593 Ga0373937_0033761 3300036401 Bacteria 4650
594 Ga0373937_0091159 3300036401 Bacteria 2824
595 Ga0316584_0148014 3300036712 Bacteria 1749
596 Ga0373925_1070097 3300037068 Bacteria 664
597 Ga0395900_0615622 3300037418 Bacteria 1025
598 Ga0395898_0524336 3300037466 Bacteria 1126
599 Ga0395905_0052992 3300037471 Bacteria 3798
600 Ga0395905_0439532 3300037471 Bacteria 1202
601 Ga0395901_0028426 3300038443 Bacteria 5750
602 Ga0395901_0031752 3300038443 Bacteria 5445
603 Ga0395901_0347602 3300038443 Bacteria 1531
604 Ga0395901_0405552 3300038443 Bacteria 1400
605 Ga0451793_0656212 3300041452 Bacteria 2199
606 Ga0451800_0120947 3300041459 Bacteria 1031
607 Ga0451807_2744985 3300041486 Bacteria 1345
608 Ga0451833_0301983 3300041491 Bacteria 711
609 Ga0451843_1480200 3300041509 Bacteria 1920
610 Ga0451853_0233585 3300041512 Bacteria 848
611 Ga0451853_0402524 3300041512 Bacteria 820
612 Ga0451853_1789901 3300041512 Bacteria 683
613 Ga0451853_3323498 3300041512 Bacteria 1546
614 Ga0451853_3894616 3300041512 Bacteria 1030
615 Ga0439451_017501 3300042009 Bacteria 1445
616 Ga0439456_025827 3300042013 Bacteria 1248
617 Ga0439460_0001189 3300042461 Bacteria 6122
618 Ga0466969_0106065 3300044656 Bacteria 1319
619 Ga0466972_0157187 3300044658 Bacteria 1068
620 Ga0466965_0120059 3300044683 Bacteria 1357
621 Ga0466965_0198880 3300044683 Bacteria 1062
622 Ga0466965_0448394 3300044683 Bacteria 718
623 Ga0466966_0095308 3300044684 Bacteria 1844
624 Ga0466963_0000274 3300044694 Bacteria 22920
625 Ga0466963_0015396 3300044694 Bacteria 4735
626 Ga0466964_0038924 3300044706 Bacteria 1914
627 Ga0466957_0002465 3300044842 Bacteria 9942
628 Ga0466957_0182976 3300044842 Bacteria 1369
629 Ga0466960_0041902 3300044901 Bacteria 2171
630 Ga0466960_0118967 3300044901 Bacteria 1381
631 Ga0466960_0127917 3300044901 Bacteria 1337
632 Ga0466960_0221998 3300044901 Bacteria 1040
633 Ga0466959_0096876 3300045049 Bacteria 2115
634 Ga0466958_0351858 3300045836 Bacteria 948
635 Ga0466967_0000199 3300045976 Bacteria 25095
636 Ga0466967_0004422 3300045976 Bacteria 9471
637 Ga0466967_0039393 3300045976 Bacteria 4063
638 Ga0466967_0085426 3300045976 Bacteria 2857
639 Ga0466967_0150502 3300045976 Bacteria 2174
640 Ga0466967_0200430 3300045976 Bacteria 1890
641 Ga0466967_0326091 3300045976 Bacteria 1482
642 Ga0466967_0768412 3300045976 Bacteria 956
643 Ga0495592_0001677 3300046454 Bacteria 15524
644 Ga0495592_0156179 3300046454 Bacteria 1573
645 Ga0495603_0004130 3300046455 Bacteria 8648
646 Ga0495629_0001345 3300046459 Bacteria 19361
647 Ga0495629_0019045 3300046459 Bacteria 4909
648 Ga0495641_0000001 3300046461 Bacteria 485224
649 Ga0495641_0100097 3300046461 Bacteria 1293
650 Ga0495653_0113273 3300046463 Bacteria 1946
651 Ga0495653_0612144 3300046463 Bacteria 668
652 Ga0495650_0000035 3300046471 Bacteria 403799
653 Ga0495639_0018661 3300046475 Bacteria 3022
654 Ga0495662_0000043 3300046476 Bacteria 42697
655 Ga0495608_0000035 3300046511 Bacteria 133011
656 Ga0495608_0000184 3300046511 Bacteria 44478
657 Ga0495608_0084436 3300046511 Bacteria 2060
658 Ga0495608_0219288 3300046511 Bacteria 1194
659 Ga0495608_0258813 3300046511 Bacteria 1084
660 Ga0495618_0000072 3300046514 Bacteria 72012
661 Ga0495620_0002270 3300046515 Bacteria 11125
662 Ga0495628_0047930 3300046516 Bacteria 3388
663 Ga0495628_0143147 3300046516 Bacteria 1824
664 Ga0495630_0000007 3300046517 Bacteria 376915
665 Ga0495630_0008497 3300046517 Bacteria 7371
666 Ga0495630_0194583 3300046517 Bacteria 1547
667 Ga0495631_0393952 3300046518 Bacteria 590
668 Ga0495644_0000618 3300046523 Bacteria 14879
669 Ga0495644_0068226 3300046523 Bacteria 1336
670 Ga0495663_0099372 3300046525 Bacteria 957
671 Ga0495587_0166468 3300046536 Bacteria 1253
672 Ga0495587_0501554 3300046536 Bacteria 671
673 Ga0495645_0136928 3300046543 Bacteria 1712
674 Ga0495667_0125589 3300046559 Bacteria 1656
675 Ga0495656_0000217 3300046615 Bacteria 20479
676 Ga0495657_0000026 3300046675 Bacteria 133011
677 Ga0495657_0002934 3300046675 Bacteria 14139
678 Ga0495657_0152540 3300046675 Bacteria 1434
679 Ga0495599_0081169 3300046678 Bacteria 2025
680 Ga0495623_0114912 3300046679 Bacteria 1627
681 Ga0495647_0001511 3300046681 Bacteria 7198
682 Ga0495658_0001081 3300046683 Bacteria 14347
683 Ga0495669_0001240 3300046684 Bacteria 10598
684 Ga0495669_0011127 3300046684 Bacteria 3813
685 Ga0495613_0000083 3300046689 Bacteria 90138
686 Ga0495613_0170409 3300046689 Bacteria 1545
687 Ga0495624_0000028 3300046690 Bacteria 93474
688 Ga0495649_0006233 3300046694 Bacteria 7439
689 Ga0495600_0000634 3300046809 Bacteria 18143
690 Ga0495600_0059109 3300046809 Bacteria 2504
691 Ga0495581_0495493 3300047315 Bacteria 710
692 Ga0495604_0080501 3300047317 Bacteria 2440
693 Ga0495604_0215730 3300047317 Bacteria 1324
694 Ga0495676_0057014 3300047321 Bacteria 3085
695 Ga0495676_0084493 3300047321 Bacteria 2395
696 Ga0495680_0000990 3300047322 Bacteria 31628
697 Ga0495675_0000015 3300047444 Bacteria 133004
698 Ga0495685_010679 3300047447 Bacteria 3085
699 Ga0495686_0058967 3300047472 Bacteria 2391
700 Ga0495593_0035395 3300047673 Bacteria 2712
701 Ga0495602_0000041 3300048088 Bacteria 126954
702 Ga0495602_0005861 3300048088 Bacteria 12897
703 Ga0495602_0177096 3300048088 Bacteria 1649
704 Ga0496100_0000005 3300048903 Bacteria 312112
705 Ga0496100_0000049 3300048903 Bacteria 75590
706 Ga0496100_0029070 3300048903 Bacteria 3415
707 Ga0496100_0166003 3300048903 Bacteria 1586
708 Ga0496100_0456279 3300048903 Bacteria 980
709 Ga0496100_0699495 3300048903 Bacteria 791
710 Ga0496101_0000010 3300048904 Bacteria 281990
711 Ga0496101_0000101 3300048904 Bacteria 89424
712 Ga0496101_0002517 3300048904 Bacteria 11251
713 Ga0496101_0035526 3300048904 Bacteria 3525
714 Ga0496102_0000075 3300048905 Bacteria 147013
715 Ga0496102_0017006 3300048905 Bacteria 6365
716 Ga0496102_0118625 3300048905 Bacteria 2469
717 Ga0496102_0159882 3300048905 Bacteria 2119
718 Ga0496102_0403502 3300048905 Bacteria 1285
719 Ga0496102_0812079 3300048905 Bacteria 857
720 Ga0496103_0000329 3300048906 Bacteria 43481
721 Ga0496103_0009420 3300048906 Bacteria 5787
722 Ga0496103_0013294 3300048906 Bacteria 4879
723 Ga0496104_0000003 3300048907 Bacteria 669219
724 Ga0496104_0004549 3300048907 Bacteria 12084
725 Ga0496104_0011315 3300048907 Bacteria 7987
726 Ga0496104_0248307 3300048907 Bacteria 1692
727 Ga0496104_0630956 3300048907 Bacteria 981
728 Ga0496104_0637938 3300048907 Bacteria 974
729 Ga0496105_0000003 3300048908 Bacteria 713251
730 Ga0496105_0043980 3300048908 Bacteria 3682
731 Ga0496105_0063040 3300048908 Bacteria 3059
732 Ga0496105_0107930 3300048908 Bacteria 2298
733 Ga0496106_0000013 3300048909 Bacteria 202263
734 Ga0496106_0000554 3300048909 Bacteria 26600
735 Ga0496106_0001085 3300048909 Bacteria 20088
736 Ga0496106_0074346 3300048909 Bacteria 2601
737 Ga0496106_0103285 3300048909 Bacteria 2212
738 Ga0496106_0415300 3300048909 Bacteria 1081
739 Ga0496107_0000011 3300048910 Bacteria 201631
740 Ga0496107_0000032 3300048910 Bacteria 99848
741 Ga0496107_0001550 3300048910 Bacteria 14280
742 Ga0496107_0274185 3300048910 Bacteria 1255
743 Ga0496107_0730069 3300048910 Bacteria 727
744 Ga0496108_0000004 3300048911 Bacteria 545055
745 Ga0496108_0000005 3300048911 Bacteria 535059
746 Ga0496108_0000383 3300048911 Bacteria 36765
747 Ga0496108_0006122 3300048911 Bacteria 9734
748 Ga0496108_0024974 3300048911 Bacteria 4923
749 Ga0496108_1075027 3300048911 Bacteria 685
750 Ga0496108_1324797 3300048911 Bacteria 605
751 Ga0496109_0000002 3300048912 Bacteria 443393
752 Ga0496109_0000036 3300048912 Bacteria 153972
753 Ga0496109_0000365 3300048912 Bacteria 42078
754 Ga0496109_0005502 3300048912 Bacteria 10606
755 Ga0496109_0013316 3300048912 Bacteria 7127
756 Ga0496109_0019747 3300048912 Bacteria 5945
757 Ga0496109_0026713 3300048912 Bacteria 5150
758 Ga0496109_0201552 3300048912 Bacteria 1871
759 Ga0496109_0337214 3300048912 Bacteria 1424
760 Ga0496110_0004721 3300048913 Bacteria 10604
761 Ga0496110_0005716 3300048913 Bacteria 9768
762 Ga0496110_0006918 3300048913 Bacteria 9019
763 Ga0496110_0051026 3300048913 Bacteria 3634
764 Ga0496110_0067135 3300048913 Bacteria 3173
765 Ga0496110_0287321 3300048913 Bacteria 1498
766 Ga0496110_0314426 3300048913 Bacteria 1426
767 Ga0496110_0837646 3300048913 Bacteria 825
768 Ga0496111_0001935 3300048914 Bacteria 12260
769 Ga0496111_0006969 3300048914 Bacteria 7378
770 Ga0496111_0058662 3300048914 Bacteria 2787
771 Ga0496111_0058756 3300048914 Bacteria 2784
772 Ga0496111_0290537 3300048914 Bacteria 1212
