F484314
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 874 | 308 | 871 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300049705|Ga0501225_0000782|Ga0501225_0000782_5464_6594 |
| Length | 376 |
| Sequence | MPPKIGKTAIEVTLNVQELYDLFIHDASDKFDSKDFVSPALLHQKCAYMKKIGILFGRERTFPMAFIERVNSRNTPGVIAEPVHIDKVIQGAPIEYDVIIDRISHDVPFYRSFLKNAAICGTAVINNPFWGSADEKFFNNCLAVRIGVPVPKTVILPSYDMPAETSAESFANLAWPLDWENIFNYVGFPAYMKPFAGGGWKNVYKLHNKEEFFQNHKETGQLVMLLQEEIAFEEYYRCYCIGGKYVHIMPYEPRNPHHLRYSNDFHPTPDRIHQMEEIVCRLNQYLGYDFNSVELAIRDGVPYAIDFCNPVPDADRPSIGDDNFDWVVDTAATYAIERALTHKAGLDNLTWGEFTKRSLNRAPMGEIMNEALEVEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 3 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 181 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 212 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 215 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 253 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 271 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 272 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 277 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 278 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 279 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 280 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 281 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 282 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 289 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 305 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 307 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 308 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.31 |
| Metatranscriptomes | 0.34 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.37 |
| Nodule | 0 |
| Rhizoplane | 0.46 |
| Rhizosphere | 95.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000523 | 3300002459 | Bacteria | 10988 |
| 2 | JGI25406J46586_10042359 | 3300003203 | Bacteria | 1595 |
| 3 | rootH2_10008717 | 3300003320 | Bacteria | 23143 |
| 4 | rootH2_10009544 | 3300003320 | Bacteria | 42409 |
| 5 | rootH2_10016843 | 3300003320 | Bacteria | 2304 |
| 6 | rootH2_10043528 | 3300003320 | Bacteria | 2264 |
| 7 | rootL2_10048659 | 3300003322 | Bacteria | 7441 |
| 8 | rootL2_10049027 | 3300003322 | Bacteria | 12495 |
| 9 | rootH1_10027473 | 3300003323 | Bacteria | 20275 |
| 10 | JGI25160J50197_1000391 | 3300003354 | Bacteria | 28395 |
| 11 | Ga0058863_11897022 | 3300004799 | Bacteria | 1432 |
| 12 | Ga0058862_10028396 | 3300004803 | Bacteria | 1771 |
| 13 | Ga0065714_10008149 | 3300005288 | Bacteria | 3272 |
| 14 | Ga0065704_10001598 | 3300005289 | Bacteria | 9936 |
| 15 | Ga0065712_10005043 | 3300005290 | Bacteria | 3012 |
| 16 | Ga0065712_10005395 | 3300005290 | Bacteria | 3367 |
| 17 | Ga0065712_10084305 | 3300005290 | Bacteria | 2774 |
| 18 | Ga0065712_10087336 | 3300005290 | Bacteria | 2583 |
| 19 | Ga0065715_10170227 | 3300005293 | Bacteria | 1553 |
| 20 | Ga0065707_10005338 | 3300005295 | Bacteria | 3494 |
| 21 | Ga0070658_10006339 | 3300005327 | Bacteria | 9587 |
| 22 | Ga0070658_10009081 | 3300005327 | Bacteria | 7996 |
| 23 | Ga0070658_10091759 | 3300005327 | Bacteria | 2503 |
| 24 | Ga0070658_10168037 | 3300005327 | Bacteria | 1842 |
| 25 | Ga0070676_10000103 | 3300005328 | Bacteria | 30434 |
| 26 | Ga0070676_10236260 | 3300005328 | Bacteria | 1214 |
| 27 | Ga0070683_100002537 | 3300005329 | Bacteria | 14576 |
| 28 | Ga0070683_100013464 | 3300005329 | Bacteria | 7134 |
| 29 | Ga0070683_100021425 | 3300005329 | Bacteria | 5769 |
| 30 | Ga0070690_100011893 | 3300005330 | Bacteria | 5108 |
| 31 | Ga0070670_100042984 | 3300005331 | Bacteria | 3885 |
| 32 | Ga0070670_100044182 | 3300005331 | Bacteria | 3831 |
| 33 | Ga0070670_100077802 | 3300005331 | Bacteria | 2850 |
| 34 | Ga0070670_100189196 | 3300005331 | Bacteria | 1788 |
| 35 | Ga0070677_10023834 | 3300005333 | Bacteria | 2270 |
| 36 | Ga0068869_100026133 | 3300005334 | Bacteria | 4061 |
| 37 | Ga0068869_100116676 | 3300005334 | Unclassified | 2037 |
| 38 | Ga0070666_10000043 | 3300005335 | Bacteria | 111402 |
| 39 | Ga0070666_10008965 | 3300005335 | Bacteria | 6227 |
| 40 | Ga0070666_10010785 | 3300005335 | Bacteria | 5719 |
| 41 | Ga0070666_10214398 | 3300005335 | Bacteria | 1357 |
| 42 | Ga0070680_100001109 | 3300005336 | Bacteria | 19331 |
| 43 | Ga0070680_100139397 | 3300005336 | Bacteria | 2033 |
| 44 | Ga0070682_100001222 | 3300005337 | Bacteria | 14625 |
| 45 | Ga0070682_100163862 | 3300005337 | Bacteria | 1538 |
| 46 | Ga0068868_100000358 | 3300005338 | Bacteria | 30970 |
| 47 | Ga0068868_100010933 | 3300005338 | Bacteria | 6589 |
| 48 | Ga0068868_100023528 | 3300005338 | Bacteria | 4663 |
| 49 | Ga0068868_100035794 | 3300005338 | Bacteria | 3839 |
| 50 | Ga0068868_100084289 | 3300005338 | Bacteria | 2552 |
| 51 | Ga0068868_100113611 | 3300005338 | Bacteria | 2202 |
| 52 | Ga0068868_100156118 | 3300005338 | Bacteria | 1882 |
| 53 | Ga0068868_100228677 | 3300005338 | Bacteria | 1560 |
| 54 | Ga0070660_100110434 | 3300005339 | Bacteria | 2187 |
| 55 | Ga0070660_100154298 | 3300005339 | Bacteria | 1848 |
| 56 | Ga0070660_100157651 | 3300005339 | Bacteria | 1828 |
| 57 | Ga0070689_100013710 | 3300005340 | Bacteria | 5872 |
| 58 | Ga0070689_100054252 | 3300005340 | Bacteria | 3102 |
| 59 | Ga0070689_100177674 | 3300005340 | Bacteria | 1727 |
| 60 | Ga0070689_100230095 | 3300005340 | Bacteria | 1524 |
| 61 | Ga0070691_10011704 | 3300005341 | Bacteria | 4012 |
| 62 | Ga0070687_100066040 | 3300005343 | Bacteria | 1926 |
| 63 | Ga0070661_100003722 | 3300005344 | Bacteria | 10511 |
| 64 | Ga0070661_100291045 | 3300005344 | Bacteria | 1269 |
| 65 | Ga0070692_10255199 | 3300005345 | Bacteria | 1052 |
| 66 | Ga0070668_100000308 | 3300005347 | Bacteria | 32201 |
| 67 | Ga0070668_100124154 | 3300005347 | Bacteria | 2067 |
| 68 | Ga0070668_100216686 | 3300005347 | Unclassified | 1577 |
| 69 | Ga0070668_100426451 | 3300005347 | Bacteria | 1136 |
| 70 | Ga0070669_100082384 | 3300005353 | Bacteria | 2398 |
| 71 | Ga0070675_100019600 | 3300005354 | Bacteria | 5392 |
| 72 | Ga0070675_100022363 | 3300005354 | Bacteria | 5052 |
| 73 | Ga0070675_100060036 | 3300005354 | Bacteria | 3139 |
| 74 | Ga0070675_100338717 | 3300005354 | Bacteria | 1332 |
| 75 | Ga0070671_100008263 | 3300005355 | Bacteria | 8331 |
| 76 | Ga0070671_100065974 | 3300005355 | Bacteria | 3016 |
| 77 | Ga0070671_100099251 | 3300005355 | Bacteria | 2442 |
| 78 | Ga0070671_100162476 | 3300005355 | Bacteria | 1888 |
| 79 | Ga0070674_100015249 | 3300005356 | Bacteria | 4794 |
| 80 | Ga0070674_100133037 | 3300005356 | Bacteria | 1857 |
| 81 | Ga0070673_100000232 | 3300005364 | Bacteria | 27904 |
| 82 | Ga0070673_100015106 | 3300005364 | Bacteria | 5408 |
| 83 | Ga0070673_100030266 | 3300005364 | Bacteria | 4048 |
| 84 | Ga0070673_100039411 | 3300005364 | Bacteria | 3615 |
| 85 | Ga0070673_100165717 | 3300005364 | Bacteria | 1882 |
| 86 | Ga0070673_100321580 | 3300005364 | Bacteria | 1367 |
| 87 | Ga0070688_100002313 | 3300005365 | Bacteria | 9629 |
| 88 | Ga0070688_100013129 | 3300005365 | Bacteria | 4663 |
| 89 | Ga0070688_100041662 | 3300005365 | Bacteria | 2820 |
| 90 | Ga0070659_100003286 | 3300005366 | Bacteria | 11507 |
| 91 | Ga0070659_100026117 | 3300005366 | Bacteria | 4492 |
| 92 | Ga0070659_100339075 | 3300005366 | Bacteria | 1259 |
| 93 | Ga0070667_100000583 | 3300005367 | Bacteria | 36093 |
| 94 | Ga0070667_100008582 | 3300005367 | Bacteria | 8469 |
| 95 | Ga0070667_100062669 | 3300005367 | Bacteria | 3150 |
| 96 | Ga0070667_100154928 | 3300005367 | Bacteria | 2015 |
| 97 | Ga0070667_100170495 | 3300005367 | Bacteria | 1921 |
| 98 | Ga0070667_100304283 | 3300005367 | Bacteria | 1436 |
| 99 | Ga0070709_10000005 | 3300005434 | Bacteria | 197619 |
| 100 | Ga0070663_100091453 | 3300005455 | Bacteria | 2255 |
| 101 | Ga0070663_100225988 | 3300005455 | Bacteria | 1472 |
| 102 | Ga0070663_100244775 | 3300005455 | Bacteria | 1417 |
| 103 | Ga0070663_100313151 | 3300005455 | Bacteria | 1260 |
| 104 | Ga0070678_100279444 | 3300005456 | Bacteria | 1411 |
| 105 | Ga0070662_100003591 | 3300005457 | Bacteria | 9675 |
| 106 | Ga0070662_100004745 | 3300005457 | Bacteria | 8615 |
| 107 | Ga0070681_10005409 | 3300005458 | Bacteria | 12333 |
| 108 | Ga0070681_10044327 | 3300005458 | Bacteria | 4452 |
| 109 | Ga0070681_10046320 | 3300005458 | Bacteria | 4348 |
| 110 | Ga0070681_10066331 | 3300005458 | Bacteria | 3578 |
| 111 | Ga0070681_10074154 | 3300005458 | Bacteria | 3364 |
| 112 | Ga0068867_100018459 | 3300005459 | Bacteria | 4959 |
| 113 | Ga0068867_100026320 | 3300005459 | Bacteria | 4176 |
| 114 | Ga0068867_100060080 | 3300005459 | Bacteria | 2819 |
| 115 | Ga0068867_100075190 | 3300005459 | Bacteria | 2533 |
| 116 | Ga0068867_100078110 | 3300005459 | Bacteria | 2489 |
| 117 | Ga0068867_100133897 | 3300005459 | Bacteria | 1929 |
| 118 | Ga0068867_100219902 | 3300005459 | Bacteria | 1530 |
| 119 | Ga0070685_10002988 | 3300005466 | Bacteria | 8636 |
| 120 | Ga0070685_10004337 | 3300005466 | Bacteria | 7160 |
| 121 | Ga0070685_10010428 | 3300005466 | Bacteria | 4828 |
| 122 | Ga0070698_100000866 | 3300005471 | Bacteria | 33282 |
| 123 | Ga0070698_100003054 | 3300005471 | Bacteria | 18451 |
| 124 | Ga0070698_100389607 | 3300005471 | Bacteria | 1326 |
| 125 | Ga0070679_100010138 | 3300005530 | Bacteria | 8933 |
| 126 | Ga0070679_100031280 | 3300005530 | Bacteria | 5257 |
| 127 | Ga0070679_100104310 | 3300005530 | Bacteria | 2821 |
| 128 | Ga0070684_100008118 | 3300005535 | Bacteria | 8194 |
| 129 | Ga0070684_100010258 | 3300005535 | Bacteria | 7416 |
| 130 | Ga0070684_100011702 | 3300005535 | Bacteria | 6996 |
| 131 | Ga0070684_100218736 | 3300005535 | Bacteria | 1738 |
| 132 | Ga0068853_100000097 | 3300005539 | Bacteria | 59626 |
| 133 | Ga0068853_100000501 | 3300005539 | Bacteria | 26843 |
| 134 | Ga0068853_100014007 | 3300005539 | Bacteria | 6562 |
| 135 | Ga0068853_100030060 | 3300005539 | Bacteria | 4586 |
| 136 | Ga0068853_100236061 | 3300005539 | Bacteria | 1674 |
| 137 | Ga0068853_100512523 | 3300005539 | Bacteria | 1133 |
| 138 | Ga0070672_100000345 | 3300005543 | Bacteria | 26753 |
| 139 | Ga0070672_100216034 | 3300005543 | Bacteria | 1607 |
| 140 | Ga0070686_100183996 | 3300005544 | Bacteria | 1487 |
| 141 | Ga0070665_100000041 | 3300005548 | Bacteria | 297849 |
| 142 | Ga0070665_100001618 | 3300005548 | Bacteria | 25934 |
| 143 | Ga0070665_100707618 | 3300005548 | Bacteria | 1020 |
| 144 | Ga0068855_100000704 | 3300005563 | Bacteria | 40979 |
| 145 | Ga0068855_100000957 | 3300005563 | Bacteria | 35876 |
| 146 | Ga0068855_100012898 | 3300005563 | Bacteria | 10085 |
| 147 | Ga0068855_100028910 | 3300005563 | Bacteria | 6632 |
| 148 | Ga0068855_100029350 | 3300005563 | Bacteria | 6577 |
| 149 | Ga0068855_100059952 | 3300005563 | Bacteria | 4451 |
| 150 | Ga0068855_100087593 | 3300005563 | Bacteria | 3598 |
| 151 | Ga0068855_100129819 | 3300005563 | Bacteria | 2879 |
| 152 | Ga0068855_100138006 | 3300005563 | Bacteria | 2781 |
| 153 | Ga0070664_100011562 | 3300005564 | Bacteria | 7161 |
| 154 | Ga0070664_100022602 | 3300005564 | Bacteria | 5185 |
| 155 | Ga0070664_100062879 | 3300005564 | Bacteria | 3165 |
| 156 | Ga0070664_100149551 | 3300005564 | Bacteria | 2061 |
| 157 | Ga0070664_100257278 | 3300005564 | Bacteria | 1570 |
| 158 | Ga0068857_100022608 | 3300005577 | Bacteria | 5530 |
| 159 | Ga0068857_100031575 | 3300005577 | Bacteria | 4681 |
| 160 | Ga0068857_100052589 | 3300005577 | Bacteria | 3614 |
| 161 | Ga0068857_100061838 | 3300005577 | Bacteria | 3327 |
| 162 | Ga0068857_100097054 | 3300005577 | Bacteria | 2642 |
| 163 | Ga0068857_100166228 | 3300005577 | Bacteria | 2004 |
| 164 | Ga0068857_100435101 | 3300005577 | Bacteria | 1225 |
| 165 | Ga0068854_100059917 | 3300005578 | Bacteria | 2752 |
| 166 | Ga0068854_100063658 | 3300005578 | Bacteria | 2678 |
| 167 | Ga0068854_100095628 | 3300005578 | Bacteria | 2218 |
| 168 | Ga0068854_100133600 | 3300005578 | Bacteria | 1897 |
| 169 | Ga0068856_100007898 | 3300005614 | Bacteria | 10393 |
| 170 | Ga0068856_100039447 | 3300005614 | Bacteria | 4637 |
| 171 | Ga0068856_100051092 | 3300005614 | Bacteria | 4077 |
| 172 | Ga0068856_100071316 | 3300005614 | Bacteria | 3439 |
| 173 | Ga0068856_100149457 | 3300005614 | Bacteria | 2344 |
| 174 | Ga0068856_100288614 | 3300005614 | Bacteria | 1657 |
| 175 | Ga0070702_100025113 | 3300005615 | Bacteria | 3189 |
| 176 | Ga0070702_100071258 | 3300005615 | Bacteria | 2054 |
| 177 | Ga0068852_100000503 | 3300005616 | Bacteria | 25688 |
| 178 | Ga0068852_100001785 | 3300005616 | Bacteria | 14610 |
| 179 | Ga0068852_100017293 | 3300005616 | Bacteria | 5653 |
| 180 | Ga0068852_100023529 | 3300005616 | Bacteria | 4960 |
| 181 | Ga0068852_100026331 | 3300005616 | Bacteria | 4726 |
| 182 | Ga0068852_100035776 | 3300005616 | Bacteria | 4146 |
| 183 | Ga0068852_100116153 | 3300005616 | Bacteria | 2441 |
| 184 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 185 | Ga0068859_100015958 | 3300005617 | Bacteria | 7549 |
| 186 | Ga0068859_100056360 | 3300005617 | Bacteria | 3955 |
| 187 | Ga0068859_100064054 | 3300005617 | Bacteria | 3708 |
| 188 | Ga0068859_100091984 | 3300005617 | Bacteria | 3085 |
| 189 | Ga0068859_100178112 | 3300005617 | Bacteria | 2208 |
| 190 | Ga0068864_100004460 | 3300005618 | Bacteria | 11503 |
| 191 | Ga0068864_100005117 | 3300005618 | Bacteria | 10746 |
| 192 | Ga0068864_100037534 | 3300005618 | Bacteria | 4135 |
| 193 | Ga0068864_100054233 | 3300005618 | Bacteria | 3460 |
| 194 | Ga0068864_100091855 | 3300005618 | Bacteria | 2679 |
| 195 | Ga0068864_100129762 | 3300005618 | Bacteria | 2263 |
| 196 | Ga0068864_100154783 | 3300005618 | Bacteria | 2080 |
| 197 | Ga0068866_10020849 | 3300005718 | Bacteria | 3009 |
| 198 | Ga0068861_100018453 | 3300005719 | Bacteria | 4971 |
| 199 | Ga0068861_100080555 | 3300005719 | Bacteria | 2547 |
| 200 | Ga0068861_100152547 | 3300005719 | Bacteria | 1897 |
| 201 | Ga0068861_100197842 | 3300005719 | Bacteria | 1685 |
| 202 | Ga0068851_10000252 | 3300005834 | Bacteria | 25317 |
| 203 | Ga0068851_10007180 | 3300005834 | Bacteria | 5104 |
| 204 | Ga0068851_10093735 | 3300005834 | Bacteria | 1585 |
| 205 | Ga0068851_10178396 | 3300005834 | Bacteria | 1175 |
| 206 | Ga0068870_10068105 | 3300005840 | Bacteria | 1933 |
| 207 | Ga0068863_100001439 | 3300005841 | Bacteria | 23604 |
| 208 | Ga0068863_100006838 | 3300005841 | Bacteria | 11182 |
| 209 | Ga0068863_100012618 | 3300005841 | Bacteria | 8151 |
| 210 | Ga0068863_100025607 | 3300005841 | Bacteria | 5625 |
| 211 | Ga0068863_100127766 | 3300005841 | Bacteria | 2426 |
| 212 | Ga0068863_100198507 | 3300005841 | Bacteria | 1929 |
| 213 | Ga0068863_100228489 | 3300005841 | Bacteria | 1794 |
| 214 | Ga0068858_100005079 | 3300005842 | Bacteria | 12897 |
| 215 | Ga0068858_100005154 | 3300005842 | Bacteria | 12803 |
| 216 | Ga0068858_100015472 | 3300005842 | Bacteria | 7175 |