773 Ga0496112_0000006 3300048915 Bacteria 365227
774 Ga0496112_0000280 3300048915 Bacteria 33010
775 Ga0496112_0001978 3300048915 Bacteria 16196
776 Ga0496112_0021899 3300048915 Bacteria 6082
777 Ga0496112_0389642 3300048915 Bacteria 1334
778 Ga0496112_0399097 3300048915 Bacteria 1315
779 Ga0496112_0834687 3300048915 Bacteria 845
780 Ga0496112_0980362 3300048915 Bacteria 765
781 Ga0496113_0000001 3300048916 Bacteria 224977
782 Ga0496113_0025990 3300048916 Bacteria 4182
783 Ga0496113_0299216 3300048916 Bacteria 1288
784 Ga0496114_0120061 3300048917 Bacteria 2260
785 Ga0496114_0150239 3300048917 Bacteria 2020
786 Ga0496114_0184654 3300048917 Bacteria 1822
787 Ga0496114_0355334 3300048917 Bacteria 1296
788 Ga0496115_0034307 3300048918 Bacteria 4010
789 Ga0496117_0004973 3300048920 Bacteria 14262
790 Ga0496117_0230174 3300048920 Bacteria 1025
791 Ga0496118_0001190 3300048921 Bacteria 40072
792 Ga0496119_0131214 3300048922 Bacteria 1365
793 Ga0496121_0201715 3300048924 Bacteria 1417
794 Ga0496121_0362727 3300048924 Bacteria 961
795 Ga0496121_0382486 3300048924 Bacteria 928
796 Ga0496124_0256085 3300048927 Bacteria 1291
797 Ga0496124_0472301 3300048927 Bacteria 849
798 Ga0496125_0040716 3300048928 Bacteria 3982
799 Ga0496125_0063483 3300048928 Bacteria 2945
800 Ga0496125_0509833 3300048928 Bacteria 675
801 Ga0501031_0118196 3300049568 Bacteria 1732
802 Ga0501031_0212825 3300049568 Bacteria 1259
803 Ga0501032_0243262 3300049569 Bacteria 1169
804 Ga0501034_0003584 3300049571 Bacteria 17630
805 Ga0501034_0005460 3300049571 Bacteria 13884
806 Ga0501034_0012842 3300049571 Bacteria 8638
807 Ga0501036_0233078 3300049572 Bacteria 1545
808 Ga0501036_0986755 3300049572 Bacteria 690
809 Ga0501037_0018416 3300049573 Bacteria 5148
810 Ga0501039_0010474 3300049575 Bacteria 7065
811 Ga0501039_0348269 3300049575 Bacteria 1164
812 Ga0501039_0360574 3300049575 Bacteria 1142
813 Ga0501040_0087454 3300049576 Bacteria 2164
814 Ga0501042_0032510 3300049578 Bacteria 3695
815 Ga0501042_0325357 3300049578 Bacteria 1111
816 Ga0501042_0543911 3300049578 Bacteria 844
817 Ga0501043_0154530 3300049579 Bacteria 1795
818 Ga0501047_0036161 3300049581 Bacteria 4771
819 Ga0501068_0001258 3300049584 Bacteria 13450
820 Ga0501068_0146682 3300049584 Bacteria 1481
821 Ga0501068_0328237 3300049584 Bacteria 981
822 Ga0501069_0189804 3300049585 Bacteria 1189
823 Ga0501070_0009330 3300049586 Bacteria 8297
824 Ga0501070_0018324 3300049586 Bacteria 5873
825 Ga0501070_0040260 3300049586 Bacteria 3897
826 Ga0501070_0259727 3300049586 Bacteria 1420
827 Ga0501070_0335678 3300049586 Bacteria 1228
828 Ga0501070_0380715 3300049586 Bacteria 1143
829 Ga0501072_0008971 3300049588 Bacteria 7604
830 Ga0501072_0214020 3300049588 Bacteria 1536
831 Ga0501073_0004270 3300049589 Bacteria 10712
832 Ga0501074_0024121 3300049590 Bacteria 4420
833 Ga0501075_0496733 3300049591 Bacteria 931
834 Ga0501076_0409517 3300049592 Bacteria 1115
835 Ga0501083_0028215 3300049744 Bacteria 3870
836 Ga0501083_0038464 3300049744 Bacteria 3252
837 Ga0501035_0712634 3300049822 Bacteria 808
838 Ga0501044_0027876 3300049823 Bacteria 5962
839 Ga0501045_0092816 3300049824 Bacteria 2233
840 nmdc:mga03n38_367087_c1 3300050490 Bacteria 786
841 nmdc:mga03n38_7559_c1 3300050490 Bacteria 3850
842 nmdc:mga00v17_319016_c1 3300050491 Bacteria 1010
843 nmdc:mga00v17_91979_c1 3300050491 Bacteria 1906
844 nmdc:mga0yw44_1021_c1 3300050492 Bacteria 10722
845 nmdc:mga0yw44_265577_c1 3300050492 Bacteria 1145
846 nmdc:mga06z11_270400_c1 3300050494 Bacteria 1005
847 nmdc:mga05p37_144245_c1 3300050507 Bacteria 2916
848 nmdc:mga05p37_634025_c1 3300050507 Bacteria 1200
849 nmdc:mga09592_395571_c1 3300050508 Bacteria 1194
850 nmdc:mga0qj67_610351_c1 3300050509 Bacteria 872
851 nmdc:mga06r32_519915_c1 3300050510 Bacteria 1166
852 nmdc:mga08y16_105703_c1 3300050511 Bacteria 2930
853 nmdc:mga08y16_57307_c1 3300050511 Bacteria 4072
854 nmdc:mga08y16_66134_c1 3300050511 Bacteria 3773
855 nmdc:mga08y16_82624_c1 3300050511 Bacteria 3348
856 nmdc:mga0n895_146335_c1 3300050512 Bacteria 2392
857 Ga0495601_0000131 3300053077 Bacteria 42431
858 Ga0495601_0014155 3300053077 Bacteria 4806
859 Ga0495612_0001358 3300053078 Bacteria 10075
860 Ga0495612_0002321 3300053078 Bacteria 7836
861 Ga0495612_0028742 3300053078 Bacteria 2239
862 Ga0495595_0000017 3300053084 Bacteria 133011
863 Ga0495595_0005801 3300053084 Bacteria 4999
864 Ga0495619_0000054 3300053085 Bacteria 97928
865 Ga0495619_0000101 3300053085 Bacteria 64377
866 Ga0495619_0022877 3300053085 Bacteria 4002
867 Ga0500566_0000572 3300053094 Bacteria 20728
868 Ga0500641_0005057 3300053096 Bacteria 4675
869 Ga0500595_035427 3300053119 Bacteria 1643
870 Ga0500614_001780 3300053123 Bacteria 4997
871 Ga0500616_0013239 3300053153 Bacteria 4798
872 Ga0501084_0306131 3300054114 Bacteria 1342
873 Ga0501084_1015117 3300054114 Bacteria 697
874 Ga0501082_0229423 3300060353 Bacteria 1616
875 Ga0501082_0918992 3300060353 Bacteria 765
876 Ga0530510_0529558 3300061734 Bacteria 894

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_3894616 Ga0451853_3894616_191_733 176
2 3300046518 Ga0495631_0393952 Ga0495631_0393952_24_572 177
3 3300009098 Ga0105245_10003920 Ga0105245_1000392012 178
4 3300009176 Ga0105242_10000034 Ga0105242_1000003449 178
5 3300014969 Ga0157376_10176956 Ga0157376_101769562 178
6 3300049571 Ga0501034_0003584 Ga0501034_0003584_13059_13610 178
7 3300049573 Ga0501037_0018416 Ga0501037_0018416_3403_3954 178
8 3300049584 Ga0501068_0001258 Ga0501068_0001258_9477_10028 178
9 3300049586 Ga0501070_0018324 Ga0501070_0018324_1906_2457 178
10 3300049588 Ga0501072_0008971 Ga0501072_0008971_3425_3976 178
11 3300049589 Ga0501073_0004270 Ga0501073_0004270_8456_9007 178
12 3300049590 Ga0501074_0024121 Ga0501074_0024121_2225_2776 178
13 3300010375 Ga0105239_10014181 Ga0105239_1001418110 179
14 3300011119 Ga0105246_10236673 Ga0105246_102366732 179
15 3300017792 Ga0163161_10794421 Ga0163161_107944211 179
16 3300022467 Ga0224712_10277737 Ga0224712_102777371 179
17 3300025908 Ga0207643_10153756 Ga0207643_101537562 179
18 3300041491 Ga0451833_0301983 Ga0451833_0301983_106_645 179
19 3300041512 Ga0451853_0233585 Ga0451853_0233585_16_555 179
20 3300045976 Ga0466967_0085426 Ga0466967_0085426_792_1340 179
21 3300049575 Ga0501039_0348269 Ga0501039_0348269_382_972 179
22 3300049578 Ga0501042_0543911 Ga0501042_0543911_152_742 179
23 3300060353 Ga0501082_0229423 Ga0501082_0229423_978_1568 179
24 3300002774 JGI25150J39212_1000023 JGI25150J39212_100002351 180
25 3300003187 JGI25151J46595_10000082 JGI25151J46595_1000008251 180
26 3300003215 JGI25153J46596_10000060 JGI25153J46596_1000006052 180
27 3300005288 Ga0065714_10002668 Ga0065714_1000266822 180
28 3300005288 Ga0065714_10009648 Ga0065714_100096484 180
29 3300005617 Ga0068859_101729063 Ga0068859_1017290631 180
30 3300006931 Ga0097620_101728702 Ga0097620_1017287021 180
31 3300013100 Ga0157373_10001726 Ga0157373_1000172616 180
32 3300013105 Ga0157369_10552697 Ga0157369_105526971 180
33 3300013308 Ga0157375_10388873 Ga0157375_103888732 180
34 3300020077 Ga0206351_10912576 Ga0206351_109125761 180
35 3300020080 Ga0206350_10849943 Ga0206350_108499431 180
36 3300025245 Ga0207425_1000051 Ga0207425_100005184 180
37 3300025258 Ga0209129_1000121 Ga0209129_100012151 180
38 3300025294 Ga0209025_1000160 Ga0209025_100016076 180
39 3300025297 Ga0209758_1000147 Ga0209758_100014776 180
40 3300031911 Ga0307412_10081196 Ga0307412_100811965 180
41 3300046511 Ga0495608_0258813 Ga0495608_0258813_484_1068 180
42 3300046536 Ga0495587_0166468 Ga0495587_0166468_146_730 180
43 3300047472 Ga0495686_0058967 Ga0495686_0058967_680_1231 180
44 3300048088 Ga0495602_0005861 Ga0495602_0005861_10254_10838 180
45 3300049571 Ga0501034_0012842 Ga0501034_0012842_2228_2788 180
46 3300049586 Ga0501070_0335678 Ga0501070_0335678_352_912 180
47 3300006163 Ga0070715_10000001 Ga0070715_10000001441 181
48 3300025905 Ga0207685_10000005 Ga0207685_10000005291 181
49 3300049579 Ga0501043_0154530 Ga0501043_0154530_347_892 181
50 3300025927 Ga0207687_10033552 Ga0207687_100335524 182
51 3300026089 Ga0207648_10316424 Ga0207648_103164241 182
52 3300005331 Ga0070670_100092750 Ga0070670_1000927502 183
53 3300005334 Ga0068869_100207910 Ga0068869_1002079102 183
54 3300005338 Ga0068868_100015451 Ga0068868_1000154514 183
55 3300005344 Ga0070661_100009995 Ga0070661_1000099952 183
56 3300005353 Ga0070669_100141831 Ga0070669_1001418311 183
57 3300005354 Ga0070675_100010461 Ga0070675_1000104613 183
58 3300005366 Ga0070659_100039854 Ga0070659_1000398543 183
59 3300005441 Ga0070700_100031852 Ga0070700_1000318523 183
60 3300005455 Ga0070663_100007026 Ga0070663_1000070265 183
61 3300005535 Ga0070684_100004844 Ga0070684_1000048447 183
62 3300005543 Ga0070672_101094733 Ga0070672_1010947331 183
63 3300005564 Ga0070664_100325015 Ga0070664_1003250152 183
64 3300005577 Ga0068857_100025723 Ga0068857_1000257232 183
65 3300005615 Ga0070702_100137091 Ga0070702_1001370912 183
66 3300005719 Ga0068861_100601683 Ga0068861_1006016832 183
67 3300005842 Ga0068858_100071409 Ga0068858_1000714092 183
68 3300005844 Ga0068862_100025482 Ga0068862_1000254822 183
69 3300006881 Ga0068865_100167621 Ga0068865_1001676212 183
70 3300009094 Ga0111539_10005936 Ga0111539_100059363 183
71 3300009098 Ga0105245_10001336 Ga0105245_100013364 183
72 3300009148 Ga0105243_10209647 Ga0105243_102096472 183
73 3300009551 Ga0105238_10313308 Ga0105238_103133082 183
74 3300014326 Ga0157380_10090973 Ga0157380_100909732 183
75 3300014745 Ga0157377_10012344 Ga0157377_100123442 183
76 3300025901 Ga0207688_10063636 Ga0207688_100636362 183
77 3300025907 Ga0207645_10254228 Ga0207645_102542282 183
78 3300025919 Ga0207657_10082550 Ga0207657_100825502 183
79 3300025923 Ga0207681_10134586 Ga0207681_101345861 183
80 3300025924 Ga0207694_10186853 Ga0207694_101868532 183
81 3300025925 Ga0207650_10567390 Ga0207650_105673902 183
82 3300025926 Ga0207659_10006926 Ga0207659_100069264 183
83 3300025927 Ga0207687_10027612 Ga0207687_100276122 183
84 3300025932 Ga0207690_10020231 Ga0207690_100202313 183
85 3300025938 Ga0207704_10141477 Ga0207704_101414772 183
86 3300025940 Ga0207691_10591091 Ga0207691_105910911 183
87 3300025942 Ga0207689_10094424 Ga0207689_100944242 183
88 3300025944 Ga0207661_10075358 Ga0207661_100753582 183
89 3300025945 Ga0207679_10122831 Ga0207679_101228311 183
90 3300025972 Ga0207668_10256541 Ga0207668_102565412 183
91 3300026023 Ga0207677_10054993 Ga0207677_100549932 183
92 3300026035 Ga0207703_10042528 Ga0207703_100425283 183
93 3300026067 Ga0207678_10014788 Ga0207678_100147882 183
94 3300026075 Ga0207708_10069382 Ga0207708_100693822 183
95 3300026116 Ga0207674_10035690 Ga0207674_100356902 183
96 3300026118 Ga0207675_100214990 Ga0207675_1002149901 183
97 3300026142 Ga0207698_10842700 Ga0207698_108427002 183
98 3300027907 Ga0207428_10006750 Ga0207428_100067502 183
99 3300028380 Ga0268265_10016898 Ga0268265_100168983 183
100 3300041512 Ga0451853_0402524 Ga0451853_0402524_238_789 183
101 3300049584 Ga0501068_0328237 Ga0501068_0328237_243_794 183
102 3300050508 nmdc:mga09592_395571_c1 nmdc:mga09592_395571_c1_615_1175 183
103 3300050511 nmdc:mga08y16_57307_c1 nmdc:mga08y16_57307_c1_768_1328 183
104 3300004800 Ga0058861_10735126 Ga0058861_107351261 184
105 3300005364 Ga0070673_100010697 Ga0070673_1000106973 184
106 3300020069 Ga0197907_11376416 Ga0197907_113764161 184
107 3300025960 Ga0207651_10007137 Ga0207651_100071374 184
108 3300031727 Ga0316576_10101640 Ga0316576_101016402 184
109 3300031728 Ga0316578_10211794 Ga0316578_102117941 184
110 3300031733 Ga0316577_10050570 Ga0316577_100505701 184
111 3300032139 Ga0316580_10061032 Ga0316580_100610321 184
112 3300033541 Ga0316596_1169424 Ga0316596_11694241 184
113 3300035398 Ga0316574_0113609 Ga0316574_0113609_1122_1685 184
114 3300036712 Ga0316584_0148014 Ga0316584_0148014_889_1452 184
115 3300037068 Ga0373925_1070097 Ga0373925_1070097_78_635 184
116 3300046463 Ga0495653_0612144 Ga0495653_0612144_12_569 184
117 3300046511 Ga0495608_0084436 Ga0495608_0084436_393_947 184
118 3300046511 Ga0495608_0219288 Ga0495608_0219288_69_626 184
119 3300046517 Ga0495630_0194583 Ga0495630_0194583_392_946 184
120 3300046523 Ga0495644_0068226 Ga0495644_0068226_534_1091 184
121 3300046543 Ga0495645_0136928 Ga0495645_0136928_352_906 184
122 3300046559 Ga0495667_0125589 Ga0495667_0125589_864_1421 184
123 3300046675 Ga0495657_0152540 Ga0495657_0152540_679_1236 184
124 3300047322 Ga0495680_0000990 Ga0495680_0000990_17011_17565 184
125 3300048088 Ga0495602_0177096 Ga0495602_0177096_510_1067 184
126 3300048913 Ga0496110_0006918 Ga0496110_0006918_6303_6857 184
127 3300053077 Ga0495601_0000131 Ga0495601_0000131_18468_19022 184
128 3300053078 Ga0495612_0028742 Ga0495612_0028742_48_605 184
129 3300005440 Ga0070705_100114521 Ga0070705_1001145213 185
130 3300005445 Ga0070708_100404217 Ga0070708_1004042172 185
131 3300005467 Ga0070706_100308291 Ga0070706_1003082912 185
132 3300005546 Ga0070696_100290466 Ga0070696_1002904662 185
133 3300006881 Ga0068865_100753233 Ga0068865_1007532332 185
134 3300010375 Ga0105239_10941013 Ga0105239_109410132 185
135 3300013308 Ga0157375_10104038 Ga0157375_101040383 185
136 3300020069 Ga0197907_10816812 Ga0197907_108168122 185
137 3300020077 Ga0206351_10727604 Ga0206351_107276041 185
138 3300025910 Ga0207684_10191537 Ga0207684_101915372 185
139 3300025912 Ga0207707_10203577 Ga0207707_102035772 185
140 3300026089 Ga0207648_10893434 Ga0207648_108934342 185
141 3300045976 Ga0466967_0326091 Ga0466967_0326091_372_935 185
142 3300046684 Ga0495669_0011127 Ga0495669_0011127_366_929 185
143 3300048911 Ga0496108_1324797 Ga0496108_1324797_16_579 185
144 3300048913 Ga0496110_0287321 Ga0496110_0287321_767_1342 185
145 3300005435 Ga0070714_100001023 Ga0070714_1000010236 186
146 3300005718 Ga0068866_10095277 Ga0068866_100952772 186
147 3300006846 Ga0075430_100129532 Ga0075430_1001295321 186
148 3300025929 Ga0207664_10000013 Ga0207664_10000013134 186
149 3300028380 Ga0268265_11434589 Ga0268265_114345891 186
150 3300031995 Ga0307409_100117154 Ga0307409_1001171542 186
151 3300049585 Ga0501069_0189804 Ga0501069_0189804_422_982 186
152 3300050510 nmdc:mga06r32_519915_c1 nmdc:mga06r32_519915_c1_78_656 186
153 3300053153 Ga0500616_0013239 Ga0500616_0013239_609_1169 186
154 3300005329 Ga0070683_100022176 Ga0070683_1000221764 187
155 3300005330 Ga0070690_100377100 Ga0070690_1003771002 187
156 3300005535 Ga0070684_100015887 Ga0070684_1000158873 187
157 3300005985 Ga0081539_10253126 Ga0081539_102531261 187
158 3300025944 Ga0207661_10062212 Ga0207661_100622122 187
159 3300044901 Ga0466960_0041902 Ga0466960_0041902_211_783 187
160 3300048905 Ga0496102_0000075 Ga0496102_0000075_17249_17821 187
161 3300048906 Ga0496103_0000329 Ga0496103_0000329_17475_18047 187
162 3300002077 JGI24744J21845_10036099 JGI24744J21845_100360992 188
163 3300003373 JGI25407J50210_10013120 JGI25407J50210_100131202 188
164 3300005329 Ga0070683_100013741 Ga0070683_1000137415 188
165 3300005329 Ga0070683_100097447 Ga0070683_1000974472 188
166 3300005334 Ga0068869_100124005 Ga0068869_1001240052 188
167 3300005336 Ga0070680_100761350 Ga0070680_1007613501 188
168 3300005337 Ga0070682_100001507 Ga0070682_10000150712 188
169 3300005337 Ga0070682_100007875 Ga0070682_1000078753 188
170 3300005338 Ga0068868_100006732 Ga0068868_1000067325 188
171 3300005338 Ga0068868_100181876 Ga0068868_1001818762 188
172 3300005339 Ga0070660_100038941 Ga0070660_1000389412 188
173 3300005340 Ga0070689_100015468 Ga0070689_1000154684 188
174 3300005340 Ga0070689_100333038 Ga0070689_1003330381 188
175 3300005341 Ga0070691_10006974 Ga0070691_100069746 188
176 3300005341 Ga0070691_10151049 Ga0070691_101510492 188
177 3300005345 Ga0070692_10012328 Ga0070692_100123285 188
178 3300005347 Ga0070668_100022553 Ga0070668_1000225535 188
179 3300005354 Ga0070675_100119336 Ga0070675_1001193362 188
180 3300005356 Ga0070674_100008538 Ga0070674_1000085382 188
181 3300005364 Ga0070673_100069826 Ga0070673_1000698263 188
182 3300005365 Ga0070688_100034871 Ga0070688_1000348713 188
183 3300005365 Ga0070688_100044102 Ga0070688_1000441021 188
184 3300005366 Ga0070659_100001523 Ga0070659_10000152318 188
185 3300005366 Ga0070659_100002700 Ga0070659_1000027004 188
186 3300005366 Ga0070659_100055816 Ga0070659_1000558163 188
187 3300005367 Ga0070667_100388345 Ga0070667_1003883452 188
188 3300005438 Ga0070701_10214389 Ga0070701_102143892 188
189 3300005439 Ga0070711_100178853 Ga0070711_1001788532 188
190 3300005440 Ga0070705_100108681 Ga0070705_1001086812 188
191 3300005441 Ga0070700_100046229 Ga0070700_1000462292 188
192 3300005455 Ga0070663_100009721 Ga0070663_1000097214 188
193 3300005455 Ga0070663_100013544 Ga0070663_1000135443 188
194 3300005456 Ga0070678_100054845 Ga0070678_1000548453 188
195 3300005457 Ga0070662_100007829 Ga0070662_1000078296 188
196 3300005458 Ga0070681_10299487 Ga0070681_102994872 188
197 3300005459 Ga0068867_100028276 Ga0068867_1000282765 188
198 3300005466 Ga0070685_10008752 Ga0070685_100087522 188
199 3300005535 Ga0070684_100001038 Ga0070684_1000010385 188
200 3300005535 Ga0070684_100007134 Ga0070684_1000071343 188