| 217 | Ga0068858_100099889 | 3300005842 | Bacteria | 2706 |
| 218 | Ga0068858_100283136 | 3300005842 | Bacteria | 1579 |
| 219 | Ga0068858_100506182 | 3300005842 | Bacteria | 1167 |
| 220 | Ga0068860_100000208 | 3300005843 | Bacteria | 92818 |
| 221 | Ga0068860_100000662 | 3300005843 | Bacteria | 39938 |
| 222 | Ga0068860_100007619 | 3300005843 | Bacteria | 10834 |
| 223 | Ga0068860_100008645 | 3300005843 | Bacteria | 10147 |
| 224 | Ga0068860_100009954 | 3300005843 | Bacteria | 9423 |
| 225 | Ga0068860_100010746 | 3300005843 | Bacteria | 9037 |
| 226 | Ga0068860_100022849 | 3300005843 | Bacteria | 6048 |
| 227 | Ga0068860_100385511 | 3300005843 | Bacteria | 1384 |
| 228 | Ga0068862_100000995 | 3300005844 | Bacteria | 27113 |
| 229 | Ga0068862_100117931 | 3300005844 | Bacteria | 2336 |
| 230 | Ga0068862_100176292 | 3300005844 | Bacteria | 1916 |
| 231 | Ga0068862_100460084 | 3300005844 | Bacteria | 1201 |
| 232 | Ga0081540_1004197 | 3300005983 | Bacteria | 11081 |
| 233 | Ga0081539_10000641 | 3300005985 | Bacteria | 70679 |
| 234 | Ga0097621_100013920 | 3300006237 | Bacteria | 6008 |
| 235 | Ga0097621_100016846 | 3300006237 | Bacteria | 5537 |
| 236 | Ga0097621_100021374 | 3300006237 | Bacteria | 5004 |
| 237 | Ga0097621_100021813 | 3300006237 | Bacteria | 4963 |
| 238 | Ga0097621_100042206 | 3300006237 | Bacteria | 3673 |
| 239 | Ga0097621_100206975 | 3300006237 | Bacteria | 1705 |
| 240 | Ga0097621_100396830 | 3300006237 | Bacteria | 1234 |
| 241 | Ga0068871_100039722 | 3300006358 | Bacteria | 3767 |
| 242 | Ga0068871_100041002 | 3300006358 | Bacteria | 3710 |
| 243 | Ga0068871_100043066 | 3300006358 | Bacteria | 3626 |
| 244 | Ga0068871_100052147 | 3300006358 | Bacteria | 3312 |
| 245 | Ga0068871_100067970 | 3300006358 | Bacteria | 2925 |
| 246 | Ga0068871_100189228 | 3300006358 | Bacteria | 1772 |
| 247 | Ga0068871_100277916 | 3300006358 | Bacteria | 1464 |
| 248 | Ga0075428_100003010 | 3300006844 | Bacteria | 18399 |
| 249 | Ga0075428_100009333 | 3300006844 | Bacteria | 10882 |
| 250 | Ga0075428_100145976 | 3300006844 | Bacteria | 2571 |
| 251 | Ga0075430_100010608 | 3300006846 | Bacteria | 7806 |
| 252 | Ga0075431_100014282 | 3300006847 | Bacteria | 8031 |
| 253 | Ga0075431_100040230 | 3300006847 | Bacteria | 4817 |
| 254 | Ga0075434_100134102 | 3300006871 | Bacteria | 2496 |
| 255 | Ga0075434_100323199 | 3300006871 | Bacteria | 1563 |
| 256 | Ga0075429_100001277 | 3300006880 | Bacteria | 20474 |
| 257 | Ga0075429_100006151 | 3300006880 | Bacteria | 10376 |
| 258 | Ga0075429_100010161 | 3300006880 | Bacteria | 8149 |
| 259 | Ga0068865_100000668 | 3300006881 | Bacteria | 19318 |
| 260 | Ga0068865_100219682 | 3300006881 | Bacteria | 1485 |
| 261 | Ga0068865_100239471 | 3300006881 | Bacteria | 1427 |
| 262 | Ga0075436_100000145 | 3300006914 | Bacteria | 43281 |
| 263 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 264 | Ga0097620_100015117 | 3300006931 | Bacteria | 7745 |
| 265 | Ga0097620_100015958 | 3300006931 | Bacteria | 7549 |
| 266 | Ga0097620_100056360 | 3300006931 | Bacteria | 3955 |
| 267 | Ga0097620_100064052 | 3300006931 | Bacteria | 3708 |
| 268 | Ga0097620_100091984 | 3300006931 | Bacteria | 3085 |
| 269 | Ga0097620_100178108 | 3300006931 | Bacteria | 2208 |
| 270 | Ga0105240_10000147 | 3300009093 | Bacteria | 142340 |
| 271 | Ga0105240_10000168 | 3300009093 | Bacteria | 133212 |
| 272 | Ga0105240_10000224 | 3300009093 | Bacteria | 113175 |
| 273 | Ga0105240_10002232 | 3300009093 | Bacteria | 31507 |
| 274 | Ga0105240_10011606 | 3300009093 | Bacteria | 12258 |
| 275 | Ga0105240_10012035 | 3300009093 | Bacteria | 11994 |
| 276 | Ga0105240_10015585 | 3300009093 | Bacteria | 10328 |
| 277 | Ga0105240_10050139 | 3300009093 | Bacteria | 5265 |
| 278 | Ga0105240_10148232 | 3300009093 | Bacteria | 2797 |
| 279 | Ga0111539_10106295 | 3300009094 | Bacteria | 3292 |
| 280 | Ga0111539_10300926 | 3300009094 | Bacteria | 1867 |
| 281 | Ga0111539_10347418 | 3300009094 | Bacteria | 1726 |
| 282 | Ga0105245_10167309 | 3300009098 | Bacteria | 2091 |
| 283 | Ga0105245_10278965 | 3300009098 | Bacteria | 1633 |
| 284 | Ga0105245_10418514 | 3300009098 | Bacteria | 1343 |
| 285 | Ga0105247_10003609 | 3300009101 | Bacteria | 10044 |
| 286 | Ga0105247_10006231 | 3300009101 | Bacteria | 7400 |
| 287 | Ga0114129_10050987 | 3300009147 | Bacteria | 5811 |
| 288 | Ga0114129_10156378 | 3300009147 | Bacteria | 3117 |
| 289 | Ga0114129_10528836 | 3300009147 | Bacteria | 1536 |
| 290 | Ga0105243_10189580 | 3300009148 | Bacteria | 1795 |
| 291 | Ga0105241_10001105 | 3300009174 | Bacteria | 20534 |
| 292 | Ga0105241_10003487 | 3300009174 | Bacteria | 11699 |
| 293 | Ga0105241_10135519 | 3300009174 | Bacteria | 1999 |
| 294 | Ga0105242_10004172 | 3300009176 | Bacteria | 11257 |
| 295 | Ga0105242_10023320 | 3300009176 | Bacteria | 4877 |
| 296 | Ga0105242_10138177 | 3300009176 | Bacteria | 2111 |
| 297 | Ga0105242_10176648 | 3300009176 | Bacteria | 1881 |
| 298 | Ga0105242_10291805 | 3300009176 | Bacteria | 1485 |
| 299 | Ga0105242_10340758 | 3300009176 | Bacteria | 1381 |
| 300 | Ga0105242_10433148 | 3300009176 | Bacteria | 1235 |
| 301 | Ga0105248_10080222 | 3300009177 | Bacteria | 3667 |
| 302 | Ga0105237_10000394 | 3300009545 | Bacteria | 62227 |
| 303 | Ga0105237_10000725 | 3300009545 | Bacteria | 45577 |
| 304 | Ga0105237_10008284 | 3300009545 | Bacteria | 11287 |
| 305 | Ga0105237_10020325 | 3300009545 | Bacteria | 6849 |
| 306 | Ga0105237_10023397 | 3300009545 | Bacteria | 6330 |
| 307 | Ga0105237_10031327 | 3300009545 | Bacteria | 5393 |
| 308 | Ga0105237_10163378 | 3300009545 | Bacteria | 2226 |
| 309 | Ga0105237_10163384 | 3300009545 | Bacteria | 2226 |
| 310 | Ga0105237_10176590 | 3300009545 | Bacteria | 2136 |
| 311 | Ga0105238_10000247 | 3300009551 | Bacteria | 60300 |
| 312 | Ga0105238_10008890 | 3300009551 | Bacteria | 10053 |
| 313 | Ga0105238_10062082 | 3300009551 | Bacteria | 3738 |
| 314 | Ga0105249_10000682 | 3300009553 | Bacteria | 30897 |
| 315 | Ga0105249_10001215 | 3300009553 | Bacteria | 22719 |
| 316 | Ga0105249_10006750 | 3300009553 | Bacteria | 10001 |
| 317 | Ga0105249_10007592 | 3300009553 | Bacteria | 9465 |
| 318 | Ga0105249_10130907 | 3300009553 | Bacteria | 2395 |
| 319 | Ga0105249_10347647 | 3300009553 | Bacteria | 1501 |
| 320 | Ga0105249_10736266 | 3300009553 | Unclassified | 1048 |
| 321 | Ga0105239_10000370 | 3300010375 | Bacteria | 66106 |
| 322 | Ga0105239_10001527 | 3300010375 | Bacteria | 30683 |
| 323 | Ga0105239_10001529 | 3300010375 | Bacteria | 30676 |
| 324 | Ga0105239_10015328 | 3300010375 | Bacteria | 8492 |
| 325 | Ga0105239_10016372 | 3300010375 | Bacteria | 8201 |
| 326 | Ga0105239_10016797 | 3300010375 | Bacteria | 8089 |
| 327 | Ga0105239_10089304 | 3300010375 | Bacteria | 3398 |
| 328 | Ga0105239_10115880 | 3300010375 | Bacteria | 2972 |
| 329 | Ga0105239_10139506 | 3300010375 | Bacteria | 2701 |
| 330 | Ga0105239_10156469 | 3300010375 | Bacteria | 2545 |
| 331 | Ga0105246_10036756 | 3300011119 | Bacteria | 3283 |
| 332 | Ga0157373_10002303 | 3300013100 | Bacteria | 14488 |
| 333 | Ga0157373_10011321 | 3300013100 | Bacteria | 6559 |
| 334 | Ga0157373_10036875 | 3300013100 | Bacteria | 3507 |
| 335 | Ga0157373_10045344 | 3300013100 | Bacteria | 3138 |
| 336 | Ga0157373_10049038 | 3300013100 | Bacteria | 3010 |
| 337 | Ga0157373_10069976 | 3300013100 | Bacteria | 2480 |
| 338 | Ga0157371_10001603 | 3300013102 | Bacteria | 23199 |
| 339 | Ga0157371_10001840 | 3300013102 | Bacteria | 21388 |
| 340 | Ga0157371_10002945 | 3300013102 | Bacteria | 15853 |
| 341 | Ga0157371_10004684 | 3300013102 | Bacteria | 11824 |
| 342 | Ga0157371_10006217 | 3300013102 | Bacteria | 9899 |
| 343 | Ga0157371_10010000 | 3300013102 | Bacteria | 7424 |
| 344 | Ga0157371_10020600 | 3300013102 | Bacteria | 4853 |
| 345 | Ga0157371_10023994 | 3300013102 | Bacteria | 4456 |
| 346 | Ga0157371_10039145 | 3300013102 | Bacteria | 3391 |
| 347 | Ga0157371_10079965 | 3300013102 | Bacteria | 2315 |
| 348 | Ga0157370_10000673 | 3300013104 | Bacteria | 42574 |
| 349 | Ga0157370_10002442 | 3300013104 | Bacteria | 22410 |
| 350 | Ga0157370_10006476 | 3300013104 | Bacteria | 12911 |
| 351 | Ga0157370_10012429 | 3300013104 | Bacteria | 8826 |
| 352 | Ga0157370_10061605 | 3300013104 | Bacteria | 3560 |
| 353 | Ga0157370_10188489 | 3300013104 | Bacteria | 1915 |
| 354 | Ga0157370_10497213 | 3300013104 | Bacteria | 1120 |
| 355 | Ga0157369_10005363 | 3300013105 | Bacteria | 14932 |
| 356 | Ga0157369_10006046 | 3300013105 | Bacteria | 14052 |
| 357 | Ga0157369_10020699 | 3300013105 | Bacteria | 7354 |
| 358 | Ga0157369_10042847 | 3300013105 | Bacteria | 4937 |
| 359 | Ga0157369_10135356 | 3300013105 | Bacteria | 2609 |
| 360 | Ga0157369_10344186 | 3300013105 | Bacteria | 1549 |
| 361 | Ga0157374_10000484 | 3300013296 | Bacteria | 36020 |
| 362 | Ga0157374_10008174 | 3300013296 | Bacteria | 8939 |
| 363 | Ga0157374_10258798 | 3300013296 | Bacteria | 1714 |
| 364 | Ga0157374_10281103 | 3300013296 | Bacteria | 1643 |
| 365 | Ga0157378_10002633 | 3300013297 | Bacteria | 15990 |
| 366 | Ga0157378_10016242 | 3300013297 | Bacteria | 6519 |
| 367 | Ga0157378_10021011 | 3300013297 | Bacteria | 5743 |
| 368 | Ga0157378_10024687 | 3300013297 | Bacteria | 5293 |
| 369 | Ga0157378_10051359 | 3300013297 | Bacteria | 3669 |
| 370 | Ga0157378_10117790 | 3300013297 | Bacteria | 2444 |
| 371 | Ga0157378_10122157 | 3300013297 | Bacteria | 2402 |
| 372 | Ga0157378_10124509 | 3300013297 | Bacteria | 2380 |
| 373 | Ga0157378_10309322 | 3300013297 | Bacteria | 1532 |
| 374 | Ga0163162_10000484 | 3300013306 | Bacteria | 36942 |
| 375 | Ga0163162_10001520 | 3300013306 | Bacteria | 21611 |
| 376 | Ga0163162_10004470 | 3300013306 | Bacteria | 13467 |
| 377 | Ga0163162_10011289 | 3300013306 | Bacteria | 8710 |
| 378 | Ga0163162_10012241 | 3300013306 | Bacteria | 8372 |
| 379 | Ga0163162_10040262 | 3300013306 | Bacteria | 4672 |
| 380 | Ga0163162_10122684 | 3300013306 | Bacteria | 2703 |
| 381 | Ga0163162_10134112 | 3300013306 | Bacteria | 2587 |
| 382 | Ga0163162_10211306 | 3300013306 | Unclassified | 2070 |
| 383 | Ga0163162_10245938 | 3300013306 | Bacteria | 1920 |
| 384 | Ga0163162_10616806 | 3300013306 | Bacteria | 1210 |
| 385 | Ga0157372_10000317 | 3300013307 | Bacteria | 53205 |
| 386 | Ga0157372_10002225 | 3300013307 | Bacteria | 21049 |
| 387 | Ga0157372_10008771 | 3300013307 | Bacteria | 10737 |
| 388 | Ga0157372_10025878 | 3300013307 | Bacteria | 6382 |
| 389 | Ga0157372_10030136 | 3300013307 | Bacteria | 5932 |
| 390 | Ga0157372_10041409 | 3300013307 | Bacteria | 5094 |
| 391 | Ga0157372_10045321 | 3300013307 | Bacteria | 4877 |
| 392 | Ga0157372_10068608 | 3300013307 | Bacteria | 3987 |
| 393 | Ga0157372_10092305 | 3300013307 | Bacteria | 3444 |
| 394 | Ga0157372_10138015 | 3300013307 | Bacteria | 2809 |
| 395 | Ga0157372_10153519 | 3300013307 | Bacteria | 2659 |
| 396 | Ga0157372_10158282 | 3300013307 | Bacteria | 2617 |
| 397 | Ga0157372_10178337 | 3300013307 | Bacteria | 2459 |
| 398 | Ga0157372_10210106 | 3300013307 | Bacteria | 2255 |
| 399 | Ga0157372_10225257 | 3300013307 | Bacteria | 2174 |
| 400 | Ga0157372_10321435 | 3300013307 | Bacteria | 1802 |
| 401 | Ga0157372_10514886 | 3300013307 | Bacteria | 1395 |
| 402 | Ga0157375_10000619 | 3300013308 | Bacteria | 31534 |
| 403 | Ga0157375_10011699 | 3300013308 | Bacteria | 7755 |
| 404 | Ga0157375_10062153 | 3300013308 | Bacteria | 3710 |
| 405 | Ga0157375_10276498 | 3300013308 | Bacteria | 1842 |
| 406 | Ga0157375_10423317 | 3300013308 | Bacteria | 1498 |
| 407 | Ga0163163_10000499 | 3300014325 | Bacteria | 35349 |
| 408 | Ga0163163_10001833 | 3300014325 | Bacteria | 17940 |
| 409 | Ga0163163_10071426 | 3300014325 | Bacteria | 3459 |
| 410 | Ga0163163_10115435 | 3300014325 | Bacteria | 2716 |
| 411 | Ga0163163_10229914 | 3300014325 | Bacteria | 1903 |
| 412 | Ga0163163_10236577 | 3300014325 | Bacteria | 1876 |
| 413 | Ga0157380_10000174 | 3300014326 | Bacteria | 37217 |
| 414 | Ga0157380_10003845 | 3300014326 | Bacteria | 10345 |
| 415 | Ga0157380_10006056 | 3300014326 | Bacteria | 8474 |
| 416 | Ga0157380_10033793 | 3300014326 | Bacteria | 3940 |
| 417 | Ga0157380_10201513 | 3300014326 | Bacteria | 1766 |
| 418 | Ga0182008_10000053 | 3300014497 | Bacteria | 102934 |
| 419 | Ga0157377_10012471 | 3300014745 | Bacteria | 4275 |
| 420 | Ga0157377_10064866 | 3300014745 | Bacteria | 2096 |
| 421 | Ga0157379_10001386 | 3300014968 | Bacteria | 19826 |
| 422 | Ga0157379_10024256 | 3300014968 | Bacteria | 5385 |
| 423 | Ga0157379_10108486 | 3300014968 | Bacteria | 2493 |
| 424 | Ga0157379_10134357 | 3300014968 | Bacteria | 2228 |
| 425 | Ga0157379_10244657 | 3300014968 | Bacteria | 1627 |
| 426 | Ga0157379_10386536 | 3300014968 | Bacteria | 1284 |
| 427 | Ga0157376_10000798 | 3300014969 | Bacteria | 20658 |
| 428 | Ga0157376_10002100 | 3300014969 | Bacteria | 13399 |
| 429 | Ga0157376_10055901 | 3300014969 | Bacteria | 3295 |
| 430 | Ga0157376_10230177 | 3300014969 | Bacteria | 1721 |
| 431 | Ga0157376_10265989 | 3300014969 | Bacteria | 1609 |
| 432 | Ga0182006_1000270 | 3300015261 | Bacteria | 46578 |
| 433 | Ga0163161_10071986 | 3300017792 | Bacteria | 2531 |
| 434 | Ga0163161_10171834 | 3300017792 | Bacteria | 1658 |
| 435 | Ga0163161_10193193 | 3300017792 | Bacteria | 1566 |
| 436 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 437 | Ga0207697_10029727 | 3300025315 | Bacteria | 2237 |
| 438 | Ga0207656_10000749 | 3300025321 | Bacteria | 10631 |
| 439 | Ga0207656_10002904 | 3300025321 | Bacteria | 5844 |
| 440 | Ga0207656_10102980 | 3300025321 | Bacteria | 1311 |
| 441 | Ga0207682_10016291 | 3300025893 | Bacteria | 2899 |
| 442 | Ga0207642_10154944 | 3300025899 | Unclassified | 1224 |
| 443 | Ga0207710_10003944 | 3300025900 | Bacteria | 6544 |
| 444 | Ga0207710_10004413 | 3300025900 | Bacteria | 6143 |
| 445 | Ga0207680_10000108 | 3300025903 | Bacteria | 38066 |
| 446 | Ga0207680_10023781 | 3300025903 | Bacteria | 3351 |
| 447 | Ga0207680_10029990 | 3300025903 | Bacteria | 3062 |
| 448 | Ga0207680_10153135 | 3300025903 | Bacteria | 1539 |
| 449 | Ga0207680_10188619 | 3300025903 | Bacteria | 1398 |
| 450 | Ga0207647_10000050 | 3300025904 | Bacteria | 88099 |
| 451 | Ga0207645_10018557 | 3300025907 | Bacteria | 4573 |
| 452 | Ga0207645_10170415 | 3300025907 | Bacteria | 1427 |
| 453 | Ga0207643_10003946 | 3300025908 | Bacteria | 7984 |
| 454 | Ga0207705_10003522 | 3300025909 | Bacteria | 11931 |
| 455 | Ga0207705_10004003 | 3300025909 | Bacteria | 11212 |
| 456 | Ga0207705_10026286 | 3300025909 | Bacteria | 4152 |
| 457 | Ga0207705_10111435 | 3300025909 | Bacteria | 2022 |
| 458 | Ga0207705_10217638 | 3300025909 | Bacteria | 1450 |
| 459 | Ga0207705_10313810 | 3300025909 | Bacteria | 1204 |
| 460 | Ga0207654_10001573 | 3300025911 | Bacteria | 11985 |
| 461 | Ga0207654_10005154 | 3300025911 | Bacteria | 6593 |
| 462 | Ga0207654_10066742 | 3300025911 | Bacteria | 2123 |