201 3300005535 Ga0070684_100321377 Ga0070684_1003213772 188
202 3300005539 Ga0068853_100049531 Ga0068853_1000495313 188
203 3300005543 Ga0070672_100107935 Ga0070672_1001079352 188
204 3300005543 Ga0070672_100159022 Ga0070672_1001590222 188
205 3300005544 Ga0070686_100190739 Ga0070686_1001907392 188
206 3300005547 Ga0070693_100015108 Ga0070693_1000151082 188
207 3300005548 Ga0070665_100217538 Ga0070665_1002175382 188
208 3300005564 Ga0070664_100052767 Ga0070664_1000527674 188
209 3300005564 Ga0070664_100224471 Ga0070664_1002244711 188
210 3300005564 Ga0070664_100955056 Ga0070664_1009550562 188
211 3300005577 Ga0068857_100592034 Ga0068857_1005920342 188
212 3300005614 Ga0068856_100005163 Ga0068856_10000516311 188
213 3300005615 Ga0070702_100019981 Ga0070702_1000199813 188
214 3300005616 Ga0068852_100012477 Ga0068852_1000124775 188
215 3300005616 Ga0068852_100941234 Ga0068852_1009412341 188
216 3300005617 Ga0068859_101174610 Ga0068859_1011746101 188
217 3300005618 Ga0068864_100052452 Ga0068864_1000524523 188
218 3300005719 Ga0068861_100992264 Ga0068861_1009922641 188
219 3300005834 Ga0068851_10091962 Ga0068851_100919622 188
220 3300005840 Ga0068870_10150456 Ga0068870_101504562 188
221 3300005842 Ga0068858_100091683 Ga0068858_1000916833 188
222 3300005842 Ga0068858_100252309 Ga0068858_1002523093 188
223 3300005844 Ga0068862_100086672 Ga0068862_1000866722 188
224 3300005937 Ga0081455_10025637 Ga0081455_100256373 188
225 3300005981 Ga0081538_10002334 Ga0081538_1000233413 188
226 3300005981 Ga0081538_10009623 Ga0081538_100096233 188
227 3300005981 Ga0081538_10025242 Ga0081538_100252422 188
228 3300006038 Ga0075365_10009869 Ga0075365_100098696 188
229 3300006038 Ga0075365_10078115 Ga0075365_100781152 188
230 3300006048 Ga0075363_100009250 Ga0075363_1000092506 188
231 3300006051 Ga0075364_10055657 Ga0075364_100556574 188
232 3300006051 Ga0075364_10068968 Ga0075364_100689684 188
233 3300006051 Ga0075364_10332394 Ga0075364_103323941 188
234 3300006175 Ga0070712_100000009 Ga0070712_10000000949 188
235 3300006175 Ga0070712_100115984 Ga0070712_1001159843 188
236 3300006178 Ga0075367_10227532 Ga0075367_102275322 188
237 3300006178 Ga0075367_10268715 Ga0075367_102687152 188
238 3300006881 Ga0068865_100044332 Ga0068865_1000443322 188
239 3300006931 Ga0097620_101174635 Ga0097620_1011746351 188
240 3300009093 Ga0105240_10341615 Ga0105240_103416152 188
241 3300009093 Ga0105240_11186786 Ga0105240_111867861 188
242 3300009094 Ga0111539_10092681 Ga0111539_100926812 188
243 3300009098 Ga0105245_10000975 Ga0105245_1000097512 188
244 3300009147 Ga0114129_11708635 Ga0114129_117086352 188
245 3300009148 Ga0105243_10008888 Ga0105243_100088886 188
246 3300009176 Ga0105242_10196366 Ga0105242_101963663 188
247 3300009177 Ga0105248_10058896 Ga0105248_100588962 188
248 3300009551 Ga0105238_10566905 Ga0105238_105669052 188
249 3300009551 Ga0105238_11351692 Ga0105238_113516921 188
250 3300009553 Ga0105249_10065721 Ga0105249_100657211 188
251 3300010375 Ga0105239_10200112 Ga0105239_102001122 188
252 3300011119 Ga0105246_10102252 Ga0105246_101022523 188
253 3300013296 Ga0157374_10003363 Ga0157374_100033637 188
254 3300013297 Ga0157378_10396402 Ga0157378_103964022 188
255 3300013306 Ga0163162_10066169 Ga0163162_100661692 188
256 3300013306 Ga0163162_10194466 Ga0163162_101944663 188
257 3300013307 Ga0157372_10001751 Ga0157372_1000175114 188
258 3300013308 Ga0157375_10005447 Ga0157375_100054476 188
259 3300013308 Ga0157375_10255339 Ga0157375_102553391 188
260 3300014325 Ga0163163_10840061 Ga0163163_108400612 188
261 3300014326 Ga0157380_10014388 Ga0157380_100143886 188
262 3300014745 Ga0157377_10002140 Ga0157377_100021405 188
263 3300014745 Ga0157377_10029745 Ga0157377_100297452 188
264 3300020069 Ga0197907_10601346 Ga0197907_106013461 188
265 3300020069 Ga0197907_11450979 Ga0197907_114509792 188
266 3300020070 Ga0206356_11579150 Ga0206356_115791501 188
267 3300020075 Ga0206349_1072408 Ga0206349_10724082 188
268 3300020075 Ga0206349_1841112 Ga0206349_18411121 188
269 3300020077 Ga0206351_10977218 Ga0206351_109772181 188
270 3300020078 Ga0206352_10263854 Ga0206352_102638541 188
271 3300020078 Ga0206352_11263724 Ga0206352_112637241 188
272 3300020080 Ga0206350_10174780 Ga0206350_101747802 188
273 3300020081 Ga0206354_10628115 Ga0206354_106281152 188
274 3300020081 Ga0206354_10816607 Ga0206354_108166072 188
275 3300020082 Ga0206353_10346301 Ga0206353_103463011 188
276 3300020082 Ga0206353_10543008 Ga0206353_105430082 188
277 3300020082 Ga0206353_10602801 Ga0206353_106028012 188
278 3300022467 Ga0224712_10178143 Ga0224712_101781432 188
279 3300022467 Ga0224712_10218733 Ga0224712_102187331 188
280 3300025885 Ga0207653_10156476 Ga0207653_101564762 188
281 3300025898 Ga0207692_10119988 Ga0207692_101199883 188
282 3300025901 Ga0207688_10001154 Ga0207688_100011543 188
283 3300025901 Ga0207688_10007117 Ga0207688_100071175 188
284 3300025908 Ga0207643_10090946 Ga0207643_100909462 188
285 3300025909 Ga0207705_10652835 Ga0207705_106528351 188
286 3300025913 Ga0207695_10357716 Ga0207695_103577162 188
287 3300025915 Ga0207693_10000036 Ga0207693_1000003686 188
288 3300025915 Ga0207693_10040330 Ga0207693_100403303 188
289 3300025916 Ga0207663_10308964 Ga0207663_103089642 188
290 3300025917 Ga0207660_10705803 Ga0207660_107058032 188
291 3300025919 Ga0207657_10003298 Ga0207657_100032983 188
292 3300025919 Ga0207657_10058617 Ga0207657_100586174 188
293 3300025919 Ga0207657_10086996 Ga0207657_100869962 188
294 3300025924 Ga0207694_10310107 Ga0207694_103101072 188
295 3300025926 Ga0207659_10048959 Ga0207659_100489594 188
296 3300025926 Ga0207659_10197705 Ga0207659_101977052 188
297 3300025927 Ga0207687_10049069 Ga0207687_100490692 188
298 3300025929 Ga0207664_10035621 Ga0207664_100356212 188
299 3300025932 Ga0207690_10000064 Ga0207690_1000006469 188
300 3300025932 Ga0207690_10164392 Ga0207690_101643921 188
301 3300025933 Ga0207706_10001985 Ga0207706_1000198510 188
302 3300025933 Ga0207706_10042627 Ga0207706_100426274 188
303 3300025934 Ga0207686_10483811 Ga0207686_104838111 188
304 3300025935 Ga0207709_10195429 Ga0207709_101954291 188
305 3300025936 Ga0207670_10255572 Ga0207670_102555721 188
306 3300025937 Ga0207669_10133727 Ga0207669_101337272 188
307 3300025938 Ga0207704_10008364 Ga0207704_100083644 188
308 3300025940 Ga0207691_10142893 Ga0207691_101428932 188
309 3300025941 Ga0207711_10015551 Ga0207711_100155513 188
310 3300025942 Ga0207689_10155091 Ga0207689_101550913 188
311 3300025944 Ga0207661_10004455 Ga0207661_100044552 188
312 3300025945 Ga0207679_10529617 Ga0207679_105296172 188
313 3300025949 Ga0207667_10515925 Ga0207667_105159252 188
314 3300025960 Ga0207651_10133326 Ga0207651_101333262 188
315 3300025960 Ga0207651_10370071 Ga0207651_103700712 188
316 3300025986 Ga0207658_10702128 Ga0207658_107021282 188
317 3300026023 Ga0207677_10322903 Ga0207677_103229031 188
318 3300026035 Ga0207703_10835798 Ga0207703_108357981 188
319 3300026041 Ga0207639_10039100 Ga0207639_100391004 188
320 3300026067 Ga0207678_10023321 Ga0207678_100233216 188
321 3300026067 Ga0207678_10038610 Ga0207678_100386104 188
322 3300026075 Ga0207708_10006175 Ga0207708_100061753 188
323 3300026075 Ga0207708_10008298 Ga0207708_100082986 188
324 3300026078 Ga0207702_10072197 Ga0207702_100721973 188
325 3300026088 Ga0207641_10046202 Ga0207641_100462024 188
326 3300026089 Ga0207648_10060218 Ga0207648_100602182 188
327 3300026095 Ga0207676_10046013 Ga0207676_100460133 188
328 3300026116 Ga0207674_10131165 Ga0207674_101311653 188
329 3300026116 Ga0207674_10646821 Ga0207674_106468212 188
330 3300026121 Ga0207683_10010330 Ga0207683_100103302 188
331 3300026142 Ga0207698_10794627 Ga0207698_107946272 188
332 3300028379 Ga0268266_10303321 Ga0268266_103033212 188
333 3300031548 Ga0307408_100205850 Ga0307408_1002058502 188
334 3300031901 Ga0307406_10135001 Ga0307406_101350012 188
335 3300031911 Ga0307412_10685716 Ga0307412_106857162 188
336 3300032002 Ga0307416_100708770 Ga0307416_1007087702 188
337 3300032004 Ga0307414_10936097 Ga0307414_109360972 188
338 3300032126 Ga0307415_100576123 Ga0307415_1005761232 188
339 3300037418 Ga0395900_0615622 Ga0395900_0615622_438_1004 188
340 3300038443 Ga0395901_0031752 Ga0395901_0031752_4539_5117 188
341 3300038443 Ga0395901_0347602 Ga0395901_0347602_884_1450 188
342 3300042009 Ga0439451_017501 Ga0439451_017501_210_788 188
343 3300042013 Ga0439456_025827 Ga0439456_025827_611_1234 188
344 3300042461 Ga0439460_0001189 Ga0439460_0001189_4667_5245 188
345 3300044684 Ga0466966_0095308 Ga0466966_0095308_811_1401 188
346 3300044706 Ga0466964_0038924 Ga0466964_0038924_615_1199 188
347 3300044901 Ga0466960_0118967 Ga0466960_0118967_711_1295 188
348 3300044901 Ga0466960_0127917 Ga0466960_0127917_52_636 188
349 3300045976 Ga0466967_0004422 Ga0466967_0004422_4063_4647 188
350 3300045976 Ga0466967_0768412 Ga0466967_0768412_328_894 188
351 3300046471 Ga0495650_0000035 Ga0495650_0000035_94540_95106 188
352 3300048903 Ga0496100_0029070 Ga0496100_0029070_2227_2793 188
353 3300048904 Ga0496101_0035526 Ga0496101_0035526_314_880 188
354 3300048905 Ga0496102_0017006 Ga0496102_0017006_3718_4284 188
355 3300048905 Ga0496102_0118625 Ga0496102_0118625_1707_2273 188
356 3300048906 Ga0496103_0009420 Ga0496103_0009420_1670_2236 188
357 3300048906 Ga0496103_0013294 Ga0496103_0013294_2343_2909 188
358 3300048907 Ga0496104_0004549 Ga0496104_0004549_4821_5387 188
359 3300048907 Ga0496104_0630956 Ga0496104_0630956_139_705 188
360 3300048909 Ga0496106_0103285 Ga0496106_0103285_1414_1980 188
361 3300048909 Ga0496106_0415300 Ga0496106_0415300_400_966 188
362 3300048910 Ga0496107_0274185 Ga0496107_0274185_557_1123 188
363 3300048911 Ga0496108_0006122 Ga0496108_0006122_7997_8563 188
364 3300048912 Ga0496109_0005502 Ga0496109_0005502_4618_5184 188
365 3300048912 Ga0496109_0019747 Ga0496109_0019747_3888_4454 188
366 3300048913 Ga0496110_0004721 Ga0496110_0004721_3856_4422 188
367 3300048913 Ga0496110_0051026 Ga0496110_0051026_2901_3467 188
368 3300048914 Ga0496111_0001935 Ga0496111_0001935_9507_10073 188
369 3300048915 Ga0496112_0000280 Ga0496112_0000280_11178_11744 188
370 3300048915 Ga0496112_0021899 Ga0496112_0021899_3182_3748 188
371 3300048916 Ga0496113_0025990 Ga0496113_0025990_1086_1652 188
372 3300048916 Ga0496113_0299216 Ga0496113_0299216_506_1072 188
373 3300048920 Ga0496117_0004973 Ga0496117_0004973_10423_10989 188
374 3300048920 Ga0496117_0230174 Ga0496117_0230174_43_609 188
375 3300048921 Ga0496118_0001190 Ga0496118_0001190_2473_3039 188
376 3300048922 Ga0496119_0131214 Ga0496119_0131214_109_675 188
377 3300048924 Ga0496121_0362727 Ga0496121_0362727_378_944 188
378 3300048924 Ga0496121_0382486 Ga0496121_0382486_290_856 188
379 3300048927 Ga0496124_0256085 Ga0496124_0256085_259_825 188
380 3300048927 Ga0496124_0472301 Ga0496124_0472301_59_625 188
381 3300048928 Ga0496125_0063483 Ga0496125_0063483_1247_1813 188
382 3300048928 Ga0496125_0509833 Ga0496125_0509833_21_587 188
383 3300049568 Ga0501031_0212825 Ga0501031_0212825_469_1035 188
384 3300049575 Ga0501039_0360574 Ga0501039_0360574_170_736 188
385 3300049581 Ga0501047_0036161 Ga0501047_0036161_4192_4758 188
386 3300049584 Ga0501068_0146682 Ga0501068_0146682_462_1028 188
387 3300049586 Ga0501070_0009330 Ga0501070_0009330_6491_7057 188
388 3300049586 Ga0501070_0259727 Ga0501070_0259727_817_1383 188
389 3300049588 Ga0501072_0214020 Ga0501072_0214020_474_1040 188
390 3300049744 Ga0501083_0028215 Ga0501083_0028215_1539_2105 188
391 3300049822 Ga0501035_0712634 Ga0501035_0712634_215_781 188
392 3300049823 Ga0501044_0027876 Ga0501044_0027876_3129_3695 188
393 3300050490 nmdc:mga03n38_7559_c1 nmdc:mga03n38_7559_c1_3003_3569 188
394 3300050491 nmdc:mga00v17_319016_c1 nmdc:mga00v17_319016_c1_387_953 188
395 3300050491 nmdc:mga00v17_91979_c1 nmdc:mga00v17_91979_c1_95_661 188
396 3300050492 nmdc:mga0yw44_1021_c1 nmdc:mga0yw44_1021_c1_40_606 188
397 3300050494 nmdc:mga06z11_270400_c1 nmdc:mga06z11_270400_c1_367_933 188
398 3300050511 nmdc:mga08y16_105703_c1 nmdc:mga08y16_105703_c1_1504_2070 188
399 3300050511 nmdc:mga08y16_82624_c1 nmdc:mga08y16_82624_c1_2304_2870 188
400 3300053119 Ga0500595_035427 Ga0500595_035427_363_929 188
401 3300060353 Ga0501082_0918992 Ga0501082_0918992_145_711 188
402 3300005337 Ga0070682_100000102 Ga0070682_10000010234 189
403 3300005338 Ga0068868_100738622 Ga0068868_1007386221 189
404 3300005347 Ga0070668_100113504 Ga0070668_1001135042 189
405 3300005366 Ga0070659_100176187 Ga0070659_1001761872 189
406 3300005366 Ga0070659_100408704 Ga0070659_1004087042 189
407 3300005435 Ga0070714_100074817 Ga0070714_1000748172 189
408 3300005440 Ga0070705_100018095 Ga0070705_1000180957 189
409 3300005441 Ga0070700_100184149 Ga0070700_1001841492 189
410 3300005444 Ga0070694_100510655 Ga0070694_1005106552 189
411 3300005457 Ga0070662_100276367 Ga0070662_1002763672 189
412 3300005539 Ga0068853_100371266 Ga0068853_1003712662 189
413 3300005546 Ga0070696_100115792 Ga0070696_1001157922 189
414 3300005563 Ga0068855_100446339 Ga0068855_1004463394 189
415 3300005615 Ga0070702_100086548 Ga0070702_1000865482 189
416 3300005615 Ga0070702_100094861 Ga0070702_1000948612 189
417 3300005615 Ga0070702_100098954 Ga0070702_1000989541 189
418 3300005616 Ga0068852_100103195 Ga0068852_1001031952 189
419 3300005616 Ga0068852_100622780 Ga0068852_1006227802 189
420 3300005617 Ga0068859_101001881 Ga0068859_1010018812 189
421 3300005841 Ga0068863_100160081 Ga0068863_1001600812 189
422 3300005842 Ga0068858_100059212 Ga0068858_1000592127 189
423 3300005843 Ga0068860_100238767 Ga0068860_1002387673 189
424 3300005844 Ga0068862_100785944 Ga0068862_1007859441 189
425 3300005985 Ga0081539_10150133 Ga0081539_101501332 189
426 3300006173 Ga0070716_100107080 Ga0070716_1001070803 189
427 3300006871 Ga0075434_100333981 Ga0075434_1003339812 189
428 3300006881 Ga0068865_100246995 Ga0068865_1002469953 189
429 3300006881 Ga0068865_100327960 Ga0068865_1003279602 189
430 3300006931 Ga0097620_101001848 Ga0097620_1010018482 189
431 3300009098 Ga0105245_10734819 Ga0105245_107348192 189
432 3300009101 Ga0105247_10311119 Ga0105247_103111192 189
433 3300009174 Ga0105241_10716217 Ga0105241_107162171 189
434 3300009176 Ga0105242_10085386 Ga0105242_100853862 189
435 3300009177 Ga0105248_10491642 Ga0105248_104916422 189
436 3300009545 Ga0105237_10534592 Ga0105237_105345921 189
437 3300009553 Ga0105249_11104708 Ga0105249_111047082 189
438 3300009553 Ga0105249_11262741 Ga0105249_112627411 189
439 3300010375 Ga0105239_10375416 Ga0105239_103754162 189
440 3300013296 Ga0157374_10201302 Ga0157374_102013022 189
441 3300013308 Ga0157375_10917946 Ga0157375_109179462 189
442 3300014745 Ga0157377_10042863 Ga0157377_100428636 189
443 3300014969 Ga0157376_11170484 Ga0157376_111704841 189
444 3300020080 Ga0206350_10388591 Ga0206350_103885911 189
445 3300020080 Ga0206350_10624272 Ga0206350_106242722 189
446 3300022467 Ga0224712_10351005 Ga0224712_103510051 189
447 3300025901 Ga0207688_10104859 Ga0207688_101048592 189
448 3300025904 Ga0207647_10147180 Ga0207647_101471802 189
449 3300025908 Ga0207643_10057698 Ga0207643_100576982 189
450 3300025915 Ga0207693_10054303 Ga0207693_100543032 189
451 3300025916 Ga0207663_10057935 Ga0207663_100579354 189
452 3300025919 Ga0207657_10077543 Ga0207657_100775436 189
453 3300025919 Ga0207657_10130274 Ga0207657_101302741 189
454 3300025920 Ga0207649_10493771 Ga0207649_104937711 189
455 3300025921 Ga0207652_10065133 Ga0207652_100651336 189
456 3300025923 Ga0207681_10722438 Ga0207681_107224381 189
457 3300025924 Ga0207694_10126216 Ga0207694_101262163 189
458 3300025929 Ga0207664_10223474 Ga0207664_102234742 189
459 3300025932 Ga0207690_10285246 Ga0207690_102852462 189
460 3300025933 Ga0207706_10137784 Ga0207706_101377843 189
461 3300025933 Ga0207706_10509477 Ga0207706_105094772 189
462 3300025935 Ga0207709_10515015 Ga0207709_105150151 189
463 3300025935 Ga0207709_10696105 Ga0207709_106961052 189
464 3300025936 Ga0207670_10249857 Ga0207670_102498572 189
465 3300025936 Ga0207670_10354993 Ga0207670_103549932 189
466 3300025937 Ga0207669_10231327 Ga0207669_102313272 189
467 3300025937 Ga0207669_10555855 Ga0207669_105558552 189
468 3300025938 Ga0207704_10788847 Ga0207704_107888471 189
469 3300025939 Ga0207665_10032210 Ga0207665_100322104 189
470 3300025940 Ga0207691_10151705 Ga0207691_101517053 189
471 3300025949 Ga0207667_10479701 Ga0207667_104797012 189
472 3300025949 Ga0207667_10782920 Ga0207667_107829202 189
473 3300025961 Ga0207712_10044596 Ga0207712_100445967 189
474 3300025972 Ga0207668_10385800 Ga0207668_103858002 189
475 3300025981 Ga0207640_10225193 Ga0207640_102251932 189
476 3300026041 Ga0207639_10149626 Ga0207639_101496262 189
477 3300026075 Ga0207708_10179606 Ga0207708_101796062 189
478 3300026089 Ga0207648_10097076 Ga0207648_100970762 189
479 3300026118 Ga0207675_100045768 Ga0207675_1000457687 189
480 3300026142 Ga0207698_10414479 Ga0207698_104144791 189
481 3300028380 Ga0268265_10404622 Ga0268265_104046222 189
482 3300028380 Ga0268265_10808168 Ga0268265_108081682 189
483 3300031731 Ga0307405_10567330 Ga0307405_105673302 189