| 463 | Ga0207654_10308749 | 3300025911 | Bacteria | 1078 |
| 464 | Ga0207707_10001470 | 3300025912 | Bacteria | 21804 |
| 465 | Ga0207707_10002754 | 3300025912 | Bacteria | 15674 |
| 466 | Ga0207707_10022737 | 3300025912 | Bacteria | 5483 |
| 467 | Ga0207707_10054892 | 3300025912 | Bacteria | 3467 |
| 468 | Ga0207707_10082552 | 3300025912 | Bacteria | 2806 |
| 469 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 470 | Ga0207695_10000031 | 3300025913 | Bacteria | 526801 |
| 471 | Ga0207695_10000110 | 3300025913 | Bacteria | 250079 |
| 472 | Ga0207695_10002344 | 3300025913 | Bacteria | 28132 |
| 473 | Ga0207695_10028819 | 3300025913 | Bacteria | 6147 |
| 474 | Ga0207695_10061324 | 3300025913 | Bacteria | 3887 |
| 475 | Ga0207695_10064274 | 3300025913 | Bacteria | 3779 |
| 476 | Ga0207695_10139675 | 3300025913 | Bacteria | 2372 |
| 477 | Ga0207671_10000925 | 3300025914 | Bacteria | 36841 |
| 478 | Ga0207671_10003957 | 3300025914 | Bacteria | 14415 |
| 479 | Ga0207671_10015072 | 3300025914 | Bacteria | 6075 |
| 480 | Ga0207671_10030657 | 3300025914 | Bacteria | 4009 |
| 481 | Ga0207660_10004358 | 3300025917 | Bacteria | 9225 |
| 482 | Ga0207662_10011300 | 3300025918 | Unclassified | 4946 |
| 483 | Ga0207657_10012180 | 3300025919 | Bacteria | 8499 |
| 484 | Ga0207657_10058804 | 3300025919 | Bacteria | 3306 |
| 485 | Ga0207657_10269804 | 3300025919 | Bacteria | 1353 |
| 486 | Ga0207649_10003147 | 3300025920 | Bacteria | 9054 |
| 487 | Ga0207649_10041557 | 3300025920 | Bacteria | 2799 |
| 488 | Ga0207649_10078676 | 3300025920 | Bacteria | 2128 |
| 489 | Ga0207649_10234816 | 3300025920 | Bacteria | 1313 |
| 490 | Ga0207652_10000074 | 3300025921 | Bacteria | 108397 |
| 491 | Ga0207652_10000942 | 3300025921 | Bacteria | 27351 |
| 492 | Ga0207652_10001229 | 3300025921 | Bacteria | 22941 |
| 493 | Ga0207652_10166028 | 3300025921 | Bacteria | 1979 |
| 494 | Ga0207652_10368146 | 3300025921 | Bacteria | 1297 |
| 495 | Ga0207652_10446859 | 3300025921 | Bacteria | 1165 |
| 496 | Ga0207681_10339474 | 3300025923 | Bacteria | 1199 |
| 497 | Ga0207694_10012838 | 3300025924 | Bacteria | 6308 |
| 498 | Ga0207694_10020081 | 3300025924 | Bacteria | 5053 |
| 499 | Ga0207650_10008539 | 3300025925 | Bacteria | 6994 |
| 500 | Ga0207650_10031450 | 3300025925 | Bacteria | 3833 |
| 501 | Ga0207650_10069130 | 3300025925 | Bacteria | 2653 |
| 502 | Ga0207659_10006857 | 3300025926 | Bacteria | 7005 |
| 503 | Ga0207659_10018772 | 3300025926 | Bacteria | 4539 |
| 504 | Ga0207659_10274612 | 3300025926 | Bacteria | 1376 |
| 505 | Ga0207687_10167260 | 3300025927 | Bacteria | 1693 |
| 506 | Ga0207687_10179791 | 3300025927 | Bacteria | 1638 |
| 507 | Ga0207700_10309229 | 3300025928 | Bacteria | 1367 |
| 508 | Ga0207690_10008634 | 3300025932 | Bacteria | 6041 |
| 509 | Ga0207690_10014218 | 3300025932 | Bacteria | 4803 |
| 510 | Ga0207706_10002124 | 3300025933 | Bacteria | 19411 |
| 511 | Ga0207706_10013304 | 3300025933 | Bacteria | 7487 |
| 512 | Ga0207706_10057700 | 3300025933 | Bacteria | 3420 |
| 513 | Ga0207706_10094248 | 3300025933 | Bacteria | 2633 |
| 514 | Ga0207706_10308651 | 3300025933 | Bacteria | 1378 |
| 515 | Ga0207686_10001998 | 3300025934 | Bacteria | 11249 |
| 516 | Ga0207686_10036685 | 3300025934 | Bacteria | 2953 |
| 517 | Ga0207686_10300972 | 3300025934 | Bacteria | 1191 |
| 518 | Ga0207670_10021414 | 3300025936 | Bacteria | 3989 |
| 519 | Ga0207670_10059712 | 3300025936 | Bacteria | 2594 |
| 520 | Ga0207670_10100189 | 3300025936 | Bacteria | 2068 |
| 521 | Ga0207670_10186272 | 3300025936 | Bacteria | 1567 |
| 522 | Ga0207669_10064033 | 3300025937 | Bacteria | 2273 |
| 523 | Ga0207669_10090642 | 3300025937 | Bacteria | 1989 |
| 524 | Ga0207704_10130886 | 3300025938 | Bacteria | 1737 |
| 525 | Ga0207691_10000549 | 3300025940 | Bacteria | 37607 |
| 526 | Ga0207691_10034712 | 3300025940 | Bacteria | 4689 |
| 527 | Ga0207691_10141802 | 3300025940 | Bacteria | 2117 |
| 528 | Ga0207689_10001398 | 3300025942 | Bacteria | 23013 |
| 529 | Ga0207689_10025482 | 3300025942 | Bacteria | 4956 |
| 530 | Ga0207689_10031756 | 3300025942 | Bacteria | 4393 |
| 531 | Ga0207689_10116372 | 3300025942 | Bacteria | 2197 |
| 532 | Ga0207661_10003834 | 3300025944 | Bacteria | 10483 |
| 533 | Ga0207661_10034494 | 3300025944 | Bacteria | 3936 |
| 534 | Ga0207661_10043853 | 3300025944 | Bacteria | 3531 |
| 535 | Ga0207661_10140585 | 3300025944 | Bacteria | 2077 |
| 536 | Ga0207661_10330189 | 3300025944 | Bacteria | 1373 |
| 537 | Ga0207679_10000408 | 3300025945 | Bacteria | 30790 |
| 538 | Ga0207679_10007934 | 3300025945 | Bacteria | 6749 |
| 539 | Ga0207679_10133873 | 3300025945 | Bacteria | 1993 |
| 540 | Ga0207679_10220471 | 3300025945 | Bacteria | 1595 |
| 541 | Ga0207667_10000144 | 3300025949 | Bacteria | 108295 |
| 542 | Ga0207667_10000773 | 3300025949 | Bacteria | 41528 |
| 543 | Ga0207667_10006879 | 3300025949 | Bacteria | 13741 |
| 544 | Ga0207667_10016655 | 3300025949 | Bacteria | 8296 |
| 545 | Ga0207667_10024655 | 3300025949 | Bacteria | 6599 |
| 546 | Ga0207667_10112046 | 3300025949 | Bacteria | 2814 |
| 547 | Ga0207667_10148118 | 3300025949 | Bacteria | 2416 |
| 548 | Ga0207667_10379426 | 3300025949 | Bacteria | 1440 |
| 549 | Ga0207651_10000231 | 3300025960 | Bacteria | 24055 |
| 550 | Ga0207651_10031683 | 3300025960 | Bacteria | 3384 |
| 551 | Ga0207651_10093079 | 3300025960 | Bacteria | 2212 |
| 552 | Ga0207651_10168249 | 3300025960 | Bacteria | 1726 |
| 553 | Ga0207712_10001368 | 3300025961 | Bacteria | 16692 |
| 554 | Ga0207712_10001805 | 3300025961 | Bacteria | 14147 |
| 555 | Ga0207712_10018237 | 3300025961 | Bacteria | 4569 |
| 556 | Ga0207712_10056597 | 3300025961 | Bacteria | 2763 |
| 557 | Ga0207712_10075955 | 3300025961 | Bacteria | 2430 |
| 558 | Ga0207712_10151399 | 3300025961 | Bacteria | 1792 |
| 559 | Ga0207712_10179103 | 3300025961 | Bacteria | 1663 |
| 560 | Ga0207668_10000639 | 3300025972 | Bacteria | 21609 |
| 561 | Ga0207668_10108693 | 3300025972 | Bacteria | 2076 |
| 562 | Ga0207668_10378447 | 3300025972 | Bacteria | 1191 |
| 563 | Ga0207640_10126428 | 3300025981 | Bacteria | 1841 |
| 564 | Ga0207640_10141988 | 3300025981 | Bacteria | 1752 |
| 565 | Ga0207640_10186932 | 3300025981 | Bacteria | 1558 |
| 566 | Ga0207640_10225111 | 3300025981 | Bacteria | 1439 |
| 567 | Ga0207658_10000942 | 3300025986 | Bacteria | 24008 |
| 568 | Ga0207658_10021496 | 3300025986 | Bacteria | 4481 |
| 569 | Ga0207677_10001537 | 3300026023 | Bacteria | 12210 |
| 570 | Ga0207677_10002319 | 3300026023 | Bacteria | 9990 |
| 571 | Ga0207677_10012359 | 3300026023 | Bacteria | 4905 |
| 572 | Ga0207677_10036418 | 3300026023 | Bacteria | 3207 |
| 573 | Ga0207677_10178129 | 3300026023 | Bacteria | 1670 |
| 574 | Ga0207677_10429518 | 3300026023 | Bacteria | 1127 |
| 575 | Ga0207703_10001495 | 3300026035 | Bacteria | 21327 |
| 576 | Ga0207703_10008239 | 3300026035 | Bacteria | 8235 |
| 577 | Ga0207703_10024850 | 3300026035 | Bacteria | 4713 |
| 578 | Ga0207703_10044403 | 3300026035 | Unclassified | 3572 |
| 579 | Ga0207703_10100254 | 3300026035 | Bacteria | 2453 |
| 580 | Ga0207639_10008794 | 3300026041 | Bacteria | 6939 |
| 581 | Ga0207639_10021703 | 3300026041 | Bacteria | 4615 |
| 582 | Ga0207639_10025344 | 3300026041 | Bacteria | 4300 |
| 583 | Ga0207639_10033542 | 3300026041 | Bacteria | 3788 |
| 584 | Ga0207639_10041522 | 3300026041 | Bacteria | 3442 |
| 585 | Ga0207639_10164611 | 3300026041 | Bacteria | 1872 |
| 586 | Ga0207639_10191234 | 3300026041 | Bacteria | 1748 |
| 587 | Ga0207639_10219030 | 3300026041 | Bacteria | 1643 |
| 588 | Ga0207678_10008491 | 3300026067 | Bacteria | 9054 |
| 589 | Ga0207678_10060450 | 3300026067 | Bacteria | 3259 |
| 590 | Ga0207678_10277976 | 3300026067 | Bacteria | 1437 |
| 591 | Ga0207678_10354078 | 3300026067 | Bacteria | 1266 |
| 592 | Ga0207702_10089251 | 3300026078 | Bacteria | 2695 |
| 593 | Ga0207702_10138633 | 3300026078 | Bacteria | 2198 |
| 594 | Ga0207702_10622404 | 3300026078 | Bacteria | 1060 |
| 595 | Ga0207641_10000048 | 3300026088 | Bacteria | 178206 |
| 596 | Ga0207641_10000890 | 3300026088 | Bacteria | 31183 |
| 597 | Ga0207641_10003559 | 3300026088 | Bacteria | 13766 |
| 598 | Ga0207641_10036683 | 3300026088 | Bacteria | 4092 |
| 599 | Ga0207641_10132141 | 3300026088 | Bacteria | 2243 |
| 600 | Ga0207641_10147942 | 3300026088 | Bacteria | 2125 |
| 601 | Ga0207641_10211171 | 3300026088 | Bacteria | 1795 |
| 602 | Ga0207641_10591383 | 3300026088 | Bacteria | 1086 |
| 603 | Ga0207648_10012771 | 3300026089 | Bacteria | 7848 |
| 604 | Ga0207648_10016719 | 3300026089 | Bacteria | 6694 |
| 605 | Ga0207648_10036279 | 3300026089 | Bacteria | 4342 |
| 606 | Ga0207648_10043490 | 3300026089 | Bacteria | 3942 |
| 607 | Ga0207648_10062881 | 3300026089 | Bacteria | 3236 |
| 608 | Ga0207648_10063327 | 3300026089 | Bacteria | 3224 |
| 609 | Ga0207648_10077795 | 3300026089 | Bacteria | 2893 |
| 610 | Ga0207648_10079711 | 3300026089 | Bacteria | 2856 |
| 611 | Ga0207648_10097823 | 3300026089 | Bacteria | 2569 |
| 612 | Ga0207648_10337462 | 3300026089 | Bacteria | 1357 |
| 613 | Ga0207676_10007252 | 3300026095 | Bacteria | 7853 |
| 614 | Ga0207676_10023539 | 3300026095 | Bacteria | 4546 |
| 615 | Ga0207676_10115800 | 3300026095 | Bacteria | 2251 |
| 616 | Ga0207676_10196544 | 3300026095 | Bacteria | 1779 |
| 617 | Ga0207676_10201940 | 3300026095 | Bacteria | 1757 |
| 618 | Ga0207674_10006350 | 3300026116 | Bacteria | 13916 |
| 619 | Ga0207674_10033875 | 3300026116 | Bacteria | 5343 |
| 620 | Ga0207674_10047591 | 3300026116 | Bacteria | 4394 |
| 621 | Ga0207674_10055408 | 3300026116 | Bacteria | 4031 |
| 622 | Ga0207674_10113772 | 3300026116 | Bacteria | 2679 |
| 623 | Ga0207674_10118122 | 3300026116 | Bacteria | 2622 |
| 624 | Ga0207674_10129479 | 3300026116 | Bacteria | 2488 |
| 625 | Ga0207674_10175658 | 3300026116 | Bacteria | 2094 |
| 626 | Ga0207674_10460437 | 3300026116 | Bacteria | 1229 |
| 627 | Ga0207675_100002480 | 3300026118 | Bacteria | 18271 |
| 628 | Ga0207675_100004172 | 3300026118 | Bacteria | 13985 |
| 629 | Ga0207675_100041592 | 3300026118 | Bacteria | 4292 |
| 630 | Ga0207675_100191008 | 3300026118 | Bacteria | 1964 |
| 631 | Ga0207675_100256227 | 3300026118 | Bacteria | 1695 |
| 632 | Ga0207675_100274520 | 3300026118 | Unclassified | 1637 |
| 633 | Ga0207683_10009230 | 3300026121 | Bacteria | 8404 |
| 634 | Ga0207683_10201519 | 3300026121 | Bacteria | 1809 |
| 635 | Ga0207698_10017469 | 3300026142 | Bacteria | 4868 |
| 636 | Ga0207698_10035232 | 3300026142 | Bacteria | 3659 |
| 637 | Ga0207698_10057907 | 3300026142 | Bacteria | 3000 |
| 638 | Ga0207698_10081340 | 3300026142 | Bacteria | 2614 |
| 639 | Ga0207698_10121189 | 3300026142 | Bacteria | 2214 |
| 640 | Ga0207698_10362872 | 3300026142 | Bacteria | 1372 |
| 641 | Ga0209971_1010305 | 3300027682 | Bacteria | 2213 |
| 642 | Ga0209974_10015827 | 3300027876 | Bacteria | 2504 |
| 643 | Ga0207428_10114269 | 3300027907 | Bacteria | 2075 |
| 644 | Ga0207428_10176102 | 3300027907 | Bacteria | 1618 |
| 645 | Ga0268266_10000014 | 3300028379 | Bacteria | 644033 |
| 646 | Ga0268266_10046754 | 3300028379 | Bacteria | 3705 |
| 647 | Ga0268265_10000662 | 3300028380 | Bacteria | 34143 |
| 648 | Ga0268265_10145578 | 3300028380 | Bacteria | 1990 |
| 649 | Ga0268265_10159452 | 3300028380 | Bacteria | 1914 |
| 650 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 651 | Ga0268264_10000950 | 3300028381 | Bacteria | 29935 |
| 652 | Ga0268264_10001550 | 3300028381 | Bacteria | 21303 |
| 653 | Ga0268264_10004303 | 3300028381 | Bacteria | 12148 |
| 654 | Ga0268264_10010959 | 3300028381 | Bacteria | 7488 |
| 655 | Ga0268264_10020078 | 3300028381 | Bacteria | 5459 |
| 656 | Ga0268264_10111010 | 3300028381 | Bacteria | 2401 |
| 657 | Ga0268264_10116380 | 3300028381 | Bacteria | 2350 |
| 658 | Ga0265337_1053442 | 3300028556 | Bacteria | 1132 |
| 659 | Ga0265319_1000024 | 3300028563 | Bacteria | 144981 |
| 660 | Ga0265319_1005291 | 3300028563 | Bacteria | 6211 |
| 661 | Ga0265322_10021854 | 3300028654 | Bacteria | 1832 |
| 662 | Ga0265322_10033668 | 3300028654 | Bacteria | 1461 |
| 663 | Ga0307517_10028299 | 3300028786 | Bacteria | 6689 |
| 664 | Ga0307517_10056242 | 3300028786 | Bacteria | 3843 |
| 665 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 666 | Ga0307515_10000039 | 3300028794 | Bacteria | 323229 |
| 667 | Ga0265338_10068391 | 3300028800 | Bacteria | 3060 |
| 668 | Ga0265324_10014904 | 3300029957 | Bacteria | 2865 |
| 669 | Ga0265324_10018435 | 3300029957 | Bacteria | 2524 |
| 670 | Ga0307511_10000122 | 3300030521 | Bacteria | 70869 |
| 671 | Ga0265328_10020370 | 3300031239 | Bacteria | 2539 |
| 672 | Ga0265320_10001210 | 3300031240 | Bacteria | 18956 |
| 673 | Ga0265320_10004206 | 3300031240 | Bacteria | 9459 |
| 674 | Ga0265325_10042533 | 3300031241 | Bacteria | 2375 |
| 675 | Ga0265327_10000209 | 3300031251 | Bacteria | 122633 |
| 676 | Ga0265327_10000368 | 3300031251 | Bacteria | 85604 |
| 677 | Ga0265327_10000450 | 3300031251 | Bacteria | 74345 |
| 678 | Ga0265327_10000574 | 3300031251 | Bacteria | 62215 |
| 679 | Ga0265327_10000811 | 3300031251 | Bacteria | 47322 |
| 680 | Ga0265327_10010600 | 3300031251 | Bacteria | 6454 |
| 681 | Ga0265327_10035910 | 3300031251 | Bacteria | 2732 |
| 682 | Ga0265327_10041982 | 3300031251 | Bacteria | 2459 |
| 683 | Ga0307509_10138045 | 3300031507 | Bacteria | 2380 |
| 684 | Ga0265313_10130601 | 3300031595 | Bacteria | 1088 |
| 685 | Ga0307508_10000559 | 3300031616 | Bacteria | 44219 |
| 686 | Ga0265314_10001696 | 3300031711 | Bacteria | 23946 |
| 687 | Ga0307413_10186071 | 3300031824 | Bacteria | 1486 |
| 688 | Ga0307410_10273745 | 3300031852 | Bacteria | 1322 |
| 689 | Ga0307406_10048222 | 3300031901 | Bacteria | 2689 |
| 690 | Ga0307416_100225965 | 3300032002 | Bacteria | 1800 |
| 691 | Ga0307414_10001307 | 3300032004 | Bacteria | 12873 |
| 692 | Ga0316593_10057904 | 3300032168 | Bacteria | 1320 |
| 693 | Ga0307510_10000615 | 3300033180 | Bacteria | 36175 |
| 694 | Ga0307510_10211390 | 3300033180 | Bacteria | 1462 |
| 695 | Ga0373929_0000001 | 3300035085 | Bacteria | 956023 |
| 696 | Ga0373924_0087645 | 3300035410 | Bacteria | 1329 |
| 697 | Ga0373933_0055165 | 3300035724 | Bacteria | 2383 |
| 698 | Ga0373947_0105322 | 3300035725 | Bacteria | 1777 |
| 699 | Ga0373947_0149681 | 3300035725 | Unclassified | 1502 |
| 700 | Ga0373937_0056226 | 3300036401 | Bacteria | 3613 |
| 701 | Ga0373937_0200195 | 3300036401 | Bacteria | 1877 |
| 702 | Ga0373937_0250991 | 3300036401 | Bacteria | 1668 |
| 703 | Ga0395899_0003607 | 3300037312 | Bacteria | 12242 |
| 704 | Ga0395899_0032866 | 3300037312 | Bacteria | 3898 |
| 705 | Ga0395899_0052141 | 3300037312 | Bacteria | 3033 |
| 706 | Ga0395900_0058464 | 3300037418 | Bacteria | 3969 |
| 707 | Ga0395900_0071857 | 3300037418 | Bacteria | 3557 |
| 708 | Ga0395900_0102964 | 3300037418 | Bacteria | 2933 |
| 709 | Ga0395900_0173545 | 3300037418 | Bacteria | 2193 |
| 710 | Ga0395900_0426261 | 3300037418 | Bacteria | 1286 |
| 711 | Ga0395898_0004078 | 3300037466 | Bacteria | 16030 |
| 712 | Ga0395898_0004670 | 3300037466 | Bacteria | 14929 |
| 713 | Ga0395898_0013786 | 3300037466 | Bacteria | 8309 |
| 714 | Ga0395898_0268154 | 3300037466 | Bacteria | 1628 |
| 715 | Ga0395905_0001073 | 3300037471 | Bacteria | 34468 |
| 716 | Ga0395905_0018814 | 3300037471 | Bacteria | 6551 |
| 717 | Ga0395905_0061145 | 3300037471 | Bacteria | 3523 |
| 718 | Ga0395905_0134267 | 3300037471 | Bacteria | 2328 |
| 719 | Ga0395901_0002083 | 3300038443 | Bacteria | 20509 |
| 720 | Ga0395901_0006414 | 3300038443 | Bacteria | 11920 |
| 721 | Ga0395901_0050159 | 3300038443 | Bacteria | 4337 |
| 722 | Ga0395901_0294133 | 3300038443 | Bacteria | 1684 |
| 723 | Ga0436365_0081746 | 3300039437 | Bacteria | 17336 |
| 724 | Ga0436365_1248268 | 3300039437 | Bacteria | 25465 |
| 725 | Ga0451849_0746662 | 3300041505 | Bacteria | 1303 |
| 726 | Ga0439449_0005909 | 3300042007 | Bacteria | 4676 |
| 727 | Ga0451577_0000023 | 3300042876 | Bacteria | 419051 |
| 728 | Ga0451577_0004954 | 3300042876 | Bacteria | 13843 |
| 729 | Ga0451577_0039022 | 3300042876 | Bacteria | 4268 |
| 730 | Ga0451577_0206165 | 3300042876 | Bacteria | 1775 |
| 731 | Ga0466969_0000612 | 3300044656 | Bacteria | 19295 |
| 732 | Ga0466972_0000039 | 3300044658 | Bacteria | 135618 |
| 733 | Ga0466972_0007139 | 3300044658 | Bacteria | 5611 |
| 734 | Ga0466972_0018317 | 3300044658 | Bacteria | 3499 |
| 735 | Ga0453684_0023992 | 3300044712 | Bacteria | 8944 |
| 736 | Ga0453684_0061470 | 3300044712 | Bacteria | 4822 |
| 737 | Ga0453684_0290603 | 3300044712 | Bacteria | 1861 |
| 738 | Ga0466968_0098319 | 3300044735 | Bacteria | 1304 |
| 739 | Ga0466957_0004285 | 3300044842 | Bacteria | 7911 |
| 740 | Ga0466957_0023080 | 3300044842 | Bacteria | 3674 |
| 741 | Ga0466960_0108543 | 3300044901 | Bacteria | 1439 |
| 742 | Ga0466959_0000002 | 3300045049 | Bacteria | 362671 |
| 743 | Ga0466967_0147911 | 3300045976 | Bacteria | 2193 |
| 744 | Ga0495629_0030351 | 3300046459 | Bacteria | 3833 |
| 745 | Ga0495638_0041781 | 3300046460 | Bacteria | 2899 |
| 746 | Ga0495638_0111690 | 3300046460 | Bacteria | 1623 |
| 747 | Ga0495606_0023054 | 3300046507 | Bacteria | 4522 |
| 748 | Ga0495618_0064406 | 3300046514 | Bacteria | 2329 |
| 749 | Ga0495630_0039693 | 3300046517 | Bacteria | 3519 |
| 750 | Ga0495648_0000729 | 3300046524 | Bacteria | 35114 |
| 751 | Ga0495640_0203557 | 3300046533 | Bacteria | 1254 |
| 752 | Ga0495586_0069535 | 3300046535 | Bacteria | 1922 |
| 753 | Ga0495587_0034069 | 3300046536 | Bacteria | 3072 |
| 754 | Ga0495597_0043155 | 3300046542 | Bacteria | 2009 |
| 755 | Ga0495645_0085214 | 3300046543 | Bacteria | 2262 |
| 756 | Ga0495645_0216424 | 3300046543 | Bacteria | 1291 |
| 757 | Ga0495667_0061751 | 3300046559 | Bacteria | 2456 |
| 758 | Ga0495668_0003157 | 3300046616 | Bacteria | 12703 |
| 759 | Ga0495611_0000316 | 3300046648 | Bacteria | 32353 |
| 760 | Ga0495635_0065078 | 3300046663 | Bacteria | 2502 |
| 761 | Ga0495657_0110001 | 3300046675 | Unclassified | 1747 |
| 762 | Ga0495599_0098943 | 3300046678 | Bacteria | 1818 |
| 763 | Ga0495623_0250200 | 3300046679 | Bacteria | 997 |
| 764 | Ga0495658_0001038 | 3300046683 | Bacteria | 14680 |
| 765 | Ga0495613_0166910 | 3300046689 | Bacteria | 1564 |
| 766 | Ga0495600_0270391 | 3300046809 | Bacteria | 1078 |
| 767 | Ga0495604_0172447 | 3300047317 | Bacteria | 1520 |
| 768 | Ga0495674_0033659 | 3300047319 | Bacteria | 4640 |
| 769 | Ga0495674_0124114 | 3300047319 | Bacteria | 2180 |
| 770 | Ga0495674_0215275 | 3300047319 | Bacteria | 1590 |
| 771 | Ga0495672_0034698 | 3300047320 | Bacteria | 3114 |
| 772 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 773 | Ga0495684_0089845 | 3300047471 | Bacteria | 2327 |
| 774 | Ga0496102_0404100 | 3300048905 | Bacteria | 1284 |
| 775 | Ga0496104_0401564 | 3300048907 | Bacteria | 1283 |
| 776 | Ga0496109_0033713 | 3300048912 | Bacteria | 4608 |
| 777 | Ga0496110_0325144 | 3300048913 | Bacteria | 1401 |
| 778 | Ga0496122_0000876 | 3300048925 | Bacteria | 56653 |
| 779 | Ga0496123_0000777 | 3300048926 | Bacteria | 51679 |
| 780 | Ga0496125_0078267 | 3300048928 | Bacteria | 2543 |
| 781 | Ga0501031_0004191 | 3300049568 | Bacteria | 9316 |
| 782 | Ga0501032_0006084 | 3300049569 | Bacteria | 8894 |
| 783 | Ga0501032_0055065 | 3300049569 | Bacteria | 2676 |
| 784 | Ga0501032_0117772 | 3300049569 | Bacteria | 1756 |
| 785 | Ga0501033_0012835 | 3300049570 | Bacteria | 6389 |
| 786 | Ga0501034_0000399 | 3300049571 | Bacteria | 73348 |
| 787 | Ga0501034_0001952 | 3300049571 | Bacteria | 26110 |
| 788 | Ga0501034_0003741 | 3300049571 | Bacteria | 17186 |
| 789 | Ga0501034_0004761 | 3300049571 | Bacteria | 15020 |
| 790 | Ga0501034_0122751 | 3300049571 | Bacteria | 2583 |
| 791 | Ga0501034_0159730 | 3300049571 | Bacteria | 2226 |
| 792 | Ga0501034_0376929 | 3300049571 | Bacteria | 1344 |
| 793 | Ga0501036_0114367 | 3300049572 | Bacteria | 2280 |
| 794 | Ga0501036_0250446 | 3300049572 | Bacteria | 1484 |
| 795 | Ga0501037_0002106 | 3300049573 | Bacteria | 14423 |
| 796 | Ga0501037_0002722 | 3300049573 | Bacteria | 12784 |
| 797 | Ga0501037_0024528 | 3300049573 | Bacteria | 4460 |
| 798 | Ga0501038_0014847 | 3300049574 | Bacteria | 7093 |
| 799 | Ga0501038_0026682 | 3300049574 | Bacteria | 5143 |
| 800 | Ga0501039_0013726 | 3300049575 | Bacteria | 6197 |
| 801 | Ga0501043_0008083 | 3300049579 | Bacteria | 8301 |
| 802 | Ga0501043_0030462 | 3300049579 | Bacteria | 4240 |
| 803 | Ga0501043_0123616 | 3300049579 | Bacteria | 2029 |
| 804 | Ga0501043_0354251 | 3300049579 | Bacteria | 1115 |
| 805 | Ga0501046_0074556 | 3300049580 | Bacteria | 2632 |
| 806 | Ga0501047_0007662 | 3300049581 | Bacteria | 10170 |
| 807 | Ga0501047_0376061 | 3300049581 | Bacteria | 1255 |
| 808 | Ga0501067_0023993 | 3300049583 | Bacteria | 3382 |
| 809 | Ga0501067_0031262 | 3300049583 | Bacteria | 2954 |
| 810 | Ga0501070_0221249 | 3300049586 | Bacteria | 1552 |
| 811 | Ga0501073_0010966 | 3300049589 | Bacteria | 6630 |
| 812 | Ga0501074_0008264 | 3300049590 | Bacteria | 7545 |
| 813 | Ga0501202_000479 | 3300049652 | Bacteria | 5704 |
| 814 | Ga0501217_005940 | 3300049661 | Bacteria | 2573 |
| 815 | Ga0501223_000506 | 3300049663 | Bacteria | 9452 |
| 816 | Ga0501224_000674 | 3300049664 | Bacteria | 4254 |
| 817 | Ga0501233_000572 | 3300049668 | Bacteria | 5983 |
| 818 | Ga0501235_032644 | 3300049669 | Bacteria | 1178 |
| 819 | Ga0501250_001689 | 3300049680 | Bacteria | 1881 |
| 820 | Ga0501252_002344 | 3300049682 | Bacteria | 1872 |
| 821 | Ga0501259_000316 | 3300049688 | Bacteria | 7659 |
| 822 | Ga0501261_012254 | 3300049690 | Bacteria | 1152 |
| 823 | Ga0501219_000931 | 3300049703 | Bacteria | 3551 |
| 824 | Ga0501221_001361 | 3300049704 | Bacteria | 4026 |
| 825 | Ga0501225_0000782 | 3300049705 | Bacteria | 9942 |
| 826 | Ga0501225_0017687 | 3300049705 | Bacteria | 1979 |
| 827 | Ga0501234_000503 | 3300049707 | Bacteria | 6004 |
| 828 | Ga0501245_000412 | 3300049708 | Bacteria | 5157 |
| 829 | Ga0501079_0047494 | 3300049741 | Bacteria | 3312 |
| 830 | Ga0501080_0214118 | 3300049742 | Bacteria | 1765 |
| 831 | Ga0501083_0002808 | 3300049744 | Bacteria | 12018 |
| 832 | Ga0501083_0208482 | 3300049744 | Bacteria | 1274 |
| 833 | Ga0501232_006986 | 3300049757 | Bacteria | 1177 |
| 834 | Ga0501266_002255 | 3300049763 | Bacteria | 2440 |
| 835 | Ga0501035_0022258 | 3300049822 | Bacteria | 5820 |
| 836 | Ga0501035_0025743 | 3300049822 | Bacteria | 5393 |
| 837 | Ga0501035_0026724 | 3300049822 | Bacteria | 5279 |
| 838 | Ga0501035_0109967 | 3300049822 | Bacteria | 2416 |
| 839 | Ga0501044_0003545 | 3300049823 | Bacteria | 17566 |
| 840 | Ga0501044_0018651 | 3300049823 | Bacteria | 7432 |
| 841 | Ga0501044_0021617 | 3300049823 | Bacteria | 6860 |
| 842 | Ga0501044_0140905 | 3300049823 | Bacteria | 2400 |
| 843 | Ga0501044_0141400 | 3300049823 | Bacteria | 2395 |
| 844 | Ga0501044_0200150 | 3300049823 | Bacteria | 1956 |
| 845 | Ga0501045_0230668 | 3300049824 | Bacteria | 1378 |
| 846 | Ga0501284_00011 | 3300050005 | Bacteria | 131008 |
| 847 | nmdc:mga0k408_245116_c1 | 3300050493 | Bacteria | 1070 |
| 848 | nmdc:mga05p37_148186_c1 | 3300050507 | Bacteria | 2872 |
| 849 | nmdc:mga05p37_194378_c1 | 3300050507 | Unclassified | 2461 |
| 850 | nmdc:mga05p37_6154_c1 | 3300050507 | Bacteria | 5009 |
| 851 | nmdc:mga05p37_703725_c1 | 3300050507 | Bacteria | 1122 |
| 852 | nmdc:mga09592_69357_c1 | 3300050508 | Bacteria | 2991 |
| 853 | nmdc:mga0qj67_271037_c1 | 3300050509 | Bacteria | 1376 |
| 854 | nmdc:mga0qj67_38975_c1 | 3300050509 | Bacteria | 3730 |
| 855 | nmdc:mga06r32_13952_c1 | 3300050510 | Bacteria | 7290 |
| 856 | nmdc:mga06r32_23480_c1 | 3300050510 | Bacteria | 5706 |
| 857 | nmdc:mga08y16_120340_c1 | 3300050511 | Bacteria | 2732 |
| 858 | nmdc:mga0n895_144049_c1 | 3300050512 | Bacteria | 2412 |
| 859 | nmdc:mga0n895_96389_c1 | 3300050512 | Bacteria | 2963 |
| 860 | nmdc:mga08x19_36_c1 | 3300050514 | Bacteria | 179752 |
| 861 | Ga0495619_0046804 | 3300053085 | Bacteria | 2846 |
| 862 | Ga0495619_0057302 | 3300053085 | Bacteria | 2585 |
| 863 | Ga0500578_0014967 | 3300053086 | Bacteria | 4983 |
| 864 | Ga0500583_0000075 | 3300053092 | Bacteria | 59561 |
| 865 | Ga0500583_0000796 | 3300053092 | Bacteria | 9111 |
| 866 | Ga0500583_0000989 | 3300053092 | Bacteria | 8077 |
| 867 | Ga0500568_0016276 | 3300053139 | Bacteria | 3311 |
| 868 | Ga0500589_009515 | 3300053147 | Bacteria | 4113 |
| 869 | Ga0500622_0054836 | 3300053156 | Bacteria | 2043 |
| 870 | Ga0500622_0101515 | 3300053156 | Bacteria | 1416 |
| 871 | Ga0500611_000031 | 3300053727 | Bacteria | 85821 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031251 | Ga0265327_10000574 | Ga0265327_1000057449 | 293 |
| 2 | 3300028563 | Ga0265319_1005291 | Ga0265319_10052913 | 295 |
| 3 | 3300042876 | Ga0451577_0206165 | Ga0451577_0206165_660_1604 | 298 |
| 4 | 3300006237 | Ga0097621_100016846 | Ga0097621_1000168463 | 299 |
| 5 | 3300005458 | Ga0070681_10044327 | Ga0070681_100443273 | 301 |
| 6 | 3300009551 | Ga0105238_10008890 | Ga0105238_100088904 | 301 |
| 7 | 3300025913 | Ga0207695_10064274 | Ga0207695_100642742 | 301 |
| 8 | 3300044901 | Ga0466960_0108543 | Ga0466960_0108543_487_1392 | 301 |
| 9 | 3300053139 | Ga0500568_0016276 | Ga0500568_0016276_1616_2521 | 301 |
| 10 | 3300005616 | Ga0068852_100023529 | Ga0068852_1000235292 | 302 |
| 11 | 3300009174 | Ga0105241_10135519 | Ga0105241_101355192 | 302 |
| 12 | 3300010375 | Ga0105239_10001527 | Ga0105239_1000152715 | 302 |
| 13 | 3300014968 | Ga0157379_10244657 | Ga0157379_102446572 | 302 |
| 14 | 3300025907 | Ga0207645_10170415 | Ga0207645_101704151 | 302 |
| 15 | 3300026023 | Ga0207677_10429518 | Ga0207677_104295181 | 302 |
| 16 | 3300026118 | Ga0207675_100191008 | Ga0207675_1001910083 | 302 |
| 17 | 3300031616 | Ga0307508_10000559 | Ga0307508_1000055911 | 302 |
| 18 | 3300044656 | Ga0466969_0000612 | Ga0466969_0000612_12399_13316 | 302 |
| 19 | 3300044735 | Ga0466968_0098319 | Ga0466968_0098319_151_1092 | 302 |
| 20 | 3300045049 | Ga0466959_0000002 | Ga0466959_0000002_246039_246956 | 302 |
| 21 | 3300049570 | Ga0501033_0012835 | Ga0501033_0012835_45_953 | 302 |
| 22 | 3300049690 | Ga0501261_012254 | Ga0501261_012254_201_1109 | 302 |
| 23 | 3300050509 | nmdc:mga0qj67_271037_c1 | nmdc:mga0qj67_271037_c1_448_1356 | 302 |
| 24 | 3300042007 | Ga0439449_0005909 | Ga0439449_0005909_1766_2746 | 304 |
| 25 | 3300025936 | Ga0207670_10186272 | Ga0207670_101862721 | 305 |
| 26 | 3300025321 | Ga0207656_10102980 | Ga0207656_101029801 | 306 |
| 27 | 3300037418 | Ga0395900_0102964 | Ga0395900_0102964_256_1212 | 306 |
| 28 | 3300005334 | Ga0068869_100026133 | Ga0068869_1000261333 | 307 |
| 29 | 3300005335 | Ga0070666_10000043 | Ga0070666_1000004339 | 307 |
| 30 | 3300005616 | Ga0068852_100026331 | Ga0068852_1000263315 | 307 |
| 31 | 3300005617 | Ga0068859_100000012 | Ga0068859_100000012142 | 307 |
| 32 | 3300005618 | Ga0068864_100005117 | Ga0068864_1000051179 | 307 |
| 33 | 3300005834 | Ga0068851_10178396 | Ga0068851_101783961 | 307 |
| 34 | 3300005841 | Ga0068863_100006838 | Ga0068863_1000068389 | 307 |
| 35 | 3300005842 | Ga0068858_100005154 | Ga0068858_10000515413 | 307 |
| 36 | 3300005844 | Ga0068862_100000995 | Ga0068862_1000009954 | 307 |
| 37 | 3300006237 | Ga0097621_100206975 | Ga0097621_1002069752 | 307 |
| 38 | 3300006931 | Ga0097620_100000012 | Ga0097620_100000012142 | 307 |
| 39 | 3300009098 | Ga0105245_10167309 | Ga0105245_101673093 | 307 |
| 40 | 3300009101 | Ga0105247_10006231 | Ga0105247_100062316 | 307 |
| 41 | 3300009174 | Ga0105241_10001105 | Ga0105241_1000110515 | 307 |
| 42 | 3300009545 | Ga0105237_10000725 | Ga0105237_1000072526 | 307 |
| 43 | 3300013105 | Ga0157369_10344186 | Ga0157369_103441862 | 307 |
| 44 | 3300013306 | Ga0163162_10004470 | Ga0163162_100044707 | 307 |
| 45 | 3300014325 | Ga0163163_10115435 | Ga0163163_101154353 | 307 |
| 46 | 3300014968 | Ga0157379_10108486 | Ga0157379_101084862 | 307 |
| 47 | 3300014969 | Ga0157376_10055901 | Ga0157376_100559012 | 307 |
| 48 | 3300025900 | Ga0207710_10004413 | Ga0207710_100044133 | 307 |
| 49 | 3300025903 | Ga0207680_10000108 | Ga0207680_1000010832 | 307 |
| 50 | 3300025911 | Ga0207654_10005154 | Ga0207654_100051542 | 307 |
| 51 | 3300025927 | Ga0207687_10167260 | Ga0207687_101672601 | 307 |
| 52 | 3300025942 | Ga0207689_10001398 | Ga0207689_1000139818 | 307 |
| 53 | 3300025961 | Ga0207712_10018237 | Ga0207712_100182372 | 307 |
| 54 | 3300026035 | Ga0207703_10001495 | Ga0207703_1000149517 | 307 |
| 55 | 3300026088 | Ga0207641_10000048 | Ga0207641_1000004812 | 307 |
| 56 | 3300026095 | Ga0207676_10007252 | Ga0207676_100072522 | 307 |
| 57 | 3300028380 | Ga0268265_10000662 | Ga0268265_1000066220 | 307 |
| 58 | 3300050507 | nmdc:mga05p37_703725_c1 | nmdc:mga05p37_703725_c1_122_1063 | 307 |
| 59 | 3300013297 | Ga0157378_10124509 | Ga0157378_101245092 | 308 |
| 60 | 3300005328 | Ga0070676_10000103 | Ga0070676_100001038 | 310 |
| 61 | 3300005338 | Ga0068868_100000358 | Ga0068868_10000035811 | 310 |
| 62 | 3300005339 | Ga0070660_100157651 | Ga0070660_1001576512 | 310 |
| 63 | 3300005347 | Ga0070668_100000308 | Ga0070668_10000030819 | 310 |
| 64 | 3300005354 | Ga0070675_100060036 | Ga0070675_1000600362 | 310 |
| 65 | 3300005364 | Ga0070673_100000232 | Ga0070673_10000023215 | 310 |
| 66 | 3300005367 | Ga0070667_100000583 | Ga0070667_10000058318 | 310 |
| 67 | 3300005367 | Ga0070667_100154928 | Ga0070667_1001549282 | 310 |
| 68 | 3300005459 | Ga0068867_100018459 | Ga0068867_1000184592 | 310 |
| 69 | 3300005539 | Ga0068853_100030060 | Ga0068853_1000300602 | 310 |
| 70 | 3300005543 | Ga0070672_100000345 | Ga0070672_10000034517 | 310 |
| 71 | 3300005548 | Ga0070665_100001618 | Ga0070665_10000161817 | 310 |
| 72 | 3300005563 | Ga0068855_100028910 | Ga0068855_1000289103 | 310 |
| 73 | 3300005564 | Ga0070664_100062879 | Ga0070664_1000628793 | 310 |