484 3300031824 Ga0307413_10165871 Ga0307413_101658712 189
485 3300031824 Ga0307413_10292913 Ga0307413_102929131 189
486 3300031852 Ga0307410_10031793 Ga0307410_100317934 189
487 3300031901 Ga0307406_10013575 Ga0307406_100135752 189
488 3300031901 Ga0307406_10483738 Ga0307406_104837381 189
489 3300031903 Ga0307407_10199790 Ga0307407_101997902 189
490 3300031995 Ga0307409_100381919 Ga0307409_1003819191 189
491 3300031995 Ga0307409_100632681 Ga0307409_1006326812 189
492 3300032002 Ga0307416_100030344 Ga0307416_1000303443 189
493 3300032004 Ga0307414_10219882 Ga0307414_102198821 189
494 3300032005 Ga0307411_10047028 Ga0307411_100470282 189
495 3300032126 Ga0307415_100042215 Ga0307415_1000422153 189
496 3300032126 Ga0307415_100068875 Ga0307415_1000688754 189
497 3300032126 Ga0307415_100073134 Ga0307415_1000731341 189
498 3300032126 Ga0307415_100841642 Ga0307415_1008416422 189
499 3300035172 Ga0373955_0111673 Ga0373955_0111673_358_1029 189
500 3300037471 Ga0395905_0052992 Ga0395905_0052992_738_1343 189
501 3300041452 Ga0451793_0656212 Ga0451793_0656212_467_1036 189
502 3300041509 Ga0451843_1480200 Ga0451843_1480200_818_1387 189
503 3300044683 Ga0466965_0448394 Ga0466965_0448394_121_702 189
504 3300044842 Ga0466957_0182976 Ga0466957_0182976_300_884 189
505 3300045836 Ga0466958_0351858 Ga0466958_0351858_151_726 189
506 3300045976 Ga0466967_0039393 Ga0466967_0039393_2720_3307 189
507 3300045976 Ga0466967_0150502 Ga0466967_0150502_1297_1869 189
508 3300046525 Ga0495663_0099372 Ga0495663_0099372_101_679 189
509 3300046615 Ga0495656_0000217 Ga0495656_0000217_83_667 189
510 3300048903 Ga0496100_0166003 Ga0496100_0166003_163_750 189
511 3300048903 Ga0496100_0456279 Ga0496100_0456279_71_679 189
512 3300048903 Ga0496100_0699495 Ga0496100_0699495_178_765 189
513 3300048904 Ga0496101_0002517 Ga0496101_0002517_1648_2235 189
514 3300048905 Ga0496102_0159882 Ga0496102_0159882_1297_1884 189
515 3300048905 Ga0496102_0403502 Ga0496102_0403502_277_885 189
516 3300048905 Ga0496102_0812079 Ga0496102_0812079_208_795 189
517 3300048907 Ga0496104_0248307 Ga0496104_0248307_217_798 189
518 3300048907 Ga0496104_0637938 Ga0496104_0637938_309_890 189
519 3300048908 Ga0496105_0063040 Ga0496105_0063040_2415_2996 189
520 3300048908 Ga0496105_0107930 Ga0496105_0107930_1492_2073 189
521 3300048909 Ga0496106_0074346 Ga0496106_0074346_1756_2343 189
522 3300048910 Ga0496107_0001550 Ga0496107_0001550_10235_10822 189
523 3300048910 Ga0496107_0730069 Ga0496107_0730069_113_700 189
524 3300048911 Ga0496108_0024974 Ga0496108_0024974_2226_2813 189
525 3300048911 Ga0496108_1075027 Ga0496108_1075027_34_615 189
526 3300048912 Ga0496109_0026713 Ga0496109_0026713_4366_4953 189
527 3300048913 Ga0496110_0314426 Ga0496110_0314426_470_1057 189
528 3300048913 Ga0496110_0837646 Ga0496110_0837646_92_673 189
529 3300048914 Ga0496111_0058662 Ga0496111_0058662_1415_1996 189
530 3300048914 Ga0496111_0290537 Ga0496111_0290537_165_752 189
531 3300048915 Ga0496112_0001978 Ga0496112_0001978_19_597 189
532 3300048915 Ga0496112_0399097 Ga0496112_0399097_163_744 189
533 3300048915 Ga0496112_0834687 Ga0496112_0834687_178_765 189
534 3300048915 Ga0496112_0980362 Ga0496112_0980362_41_628 189
535 3300048916 Ga0496113_0000001 Ga0496113_0000001_51534_52112 189
536 3300048917 Ga0496114_0120061 Ga0496114_0120061_986_1594 189
537 3300048917 Ga0496114_0150239 Ga0496114_0150239_489_1070 189
538 3300048917 Ga0496114_0355334 Ga0496114_0355334_137_724 189
539 3300049572 Ga0501036_0233078 Ga0501036_0233078_602_1183 189
540 3300049586 Ga0501070_0380715 Ga0501070_0380715_215_796 189
541 3300049591 Ga0501075_0496733 Ga0501075_0496733_80_658 189
542 3300050507 nmdc:mga05p37_634025_c1 nmdc:mga05p37_634025_c1_315_902 189
543 3300050512 nmdc:mga0n895_146335_c1 nmdc:mga0n895_146335_c1_1523_2101 189
544 3300001979 JGI24740J21852_10010169 JGI24740J21852_100101692 190
545 3300002074 JGI24748J21848_1001174 JGI24748J21848_10011742 190
546 3300002239 JGI24034J26672_10000090 JGI24034J26672_1000009025 190
547 3300002239 JGI24034J26672_10000145 JGI24034J26672_100001452 190
548 3300002244 JGI24742J22300_10000813 JGI24742J22300_1000081311 190
549 3300003308 Ga0006777J48905_1038789 Ga0006777J48905_10387892 190
550 3300003568 Ga0006781J51513_1016641 Ga0006781J51513_10166412 190
551 3300003577 Ga0007416J51690_1082693 Ga0007416J51690_10826931 190
552 3300003579 Ga0007429J51699_1024122 Ga0007429J51699_10241222 190
553 3300003579 Ga0007429J51699_1040927 Ga0007429J51699_10409271 190
554 3300003579 Ga0007429J51699_1058940 Ga0007429J51699_10589401 190
555 3300003693 Ga0032354_1046428 Ga0032354_10464281 190
556 3300005329 Ga0070683_100000534 Ga0070683_10000053422 190
557 3300005329 Ga0070683_100000888 Ga0070683_10000088815 190
558 3300005329 Ga0070683_100002079 Ga0070683_10000207914 190
559 3300005329 Ga0070683_100173974 Ga0070683_1001739743 190
560 3300005331 Ga0070670_100012696 Ga0070670_1000126964 190
561 3300005333 Ga0070677_10000081 Ga0070677_1000008129 190
562 3300005337 Ga0070682_100000556 Ga0070682_1000005563 190
563 3300005338 Ga0068868_100000634 Ga0068868_10000063428 190
564 3300005338 Ga0068868_100001874 Ga0068868_1000018749 190
565 3300005339 Ga0070660_100513137 Ga0070660_1005131372 190
566 3300005341 Ga0070691_10000064 Ga0070691_1000006413 190
567 3300005344 Ga0070661_100000004 Ga0070661_10000000460 190
568 3300005345 Ga0070692_10040923 Ga0070692_100409231 190
569 3300005347 Ga0070668_100050286 Ga0070668_1000502862 190
570 3300005354 Ga0070675_100000078 Ga0070675_10000007822 190
571 3300005354 Ga0070675_100226255 Ga0070675_1002262551 190
572 3300005365 Ga0070688_100000705 Ga0070688_10000070516 190
573 3300005365 Ga0070688_100000989 Ga0070688_1000009899 190
574 3300005366 Ga0070659_100030992 Ga0070659_1000309922 190
575 3300005435 Ga0070714_100770019 Ga0070714_1007700192 190
576 3300005436 Ga0070713_100000005 Ga0070713_100000005215 190
577 3300005444 Ga0070694_100466781 Ga0070694_1004667812 190
578 3300005455 Ga0070663_100583445 Ga0070663_1005834452 190
579 3300005455 Ga0070663_100708643 Ga0070663_1007086431 190
580 3300005458 Ga0070681_10111778 Ga0070681_101117785 190
581 3300005459 Ga0068867_100000278 Ga0068867_10000027836 190
582 3300005466 Ga0070685_10000012 Ga0070685_1000001230 190
583 3300005466 Ga0070685_10001134 Ga0070685_100011349 190
584 3300005530 Ga0070679_100011522 Ga0070679_1000115227 190
585 3300005535 Ga0070684_100010265 Ga0070684_1000102653 190
586 3300005535 Ga0070684_100060185 Ga0070684_1000601854 190
587 3300005535 Ga0070684_100086257 Ga0070684_1000862573 190
588 3300005535 Ga0070684_100128128 Ga0070684_1001281283 190
589 3300005539 Ga0068853_100304048 Ga0068853_1003040482 190
590 3300005548 Ga0070665_100000604 Ga0070665_1000006049 190
591 3300005563 Ga0068855_100316178 Ga0068855_1003161784 190
592 3300005564 Ga0070664_100022449 Ga0070664_1000224494 190
593 3300005577 Ga0068857_100131984 Ga0068857_1001319841 190
594 3300005578 Ga0068854_100000062 Ga0068854_10000006238 190
595 3300005578 Ga0068854_100322363 Ga0068854_1003223632 190
596 3300005614 Ga0068856_100000377 Ga0068856_10000037739 190
597 3300005614 Ga0068856_100007632 Ga0068856_10000763215 190
598 3300005614 Ga0068856_100028080 Ga0068856_1000280807 190
599 3300005616 Ga0068852_100000022 Ga0068852_100000022106 190
600 3300005616 Ga0068852_100556184 Ga0068852_1005561843 190
601 3300005718 Ga0068866_10172042 Ga0068866_101720422 190
602 3300005719 Ga0068861_100315762 Ga0068861_1003157622 190
603 3300005834 Ga0068851_10000297 Ga0068851_1000029714 190
604 3300005834 Ga0068851_10024779 Ga0068851_100247792 190
605 3300005841 Ga0068863_100000032 Ga0068863_10000003246 190
606 3300005841 Ga0068863_100021805 Ga0068863_1000218056 190
607 3300005842 Ga0068858_100000343 Ga0068858_1000003439 190
608 3300005937 Ga0081455_10269259 Ga0081455_102692592 190
609 3300005981 Ga0081538_10002916 Ga0081538_1000291613 190
610 3300005981 Ga0081538_10008690 Ga0081538_100086904 190
611 3300005981 Ga0081538_10134014 Ga0081538_101340142 190
612 3300005981 Ga0081538_10165413 Ga0081538_101654132 190
613 3300005983 Ga0081540_1084274 Ga0081540_10842742 190
614 3300005985 Ga0081539_10074225 Ga0081539_100742253 190
615 3300006038 Ga0075365_10000884 Ga0075365_1000088410 190
616 3300006175 Ga0070712_100007920 Ga0070712_1000079205 190
617 3300006237 Ga0097621_100549664 Ga0097621_1005496641 190
618 3300006844 Ga0075428_100130007 Ga0075428_1001300072 190
619 3300006852 Ga0075433_10431955 Ga0075433_104319552 190
620 3300006881 Ga0068865_100000135 Ga0068865_10000013533 190
621 3300007076 Ga0075435_100655607 Ga0075435_1006556072 190