| 74 | 3300005616 | Ga0068852_100035776 | Ga0068852_1000357762 | 310 |
| 75 | 3300005618 | Ga0068864_100004460 | Ga0068864_1000044602 | 310 |
| 76 | 3300005834 | Ga0068851_10007180 | Ga0068851_100071804 | 310 |
| 77 | 3300005841 | Ga0068863_100001439 | Ga0068863_1000014396 | 310 |
| 78 | 3300005842 | Ga0068858_100005079 | Ga0068858_1000050795 | 310 |
| 79 | 3300005843 | Ga0068860_100000662 | Ga0068860_10000066218 | 310 |
| 80 | 3300006237 | Ga0097621_100021813 | Ga0097621_1000218135 | 310 |
| 81 | 3300006358 | Ga0068871_100039722 | Ga0068871_1000397222 | 310 |
| 82 | 3300006881 | Ga0068865_100000668 | Ga0068865_10000066811 | 310 |
| 83 | 3300006914 | Ga0075436_100000145 | Ga0075436_1000001455 | 310 |
| 84 | 3300009093 | Ga0105240_10148232 | Ga0105240_101482322 | 310 |
| 85 | 3300009098 | Ga0105245_10278965 | Ga0105245_102789652 | 310 |
| 86 | 3300009148 | Ga0105243_10189580 | Ga0105243_101895802 | 310 |
| 87 | 3300009176 | Ga0105242_10433148 | Ga0105242_104331482 | 310 |
| 88 | 3300009545 | Ga0105237_10163378 | Ga0105237_101633782 | 310 |
| 89 | 3300009551 | Ga0105238_10062082 | Ga0105238_100620825 | 310 |
| 90 | 3300009553 | Ga0105249_10000682 | Ga0105249_1000068211 | 310 |
| 91 | 3300010375 | Ga0105239_10089304 | Ga0105239_100893043 | 310 |
| 92 | 3300011119 | Ga0105246_10036756 | Ga0105246_100367563 | 310 |
| 93 | 3300013296 | Ga0157374_10000484 | Ga0157374_1000048418 | 310 |
| 94 | 3300013297 | Ga0157378_10051359 | Ga0157378_100513594 | 310 |
| 95 | 3300013306 | Ga0163162_10000484 | Ga0163162_1000048418 | 310 |
| 96 | 3300013308 | Ga0157375_10000619 | Ga0157375_1000061918 | 310 |
| 97 | 3300014325 | Ga0163163_10000499 | Ga0163163_1000049918 | 310 |
| 98 | 3300014326 | Ga0157380_10201513 | Ga0157380_102015132 | 310 |
| 99 | 3300014968 | Ga0157379_10001386 | Ga0157379_100013864 | 310 |
| 100 | 3300014969 | Ga0157376_10000798 | Ga0157376_100007987 | 310 |
| 101 | 3300025321 | Ga0207656_10002904 | Ga0207656_100029045 | 310 |
| 102 | 3300025903 | Ga0207680_10023781 | Ga0207680_100237812 | 310 |
| 103 | 3300025909 | Ga0207705_10003522 | Ga0207705_100035229 | 310 |
| 104 | 3300025913 | Ga0207695_10139675 | Ga0207695_101396752 | 310 |
| 105 | 3300025927 | Ga0207687_10179791 | Ga0207687_101797912 | 310 |
| 106 | 3300025934 | Ga0207686_10300972 | Ga0207686_103009721 | 310 |
| 107 | 3300025940 | Ga0207691_10000549 | Ga0207691_1000054918 | 310 |
| 108 | 3300025945 | Ga0207679_10220471 | Ga0207679_102204711 | 310 |
| 109 | 3300025949 | Ga0207667_10148118 | Ga0207667_101481182 | 310 |
| 110 | 3300025960 | Ga0207651_10000231 | Ga0207651_1000023112 | 310 |
| 111 | 3300025961 | Ga0207712_10151399 | Ga0207712_101513992 | 310 |
| 112 | 3300025972 | Ga0207668_10000639 | Ga0207668_100006398 | 310 |
| 113 | 3300025986 | Ga0207658_10000942 | Ga0207658_1000094219 | 310 |
| 114 | 3300026023 | Ga0207677_10001537 | Ga0207677_100015378 | 310 |
| 115 | 3300026035 | Ga0207703_10008239 | Ga0207703_100082395 | 310 |
| 116 | 3300026041 | Ga0207639_10025344 | Ga0207639_100253442 | 310 |
| 117 | 3300026088 | Ga0207641_10000890 | Ga0207641_100008909 | 310 |
| 118 | 3300026089 | Ga0207648_10016719 | Ga0207648_100167192 | 310 |
| 119 | 3300026095 | Ga0207676_10023539 | Ga0207676_100235392 | 310 |
| 120 | 3300026142 | Ga0207698_10017469 | Ga0207698_100174693 | 310 |
| 121 | 3300028379 | Ga0268266_10046754 | Ga0268266_100467542 | 310 |
| 122 | 3300028381 | Ga0268264_10001550 | Ga0268264_1000155018 | 310 |
| 123 | 3300048905 | Ga0496102_0404100 | Ga0496102_0404100_313_1269 | 310 |
| 124 | 3300048912 | Ga0496109_0033713 | Ga0496109_0033713_1826_2782 | 310 |
| 125 | 3300050514 | nmdc:mga08x19_36_c1 | nmdc:mga08x19_36_c1_2267_3217 | 310 |
| 126 | 3300027682 | Ga0209971_1010305 | Ga0209971_10103052 | 311 |
| 127 | 3300027876 | Ga0209974_10015827 | Ga0209974_100158272 | 311 |
| 128 | 3300028654 | Ga0265322_10033668 | Ga0265322_100336682 | 311 |
| 129 | 3300029957 | Ga0265324_10014904 | Ga0265324_100149041 | 311 |
| 130 | 3300031239 | Ga0265328_10020370 | Ga0265328_100203702 | 311 |
| 131 | 3300031251 | Ga0265327_10010600 | Ga0265327_100106005 | 311 |
| 132 | iso_pu_bacteria | 2738541283 | 2738756062 | 311 |
| 133 | iso_pu_bacteria | 2775506987 | 2776616081 | 311 |
| 134 | 3300004799 | Ga0058863_11897022 | Ga0058863_118970222 | 312 |
| 135 | 3300004803 | Ga0058862_10028396 | Ga0058862_100283963 | 312 |
| 136 | 3300005327 | Ga0070658_10009081 | Ga0070658_100090811 | 312 |
| 137 | 3300005336 | Ga0070680_100001109 | Ga0070680_1000011098 | 312 |
| 138 | 3300005345 | Ga0070692_10255199 | Ga0070692_102551991 | 312 |
| 139 | 3300005455 | Ga0070663_100225988 | Ga0070663_1002259881 | 312 |
| 140 | 3300005455 | Ga0070663_100244775 | Ga0070663_1002447751 | 312 |
| 141 | 3300005458 | Ga0070681_10005409 | Ga0070681_1000540911 | 312 |
| 142 | 3300005530 | Ga0070679_100031280 | Ga0070679_1000312803 | 312 |
| 143 | 3300005563 | Ga0068855_100087593 | Ga0068855_1000875934 | 312 |
| 144 | 3300005578 | Ga0068854_100095628 | Ga0068854_1000956282 | 312 |
| 145 | 3300005614 | Ga0068856_100149457 | Ga0068856_1001494571 | 312 |
| 146 | 3300013100 | Ga0157373_10049038 | Ga0157373_100490383 | 312 |
| 147 | 3300013102 | Ga0157371_10039145 | Ga0157371_100391454 | 312 |
| 148 | 3300013104 | Ga0157370_10000673 | Ga0157370_1000067317 | 312 |
| 149 | 3300013105 | Ga0157369_10006046 | Ga0157369_1000604611 | 312 |
| 150 | 3300013307 | Ga0157372_10041409 | Ga0157372_100414096 | 312 |
| 151 | 3300025909 | Ga0207705_10004003 | Ga0207705_1000400310 | 312 |
| 152 | 3300025912 | Ga0207707_10002754 | Ga0207707_1000275411 | 312 |
| 153 | 3300025919 | Ga0207657_10269804 | Ga0207657_102698042 | 312 |
| 154 | 3300025921 | Ga0207652_10000074 | Ga0207652_1000007492 | 312 |
| 155 | 3300025921 | Ga0207652_10000942 | Ga0207652_1000094219 | 312 |
| 156 | 3300025921 | Ga0207652_10446859 | Ga0207652_104468591 | 312 |
| 157 | 3300025949 | Ga0207667_10016655 | Ga0207667_1001665511 | 312 |
| 158 | 3300026067 | Ga0207678_10008491 | Ga0207678_100084919 | 312 |
| 159 | 3300026067 | Ga0207678_10277976 | Ga0207678_102779762 | 312 |
| 160 | 3300026078 | Ga0207702_10089251 | Ga0207702_100892512 | 312 |
| 161 | 3300037312 | Ga0395899_0032866 | Ga0395899_0032866_1231_2169 | 312 |
| 162 | 3300037418 | Ga0395900_0058464 | Ga0395900_0058464_2381_3319 | 312 |
| 163 | 3300037418 | Ga0395900_0426261 | Ga0395900_0426261_168_1106 | 312 |
| 164 | 3300037466 | Ga0395898_0013786 | Ga0395898_0013786_2862_3800 | 312 |
| 165 | 3300037466 | Ga0395898_0268154 | Ga0395898_0268154_449_1387 | 312 |
| 166 | 3300038443 | Ga0395901_0050159 | Ga0395901_0050159_1135_2073 | 312 |
| 167 | 3300005329 | Ga0070683_100013464 | Ga0070683_1000134647 | 313 |
| 168 | 3300005337 | Ga0070682_100163862 | Ga0070682_1001638622 | 313 |
| 169 | 3300005344 | Ga0070661_100003722 | Ga0070661_1000037227 | 313 |
| 170 | 3300005366 | Ga0070659_100026117 | Ga0070659_1000261172 | 313 |
| 171 | 3300005455 | Ga0070663_100313151 | Ga0070663_1003131512 | 313 |
| 172 | 3300005535 | Ga0070684_100011702 | Ga0070684_1000117028 | 313 |
| 173 | 3300005539 | Ga0068853_100000097 | Ga0068853_1000000978 | 313 |
| 174 | 3300005564 | Ga0070664_100011562 | Ga0070664_1000115622 | 313 |
| 175 | 3300005577 | Ga0068857_100435101 | Ga0068857_1004351011 | 313 |
| 176 | 3300013100 | Ga0157373_10045344 | Ga0157373_100453441 | 313 |
| 177 | 3300013100 | Ga0157373_10069976 | Ga0157373_100699762 | 313 |
| 178 | 3300013102 | Ga0157371_10020600 | Ga0157371_100206004 | 313 |
| 179 | 3300013307 | Ga0157372_10321435 | Ga0157372_103214352 | 313 |
| 180 | 3300025920 | Ga0207649_10078676 | Ga0207649_100786762 | 313 |
| 181 | 3300025932 | Ga0207690_10008634 | Ga0207690_100086342 | 313 |
| 182 | 3300025944 | Ga0207661_10003834 | Ga0207661_100038343 | 313 |
| 183 | 3300025945 | Ga0207679_10000408 | Ga0207679_1000040820 | 313 |
| 184 | 3300026041 | Ga0207639_10008794 | Ga0207639_100087946 | 313 |
| 185 | 3300026067 | Ga0207678_10354078 | Ga0207678_103540781 | 313 |
| 186 | 3300026116 | Ga0207674_10006350 | Ga0207674_100063501 | 313 |
| 187 | 3300028786 | Ga0307517_10028299 | Ga0307517_100282994 | 313 |
| 188 | 3300032168 | Ga0316593_10057904 | Ga0316593_100579041 | 313 |
| 189 | 3300035085 | Ga0373929_0000001 | Ga0373929_0000001_63689_64684 | 313 |
| 190 | 3300044658 | Ga0466972_0018317 | Ga0466972_0018317_1053_2039 | 313 |
| 191 | 3300046675 | Ga0495657_0110001 | Ga0495657_0110001_328_1269 | 313 |
| 192 | 3300046809 | Ga0495600_0270391 | Ga0495600_0270391_108_1049 | 313 |
| 193 | iso_pu_bacteria | 2738541278 | 2738727099 | 313 |
| 194 | 3300005834 | Ga0068851_10000252 | Ga0068851_1000025210 | 314 |
| 195 | 3300006871 | Ga0075434_100134102 | Ga0075434_1001341022 | 314 |
| 196 | 3300009553 | Ga0105249_10347647 | Ga0105249_103476472 | 314 |
| 197 | 3300014326 | Ga0157380_10003845 | Ga0157380_100038453 | 314 |
| 198 | 3300025321 | Ga0207656_10000749 | Ga0207656_100007495 | 314 |
| 199 | 3300025961 | Ga0207712_10179103 | Ga0207712_101791031 | 314 |
| 200 | 3300028556 | Ga0265337_1053442 | Ga0265337_10534421 | 314 |
| 201 | 3300028563 | Ga0265319_1000024 | Ga0265319_100002432 | 314 |
| 202 | 3300028654 | Ga0265322_10021854 | Ga0265322_100218542 | 314 |
| 203 | 3300031240 | Ga0265320_10001210 | Ga0265320_1000121017 | 314 |
| 204 | 3300031240 | Ga0265320_10004206 | Ga0265320_100042066 | 314 |
| 205 | 3300031241 | Ga0265325_10042533 | Ga0265325_100425333 | 314 |
| 206 | 3300031251 | Ga0265327_10000450 | Ga0265327_1000045030 | 314 |
| 207 | 3300031251 | Ga0265327_10035910 | Ga0265327_100359102 | 314 |
| 208 | 3300031595 | Ga0265313_10130601 | Ga0265313_101306011 | 314 |
| 209 | 3300031711 | Ga0265314_10001696 | Ga0265314_1000169615 | 314 |
| 210 | 3300042876 | Ga0451577_0000023 | Ga0451577_0000023_395892_396893 | 314 |
| 211 | 3300044712 | Ga0453684_0023992 | Ga0453684_0023992_2614_3618 | 314 |
| 212 | 3300050512 | nmdc:mga0n895_144049_c1 | nmdc:mga0n895_144049_c1_971_2017 | 314 |
| 213 | 3300005289 | Ga0065704_10001598 | Ga0065704_100015985 | 315 |
| 214 | 3300005434 | Ga0070709_10000005 | Ga0070709_100000055 | 315 |
| 215 | 3300005466 | Ga0070685_10002988 | Ga0070685_100029882 | 315 |
| 216 | 3300005539 | Ga0068853_100000501 | Ga0068853_1000005013 | 315 |
| 217 | 3300005563 | Ga0068855_100138006 | Ga0068855_1001380063 | 315 |
| 218 | 3300005577 | Ga0068857_100022608 | Ga0068857_1000226083 | 315 |
| 219 | 3300005616 | Ga0068852_100001785 | Ga0068852_1000017854 | 315 |
| 220 | 3300005843 | Ga0068860_100007619 | Ga0068860_1000076195 | 315 |
| 221 | 3300006871 | Ga0075434_100323199 | Ga0075434_1003231992 | 315 |
| 222 | 3300006881 | Ga0068865_100219682 | Ga0068865_1002196822 | 315 |
| 223 | 3300009093 | Ga0105240_10000147 | Ga0105240_1000014793 | 315 |
| 224 | 3300009093 | Ga0105240_10000168 | Ga0105240_1000016888 | 315 |
| 225 | 3300009093 | Ga0105240_10012035 | Ga0105240_100120354 | 315 |
| 226 | 3300009093 | Ga0105240_10015585 | Ga0105240_100155853 | 315 |
| 227 | 3300009093 | Ga0105240_10050139 | Ga0105240_100501392 | 315 |
| 228 | 3300009147 | Ga0114129_10528836 | Ga0114129_105288362 | 315 |
| 229 | 3300009545 | Ga0105237_10000394 | Ga0105237_1000039429 | 315 |
| 230 | 3300009545 | Ga0105237_10008284 | Ga0105237_100082849 | 315 |
| 231 | 3300009545 | Ga0105237_10023397 | Ga0105237_100233975 | 315 |
| 232 | 3300010375 | Ga0105239_10001529 | Ga0105239_1000152918 | 315 |
| 233 | 3300010375 | Ga0105239_10016372 | Ga0105239_100163725 | 315 |
| 234 | 3300010375 | Ga0105239_10139506 | Ga0105239_101395062 | 315 |
| 235 | 3300013102 | Ga0157371_10001603 | Ga0157371_100016036 | 315 |
| 236 | 3300013104 | Ga0157370_10006476 | Ga0157370_100064764 | 315 |
| 237 | 3300013104 | Ga0157370_10012429 | Ga0157370_100124295 | 315 |
| 238 | 3300013105 | Ga0157369_10020699 | Ga0157369_100206993 | 315 |
| 239 | 3300013307 | Ga0157372_10000317 | Ga0157372_1000031726 | 315 |
| 240 | 3300014497 | Ga0182008_10000053 | Ga0182008_1000005371 | 315 |
| 241 | 3300015261 | Ga0182006_1000270 | Ga0182006_100027044 | 315 |
| 242 | 3300025903 | Ga0207680_10188619 | Ga0207680_101886191 | 315 |
| 243 | 3300025909 | Ga0207705_10026286 | Ga0207705_100262863 | 315 |
| 244 | 3300025911 | Ga0207654_10308749 | Ga0207654_103087491 | 315 |
| 245 | 3300025913 | Ga0207695_10000023 | Ga0207695_10000023214 | 315 |
| 246 | 3300025913 | Ga0207695_10000031 | Ga0207695_10000031355 | 315 |
| 247 | 3300025913 | Ga0207695_10028819 | Ga0207695_100288193 | 315 |
| 248 | 3300025914 | Ga0207671_10000925 | Ga0207671_100009251 | 315 |
| 249 | 3300025924 | Ga0207694_10012838 | Ga0207694_100128384 | 315 |
| 250 | 3300025928 | Ga0207700_10309229 | Ga0207700_103092291 | 315 |
| 251 | 3300025949 | Ga0207667_10000773 | Ga0207667_1000077316 | 315 |
| 252 | 3300025972 | Ga0207668_10378447 | Ga0207668_103784471 | 315 |
| 253 | 3300026041 | Ga0207639_10041522 | Ga0207639_100415222 | 315 |
| 254 | 3300026041 | Ga0207639_10164611 | Ga0207639_101646112 | 315 |
| 255 | 3300026116 | Ga0207674_10055408 | Ga0207674_100554084 | 315 |
| 256 | 3300026142 | Ga0207698_10035232 | Ga0207698_100352322 | 315 |
| 257 | 3300028381 | Ga0268264_10000950 | Ga0268264_100009506 | 315 |
| 258 | 3300032004 | Ga0307414_10001307 | Ga0307414_100013074 | 315 |
| 259 | 3300035725 | Ga0373947_0149681 | Ga0373947_0149681_284_1321 | 315 |
| 260 | 3300041505 | Ga0451849_0746662 | Ga0451849_0746662_334_1293 | 315 |
| 261 | 3300048925 | Ga0496122_0000876 | Ga0496122_0000876_19334_20437 | 315 |
| 262 | 3300048926 | Ga0496123_0000777 | Ga0496123_0000777_28869_29972 | 315 |
| 263 | 3300048928 | Ga0496125_0078267 | Ga0496125_0078267_1474_2526 | 315 |
| 264 | 3300049744 | Ga0501083_0002808 | Ga0501083_0002808_9111_10148 | 315 |
| 265 | 3300050512 | nmdc:mga0n895_96389_c1 | nmdc:mga0n895_96389_c1_521_1504 | 315 |
| 266 | 3300003320 | rootH2_10016843 | rootH2_100168432 | 316 |
| 267 | 3300005327 | Ga0070658_10168037 | Ga0070658_101680373 | 316 |
| 268 | 3300005329 | Ga0070683_100002537 | Ga0070683_1000025378 | 316 |
| 269 | 3300005331 | Ga0070670_100189196 | Ga0070670_1001891962 | 316 |
| 270 | 3300005335 | Ga0070666_10008965 | Ga0070666_100089653 | 316 |
| 271 | 3300005335 | Ga0070666_10010785 | Ga0070666_100107852 | 316 |
| 272 | 3300005338 | Ga0068868_100010933 | Ga0068868_1000109336 | 316 |
| 273 | 3300005338 | Ga0068868_100113611 | Ga0068868_1001136112 | 316 |
| 274 | 3300005338 | Ga0068868_100156118 | Ga0068868_1001561182 | 316 |
| 275 | 3300005339 | Ga0070660_100110434 | Ga0070660_1001104344 | 316 |
| 276 | 3300005347 | Ga0070668_100216686 | Ga0070668_1002166861 | 316 |
| 277 | 3300005354 | Ga0070675_100338717 | Ga0070675_1003387172 | 316 |
| 278 | 3300005355 | Ga0070671_100099251 | Ga0070671_1000992511 | 316 |
| 279 | 3300005355 | Ga0070671_100162476 | Ga0070671_1001624762 | 316 |
| 280 | 3300005365 | Ga0070688_100002313 | Ga0070688_1000023133 | 316 |
| 281 | 3300005367 | Ga0070667_100062669 | Ga0070667_1000626692 | 316 |
| 282 | 3300005367 | Ga0070667_100304283 | Ga0070667_1003042831 | 316 |
| 283 | 3300005457 | Ga0070662_100004745 | Ga0070662_1000047453 | 316 |
| 284 | 3300005459 | Ga0068867_100075190 | Ga0068867_1000751902 | 316 |
| 285 | 3300005459 | Ga0068867_100078110 | Ga0068867_1000781102 | 316 |
| 286 | 3300005535 | Ga0070684_100218736 | Ga0070684_1002187362 | 316 |
| 287 | 3300005539 | Ga0068853_100236061 | Ga0068853_1002360612 | 316 |
| 288 | 3300005548 | Ga0070665_100000041 | Ga0070665_100000041188 | 316 |
| 289 | 3300005548 | Ga0070665_100707618 | Ga0070665_1007076181 | 316 |
| 290 | 3300005563 | Ga0068855_100000957 | Ga0068855_10000095714 | 316 |
| 291 | 3300005564 | Ga0070664_100257278 | Ga0070664_1002572782 | 316 |
| 292 | 3300005577 | Ga0068857_100061838 | Ga0068857_1000618383 | 316 |
| 293 | 3300005578 | Ga0068854_100059917 | Ga0068854_1000599173 | 316 |
| 294 | 3300005614 | Ga0068856_100071316 | Ga0068856_1000713162 | 316 |
| 295 | 3300005614 | Ga0068856_100288614 | Ga0068856_1002886142 | 316 |
| 296 | 3300005615 | Ga0070702_100025113 | Ga0070702_1000251133 | 316 |
| 297 | 3300005616 | Ga0068852_100116153 | Ga0068852_1001161532 | 316 |
| 298 | 3300005617 | Ga0068859_100015958 | Ga0068859_1000159587 | 316 |
| 299 | 3300005617 | Ga0068859_100056360 | Ga0068859_1000563603 | 316 |
| 300 | 3300005617 | Ga0068859_100064054 | Ga0068859_1000640543 | 316 |
| 301 | 3300005618 | Ga0068864_100054233 | Ga0068864_1000542333 | 316 |
| 302 | 3300005842 | Ga0068858_100015472 | Ga0068858_1000154723 | 316 |
| 303 | 3300005842 | Ga0068858_100283136 | Ga0068858_1002831362 | 316 |
| 304 | 3300005843 | Ga0068860_100000208 | Ga0068860_10000020811 | 316 |
| 305 | 3300005843 | Ga0068860_100385511 | Ga0068860_1003855112 | 316 |
| 306 | 3300006358 | Ga0068871_100043066 | Ga0068871_1000430663 | 316 |
| 307 | 3300006931 | Ga0097620_100015958 | Ga0097620_1000159583 | 316 |
| 308 | 3300006931 | Ga0097620_100056360 | Ga0097620_1000563603 | 316 |
| 309 | 3300006931 | Ga0097620_100064052 | Ga0097620_1000640523 | 316 |
| 310 | 3300009093 | Ga0105240_10000224 | Ga0105240_1000022455 | 316 |
| 311 | 3300009545 | Ga0105237_10020325 | Ga0105237_100203253 | 316 |
| 312 | 3300009551 | Ga0105238_10000247 | Ga0105238_1000024718 | 316 |
| 313 | 3300010375 | Ga0105239_10015328 | Ga0105239_100153282 | 316 |
| 314 | 3300010375 | Ga0105239_10156469 | Ga0105239_101564692 | 316 |
| 315 | 3300013100 | Ga0157373_10011321 | Ga0157373_100113215 | 316 |
| 316 | 3300013102 | Ga0157371_10001840 | Ga0157371_1000184011 | 316 |
| 317 | 3300013102 | Ga0157371_10023994 | Ga0157371_100239944 | 316 |
| 318 | 3300013104 | Ga0157370_10002442 | Ga0157370_1000244222 | 316 |
| 319 | 3300013306 | Ga0163162_10001520 | Ga0163162_1000152018 | 316 |
| 320 | 3300013306 | Ga0163162_10011289 | Ga0163162_100112892 | 316 |
| 321 | 3300013306 | Ga0163162_10040262 | Ga0163162_100402622 | 316 |
| 322 | 3300013306 | Ga0163162_10211306 | Ga0163162_102113062 | 316 |
| 323 | 3300013307 | Ga0157372_10008771 | Ga0157372_100087718 | 316 |
| 324 | 3300013307 | Ga0157372_10068608 | Ga0157372_100686082 | 316 |
| 325 | 3300013308 | Ga0157375_10062153 | Ga0157375_100621535 | 316 |
| 326 | 3300013308 | Ga0157375_10423317 | Ga0157375_104233172 | 316 |
| 327 | 3300014325 | Ga0163163_10001833 | Ga0163163_100018331 | 316 |
| 328 | 3300014325 | Ga0163163_10229914 | Ga0163163_102299142 | 316 |
| 329 | 3300014968 | Ga0157379_10024256 | Ga0157379_100242563 | 316 |
| 330 | 3300014968 | Ga0157379_10386536 | Ga0157379_103865361 | 316 |
| 331 | 3300025899 | Ga0207642_10154944 | Ga0207642_101549441 | 316 |
| 332 | 3300025903 | Ga0207680_10029990 | Ga0207680_100299902 | 316 |
| 333 | 3300025903 | Ga0207680_10153135 | Ga0207680_101531351 | 316 |
| 334 | 3300025907 | Ga0207645_10018557 | Ga0207645_100185574 | 316 |
| 335 | 3300025912 | Ga0207707_10022737 | Ga0207707_100227372 | 316 |
| 336 | 3300025913 | Ga0207695_10002344 | Ga0207695_100023447 | 316 |
| 337 | 3300025914 | Ga0207671_10003957 | Ga0207671_1000395712 | 316 |
| 338 | 3300025920 | Ga0207649_10003147 | Ga0207649_100031475 | 316 |
| 339 | 3300025924 | Ga0207694_10020081 | Ga0207694_100200813 | 316 |
| 340 | 3300025926 | Ga0207659_10018772 | Ga0207659_100187722 | 316 |
| 341 | 3300025926 | Ga0207659_10274612 | Ga0207659_102746122 | 316 |
| 342 | 3300025933 | Ga0207706_10002124 | Ga0207706_100021248 | 316 |
| 343 | 3300025933 | Ga0207706_10057700 | Ga0207706_100577002 | 316 |
| 344 | 3300025933 | Ga0207706_10094248 | Ga0207706_100942482 | 316 |
| 345 | 3300025936 | Ga0207670_10059712 | Ga0207670_100597122 | 316 |
| 346 | 3300025936 | Ga0207670_10100189 | Ga0207670_101001892 | 316 |
| 347 | 3300025942 | Ga0207689_10031756 | Ga0207689_100317562 | 316 |
| 348 | 3300025944 | Ga0207661_10043853 | Ga0207661_100438534 | 316 |
| 349 | 3300025945 | Ga0207679_10007934 | Ga0207679_100079346 | 316 |
| 350 | 3300025949 | Ga0207667_10006879 | Ga0207667_1000687910 | 316 |
| 351 | 3300025960 | Ga0207651_10031683 | Ga0207651_100316832 | 316 |
| 352 | 3300025981 | Ga0207640_10225111 | Ga0207640_102251112 | 316 |
| 353 | 3300025986 | Ga0207658_10021496 | Ga0207658_100214962 | 316 |
| 354 | 3300026023 | Ga0207677_10012359 | Ga0207677_100123592 | 316 |
| 355 | 3300026023 | Ga0207677_10036418 | Ga0207677_100364182 | 316 |
| 356 | 3300026035 | Ga0207703_10024850 | Ga0207703_100248503 | 316 |
| 357 | 3300026035 | Ga0207703_10044403 | Ga0207703_100444033 | 316 |
| 358 | 3300026041 | Ga0207639_10219030 | Ga0207639_102190302 | 316 |
| 359 | 3300026078 | Ga0207702_10138633 | Ga0207702_101386332 | 316 |
| 360 | 3300026089 | Ga0207648_10012771 | Ga0207648_100127714 | 316 |
| 361 | 3300026089 | Ga0207648_10077795 | Ga0207648_100777953 | 316 |
| 362 | 3300026089 | Ga0207648_10079711 | Ga0207648_100797112 | 316 |
| 363 | 3300026121 | Ga0207683_10009230 | Ga0207683_100092305 | 316 |
| 364 | 3300028379 | Ga0268266_10000014 | Ga0268266_100000147 | 316 |
| 365 | 3300028381 | Ga0268264_10000041 | Ga0268264_1000004174 | 316 |
| 366 | 3300028786 | Ga0307517_10056242 | Ga0307517_100562423 | 316 |
| 367 | 3300035410 | Ga0373924_0087645 | Ga0373924_0087645_123_1073 | 316 |
| 368 | 3300035724 | Ga0373933_0055165 | Ga0373933_0055165_1070_2020 | 316 |
| 369 | 3300036401 | Ga0373937_0056226 | Ga0373937_0056226_838_1788 | 316 |
| 370 | 3300037312 | Ga0395899_0052141 | Ga0395899_0052141_379_1329 | 316 |
| 371 | 3300037418 | Ga0395900_0071857 | Ga0395900_0071857_2506_3456 | 316 |
| 372 | 3300037418 | Ga0395900_0173545 | Ga0395900_0173545_1109_2059 | 316 |
| 373 | 3300037466 | Ga0395898_0004078 | Ga0395898_0004078_5380_6330 | 316 |
| 374 | 3300037471 | Ga0395905_0018814 | Ga0395905_0018814_2297_3283 | 316 |
| 375 | 3300037471 | Ga0395905_0061145 | Ga0395905_0061145_1479_2429 | 316 |
| 376 | 3300038443 | Ga0395901_0002083 | Ga0395901_0002083_570_1520 | 316 |
| 377 | 3300038443 | Ga0395901_0294133 | Ga0395901_0294133_619_1605 | 316 |
| 378 | 3300044658 | Ga0466972_0007139 | Ga0466972_0007139_3716_4675 | 316 |
| 379 | 3300046514 | Ga0495618_0064406 | Ga0495618_0064406_1099_2049 | 316 |
| 380 | 3300046517 | Ga0495630_0039693 | Ga0495630_0039693_2199_3149 | 316 |
| 381 | 3300046524 | Ga0495648_0000729 | Ga0495648_0000729_13799_14758 | 316 |
| 382 | 3300046535 | Ga0495586_0069535 | Ga0495586_0069535_251_1201 | 316 |
| 383 | 3300046536 | Ga0495587_0034069 | Ga0495587_0034069_2094_3044 | 316 |
| 384 | 3300046542 | Ga0495597_0043155 | Ga0495597_0043155_1005_1964 | 316 |
| 385 | 3300046543 | Ga0495645_0216424 | Ga0495645_0216424_83_1033 | 316 |
| 386 | 3300046559 | Ga0495667_0061751 | Ga0495667_0061751_278_1228 | 316 |
| 387 | 3300046663 | Ga0495635_0065078 | Ga0495635_0065078_842_1792 | 316 |
| 388 | 3300046678 | Ga0495599_0098943 | Ga0495599_0098943_364_1314 | 316 |
| 389 | 3300046689 | Ga0495613_0166910 | Ga0495613_0166910_40_990 | 316 |
| 390 | 3300047317 | Ga0495604_0172447 | Ga0495604_0172447_168_1118 | 316 |
| 391 | 3300047319 | Ga0495674_0124114 | Ga0495674_0124114_733_1683 | 316 |
| 392 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_83587_84546 | 316 |
| 393 | 3300047471 | Ga0495684_0089845 | Ga0495684_0089845_1156_2106 | 316 |
| 394 | 3300048907 | Ga0496104_0401564 | Ga0496104_0401564_93_1157 | 316 |
| 395 | 3300048913 | Ga0496110_0325144 | Ga0496110_0325144_232_1290 | 316 |
| 396 | 3300053085 | Ga0495619_0057302 | Ga0495619_0057302_1559_2509 | 316 |
| 397 | 3300053092 | Ga0500583_0000989 | Ga0500583_0000989_739_1698 | 316 |
| 398 | 3300053156 | Ga0500622_0054836 | Ga0500622_0054836_978_1937 | 316 |
| 399 | 3300002459 | JGI24751J29686_10000523 | JGI24751J29686_100005237 | 317 |
| 400 | 3300003203 | JGI25406J46586_10042359 | JGI25406J46586_100423591 | 317 |
| 401 | 3300003320 | rootH2_10008717 | rootH2_100087174 | 317 |
| 402 | 3300003320 | rootH2_10009544 | rootH2_1000954420 | 317 |
| 403 | 3300003320 | rootH2_10043528 | rootH2_100435282 | 317 |
| 404 | 3300003322 | rootL2_10048659 | rootL2_100486593 | 317 |
| 405 | 3300003322 | rootL2_10049027 | rootL2_100490275 | 317 |
| 406 | 3300003323 | rootH1_10027473 | rootH1_100274737 | 317 |
| 407 | 3300003354 | JGI25160J50197_1000391 | JGI25160J50197_100039121 | 317 |
| 408 | 3300005288 | Ga0065714_10008149 | Ga0065714_100081493 | 317 |
| 409 | 3300005290 | Ga0065712_10005043 | Ga0065712_100050433 | 317 |
| 410 | 3300005290 | Ga0065712_10005395 | Ga0065712_100053953 | 317 |
| 411 | 3300005290 | Ga0065712_10084305 | Ga0065712_100843052 | 317 |
| 412 | 3300005290 | Ga0065712_10087336 | Ga0065712_100873362 | 317 |
| 413 | 3300005293 | Ga0065715_10170227 | Ga0065715_101702272 | 317 |
| 414 | 3300005295 | Ga0065707_10005338 | Ga0065707_100053382 | 317 |
| 415 | 3300005327 | Ga0070658_10006339 | Ga0070658_100063399 | 317 |
| 416 | 3300005327 | Ga0070658_10091759 | Ga0070658_100917592 | 317 |
| 417 | 3300005328 | Ga0070676_10236260 | Ga0070676_102362601 | 317 |
| 418 | 3300005329 | Ga0070683_100021425 | Ga0070683_1000214252 | 317 |
| 419 | 3300005330 | Ga0070690_100011893 | Ga0070690_1000118931 | 317 |
| 420 | 3300005331 | Ga0070670_100042984 | Ga0070670_1000429843 | 317 |
| 421 | 3300005331 | Ga0070670_100044182 | Ga0070670_1000441823 | 317 |
| 422 | 3300005331 | Ga0070670_100077802 | Ga0070670_1000778022 | 317 |
| 423 | 3300005333 | Ga0070677_10023834 | Ga0070677_100238342 | 317 |
| 424 | 3300005334 | Ga0068869_100116676 | Ga0068869_1001166762 | 317 |
| 425 | 3300005335 | Ga0070666_10214398 | Ga0070666_102143981 | 317 |
| 426 | 3300005336 | Ga0070680_100139397 | Ga0070680_1001393974 | 317 |
| 427 | 3300005337 | Ga0070682_100001222 | Ga0070682_1000012225 | 317 |
| 428 | 3300005338 | Ga0068868_100023528 | Ga0068868_1000235285 | 317 |
| 429 | 3300005338 | Ga0068868_100035794 | Ga0068868_1000357943 | 317 |
| 430 | 3300005338 | Ga0068868_100084289 | Ga0068868_1000842892 | 317 |
| 431 | 3300005338 | Ga0068868_100228677 | Ga0068868_1002286771 | 317 |
| 432 | 3300005339 | Ga0070660_100154298 | Ga0070660_1001542981 | 317 |
| 433 | 3300005340 | Ga0070689_100013710 | Ga0070689_1000137102 | 317 |
| 434 | 3300005340 | Ga0070689_100054252 | Ga0070689_1000542523 | 317 |
| 435 | 3300005340 | Ga0070689_100177674 | Ga0070689_1001776742 | 317 |
| 436 | 3300005340 | Ga0070689_100230095 | Ga0070689_1002300952 | 317 |
| 437 | 3300005341 | Ga0070691_10011704 | Ga0070691_100117043 | 317 |
| 438 | 3300005343 | Ga0070687_100066040 | Ga0070687_1000660402 | 317 |
| 439 | 3300005344 | Ga0070661_100291045 | Ga0070661_1002910451 | 317 |
| 440 | 3300005347 | Ga0070668_100124154 | Ga0070668_1001241542 | 317 |
| 441 | 3300005347 | Ga0070668_100426451 | Ga0070668_1004264511 | 317 |
| 442 | 3300005353 | Ga0070669_100082384 | Ga0070669_1000823842 | 317 |
| 443 | 3300005354 | Ga0070675_100019600 | Ga0070675_1000196005 | 317 |
| 444 | 3300005354 | Ga0070675_100022363 | Ga0070675_1000223633 | 317 |
| 445 | 3300005355 | Ga0070671_100008263 | Ga0070671_1000082633 | 317 |
| 446 | 3300005355 | Ga0070671_100065974 | Ga0070671_1000659742 | 317 |
| 447 | 3300005356 | Ga0070674_100015249 | Ga0070674_1000152492 | 317 |
| 448 | 3300005356 | Ga0070674_100133037 | Ga0070674_1001330372 | 317 |
| 449 | 3300005364 | Ga0070673_100015106 | Ga0070673_1000151062 | 317 |
| 450 | 3300005364 | Ga0070673_100030266 | Ga0070673_1000302662 | 317 |
| 451 | 3300005364 | Ga0070673_100039411 | Ga0070673_1000394111 | 317 |
| 452 | 3300005364 | Ga0070673_100165717 | Ga0070673_1001657171 | 317 |
| 453 | 3300005364 | Ga0070673_100321580 | Ga0070673_1003215801 | 317 |
| 454 | 3300005365 | Ga0070688_100013129 | Ga0070688_1000131293 | 317 |
| 455 | 3300005365 | Ga0070688_100041662 | Ga0070688_1000416623 | 317 |
| 456 | 3300005366 | Ga0070659_100003286 | Ga0070659_1000032865 | 317 |
| 457 | 3300005366 | Ga0070659_100339075 | Ga0070659_1003390751 | 317 |
| 458 | 3300005367 | Ga0070667_100008582 | Ga0070667_1000085825 | 317 |
| 459 | 3300005367 | Ga0070667_100170495 | Ga0070667_1001704952 | 317 |
| 460 | 3300005455 | Ga0070663_100091453 | Ga0070663_1000914532 | 317 |
| 461 | 3300005456 | Ga0070678_100279444 | Ga0070678_1002794442 | 317 |
| 462 | 3300005457 | Ga0070662_100003591 | Ga0070662_1000035918 | 317 |
| 463 | 3300005458 | Ga0070681_10046320 | Ga0070681_100463204 | 317 |
| 464 | 3300005458 | Ga0070681_10066331 | Ga0070681_100663313 | 317 |
| 465 | 3300005458 | Ga0070681_10074154 | Ga0070681_100741542 | 317 |
| 466 | 3300005459 | Ga0068867_100026320 | Ga0068867_1000263203 | 317 |
| 467 | 3300005459 | Ga0068867_100060080 | Ga0068867_1000600802 | 317 |
| 468 | 3300005459 | Ga0068867_100133897 | Ga0068867_1001338972 | 317 |
| 469 | 3300005459 | Ga0068867_100219902 | Ga0068867_1002199022 | 317 |
| 470 | 3300005466 | Ga0070685_10004337 | Ga0070685_100043371 | 317 |
| 471 | 3300005466 | Ga0070685_10010428 | Ga0070685_100104286 | 317 |
| 472 | 3300005471 | Ga0070698_100000866 | Ga0070698_10000086611 | 317 |
| 473 | 3300005471 | Ga0070698_100003054 | Ga0070698_10000305411 | 317 |
| 474 | 3300005471 | Ga0070698_100389607 | Ga0070698_1003896071 | 317 |
| 475 | 3300005530 | Ga0070679_100010138 | Ga0070679_1000101385 | 317 |
| 476 | 3300005530 | Ga0070679_100104310 | Ga0070679_1001043101 | 317 |
| 477 | 3300005535 | Ga0070684_100008118 | Ga0070684_1000081185 | 317 |
| 478 | 3300005535 | Ga0070684_100010258 | Ga0070684_1000102585 | 317 |
| 479 | 3300005539 | Ga0068853_100014007 | Ga0068853_1000140073 | 317 |
| 480 | 3300005539 | Ga0068853_100512523 | Ga0068853_1005125231 | 317 |
| 481 | 3300005543 | Ga0070672_100216034 | Ga0070672_1002160342 | 317 |
| 482 | 3300005544 | Ga0070686_100183996 | Ga0070686_1001839962 | 317 |
| 483 | 3300005563 | Ga0068855_100000704 | Ga0068855_10000070422 | 317 |
| 484 | 3300005563 | Ga0068855_100012898 | Ga0068855_1000128986 | 317 |
| 485 | 3300005563 | Ga0068855_100029350 | Ga0068855_1000293506 | 317 |
| 486 | 3300005563 | Ga0068855_100059952 | Ga0068855_1000599524 | 317 |
| 487 | 3300005563 | Ga0068855_100129819 | Ga0068855_1001298192 | 317 |
| 488 | 3300005564 | Ga0070664_100022602 | Ga0070664_1000226027 | 317 |
| 489 | 3300005564 | Ga0070664_100149551 | Ga0070664_1001495512 | 317 |