622 3300009094 Ga0111539_10069371 Ga0111539_100693713 190
623 3300009098 Ga0105245_10000022 Ga0105245_10000022151 190
624 3300009098 Ga0105245_10000023 Ga0105245_1000002326 190
625 3300009098 Ga0105245_10004839 Ga0105245_1000483914 190
626 3300009147 Ga0114129_10229197 Ga0114129_102291973 190
627 3300009148 Ga0105243_10046939 Ga0105243_100469394 190
628 3300009148 Ga0105243_10280006 Ga0105243_102800062 190
629 3300009174 Ga0105241_10040715 Ga0105241_100407152 190
630 3300009177 Ga0105248_10000245 Ga0105248_1000024550 190
631 3300009177 Ga0105248_11588538 Ga0105248_115885381 190
632 3300009551 Ga0105238_10000028 Ga0105238_10000028137 190
633 3300009553 Ga0105249_10000181 Ga0105249_1000018155 190
634 3300009553 Ga0105249_10308920 Ga0105249_103089202 190
635 3300010375 Ga0105239_10048810 Ga0105239_100488102 190
636 3300010375 Ga0105239_10133333 Ga0105239_101333332 190
637 3300013052 Ga0154014_151005 Ga0154014_1510052 190
638 3300013100 Ga0157373_10089132 Ga0157373_100891321 190
639 3300013102 Ga0157371_10004879 Ga0157371_1000487911 190
640 3300013104 Ga0157370_10002276 Ga0157370_1000227615 190
641 3300013104 Ga0157370_10003533 Ga0157370_1000353314 190
642 3300013104 Ga0157370_10135255 Ga0157370_101352552 190
643 3300013105 Ga0157369_10000014 Ga0157369_10000014201 190
644 3300013296 Ga0157374_10001500 Ga0157374_1000150023 190
645 3300013296 Ga0157374_10088252 Ga0157374_100882522 190
646 3300013297 Ga0157378_10001375 Ga0157378_1000137515 190
647 3300013307 Ga0157372_10000550 Ga0157372_1000055037 190
648 3300013308 Ga0157375_10000127 Ga0157375_1000012772 190
649 3300013308 Ga0157375_10000765 Ga0157375_1000076527 190
650 3300013308 Ga0157375_10096174 Ga0157375_100961742 190
651 3300014325 Ga0163163_10050696 Ga0163163_100506962 190
652 3300014326 Ga0157380_10361637 Ga0157380_103616372 190
653 3300014745 Ga0157377_10344517 Ga0157377_103445172 190
654 3300014968 Ga0157379_10005332 Ga0157379_100053329 190
655 3300014968 Ga0157379_10459290 Ga0157379_104592902 190
656 3300017792 Ga0163161_10000013 Ga0163161_10000013204 190
657 3300017792 Ga0163161_10263457 Ga0163161_102634572 190
658 3300017792 Ga0163161_10997194 Ga0163161_109971941 190
659 3300020069 Ga0197907_10308920 Ga0197907_103089202 190
660 3300020069 Ga0197907_11146121 Ga0197907_111461214 190
661 3300020070 Ga0206356_10943150 Ga0206356_109431503 190
662 3300020070 Ga0206356_11357271 Ga0206356_113572711 190
663 3300020070 Ga0206356_11573056 Ga0206356_115730561 190
664 3300020070 Ga0206356_11861396 Ga0206356_118613963 190
665 3300020075 Ga0206349_1042634 Ga0206349_10426341 190
666 3300020075 Ga0206349_1144720 Ga0206349_11447201 190
667 3300020075 Ga0206349_1166632 Ga0206349_11666321 190
668 3300020075 Ga0206349_1866038 Ga0206349_18660381 190
669 3300020076 Ga0206355_1701321 Ga0206355_17013211 190
670 3300020078 Ga0206352_10098428 Ga0206352_100984283 190
671 3300020080 Ga0206350_10519099 Ga0206350_105190991 190
672 3300020080 Ga0206350_10662425 Ga0206350_106624251 190
673 3300020081 Ga0206354_11397997 Ga0206354_113979971 190
674 3300020081 Ga0206354_11539976 Ga0206354_115399761 190
675 3300020082 Ga0206353_11205913 Ga0206353_112059133 190
676 3300020082 Ga0206353_11695836 Ga0206353_116958361 190
677 3300022467 Ga0224712_10016960 Ga0224712_100169605 190
678 3300022467 Ga0224712_10203642 Ga0224712_102036422 190
679 3300025321 Ga0207656_10000084 Ga0207656_1000008415 190
680 3300025321 Ga0207656_10012836 Ga0207656_100128362 190
681 3300025893 Ga0207682_10000327 Ga0207682_1000032719 190
682 3300025907 Ga0207645_10266828 Ga0207645_102668282 190
683 3300025911 Ga0207654_10024265 Ga0207654_100242652 190
684 3300025912 Ga0207707_10088518 Ga0207707_100885185 190
685 3300025913 Ga0207695_10188864 Ga0207695_101888642 190
686 3300025915 Ga0207693_10036252 Ga0207693_100362523 190
687 3300025917 Ga0207660_10008879 Ga0207660_100088797 190
688 3300025920 Ga0207649_10000003 Ga0207649_10000003199 190
689 3300025921 Ga0207652_10008003 Ga0207652_100080037 190
690 3300025924 Ga0207694_10000008 Ga0207694_10000008424 190
691 3300025925 Ga0207650_10584826 Ga0207650_105848261 190
692 3300025926 Ga0207659_10000018 Ga0207659_10000018116 190
693 3300025927 Ga0207687_10000015 Ga0207687_10000015155 190
694 3300025927 Ga0207687_10000039 Ga0207687_1000003982 190
695 3300025927 Ga0207687_10007940 Ga0207687_100079408 190
696 3300025928 Ga0207700_10000003 Ga0207700_10000003404 190
697 3300025929 Ga0207664_10600991 Ga0207664_106009912 190
698 3300025932 Ga0207690_10007587 Ga0207690_100075876 190
699 3300025932 Ga0207690_10193428 Ga0207690_101934283 190
700 3300025935 Ga0207709_10097972 Ga0207709_100979723 190
701 3300025935 Ga0207709_10114728 Ga0207709_101147282 190
702 3300025936 Ga0207670_10093933 Ga0207670_100939333 190
703 3300025938 Ga0207704_10000026 Ga0207704_1000002673 190
704 3300025940 Ga0207691_10078513 Ga0207691_100785135 190
705 3300025941 Ga0207711_10000192 Ga0207711_1000019250 190
706 3300025941 Ga0207711_11060061 Ga0207711_110600611 190
707 3300025944 Ga0207661_10000235 Ga0207661_1000023526 190
708 3300025944 Ga0207661_10000247 Ga0207661_1000024726 190
709 3300025944 Ga0207661_10001056 Ga0207661_1000105615 190
710 3300025944 Ga0207661_10313874 Ga0207661_103138743 190
711 3300025945 Ga0207679_10014783 Ga0207679_100147834 190
712 3300025961 Ga0207712_10000067 Ga0207712_1000006791 190
713 3300025961 Ga0207712_10706224 Ga0207712_107062241 190
714 3300025972 Ga0207668_10013940 Ga0207668_100139407 190
715 3300025981 Ga0207640_10000074 Ga0207640_1000007438 190
716 3300025981 Ga0207640_10220445 Ga0207640_102204452 190
717 3300026023 Ga0207677_10000308 Ga0207677_1000030830 190
718 3300026023 Ga0207677_10000534 Ga0207677_100005343 190
719 3300026035 Ga0207703_10004225 Ga0207703_100042259 190
720 3300026041 Ga0207639_10007308 Ga0207639_100073081 190
721 3300026041 Ga0207639_10034486 Ga0207639_100344865 190
722 3300026041 Ga0207639_10090967 Ga0207639_100909672 190
723 3300026067 Ga0207678_10438116 Ga0207678_104381162 190
724 3300026075 Ga0207708_10001934 Ga0207708_100019345 190
725 3300026078 Ga0207702_10000085 Ga0207702_1000008550 190
726 3300026078 Ga0207702_10002252 Ga0207702_1000225217 190
727 3300026078 Ga0207702_10030239 Ga0207702_100302393 190
728 3300026088 Ga0207641_10000071 Ga0207641_1000007147 190
729 3300026088 Ga0207641_10016922 Ga0207641_100169225 190
730 3300026088 Ga0207641_10791072 Ga0207641_107910721 190
731 3300026089 Ga0207648_10000630 Ga0207648_100006302 190
732 3300026118 Ga0207675_100006762 Ga0207675_10000676210 190
733 3300026118 Ga0207675_100343729 Ga0207675_1003437292 190
734 3300026121 Ga0207683_10044763 Ga0207683_100447634 190
735 3300026142 Ga0207698_10000043 Ga0207698_1000004319 190
736 3300027907 Ga0207428_10007997 Ga0207428_100079977 190
737 3300028379 Ga0268266_10000020 Ga0268266_10000020516 190
738 3300028380 Ga0268265_10176211 Ga0268265_101762113 190
739 3300028381 Ga0268264_10025099 Ga0268264_100250992 190
740 3300028381 Ga0268264_11331960 Ga0268264_113319601 190
741 3300028563 Ga0265319_1000035 Ga0265319_100003557 190
742 3300028573 Ga0265334_10103940 Ga0265334_101039402 190
743 3300028800 Ga0265338_10000171 Ga0265338_1000017160 190
744 3300030521 Ga0307511_10041190 Ga0307511_100411905 190
745 3300031241 Ga0265325_10027704 Ga0265325_100277043 190
746 3300031344 Ga0265316_10367578 Ga0265316_103675781 190
747 3300031548 Ga0307408_100719889 Ga0307408_1007198891 190
748 3300032002 Ga0307416_100189500 Ga0307416_1001895002 190
749 3300032005 Ga0307411_10898499 Ga0307411_108984991 190
750 3300032126 Ga0307415_100155804 Ga0307415_1001558042 190
751 3300036401 Ga0373937_0033761 Ga0373937_0033761_2215_2799 190
752 3300036401 Ga0373937_0091159 Ga0373937_0091159_1523_2191 190
753 3300037466 Ga0395898_0524336 Ga0395898_0524336_211_789 190
754 3300037471 Ga0395905_0439532 Ga0395905_0439532_19_597 190
755 3300038443 Ga0395901_0028426 Ga0395901_0028426_2770_3354 190
756 3300038443 Ga0395901_0405552 Ga0395901_0405552_808_1389 190
757 3300041459 Ga0451800_0120947 Ga0451800_0120947_258_839 190
758 3300041486 Ga0451807_2744985 Ga0451807_2744985_232_813 190
759 3300041512 Ga0451853_1789901 Ga0451853_1789901_62_643 190
760 3300041512 Ga0451853_3323498 Ga0451853_3323498_393_965 190
761 3300044656 Ga0466969_0106065 Ga0466969_0106065_635_1210 190
762 3300044658 Ga0466972_0157187 Ga0466972_0157187_246_824 190
763 3300044683 Ga0466965_0120059 Ga0466965_0120059_307_882 190
764 3300044683 Ga0466965_0198880 Ga0466965_0198880_211_789 190
765 3300044694 Ga0466963_0000274 Ga0466963_0000274_8019_8597 190
766 3300044694 Ga0466963_0015396 Ga0466963_0015396_2029_2610 190
767 3300044842 Ga0466957_0002465 Ga0466957_0002465_1950_2531 190
768 3300044901 Ga0466960_0221998 Ga0466960_0221998_388_975 190
769 3300045049 Ga0466959_0096876 Ga0466959_0096876_417_992 190
770 3300045976 Ga0466967_0000199 Ga0466967_0000199_20057_20638 190
771 3300045976 Ga0466967_0200430 Ga0466967_0200430_140_718 190
772 3300046454 Ga0495592_0001677 Ga0495592_0001677_11497_12081 190
773 3300046454 Ga0495592_0156179 Ga0495592_0156179_350_934 190
774 3300046455 Ga0495603_0004130 Ga0495603_0004130_3605_4189 190
775 3300046459 Ga0495629_0001345 Ga0495629_0001345_3356_3940 190
776 3300046459 Ga0495629_0019045 Ga0495629_0019045_2588_3169 190
777 3300046461 Ga0495641_0000001 Ga0495641_0000001_390793_391377 190
778 3300046461 Ga0495641_0100097 Ga0495641_0100097_650_1234 190
779 3300046463 Ga0495653_0113273 Ga0495653_0113273_1292_1876 190
780 3300046475 Ga0495639_0018661 Ga0495639_0018661_2383_2964 190
781 3300046476 Ga0495662_0000043 Ga0495662_0000043_9713_10297 190
782 3300046511 Ga0495608_0000035 Ga0495608_0000035_72920_73501 190
783 3300046511 Ga0495608_0000184 Ga0495608_0000184_23963_24550 190
784 3300046514 Ga0495618_0000072 Ga0495618_0000072_58539_59123 190
785 3300046515 Ga0495620_0002270 Ga0495620_0002270_3984_4574 190
786 3300046516 Ga0495628_0047930 Ga0495628_0047930_1426_2010 190
787 3300046516 Ga0495628_0143147 Ga0495628_0143147_520_1104 190
788 3300046517 Ga0495630_0000007 Ga0495630_0000007_278073_278657 190
789 3300046517 Ga0495630_0008497 Ga0495630_0008497_2922_3506 190
790 3300046523 Ga0495644_0000618 Ga0495644_0000618_6511_7095 190
791 3300046536 Ga0495587_0501554 Ga0495587_0501554_64_645 190
792 3300046675 Ga0495657_0000026 Ga0495657_0000026_59511_60092 190
793 3300046675 Ga0495657_0002934 Ga0495657_0002934_7486_8070 190
794 3300046678 Ga0495599_0081169 Ga0495599_0081169_852_1436 190
795 3300046679 Ga0495623_0114912 Ga0495623_0114912_708_1292 190
796 3300046681 Ga0495647_0001511 Ga0495647_0001511_1449_2033 190
797 3300046683 Ga0495658_0001081 Ga0495658_0001081_8259_8840 190
798 3300046684 Ga0495669_0001240 Ga0495669_0001240_6876_7460 190
799 3300046689 Ga0495613_0000083 Ga0495613_0000083_79169_79753 190
800 3300046689 Ga0495613_0170409 Ga0495613_0170409_573_1157 190
801 3300046690 Ga0495624_0000028 Ga0495624_0000028_43175_43759 190
802 3300046694 Ga0495649_0006233 Ga0495649_0006233_3293_3874 190
803 3300046809 Ga0495600_0000634 Ga0495600_0000634_10286_10870 190
804 3300046809 Ga0495600_0059109 Ga0495600_0059109_1896_2480 190
805 3300047315 Ga0495581_0495493 Ga0495581_0495493_52_636 190
806 3300047317 Ga0495604_0080501 Ga0495604_0080501_1217_1795 190
807 3300047317 Ga0495604_0215730 Ga0495604_0215730_113_697 190
808 3300047321 Ga0495676_0057014 Ga0495676_0057014_1425_2006 190
809 3300047321 Ga0495676_0084493 Ga0495676_0084493_564_1148 190
810 3300047444 Ga0495675_0000015 Ga0495675_0000015_59504_60085 190
811 3300047447 Ga0495685_010679 Ga0495685_010679_1517_2101 190
812 3300047673 Ga0495593_0035395 Ga0495593_0035395_1893_2474 190
813 3300048088 Ga0495602_0000041 Ga0495602_0000041_51773_52351 190
814 3300048903 Ga0496100_0000005 Ga0496100_0000005_249528_250100 190
815 3300048903 Ga0496100_0000049 Ga0496100_0000049_9518_10102 190
816 3300048904 Ga0496101_0000010 Ga0496101_0000010_90458_91042 190
817 3300048904 Ga0496101_0000101 Ga0496101_0000101_80954_81526 190
818 3300048907 Ga0496104_0000003 Ga0496104_0000003_594384_594968 190
819 3300048907 Ga0496104_0011315 Ga0496104_0011315_4838_5422 190
820 3300048908 Ga0496105_0000003 Ga0496105_0000003_591153_591737 190
821 3300048908 Ga0496105_0043980 Ga0496105_0043980_1377_1961 190
822 3300048909 Ga0496106_0000013 Ga0496106_0000013_134445_135029 190
823 3300048909 Ga0496106_0000554 Ga0496106_0000554_8842_9426 190
824 3300048909 Ga0496106_0001085 Ga0496106_0001085_7838_8410 190
825 3300048910 Ga0496107_0000011 Ga0496107_0000011_61783_62355 190
826 3300048910 Ga0496107_0000032 Ga0496107_0000032_8855_9439 190
827 3300048911 Ga0496108_0000004 Ga0496108_0000004_103347_103922 190
828 3300048911 Ga0496108_0000005 Ga0496108_0000005_187346_187927 190
829 3300048911 Ga0496108_0000383 Ga0496108_0000383_24300_24893 190
830 3300048912 Ga0496109_0000002 Ga0496109_0000002_347165_347746 190
831 3300048912 Ga0496109_0000036 Ga0496109_0000036_50052_50627 190
832 3300048912 Ga0496109_0000365 Ga0496109_0000365_32184_32777 190
833 3300048912 Ga0496109_0013316 Ga0496109_0013316_6081_6662 190
834 3300048912 Ga0496109_0201552 Ga0496109_0201552_1166_1753 190
835 3300048912 Ga0496109_0337214 Ga0496109_0337214_226_810 190
836 3300048913 Ga0496110_0005716 Ga0496110_0005716_5357_5944 190
837 3300048913 Ga0496110_0067135 Ga0496110_0067135_1341_1916 190
838 3300048914 Ga0496111_0006969 Ga0496111_0006969_3109_3696 190
839 3300048914 Ga0496111_0058756 Ga0496111_0058756_764_1339 190
840 3300048915 Ga0496112_0000006 Ga0496112_0000006_200107_200691 190
841 3300048915 Ga0496112_0389642 Ga0496112_0389642_342_929 190
842 3300048917 Ga0496114_0184654 Ga0496114_0184654_973_1548 190
843 3300048918 Ga0496115_0034307 Ga0496115_0034307_2702_3283 190
844 3300048924 Ga0496121_0201715 Ga0496121_0201715_290_892 190
845 3300048928 Ga0496125_0040716 Ga0496125_0040716_3064_3639 190
846 3300049568 Ga0501031_0118196 Ga0501031_0118196_522_1094 190
847 3300049569 Ga0501032_0243262 Ga0501032_0243262_469_1041 190
848 3300049571 Ga0501034_0005460 Ga0501034_0005460_3777_4376 190
849 3300049572 Ga0501036_0986755 Ga0501036_0986755_20_598 190
850 3300049575 Ga0501039_0010474 Ga0501039_0010474_3862_4434 190
851 3300049576 Ga0501040_0087454 Ga0501040_0087454_540_1112 190
852 3300049578 Ga0501042_0032510 Ga0501042_0032510_966_1547 190
853 3300049578 Ga0501042_0325357 Ga0501042_0325357_158_730 190
854 3300049586 Ga0501070_0040260 Ga0501070_0040260_1906_2478 190
855 3300049592 Ga0501076_0409517 Ga0501076_0409517_395_985 190
856 3300049744 Ga0501083_0038464 Ga0501083_0038464_1320_1898 190
857 3300049824 Ga0501045_0092816 Ga0501045_0092816_169_768 190
858 3300050490 nmdc:mga03n38_367087_c1 nmdc:mga03n38_367087_c1_196_774 190
859 3300050492 nmdc:mga0yw44_265577_c1 nmdc:mga0yw44_265577_c1_28_612 190
860 3300050507 nmdc:mga05p37_144245_c1 nmdc:mga05p37_144245_c1_936_1520 190
861 3300050509 nmdc:mga0qj67_610351_c1 nmdc:mga0qj67_610351_c1_60_644 190
862 3300050511 nmdc:mga08y16_66134_c1 nmdc:mga08y16_66134_c1_1653_2237 190
863 3300053077 Ga0495601_0014155 Ga0495601_0014155_1157_1741 190
864 3300053078 Ga0495612_0001358 Ga0495612_0001358_2470_3045 190
865 3300053078 Ga0495612_0002321 Ga0495612_0002321_2235_2819 190
866 3300053084 Ga0495595_0000017 Ga0495595_0000017_59511_60092 190
867 3300053084 Ga0495595_0005801 Ga0495595_0005801_2075_2653 190
868 3300053085 Ga0495619_0000054 Ga0495619_0000054_69417_69995 190
869 3300053085 Ga0495619_0000101 Ga0495619_0000101_59511_60092 190
870 3300053085 Ga0495619_0022877 Ga0495619_0022877_611_1195 190
871 3300053094 Ga0500566_0000572 Ga0500566_0000572_3554_4138 190
872 3300053096 Ga0500641_0005057 Ga0500641_0005057_3567_4151 190
873 3300053123 Ga0500614_001780 Ga0500614_001780_525_1109 190
874 3300054114 Ga0501084_0306131 Ga0501084_0306131_642_1214 190
875 3300054114 Ga0501084_1015117 Ga0501084_1015117_99_680 190
876 3300061734 Ga0530510_0529558 Ga0530510_0529558_210_791 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

37

206

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9854 7 177
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9828 9 176
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9825 9 176
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9811 9 177
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.9804 5 189
ID Description Score Start End Superfamily
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9825 9 176 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9785 5 189 3.40.50.880
3fseB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9701 7 176 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9619 7 177 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9576 5 189 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A6N9YJY4-F1-model_v4 Type 1 glutamine amidotransferase 1 2 183 GO:0016740
AF-A0A6N7Z6T4-F1-model_v4 DJ-1/PfpI/YhbO family deglycase/protease 1 3 186 GO:0006508
GO:0008233
AF-A0A7V9QL38-F1-model_v4 DJ-1/PfpI family protein 1 89 189
AF-A0A7K2MGU3-F1-model_v4 Protease 0.9999 9 148 GO:0006508
GO:0008233
AF-A0A4Q5YZT0-F1-model_v4 deleted 0.9996 2 99

Feature Viewer

pLDDT pTM Quality
97.01 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map