| 490 | 3300005577 | Ga0068857_100031575 | Ga0068857_1000315754 | 317 |
| 491 | 3300005577 | Ga0068857_100052589 | Ga0068857_1000525893 | 317 |
| 492 | 3300005577 | Ga0068857_100097054 | Ga0068857_1000970543 | 317 |
| 493 | 3300005577 | Ga0068857_100166228 | Ga0068857_1001662282 | 317 |
| 494 | 3300005578 | Ga0068854_100063658 | Ga0068854_1000636583 | 317 |
| 495 | 3300005578 | Ga0068854_100133600 | Ga0068854_1001336002 | 317 |
| 496 | 3300005614 | Ga0068856_100007898 | Ga0068856_1000078988 | 317 |
| 497 | 3300005614 | Ga0068856_100039447 | Ga0068856_1000394471 | 317 |
| 498 | 3300005614 | Ga0068856_100051092 | Ga0068856_1000510924 | 317 |
| 499 | 3300005615 | Ga0070702_100071258 | Ga0070702_1000712582 | 317 |
| 500 | 3300005616 | Ga0068852_100000503 | Ga0068852_1000005033 | 317 |
| 501 | 3300005616 | Ga0068852_100017293 | Ga0068852_1000172936 | 317 |
| 502 | 3300005617 | Ga0068859_100091984 | Ga0068859_1000919842 | 317 |
| 503 | 3300005617 | Ga0068859_100178112 | Ga0068859_1001781123 | 317 |
| 504 | 3300005618 | Ga0068864_100037534 | Ga0068864_1000375343 | 317 |
| 505 | 3300005618 | Ga0068864_100091855 | Ga0068864_1000918552 | 317 |
| 506 | 3300005618 | Ga0068864_100129762 | Ga0068864_1001297622 | 317 |
| 507 | 3300005618 | Ga0068864_100154783 | Ga0068864_1001547832 | 317 |
| 508 | 3300005718 | Ga0068866_10020849 | Ga0068866_100208493 | 317 |
| 509 | 3300005719 | Ga0068861_100018453 | Ga0068861_1000184533 | 317 |
| 510 | 3300005719 | Ga0068861_100080555 | Ga0068861_1000805552 | 317 |
| 511 | 3300005719 | Ga0068861_100152547 | Ga0068861_1001525472 | 317 |
| 512 | 3300005719 | Ga0068861_100197842 | Ga0068861_1001978422 | 317 |
| 513 | 3300005834 | Ga0068851_10093735 | Ga0068851_100937352 | 317 |
| 514 | 3300005840 | Ga0068870_10068105 | Ga0068870_100681052 | 317 |
| 515 | 3300005841 | Ga0068863_100012618 | Ga0068863_1000126185 | 317 |
| 516 | 3300005841 | Ga0068863_100025607 | Ga0068863_1000256073 | 317 |
| 517 | 3300005841 | Ga0068863_100127766 | Ga0068863_1001277662 | 317 |
| 518 | 3300005841 | Ga0068863_100198507 | Ga0068863_1001985072 | 317 |
| 519 | 3300005841 | Ga0068863_100228489 | Ga0068863_1002284892 | 317 |
| 520 | 3300005842 | Ga0068858_100099889 | Ga0068858_1000998893 | 317 |
| 521 | 3300005842 | Ga0068858_100506182 | Ga0068858_1005061821 | 317 |
| 522 | 3300005843 | Ga0068860_100008645 | Ga0068860_1000086459 | 317 |
| 523 | 3300005843 | Ga0068860_100009954 | Ga0068860_1000099545 | 317 |
| 524 | 3300005843 | Ga0068860_100010746 | Ga0068860_1000107467 | 317 |
| 525 | 3300005843 | Ga0068860_100022849 | Ga0068860_1000228495 | 317 |
| 526 | 3300005844 | Ga0068862_100117931 | Ga0068862_1001179312 | 317 |
| 527 | 3300005844 | Ga0068862_100176292 | Ga0068862_1001762922 | 317 |
| 528 | 3300005844 | Ga0068862_100460084 | Ga0068862_1004600841 | 317 |
| 529 | 3300005983 | Ga0081540_1004197 | Ga0081540_10041976 | 317 |
| 530 | 3300005985 | Ga0081539_10000641 | Ga0081539_1000064164 | 317 |
| 531 | 3300006237 | Ga0097621_100013920 | Ga0097621_1000139201 | 317 |
| 532 | 3300006237 | Ga0097621_100021374 | Ga0097621_1000213742 | 317 |
| 533 | 3300006237 | Ga0097621_100042206 | Ga0097621_1000422061 | 317 |
| 534 | 3300006237 | Ga0097621_100396830 | Ga0097621_1003968301 | 317 |
| 535 | 3300006358 | Ga0068871_100041002 | Ga0068871_1000410022 | 317 |
| 536 | 3300006358 | Ga0068871_100052147 | Ga0068871_1000521473 | 317 |
| 537 | 3300006358 | Ga0068871_100067970 | Ga0068871_1000679704 | 317 |
| 538 | 3300006358 | Ga0068871_100189228 | Ga0068871_1001892282 | 317 |
| 539 | 3300006358 | Ga0068871_100277916 | Ga0068871_1002779162 | 317 |
| 540 | 3300006844 | Ga0075428_100003010 | Ga0075428_10000301010 | 317 |
| 541 | 3300006844 | Ga0075428_100009333 | Ga0075428_1000093333 | 317 |
| 542 | 3300006844 | Ga0075428_100145976 | Ga0075428_1001459761 | 317 |
| 543 | 3300006846 | Ga0075430_100010608 | Ga0075430_1000106082 | 317 |
| 544 | 3300006847 | Ga0075431_100014282 | Ga0075431_1000142823 | 317 |
| 545 | 3300006847 | Ga0075431_100040230 | Ga0075431_1000402304 | 317 |
| 546 | 3300006880 | Ga0075429_100001277 | Ga0075429_1000012779 | 317 |
| 547 | 3300006880 | Ga0075429_100006151 | Ga0075429_1000061512 | 317 |
| 548 | 3300006880 | Ga0075429_100010161 | Ga0075429_1000101617 | 317 |
| 549 | 3300006881 | Ga0068865_100239471 | Ga0068865_1002394713 | 317 |
| 550 | 3300006931 | Ga0097620_100015117 | Ga0097620_1000151173 | 317 |
| 551 | 3300006931 | Ga0097620_100091984 | Ga0097620_1000919842 | 317 |
| 552 | 3300006931 | Ga0097620_100178108 | Ga0097620_1001781083 | 317 |
| 553 | 3300009093 | Ga0105240_10002232 | Ga0105240_100022326 | 317 |
| 554 | 3300009093 | Ga0105240_10011606 | Ga0105240_100116062 | 317 |
| 555 | 3300009094 | Ga0111539_10106295 | Ga0111539_101062953 | 317 |
| 556 | 3300009094 | Ga0111539_10300926 | Ga0111539_103009262 | 317 |
| 557 | 3300009094 | Ga0111539_10347418 | Ga0111539_103474182 | 317 |
| 558 | 3300009098 | Ga0105245_10418514 | Ga0105245_104185141 | 317 |
| 559 | 3300009101 | Ga0105247_10003609 | Ga0105247_100036095 | 317 |
| 560 | 3300009147 | Ga0114129_10050987 | Ga0114129_100509875 | 317 |
| 561 | 3300009147 | Ga0114129_10156378 | Ga0114129_101563783 | 317 |
| 562 | 3300009174 | Ga0105241_10003487 | Ga0105241_1000348711 | 317 |
| 563 | 3300009176 | Ga0105242_10004172 | Ga0105242_100041725 | 317 |
| 564 | 3300009176 | Ga0105242_10023320 | Ga0105242_100233202 | 317 |
| 565 | 3300009176 | Ga0105242_10138177 | Ga0105242_101381771 | 317 |
| 566 | 3300009176 | Ga0105242_10176648 | Ga0105242_101766482 | 317 |
| 567 | 3300009176 | Ga0105242_10291805 | Ga0105242_102918052 | 317 |
| 568 | 3300009176 | Ga0105242_10340758 | Ga0105242_103407581 | 317 |
| 569 | 3300009177 | Ga0105248_10080222 | Ga0105248_100802223 | 317 |
| 570 | 3300009545 | Ga0105237_10031327 | Ga0105237_100313272 | 317 |
| 571 | 3300009545 | Ga0105237_10163384 | Ga0105237_101633842 | 317 |
| 572 | 3300009545 | Ga0105237_10176590 | Ga0105237_101765902 | 317 |
| 573 | 3300009553 | Ga0105249_10001215 | Ga0105249_1000121515 | 317 |
| 574 | 3300009553 | Ga0105249_10006750 | Ga0105249_100067505 | 317 |
| 575 | 3300009553 | Ga0105249_10007592 | Ga0105249_100075928 | 317 |
| 576 | 3300009553 | Ga0105249_10130907 | Ga0105249_101309072 | 317 |
| 577 | 3300009553 | Ga0105249_10736266 | Ga0105249_107362661 | 317 |
| 578 | 3300010375 | Ga0105239_10000370 | Ga0105239_1000037052 | 317 |
| 579 | 3300010375 | Ga0105239_10016797 | Ga0105239_100167976 | 317 |
| 580 | 3300010375 | Ga0105239_10115880 | Ga0105239_101158803 | 317 |
| 581 | 3300013100 | Ga0157373_10002303 | Ga0157373_100023035 | 317 |
| 582 | 3300013100 | Ga0157373_10036875 | Ga0157373_100368751 | 317 |
| 583 | 3300013102 | Ga0157371_10002945 | Ga0157371_1000294522 | 317 |
| 584 | 3300013102 | Ga0157371_10004684 | Ga0157371_100046843 | 317 |
| 585 | 3300013102 | Ga0157371_10006217 | Ga0157371_100062174 | 317 |
| 586 | 3300013102 | Ga0157371_10010000 | Ga0157371_100100003 | 317 |
| 587 | 3300013102 | Ga0157371_10079965 | Ga0157371_100799652 | 317 |
| 588 | 3300013104 | Ga0157370_10061605 | Ga0157370_100616055 | 317 |
| 589 | 3300013104 | Ga0157370_10188489 | Ga0157370_101884892 | 317 |
| 590 | 3300013104 | Ga0157370_10497213 | Ga0157370_104972131 | 317 |
| 591 | 3300013105 | Ga0157369_10005363 | Ga0157369_1000536314 | 317 |
| 592 | 3300013105 | Ga0157369_10042847 | Ga0157369_100428473 | 317 |
| 593 | 3300013105 | Ga0157369_10135356 | Ga0157369_101353562 | 317 |
| 594 | 3300013296 | Ga0157374_10008174 | Ga0157374_100081744 | 317 |
| 595 | 3300013296 | Ga0157374_10258798 | Ga0157374_102587982 | 317 |
| 596 | 3300013296 | Ga0157374_10281103 | Ga0157374_102811032 | 317 |
| 597 | 3300013297 | Ga0157378_10002633 | Ga0157378_100026332 | 317 |
| 598 | 3300013297 | Ga0157378_10016242 | Ga0157378_100162424 | 317 |
| 599 | 3300013297 | Ga0157378_10021011 | Ga0157378_100210116 | 317 |
| 600 | 3300013297 | Ga0157378_10024687 | Ga0157378_100246871 | 317 |
| 601 | 3300013297 | Ga0157378_10117790 | Ga0157378_101177903 | 317 |
| 602 | 3300013297 | Ga0157378_10122157 | Ga0157378_101221572 | 317 |
| 603 | 3300013297 | Ga0157378_10309322 | Ga0157378_103093222 | 317 |
| 604 | 3300013306 | Ga0163162_10012241 | Ga0163162_100122418 | 317 |
| 605 | 3300013306 | Ga0163162_10122684 | Ga0163162_101226843 | 317 |
| 606 | 3300013306 | Ga0163162_10134112 | Ga0163162_101341122 | 317 |
| 607 | 3300013306 | Ga0163162_10245938 | Ga0163162_102459381 | 317 |
| 608 | 3300013306 | Ga0163162_10616806 | Ga0163162_106168061 | 317 |
| 609 | 3300013307 | Ga0157372_10002225 | Ga0157372_100022258 | 317 |
| 610 | 3300013307 | Ga0157372_10025878 | Ga0157372_100258787 | 317 |
| 611 | 3300013307 | Ga0157372_10030136 | Ga0157372_100301363 | 317 |
| 612 | 3300013307 | Ga0157372_10045321 | Ga0157372_100453213 | 317 |
| 613 | 3300013307 | Ga0157372_10092305 | Ga0157372_100923052 | 317 |
| 614 | 3300013307 | Ga0157372_10138015 | Ga0157372_101380152 | 317 |
| 615 | 3300013307 | Ga0157372_10153519 | Ga0157372_101535192 | 317 |
| 616 | 3300013307 | Ga0157372_10158282 | Ga0157372_101582822 | 317 |
| 617 | 3300013307 | Ga0157372_10178337 | Ga0157372_101783373 | 317 |
| 618 | 3300013307 | Ga0157372_10210106 | Ga0157372_102101062 | 317 |
| 619 | 3300013307 | Ga0157372_10225257 | Ga0157372_102252572 | 317 |
| 620 | 3300013307 | Ga0157372_10514886 | Ga0157372_105148861 | 317 |
| 621 | 3300013308 | Ga0157375_10011699 | Ga0157375_100116995 | 317 |
| 622 | 3300013308 | Ga0157375_10276498 | Ga0157375_102764982 | 317 |
| 623 | 3300014325 | Ga0163163_10071426 | Ga0163163_100714261 | 317 |
| 624 | 3300014325 | Ga0163163_10236577 | Ga0163163_102365772 | 317 |
| 625 | 3300014326 | Ga0157380_10000174 | Ga0157380_100001744 | 317 |
| 626 | 3300014326 | Ga0157380_10006056 | Ga0157380_100060563 | 317 |
| 627 | 3300014326 | Ga0157380_10033793 | Ga0157380_100337933 | 317 |
| 628 | 3300014745 | Ga0157377_10012471 | Ga0157377_100124713 | 317 |
| 629 | 3300014745 | Ga0157377_10064866 | Ga0157377_100648662 | 317 |
| 630 | 3300014968 | Ga0157379_10134357 | Ga0157379_101343572 | 317 |
| 631 | 3300014969 | Ga0157376_10002100 | Ga0157376_100021007 | 317 |
| 632 | 3300014969 | Ga0157376_10230177 | Ga0157376_102301771 | 317 |
| 633 | 3300014969 | Ga0157376_10265989 | Ga0157376_102659892 | 317 |
| 634 | 3300017792 | Ga0163161_10071986 | Ga0163161_100719862 | 317 |
| 635 | 3300017792 | Ga0163161_10171834 | Ga0163161_101718342 | 317 |
| 636 | 3300017792 | Ga0163161_10193193 | Ga0163161_101931931 | 317 |
| 637 | 3300025302 | Ga0207426_1000059 | Ga0207426_100005988 | 317 |
| 638 | 3300025315 | Ga0207697_10029727 | Ga0207697_100297272 | 317 |
| 639 | 3300025893 | Ga0207682_10016291 | Ga0207682_100162912 | 317 |
| 640 | 3300025900 | Ga0207710_10003944 | Ga0207710_100039443 | 317 |
| 641 | 3300025904 | Ga0207647_10000050 | Ga0207647_1000005063 | 317 |
| 642 | 3300025908 | Ga0207643_10003946 | Ga0207643_100039463 | 317 |
| 643 | 3300025909 | Ga0207705_10111435 | Ga0207705_101114352 | 317 |
| 644 | 3300025909 | Ga0207705_10217638 | Ga0207705_102176382 | 317 |
| 645 | 3300025909 | Ga0207705_10313810 | Ga0207705_103138101 | 317 |
| 646 | 3300025911 | Ga0207654_10001573 | Ga0207654_100015733 | 317 |
| 647 | 3300025911 | Ga0207654_10066742 | Ga0207654_100667422 | 317 |
| 648 | 3300025912 | Ga0207707_10001470 | Ga0207707_100014701 | 317 |
| 649 | 3300025912 | Ga0207707_10054892 | Ga0207707_100548922 | 317 |
| 650 | 3300025912 | Ga0207707_10082552 | Ga0207707_100825523 | 317 |
| 651 | 3300025913 | Ga0207695_10000110 | Ga0207695_1000011082 | 317 |
| 652 | 3300025913 | Ga0207695_10061324 | Ga0207695_100613242 | 317 |
| 653 | 3300025914 | Ga0207671_10015072 | Ga0207671_100150722 | 317 |
| 654 | 3300025914 | Ga0207671_10030657 | Ga0207671_100306572 | 317 |
| 655 | 3300025917 | Ga0207660_10004358 | Ga0207660_1000435810 | 317 |
| 656 | 3300025918 | Ga0207662_10011300 | Ga0207662_100113005 | 317 |
| 657 | 3300025919 | Ga0207657_10012180 | Ga0207657_100121806 | 317 |
| 658 | 3300025919 | Ga0207657_10058804 | Ga0207657_100588041 | 317 |
| 659 | 3300025920 | Ga0207649_10041557 | Ga0207649_100415572 | 317 |
| 660 | 3300025920 | Ga0207649_10234816 | Ga0207649_102348161 | 317 |
| 661 | 3300025921 | Ga0207652_10001229 | Ga0207652_100012293 | 317 |
| 662 | 3300025921 | Ga0207652_10166028 | Ga0207652_101660282 | 317 |
| 663 | 3300025921 | Ga0207652_10368146 | Ga0207652_103681462 | 317 |
| 664 | 3300025923 | Ga0207681_10339474 | Ga0207681_103394741 | 317 |
| 665 | 3300025925 | Ga0207650_10008539 | Ga0207650_100085392 | 317 |
| 666 | 3300025925 | Ga0207650_10031450 | Ga0207650_100314503 | 317 |
| 667 | 3300025925 | Ga0207650_10069130 | Ga0207650_100691302 | 317 |
| 668 | 3300025926 | Ga0207659_10006857 | Ga0207659_100068576 | 317 |
| 669 | 3300025932 | Ga0207690_10014218 | Ga0207690_100142183 | 317 |
| 670 | 3300025933 | Ga0207706_10013304 | Ga0207706_100133049 | 317 |
| 671 | 3300025933 | Ga0207706_10308651 | Ga0207706_103086512 | 317 |
| 672 | 3300025934 | Ga0207686_10001998 | Ga0207686_100019982 | 317 |
| 673 | 3300025934 | Ga0207686_10036685 | Ga0207686_100366853 | 317 |
| 674 | 3300025936 | Ga0207670_10021414 | Ga0207670_100214143 | 317 |
| 675 | 3300025937 | Ga0207669_10064033 | Ga0207669_100640331 | 317 |
| 676 | 3300025937 | Ga0207669_10090642 | Ga0207669_100906423 | 317 |
| 677 | 3300025938 | Ga0207704_10130886 | Ga0207704_101308862 | 317 |
| 678 | 3300025940 | Ga0207691_10034712 | Ga0207691_100347123 | 317 |
| 679 | 3300025940 | Ga0207691_10141802 | Ga0207691_101418022 | 317 |
| 680 | 3300025942 | Ga0207689_10025482 | Ga0207689_100254824 | 317 |
| 681 | 3300025942 | Ga0207689_10116372 | Ga0207689_101163723 | 317 |
| 682 | 3300025944 | Ga0207661_10034494 | Ga0207661_100344942 | 317 |
| 683 | 3300025944 | Ga0207661_10140585 | Ga0207661_101405852 | 317 |
| 684 | 3300025944 | Ga0207661_10330189 | Ga0207661_103301892 | 317 |
| 685 | 3300025945 | Ga0207679_10133873 | Ga0207679_101338732 | 317 |
| 686 | 3300025949 | Ga0207667_10000144 | Ga0207667_1000014448 | 317 |
| 687 | 3300025949 | Ga0207667_10024655 | Ga0207667_100246555 | 317 |
| 688 | 3300025949 | Ga0207667_10112046 | Ga0207667_101120462 | 317 |
| 689 | 3300025949 | Ga0207667_10379426 | Ga0207667_103794261 | 317 |
| 690 | 3300025960 | Ga0207651_10093079 | Ga0207651_100930792 | 317 |
| 691 | 3300025960 | Ga0207651_10168249 | Ga0207651_101682492 | 317 |
| 692 | 3300025961 | Ga0207712_10001368 | Ga0207712_100013687 | 317 |
| 693 | 3300025961 | Ga0207712_10001805 | Ga0207712_100018057 | 317 |
| 694 | 3300025961 | Ga0207712_10056597 | Ga0207712_100565973 | 317 |
| 695 | 3300025961 | Ga0207712_10075955 | Ga0207712_100759553 | 317 |
| 696 | 3300025972 | Ga0207668_10108693 | Ga0207668_101086932 | 317 |
| 697 | 3300025981 | Ga0207640_10126428 | Ga0207640_101264282 | 317 |
| 698 | 3300025981 | Ga0207640_10141988 | Ga0207640_101419881 | 317 |
| 699 | 3300025981 | Ga0207640_10186932 | Ga0207640_101869321 | 317 |
| 700 | 3300026023 | Ga0207677_10002319 | Ga0207677_100023193 | 317 |
| 701 | 3300026023 | Ga0207677_10178129 | Ga0207677_101781292 | 317 |
| 702 | 3300026035 | Ga0207703_10100254 | Ga0207703_101002541 | 317 |
| 703 | 3300026041 | Ga0207639_10021703 | Ga0207639_100217031 | 317 |
| 704 | 3300026041 | Ga0207639_10033542 | Ga0207639_100335423 | 317 |
| 705 | 3300026041 | Ga0207639_10191234 | Ga0207639_101912342 | 317 |
| 706 | 3300026067 | Ga0207678_10060450 | Ga0207678_100604502 | 317 |
| 707 | 3300026078 | Ga0207702_10622404 | Ga0207702_106224041 | 317 |
| 708 | 3300026088 | Ga0207641_10003559 | Ga0207641_100035595 | 317 |
| 709 | 3300026088 | Ga0207641_10036683 | Ga0207641_100366832 | 317 |
| 710 | 3300026088 | Ga0207641_10132141 | Ga0207641_101321412 | 317 |
| 711 | 3300026088 | Ga0207641_10147942 | Ga0207641_101479422 | 317 |
| 712 | 3300026088 | Ga0207641_10211171 | Ga0207641_102111712 | 317 |
| 713 | 3300026088 | Ga0207641_10591383 | Ga0207641_105913831 | 317 |
| 714 | 3300026089 | Ga0207648_10036279 | Ga0207648_100362794 | 317 |
| 715 | 3300026089 | Ga0207648_10043490 | Ga0207648_100434902 | 317 |
| 716 | 3300026089 | Ga0207648_10062881 | Ga0207648_100628813 | 317 |
| 717 | 3300026089 | Ga0207648_10063327 | Ga0207648_100633272 | 317 |
| 718 | 3300026089 | Ga0207648_10097823 | Ga0207648_100978233 | 317 |
| 719 | 3300026089 | Ga0207648_10337462 | Ga0207648_103374621 | 317 |
| 720 | 3300026095 | Ga0207676_10115800 | Ga0207676_101158001 | 317 |
| 721 | 3300026095 | Ga0207676_10196544 | Ga0207676_101965441 | 317 |
| 722 | 3300026095 | Ga0207676_10201940 | Ga0207676_102019402 | 317 |
| 723 | 3300026116 | Ga0207674_10033875 | Ga0207674_100338754 | 317 |
| 724 | 3300026116 | Ga0207674_10047591 | Ga0207674_100475913 | 317 |
| 725 | 3300026116 | Ga0207674_10113772 | Ga0207674_101137721 | 317 |
| 726 | 3300026116 | Ga0207674_10118122 | Ga0207674_101181222 | 317 |
| 727 | 3300026116 | Ga0207674_10129479 | Ga0207674_101294792 | 317 |
| 728 | 3300026116 | Ga0207674_10175658 | Ga0207674_101756581 | 317 |
| 729 | 3300026116 | Ga0207674_10460437 | Ga0207674_104604371 | 317 |
| 730 | 3300026118 | Ga0207675_100002480 | Ga0207675_1000024803 | 317 |
| 731 | 3300026118 | Ga0207675_100004172 | Ga0207675_1000041725 | 317 |
| 732 | 3300026118 | Ga0207675_100041592 | Ga0207675_1000415923 | 317 |
| 733 | 3300026118 | Ga0207675_100256227 | Ga0207675_1002562272 | 317 |
| 734 | 3300026118 | Ga0207675_100274520 | Ga0207675_1002745201 | 317 |
| 735 | 3300026121 | Ga0207683_10201519 | Ga0207683_102015192 | 317 |
| 736 | 3300026142 | Ga0207698_10057907 | Ga0207698_100579072 | 317 |
| 737 | 3300026142 | Ga0207698_10081340 | Ga0207698_100813401 | 317 |
| 738 | 3300026142 | Ga0207698_10121189 | Ga0207698_101211891 | 317 |
| 739 | 3300026142 | Ga0207698_10362872 | Ga0207698_103628721 | 317 |
| 740 | 3300027907 | Ga0207428_10114269 | Ga0207428_101142692 | 317 |
| 741 | 3300027907 | Ga0207428_10176102 | Ga0207428_101761021 | 317 |
| 742 | 3300028380 | Ga0268265_10145578 | Ga0268265_101455782 | 317 |
| 743 | 3300028380 | Ga0268265_10159452 | Ga0268265_101594522 | 317 |
| 744 | 3300028381 | Ga0268264_10004303 | Ga0268264_100043035 | 317 |
| 745 | 3300028381 | Ga0268264_10010959 | Ga0268264_100109592 | 317 |
| 746 | 3300028381 | Ga0268264_10020078 | Ga0268264_100200783 | 317 |
| 747 | 3300028381 | Ga0268264_10111010 | Ga0268264_101110101 | 317 |
| 748 | 3300028381 | Ga0268264_10116380 | Ga0268264_101163802 | 317 |
| 749 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002842 | 317 |
| 750 | 3300028794 | Ga0307515_10000039 | Ga0307515_1000003965 | 317 |
| 751 | 3300028800 | Ga0265338_10068391 | Ga0265338_100683912 | 317 |
| 752 | 3300029957 | Ga0265324_10018435 | Ga0265324_100184352 | 317 |
| 753 | 3300030521 | Ga0307511_10000122 | Ga0307511_1000012216 | 317 |
| 754 | 3300031251 | Ga0265327_10000209 | Ga0265327_1000020933 | 317 |
| 755 | 3300031251 | Ga0265327_10000368 | Ga0265327_1000036837 | 317 |
| 756 | 3300031251 | Ga0265327_10000811 | Ga0265327_100008116 | 317 |
| 757 | 3300031251 | Ga0265327_10041982 | Ga0265327_100419822 | 317 |
| 758 | 3300031507 | Ga0307509_10138045 | Ga0307509_101380452 | 317 |
| 759 | 3300031824 | Ga0307413_10186071 | Ga0307413_101860712 | 317 |
| 760 | 3300031852 | Ga0307410_10273745 | Ga0307410_102737452 | 317 |
| 761 | 3300031901 | Ga0307406_10048222 | Ga0307406_100482223 | 317 |
| 762 | 3300032002 | Ga0307416_100225965 | Ga0307416_1002259652 | 317 |
| 763 | 3300033180 | Ga0307510_10000615 | Ga0307510_1000061517 | 317 |
| 764 | 3300033180 | Ga0307510_10211390 | Ga0307510_102113902 | 317 |
| 765 | 3300035725 | Ga0373947_0105322 | Ga0373947_0105322_329_1285 | 317 |
| 766 | 3300036401 | Ga0373937_0200195 | Ga0373937_0200195_142_1098 | 317 |
| 767 | 3300036401 | Ga0373937_0250991 | Ga0373937_0250991_374_1330 | 317 |
| 768 | 3300037312 | Ga0395899_0003607 | Ga0395899_0003607_3738_4691 | 317 |
| 769 | 3300037466 | Ga0395898_0004670 | Ga0395898_0004670_2817_3770 | 317 |
| 770 | 3300037471 | Ga0395905_0001073 | Ga0395905_0001073_32123_33076 | 317 |
| 771 | 3300037471 | Ga0395905_0134267 | Ga0395905_0134267_222_1175 | 317 |
| 772 | 3300038443 | Ga0395901_0006414 | Ga0395901_0006414_1542_2495 | 317 |
| 773 | 3300039437 | Ga0436365_0081746 | Ga0436365_0081746_5176_6129 | 317 |
| 774 | 3300039437 | Ga0436365_1248268 | Ga0436365_1248268_15627_16580 | 317 |
| 775 | 3300042876 | Ga0451577_0004954 | Ga0451577_0004954_11235_12188 | 317 |
| 776 | 3300042876 | Ga0451577_0039022 | Ga0451577_0039022_2379_3332 | 317 |
| 777 | 3300044658 | Ga0466972_0000039 | Ga0466972_0000039_26941_27927 | 317 |
| 778 | 3300044712 | Ga0453684_0061470 | Ga0453684_0061470_2470_3504 | 317 |
| 779 | 3300044712 | Ga0453684_0290603 | Ga0453684_0290603_427_1380 | 317 |
| 780 | 3300044842 | Ga0466957_0004285 | Ga0466957_0004285_3045_4001 | 317 |
| 781 | 3300044842 | Ga0466957_0023080 | Ga0466957_0023080_1776_2762 | 317 |
| 782 | 3300045976 | Ga0466967_0147911 | Ga0466967_0147911_1194_2153 | 317 |
| 783 | 3300046459 | Ga0495629_0030351 | Ga0495629_0030351_1070_2026 | 317 |
| 784 | 3300046460 | Ga0495638_0041781 | Ga0495638_0041781_240_1232 | 317 |
| 785 | 3300046460 | Ga0495638_0111690 | Ga0495638_0111690_555_1508 | 317 |
| 786 | 3300046507 | Ga0495606_0023054 | Ga0495606_0023054_1964_2929 | 317 |
| 787 | 3300046533 | Ga0495640_0203557 | Ga0495640_0203557_253_1209 | 317 |
| 788 | 3300046543 | Ga0495645_0085214 | Ga0495645_0085214_682_1638 | 317 |
| 789 | 3300046616 | Ga0495668_0003157 | Ga0495668_0003157_2519_3472 | 317 |
| 790 | 3300046648 | Ga0495611_0000316 | Ga0495611_0000316_9765_10730 | 317 |
| 791 | 3300046679 | Ga0495623_0250200 | Ga0495623_0250200_22_978 | 317 |
| 792 | 3300046683 | Ga0495658_0001038 | Ga0495658_0001038_1133_2089 | 317 |
| 793 | 3300047319 | Ga0495674_0033659 | Ga0495674_0033659_2024_2980 | 317 |
| 794 | 3300047319 | Ga0495674_0215275 | Ga0495674_0215275_516_1484 | 317 |
| 795 | 3300047320 | Ga0495672_0034698 | Ga0495672_0034698_162_1115 | 317 |
| 796 | 3300049568 | Ga0501031_0004191 | Ga0501031_0004191_4988_5941 | 317 |
| 797 | 3300049569 | Ga0501032_0006084 | Ga0501032_0006084_883_1896 | 317 |
| 798 | 3300049569 | Ga0501032_0055065 | Ga0501032_0055065_678_1631 | 317 |
| 799 | 3300049569 | Ga0501032_0117772 | Ga0501032_0117772_87_1040 | 317 |
| 800 | 3300049571 | Ga0501034_0000399 | Ga0501034_0000399_1557_2510 | 317 |
| 801 | 3300049571 | Ga0501034_0001952 | Ga0501034_0001952_21658_22671 | 317 |
| 802 | 3300049571 | Ga0501034_0003741 | Ga0501034_0003741_6040_6993 | 317 |
| 803 | 3300049571 | Ga0501034_0004761 | Ga0501034_0004761_6115_7071 | 317 |
| 804 | 3300049571 | Ga0501034_0122751 | Ga0501034_0122751_367_1320 | 317 |
| 805 | 3300049571 | Ga0501034_0159730 | Ga0501034_0159730_272_1225 | 317 |
| 806 | 3300049571 | Ga0501034_0376929 | Ga0501034_0376929_50_1006 | 317 |
| 807 | 3300049572 | Ga0501036_0114367 | Ga0501036_0114367_522_1535 | 317 |
| 808 | 3300049572 | Ga0501036_0250446 | Ga0501036_0250446_88_1041 | 317 |
| 809 | 3300049573 | Ga0501037_0002106 | Ga0501037_0002106_6309_7262 | 317 |
| 810 | 3300049573 | Ga0501037_0002722 | Ga0501037_0002722_6176_7129 | 317 |
| 811 | 3300049573 | Ga0501037_0024528 | Ga0501037_0024528_1887_2900 | 317 |
| 812 | 3300049574 | Ga0501038_0014847 | Ga0501038_0014847_483_1436 | 317 |
| 813 | 3300049574 | Ga0501038_0026682 | Ga0501038_0026682_1319_2272 | 317 |
| 814 | 3300049575 | Ga0501039_0013726 | Ga0501039_0013726_354_1307 | 317 |
| 815 | 3300049579 | Ga0501043_0008083 | Ga0501043_0008083_1303_2256 | 317 |
| 816 | 3300049579 | Ga0501043_0030462 | Ga0501043_0030462_1520_2533 | 317 |
| 817 | 3300049579 | Ga0501043_0123616 | Ga0501043_0123616_102_1055 | 317 |
| 818 | 3300049579 | Ga0501043_0354251 | Ga0501043_0354251_98_1066 | 317 |
| 819 | 3300049580 | Ga0501046_0074556 | Ga0501046_0074556_882_1895 | 317 |
| 820 | 3300049581 | Ga0501047_0007662 | Ga0501047_0007662_4360_5346 | 317 |
| 821 | 3300049581 | Ga0501047_0376061 | Ga0501047_0376061_172_1125 | 317 |
| 822 | 3300049583 | Ga0501067_0023993 | Ga0501067_0023993_1919_2932 | 317 |
| 823 | 3300049583 | Ga0501067_0031262 | Ga0501067_0031262_728_1768 | 317 |
| 824 | 3300049586 | Ga0501070_0221249 | Ga0501070_0221249_311_1351 | 317 |
| 825 | 3300049589 | Ga0501073_0010966 | Ga0501073_0010966_5216_6229 | 317 |
| 826 | 3300049590 | Ga0501074_0008264 | Ga0501074_0008264_706_1719 | 317 |
| 827 | 3300049652 | Ga0501202_000479 | Ga0501202_000479_2537_3496 | 317 |
| 828 | 3300049661 | Ga0501217_005940 | Ga0501217_005940_95_1048 | 317 |
| 829 | 3300049663 | Ga0501223_000506 | Ga0501223_000506_2013_2972 | 317 |
| 830 | 3300049664 | Ga0501224_000674 | Ga0501224_000674_1566_2525 | 317 |
| 831 | 3300049668 | Ga0501233_000572 | Ga0501233_000572_2690_3649 | 317 |
| 832 | 3300049669 | Ga0501235_032644 | Ga0501235_032644_197_1150 | 317 |
| 833 | 3300049680 | Ga0501250_001689 | Ga0501250_001689_101_1054 | 317 |
| 834 | 3300049682 | Ga0501252_002344 | Ga0501252_002344_815_1774 | 317 |
| 835 | 3300049688 | Ga0501259_000316 | Ga0501259_000316_4434_5387 | 317 |
| 836 | 3300049703 | Ga0501219_000931 | Ga0501219_000931_1217_2173 | 317 |
| 837 | 3300049704 | Ga0501221_001361 | Ga0501221_001361_510_1469 | 317 |
| 838 | 3300049705 | Ga0501225_0000782 | Ga0501225_0000782_5464_6594 | 317 |
| 839 | 3300049705 | Ga0501225_0017687 | Ga0501225_0017687_598_1551 | 317 |
| 840 | 3300049707 | Ga0501234_000503 | Ga0501234_000503_2008_2967 | 317 |
| 841 | 3300049708 | Ga0501245_000412 | Ga0501245_000412_2615_3574 | 317 |
| 842 | 3300049741 | Ga0501079_0047494 | Ga0501079_0047494_1107_2120 | 317 |
| 843 | 3300049742 | Ga0501080_0214118 | Ga0501080_0214118_83_1036 | 317 |
| 844 | 3300049744 | Ga0501083_0208482 | Ga0501083_0208482_124_1137 | 317 |
| 845 | 3300049757 | Ga0501232_006986 | Ga0501232_006986_32_994 | 317 |
| 846 | 3300049763 | Ga0501266_002255 | Ga0501266_002255_663_1616 | 317 |
| 847 | 3300049822 | Ga0501035_0022258 | Ga0501035_0022258_2943_3896 | 317 |
| 848 | 3300049822 | Ga0501035_0025743 | Ga0501035_0025743_4129_5082 | 317 |
| 849 | 3300049822 | Ga0501035_0026724 | Ga0501035_0026724_3174_4187 | 317 |
| 850 | 3300049822 | Ga0501035_0109967 | Ga0501035_0109967_817_1773 | 317 |
| 851 | 3300049823 | Ga0501044_0003545 | Ga0501044_0003545_9314_10267 | 317 |
| 852 | 3300049823 | Ga0501044_0018651 | Ga0501044_0018651_1175_2188 | 317 |
| 853 | 3300049823 | Ga0501044_0021617 | Ga0501044_0021617_3854_4840 | 317 |
| 854 | 3300049823 | Ga0501044_0140905 | Ga0501044_0140905_493_1449 | 317 |
| 855 | 3300049823 | Ga0501044_0141400 | Ga0501044_0141400_254_1210 | 317 |
| 856 | 3300049823 | Ga0501044_0200150 | Ga0501044_0200150_928_1896 | 317 |
| 857 | 3300049824 | Ga0501045_0230668 | Ga0501045_0230668_143_1156 | 317 |
| 858 | 3300050005 | Ga0501284_00011 | Ga0501284_00011_2229_3185 | 317 |
| 859 | 3300050493 | nmdc:mga0k408_245116_c1 | nmdc:mga0k408_245116_c1_62_1048 | 317 |
| 860 | 3300050507 | nmdc:mga05p37_148186_c1 | nmdc:mga05p37_148186_c1_1043_1996 | 317 |
| 861 | 3300050507 | nmdc:mga05p37_194378_c1 | nmdc:mga05p37_194378_c1_367_1320 | 317 |
| 862 | 3300050507 | nmdc:mga05p37_6154_c1 | nmdc:mga05p37_6154_c1_1261_2247 | 317 |
| 863 | 3300050508 | nmdc:mga09592_69357_c1 | nmdc:mga09592_69357_c1_1556_2509 | 317 |
| 864 | 3300050509 | nmdc:mga0qj67_38975_c1 | nmdc:mga0qj67_38975_c1_644_1597 | 317 |
| 865 | 3300050510 | nmdc:mga06r32_13952_c1 | nmdc:mga06r32_13952_c1_5372_6325 | 317 |
| 866 | 3300050510 | nmdc:mga06r32_23480_c1 | nmdc:mga06r32_23480_c1_2662_3615 | 317 |
| 867 | 3300050511 | nmdc:mga08y16_120340_c1 | nmdc:mga08y16_120340_c1_1552_2505 | 317 |
| 868 | 3300053085 | Ga0495619_0046804 | Ga0495619_0046804_1616_2572 | 317 |
| 869 | 3300053086 | Ga0500578_0014967 | Ga0500578_0014967_635_1675 | 317 |
| 870 | 3300053092 | Ga0500583_0000075 | Ga0500583_0000075_1325_2311 | 317 |
| 871 | 3300053092 | Ga0500583_0000796 | Ga0500583_0000796_7387_8373 | 317 |
| 872 | 3300053147 | Ga0500589_009515 | Ga0500589_009515_1309_2301 | 317 |
| 873 | 3300053156 | Ga0500622_0101515 | Ga0500622_0101515_98_1084 | 317 |
| 874 | 3300053727 | Ga0500611_000031 | Ga0500611_000031_50047_51000 | 317 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4leh-assembly1.cif.gz_C | crystal structure of a bile-acid 7-alpha dehydratase (closci_03134) from clostridium scindens atcc 35704 at 2.90 a resolution | 0.7644 | 242 | 259 |
| 4l8o-assembly1.cif.gz_A | crystal structure of a bile-acid 7-alpha dehydratase (clohylem_06634) from clostridium hylemonae dsm 15053 at 2.20 a resolution | 0.71 | 242 | 259 |
| 5hv6-assembly1.cif.gz_A | the atp binding domain of rifampin phosphotransferase from listeria monocytogenes | 0.6791 | 132 | 261 |
| 7waf-assembly1.cif.gz_C | trichodesmium erythraeum cyanophycin synthetase 1 (tecpha1) with atpgammas and 4x(beta-asp-arg) | 0.6557 | 87 | 268 |
| 1jll-assembly1.cif.gz_B | crystal structure analysis of the e197betaa mutant of e. coli scs | 0.6399 | 87 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D4ADZ3_130_196_3.30.1490.20 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain | 0.8623 | 140 | 182 | 3.30.1490.20 |
| 1pk8A01 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain | 0.8139 | 140 | 181 | 3.30.1490.20 |
| 5dmxB02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.8046 | 87 | 285 | 3.30.470.20 |
| 1auvB01 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain | 0.8013 | 139 | 181 | 3.30.1490.20 |
| af_P9WM01_47_220_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8007 | 242 | 259 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838TNY5-F1-model_v4 | Uncharacterized protein | 0.9987 | 1 | 76 |
|
| AF-A0A838TNY5-F1-model_v4 | Uncharacterized protein | 0.9858 | 1 | 76 |
|
| AF-A0A4Q6CG82-F1-model_v4 | deleted | 0.985 | 172 | 317 |
|
| AF-A0A2V6MBT6-F1-model_v4 | ATP-grasp domain-containing protein | 0.9823 | 170 | 317 |
|
| AF-A0A519VZI3-F1-model_v4 | ATP-grasp domain-containing protein | 0.9808 | 180 | 317 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar