F484314

General Info

Members Datasets Scaffolds Average Seq Length
874 308 871 319

Family's Representative Sequence

Representative Sequence 3300049705|Ga0501225_0000782|Ga0501225_0000782_5464_6594
Length 376
Sequence MPPKIGKTAIEVTLNVQELYDLFIHDASDKFDSKDFVSPALLHQKCAYMKKIGILFGRERTFPMAFIERVNSRNTPGVIAEPVHIDKVIQGAPIEYDVIIDRISHDVPFYRSFLKNAAICGTAVINNPFWGSADEKFFNNCLAVRIGVPVPKTVILPSYDMPAETSAESFANLAWPLDWENIFNYVGFPAYMKPFAGGGWKNVYKLHNKEEFFQNHKETGQLVMLLQEEIAFEEYYRCYCIGGKYVHIMPYEPRNPHHLRYSNDFHPTPDRIHQMEEIVCRLNQYLGYDFNSVELAIRDGVPYAIDFCNPVPDADRPSIGDDNFDWVVDTAATYAIERALTHKAGLDNLTWGEFTKRSLNRAPMGEIMNEALEVEK

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
178 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
179 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
180 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
184 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
271 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
272 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
273 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
274 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
275 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
276 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
277 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
278 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
279 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
280 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
281 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
282 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
283 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
284 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
289 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
304 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
307 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
308 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.34
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 0.46
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000523 3300002459 Bacteria 10988
2 JGI25406J46586_10042359 3300003203 Bacteria 1595
3 rootH2_10008717 3300003320 Bacteria 23143
4 rootH2_10009544 3300003320 Bacteria 42409
5 rootH2_10016843 3300003320 Bacteria 2304
6 rootH2_10043528 3300003320 Bacteria 2264
7 rootL2_10048659 3300003322 Bacteria 7441
8 rootL2_10049027 3300003322 Bacteria 12495
9 rootH1_10027473 3300003323 Bacteria 20275
10 JGI25160J50197_1000391 3300003354 Bacteria 28395
11 Ga0058863_11897022 3300004799 Bacteria 1432
12 Ga0058862_10028396 3300004803 Bacteria 1771
13 Ga0065714_10008149 3300005288 Bacteria 3272
14 Ga0065704_10001598 3300005289 Bacteria 9936
15 Ga0065712_10005043 3300005290 Bacteria 3012
16 Ga0065712_10005395 3300005290 Bacteria 3367
17 Ga0065712_10084305 3300005290 Bacteria 2774
18 Ga0065712_10087336 3300005290 Bacteria 2583
19 Ga0065715_10170227 3300005293 Bacteria 1553
20 Ga0065707_10005338 3300005295 Bacteria 3494
21 Ga0070658_10006339 3300005327 Bacteria 9587
22 Ga0070658_10009081 3300005327 Bacteria 7996
23 Ga0070658_10091759 3300005327 Bacteria 2503
24 Ga0070658_10168037 3300005327 Bacteria 1842
25 Ga0070676_10000103 3300005328 Bacteria 30434
26 Ga0070676_10236260 3300005328 Bacteria 1214
27 Ga0070683_100002537 3300005329 Bacteria 14576
28 Ga0070683_100013464 3300005329 Bacteria 7134
29 Ga0070683_100021425 3300005329 Bacteria 5769
30 Ga0070690_100011893 3300005330 Bacteria 5108
31 Ga0070670_100042984 3300005331 Bacteria 3885
32 Ga0070670_100044182 3300005331 Bacteria 3831
33 Ga0070670_100077802 3300005331 Bacteria 2850
34 Ga0070670_100189196 3300005331 Bacteria 1788
35 Ga0070677_10023834 3300005333 Bacteria 2270
36 Ga0068869_100026133 3300005334 Bacteria 4061
37 Ga0068869_100116676 3300005334 Unclassified 2037
38 Ga0070666_10000043 3300005335 Bacteria 111402
39 Ga0070666_10008965 3300005335 Bacteria 6227
40 Ga0070666_10010785 3300005335 Bacteria 5719
41 Ga0070666_10214398 3300005335 Bacteria 1357
42 Ga0070680_100001109 3300005336 Bacteria 19331
43 Ga0070680_100139397 3300005336 Bacteria 2033
44 Ga0070682_100001222 3300005337 Bacteria 14625
45 Ga0070682_100163862 3300005337 Bacteria 1538
46 Ga0068868_100000358 3300005338 Bacteria 30970
47 Ga0068868_100010933 3300005338 Bacteria 6589
48 Ga0068868_100023528 3300005338 Bacteria 4663
49 Ga0068868_100035794 3300005338 Bacteria 3839
50 Ga0068868_100084289 3300005338 Bacteria 2552
51 Ga0068868_100113611 3300005338 Bacteria 2202
52 Ga0068868_100156118 3300005338 Bacteria 1882
53 Ga0068868_100228677 3300005338 Bacteria 1560
54 Ga0070660_100110434 3300005339 Bacteria 2187
55 Ga0070660_100154298 3300005339 Bacteria 1848
56 Ga0070660_100157651 3300005339 Bacteria 1828
57 Ga0070689_100013710 3300005340 Bacteria 5872
58 Ga0070689_100054252 3300005340 Bacteria 3102
59 Ga0070689_100177674 3300005340 Bacteria 1727
60 Ga0070689_100230095 3300005340 Bacteria 1524
61 Ga0070691_10011704 3300005341 Bacteria 4012
62 Ga0070687_100066040 3300005343 Bacteria 1926
63 Ga0070661_100003722 3300005344 Bacteria 10511
64 Ga0070661_100291045 3300005344 Bacteria 1269
65 Ga0070692_10255199 3300005345 Bacteria 1052
66 Ga0070668_100000308 3300005347 Bacteria 32201
67 Ga0070668_100124154 3300005347 Bacteria 2067
68 Ga0070668_100216686 3300005347 Unclassified 1577
69 Ga0070668_100426451 3300005347 Bacteria 1136
70 Ga0070669_100082384 3300005353 Bacteria 2398
71 Ga0070675_100019600 3300005354 Bacteria 5392
72 Ga0070675_100022363 3300005354 Bacteria 5052
73 Ga0070675_100060036 3300005354 Bacteria 3139
74 Ga0070675_100338717 3300005354 Bacteria 1332
75 Ga0070671_100008263 3300005355 Bacteria 8331
76 Ga0070671_100065974 3300005355 Bacteria 3016
77 Ga0070671_100099251 3300005355 Bacteria 2442
78 Ga0070671_100162476 3300005355 Bacteria 1888
79 Ga0070674_100015249 3300005356 Bacteria 4794
80 Ga0070674_100133037 3300005356 Bacteria 1857
81 Ga0070673_100000232 3300005364 Bacteria 27904
82 Ga0070673_100015106 3300005364 Bacteria 5408
83 Ga0070673_100030266 3300005364 Bacteria 4048
84 Ga0070673_100039411 3300005364 Bacteria 3615
85 Ga0070673_100165717 3300005364 Bacteria 1882
86 Ga0070673_100321580 3300005364 Bacteria 1367
87 Ga0070688_100002313 3300005365 Bacteria 9629
88 Ga0070688_100013129 3300005365 Bacteria 4663
89 Ga0070688_100041662 3300005365 Bacteria 2820
90 Ga0070659_100003286 3300005366 Bacteria 11507
91 Ga0070659_100026117 3300005366 Bacteria 4492
92 Ga0070659_100339075 3300005366 Bacteria 1259
93 Ga0070667_100000583 3300005367 Bacteria 36093
94 Ga0070667_100008582 3300005367 Bacteria 8469
95 Ga0070667_100062669 3300005367 Bacteria 3150
96 Ga0070667_100154928 3300005367 Bacteria 2015
97 Ga0070667_100170495 3300005367 Bacteria 1921
98 Ga0070667_100304283 3300005367 Bacteria 1436
99 Ga0070709_10000005 3300005434 Bacteria 197619
100 Ga0070663_100091453 3300005455 Bacteria 2255
101 Ga0070663_100225988 3300005455 Bacteria 1472
102 Ga0070663_100244775 3300005455 Bacteria 1417
103 Ga0070663_100313151 3300005455 Bacteria 1260
104 Ga0070678_100279444 3300005456 Bacteria 1411
105 Ga0070662_100003591 3300005457 Bacteria 9675
106 Ga0070662_100004745 3300005457 Bacteria 8615
107 Ga0070681_10005409 3300005458 Bacteria 12333
108 Ga0070681_10044327 3300005458 Bacteria 4452
109 Ga0070681_10046320 3300005458 Bacteria 4348
110 Ga0070681_10066331 3300005458 Bacteria 3578
111 Ga0070681_10074154 3300005458 Bacteria 3364
112 Ga0068867_100018459 3300005459 Bacteria 4959
113 Ga0068867_100026320 3300005459 Bacteria 4176
114 Ga0068867_100060080 3300005459 Bacteria 2819
115 Ga0068867_100075190 3300005459 Bacteria 2533
116 Ga0068867_100078110 3300005459 Bacteria 2489
117 Ga0068867_100133897 3300005459 Bacteria 1929
118 Ga0068867_100219902 3300005459 Bacteria 1530
119 Ga0070685_10002988 3300005466 Bacteria 8636
120 Ga0070685_10004337 3300005466 Bacteria 7160
121 Ga0070685_10010428 3300005466 Bacteria 4828
122 Ga0070698_100000866 3300005471 Bacteria 33282
123 Ga0070698_100003054 3300005471 Bacteria 18451
124 Ga0070698_100389607 3300005471 Bacteria 1326
125 Ga0070679_100010138 3300005530 Bacteria 8933
126 Ga0070679_100031280 3300005530 Bacteria 5257
127 Ga0070679_100104310 3300005530 Bacteria 2821
128 Ga0070684_100008118 3300005535 Bacteria 8194
129 Ga0070684_100010258 3300005535 Bacteria 7416
130 Ga0070684_100011702 3300005535 Bacteria 6996
131 Ga0070684_100218736 3300005535 Bacteria 1738
132 Ga0068853_100000097 3300005539 Bacteria 59626
133 Ga0068853_100000501 3300005539 Bacteria 26843
134 Ga0068853_100014007 3300005539 Bacteria 6562
135 Ga0068853_100030060 3300005539 Bacteria 4586
136 Ga0068853_100236061 3300005539 Bacteria 1674
137 Ga0068853_100512523 3300005539 Bacteria 1133
138 Ga0070672_100000345 3300005543 Bacteria 26753
139 Ga0070672_100216034 3300005543 Bacteria 1607
140 Ga0070686_100183996 3300005544 Bacteria 1487
141 Ga0070665_100000041 3300005548 Bacteria 297849
142 Ga0070665_100001618 3300005548 Bacteria 25934
143 Ga0070665_100707618 3300005548 Bacteria 1020
144 Ga0068855_100000704 3300005563 Bacteria 40979
145 Ga0068855_100000957 3300005563 Bacteria 35876
146 Ga0068855_100012898 3300005563 Bacteria 10085
147 Ga0068855_100028910 3300005563 Bacteria 6632
148 Ga0068855_100029350 3300005563 Bacteria 6577
149 Ga0068855_100059952 3300005563 Bacteria 4451
150 Ga0068855_100087593 3300005563 Bacteria 3598
151 Ga0068855_100129819 3300005563 Bacteria 2879
152 Ga0068855_100138006 3300005563 Bacteria 2781
153 Ga0070664_100011562 3300005564 Bacteria 7161
154 Ga0070664_100022602 3300005564 Bacteria 5185
155 Ga0070664_100062879 3300005564 Bacteria 3165
156 Ga0070664_100149551 3300005564 Bacteria 2061
157 Ga0070664_100257278 3300005564 Bacteria 1570
158 Ga0068857_100022608 3300005577 Bacteria 5530
159 Ga0068857_100031575 3300005577 Bacteria 4681
160 Ga0068857_100052589 3300005577 Bacteria 3614
161 Ga0068857_100061838 3300005577 Bacteria 3327
162 Ga0068857_100097054 3300005577 Bacteria 2642
163 Ga0068857_100166228 3300005577 Bacteria 2004
164 Ga0068857_100435101 3300005577 Bacteria 1225
165 Ga0068854_100059917 3300005578 Bacteria 2752
166 Ga0068854_100063658 3300005578 Bacteria 2678
167 Ga0068854_100095628 3300005578 Bacteria 2218
168 Ga0068854_100133600 3300005578 Bacteria 1897
169 Ga0068856_100007898 3300005614 Bacteria 10393
170 Ga0068856_100039447 3300005614 Bacteria 4637
171 Ga0068856_100051092 3300005614 Bacteria 4077
172 Ga0068856_100071316 3300005614 Bacteria 3439
173 Ga0068856_100149457 3300005614 Bacteria 2344
174 Ga0068856_100288614 3300005614 Bacteria 1657
175 Ga0070702_100025113 3300005615 Bacteria 3189
176 Ga0070702_100071258 3300005615 Bacteria 2054
177 Ga0068852_100000503 3300005616 Bacteria 25688
178 Ga0068852_100001785 3300005616 Bacteria 14610
179 Ga0068852_100017293 3300005616 Bacteria 5653
180 Ga0068852_100023529 3300005616 Bacteria 4960
181 Ga0068852_100026331 3300005616 Bacteria 4726
182 Ga0068852_100035776 3300005616 Bacteria 4146
183 Ga0068852_100116153 3300005616 Bacteria 2441
184 Ga0068859_100000012 3300005617 Bacteria 300376
185 Ga0068859_100015958 3300005617 Bacteria 7549
186 Ga0068859_100056360 3300005617 Bacteria 3955
187 Ga0068859_100064054 3300005617 Bacteria 3708
188 Ga0068859_100091984 3300005617 Bacteria 3085
189 Ga0068859_100178112 3300005617 Bacteria 2208
190 Ga0068864_100004460 3300005618 Bacteria 11503
191 Ga0068864_100005117 3300005618 Bacteria 10746
192 Ga0068864_100037534 3300005618 Bacteria 4135
193 Ga0068864_100054233 3300005618 Bacteria 3460
194 Ga0068864_100091855 3300005618 Bacteria 2679
195 Ga0068864_100129762 3300005618 Bacteria 2263
196 Ga0068864_100154783 3300005618 Bacteria 2080
197 Ga0068866_10020849 3300005718 Bacteria 3009
198 Ga0068861_100018453 3300005719 Bacteria 4971
199 Ga0068861_100080555 3300005719 Bacteria 2547
200 Ga0068861_100152547 3300005719 Bacteria 1897
201 Ga0068861_100197842 3300005719 Bacteria 1685
202 Ga0068851_10000252 3300005834 Bacteria 25317
203 Ga0068851_10007180 3300005834 Bacteria 5104
204 Ga0068851_10093735 3300005834 Bacteria 1585
205 Ga0068851_10178396 3300005834 Bacteria 1175
206 Ga0068870_10068105 3300005840 Bacteria 1933
207 Ga0068863_100001439 3300005841 Bacteria 23604
208 Ga0068863_100006838 3300005841 Bacteria 11182
209 Ga0068863_100012618 3300005841 Bacteria 8151
210 Ga0068863_100025607 3300005841 Bacteria 5625
211 Ga0068863_100127766 3300005841 Bacteria 2426
212 Ga0068863_100198507 3300005841 Bacteria 1929
213 Ga0068863_100228489 3300005841 Bacteria 1794
214 Ga0068858_100005079 3300005842 Bacteria 12897
215 Ga0068858_100005154 3300005842 Bacteria 12803
216 Ga0068858_100015472 3300005842 Bacteria 7175
217 Ga0068858_100099889 3300005842 Bacteria 2706
218 Ga0068858_100283136 3300005842 Bacteria 1579
219 Ga0068858_100506182 3300005842 Bacteria 1167
220 Ga0068860_100000208 3300005843 Bacteria 92818
221 Ga0068860_100000662 3300005843 Bacteria 39938
222 Ga0068860_100007619 3300005843 Bacteria 10834
223 Ga0068860_100008645 3300005843 Bacteria 10147
224 Ga0068860_100009954 3300005843 Bacteria 9423
225 Ga0068860_100010746 3300005843 Bacteria 9037
226 Ga0068860_100022849 3300005843 Bacteria 6048
227 Ga0068860_100385511 3300005843 Bacteria 1384
228 Ga0068862_100000995 3300005844 Bacteria 27113
229 Ga0068862_100117931 3300005844 Bacteria 2336
230 Ga0068862_100176292 3300005844 Bacteria 1916
231 Ga0068862_100460084 3300005844 Bacteria 1201
232 Ga0081540_1004197 3300005983 Bacteria 11081
233 Ga0081539_10000641 3300005985 Bacteria 70679
234 Ga0097621_100013920 3300006237 Bacteria 6008
235 Ga0097621_100016846 3300006237 Bacteria 5537
236 Ga0097621_100021374 3300006237 Bacteria 5004
237 Ga0097621_100021813 3300006237 Bacteria 4963
238 Ga0097621_100042206 3300006237 Bacteria 3673
239 Ga0097621_100206975 3300006237 Bacteria 1705
240 Ga0097621_100396830 3300006237 Bacteria 1234
241 Ga0068871_100039722 3300006358 Bacteria 3767
242 Ga0068871_100041002 3300006358 Bacteria 3710
243 Ga0068871_100043066 3300006358 Bacteria 3626
244 Ga0068871_100052147 3300006358 Bacteria 3312
245 Ga0068871_100067970 3300006358 Bacteria 2925
246 Ga0068871_100189228 3300006358 Bacteria 1772
247 Ga0068871_100277916 3300006358 Bacteria 1464
248 Ga0075428_100003010 3300006844 Bacteria 18399
249 Ga0075428_100009333 3300006844 Bacteria 10882
250 Ga0075428_100145976 3300006844 Bacteria 2571
251 Ga0075430_100010608 3300006846 Bacteria 7806
252 Ga0075431_100014282 3300006847 Bacteria 8031
253 Ga0075431_100040230 3300006847 Bacteria 4817
254 Ga0075434_100134102 3300006871 Bacteria 2496
255 Ga0075434_100323199 3300006871 Bacteria 1563
256 Ga0075429_100001277 3300006880 Bacteria 20474
257 Ga0075429_100006151 3300006880 Bacteria 10376
258 Ga0075429_100010161 3300006880 Bacteria 8149
259 Ga0068865_100000668 3300006881 Bacteria 19318
260 Ga0068865_100219682 3300006881 Bacteria 1485
261 Ga0068865_100239471 3300006881 Bacteria 1427
262 Ga0075436_100000145 3300006914 Bacteria 43281
263 Ga0097620_100000012 3300006931 Bacteria 300376
264 Ga0097620_100015117 3300006931 Bacteria 7745
265 Ga0097620_100015958 3300006931 Bacteria 7549
266 Ga0097620_100056360 3300006931 Bacteria 3955
267 Ga0097620_100064052 3300006931 Bacteria 3708
268 Ga0097620_100091984 3300006931 Bacteria 3085
269 Ga0097620_100178108 3300006931 Bacteria 2208
270 Ga0105240_10000147 3300009093 Bacteria 142340
271 Ga0105240_10000168 3300009093 Bacteria 133212
272 Ga0105240_10000224 3300009093 Bacteria 113175
273 Ga0105240_10002232 3300009093 Bacteria 31507
274 Ga0105240_10011606 3300009093 Bacteria 12258
275 Ga0105240_10012035 3300009093 Bacteria 11994
276 Ga0105240_10015585 3300009093 Bacteria 10328
277 Ga0105240_10050139 3300009093 Bacteria 5265
278 Ga0105240_10148232 3300009093 Bacteria 2797
279 Ga0111539_10106295 3300009094 Bacteria 3292
280 Ga0111539_10300926 3300009094 Bacteria 1867
281 Ga0111539_10347418 3300009094 Bacteria 1726
282 Ga0105245_10167309 3300009098 Bacteria 2091
283 Ga0105245_10278965 3300009098 Bacteria 1633
284 Ga0105245_10418514 3300009098 Bacteria 1343
285 Ga0105247_10003609 3300009101 Bacteria 10044
286 Ga0105247_10006231 3300009101 Bacteria 7400
287 Ga0114129_10050987 3300009147 Bacteria 5811
288 Ga0114129_10156378 3300009147 Bacteria 3117
289 Ga0114129_10528836 3300009147 Bacteria 1536
290 Ga0105243_10189580 3300009148 Bacteria 1795
291 Ga0105241_10001105 3300009174 Bacteria 20534
292 Ga0105241_10003487 3300009174 Bacteria 11699
293 Ga0105241_10135519 3300009174 Bacteria 1999
294 Ga0105242_10004172 3300009176 Bacteria 11257
295 Ga0105242_10023320 3300009176 Bacteria 4877
296 Ga0105242_10138177 3300009176 Bacteria 2111
297 Ga0105242_10176648 3300009176 Bacteria 1881
298 Ga0105242_10291805 3300009176 Bacteria 1485
299 Ga0105242_10340758 3300009176 Bacteria 1381
300 Ga0105242_10433148 3300009176 Bacteria 1235
301 Ga0105248_10080222 3300009177 Bacteria 3667
302 Ga0105237_10000394 3300009545 Bacteria 62227
303 Ga0105237_10000725 3300009545 Bacteria 45577
304 Ga0105237_10008284 3300009545 Bacteria 11287
305 Ga0105237_10020325 3300009545 Bacteria 6849
306 Ga0105237_10023397 3300009545 Bacteria 6330
307 Ga0105237_10031327 3300009545 Bacteria 5393
308 Ga0105237_10163378 3300009545 Bacteria 2226
309 Ga0105237_10163384 3300009545 Bacteria 2226
310 Ga0105237_10176590 3300009545 Bacteria 2136
311 Ga0105238_10000247 3300009551 Bacteria 60300
312 Ga0105238_10008890 3300009551 Bacteria 10053
313 Ga0105238_10062082 3300009551 Bacteria 3738
314 Ga0105249_10000682 3300009553 Bacteria 30897
315 Ga0105249_10001215 3300009553 Bacteria 22719
316 Ga0105249_10006750 3300009553 Bacteria 10001
317 Ga0105249_10007592 3300009553 Bacteria 9465
318 Ga0105249_10130907 3300009553 Bacteria 2395
319 Ga0105249_10347647 3300009553 Bacteria 1501
320 Ga0105249_10736266 3300009553 Unclassified 1048
321 Ga0105239_10000370 3300010375 Bacteria 66106
322 Ga0105239_10001527 3300010375 Bacteria 30683
323 Ga0105239_10001529 3300010375 Bacteria 30676
324 Ga0105239_10015328 3300010375 Bacteria 8492
325 Ga0105239_10016372 3300010375 Bacteria 8201
326 Ga0105239_10016797 3300010375 Bacteria 8089
327 Ga0105239_10089304 3300010375 Bacteria 3398
328 Ga0105239_10115880 3300010375 Bacteria 2972
329 Ga0105239_10139506 3300010375 Bacteria 2701
330 Ga0105239_10156469 3300010375 Bacteria 2545
331 Ga0105246_10036756 3300011119 Bacteria 3283
332 Ga0157373_10002303 3300013100 Bacteria 14488
333 Ga0157373_10011321 3300013100 Bacteria 6559
334 Ga0157373_10036875 3300013100 Bacteria 3507
335 Ga0157373_10045344 3300013100 Bacteria 3138
336 Ga0157373_10049038 3300013100 Bacteria 3010
337 Ga0157373_10069976 3300013100 Bacteria 2480
338 Ga0157371_10001603 3300013102 Bacteria 23199
339 Ga0157371_10001840 3300013102 Bacteria 21388
340 Ga0157371_10002945 3300013102 Bacteria 15853
341 Ga0157371_10004684 3300013102 Bacteria 11824
342 Ga0157371_10006217 3300013102 Bacteria 9899
343 Ga0157371_10010000 3300013102 Bacteria 7424
344 Ga0157371_10020600 3300013102 Bacteria 4853
345 Ga0157371_10023994 3300013102 Bacteria 4456
346 Ga0157371_10039145 3300013102 Bacteria 3391
347 Ga0157371_10079965 3300013102 Bacteria 2315
348 Ga0157370_10000673 3300013104 Bacteria 42574
349 Ga0157370_10002442 3300013104 Bacteria 22410
350 Ga0157370_10006476 3300013104 Bacteria 12911
351 Ga0157370_10012429 3300013104 Bacteria 8826
352 Ga0157370_10061605 3300013104 Bacteria 3560
353 Ga0157370_10188489 3300013104 Bacteria 1915
354 Ga0157370_10497213 3300013104 Bacteria 1120
355 Ga0157369_10005363 3300013105 Bacteria 14932
356 Ga0157369_10006046 3300013105 Bacteria 14052
357 Ga0157369_10020699 3300013105 Bacteria 7354
358 Ga0157369_10042847 3300013105 Bacteria 4937
359 Ga0157369_10135356 3300013105 Bacteria 2609
360 Ga0157369_10344186 3300013105 Bacteria 1549
361 Ga0157374_10000484 3300013296 Bacteria 36020
362 Ga0157374_10008174 3300013296 Bacteria 8939
363 Ga0157374_10258798 3300013296 Bacteria 1714
364 Ga0157374_10281103 3300013296 Bacteria 1643
365 Ga0157378_10002633 3300013297 Bacteria 15990
366 Ga0157378_10016242 3300013297 Bacteria 6519
367 Ga0157378_10021011 3300013297 Bacteria 5743
368 Ga0157378_10024687 3300013297 Bacteria 5293
369 Ga0157378_10051359 3300013297 Bacteria 3669
370 Ga0157378_10117790 3300013297 Bacteria 2444
371 Ga0157378_10122157 3300013297 Bacteria 2402
372 Ga0157378_10124509 3300013297 Bacteria 2380
373 Ga0157378_10309322 3300013297 Bacteria 1532
374 Ga0163162_10000484 3300013306 Bacteria 36942
375 Ga0163162_10001520 3300013306 Bacteria 21611
376 Ga0163162_10004470 3300013306 Bacteria 13467
377 Ga0163162_10011289 3300013306 Bacteria 8710
378 Ga0163162_10012241 3300013306 Bacteria 8372
379 Ga0163162_10040262 3300013306 Bacteria 4672
380 Ga0163162_10122684 3300013306 Bacteria 2703
381 Ga0163162_10134112 3300013306 Bacteria 2587
382 Ga0163162_10211306 3300013306 Unclassified 2070
383 Ga0163162_10245938 3300013306 Bacteria 1920
384 Ga0163162_10616806 3300013306 Bacteria 1210
385 Ga0157372_10000317 3300013307 Bacteria 53205
386 Ga0157372_10002225 3300013307 Bacteria 21049
387 Ga0157372_10008771 3300013307 Bacteria 10737
388 Ga0157372_10025878 3300013307 Bacteria 6382
389 Ga0157372_10030136 3300013307 Bacteria 5932
390 Ga0157372_10041409 3300013307 Bacteria 5094
391 Ga0157372_10045321 3300013307 Bacteria 4877
392 Ga0157372_10068608 3300013307 Bacteria 3987
393 Ga0157372_10092305 3300013307 Bacteria 3444
394 Ga0157372_10138015 3300013307 Bacteria 2809
395 Ga0157372_10153519 3300013307 Bacteria 2659
396 Ga0157372_10158282 3300013307 Bacteria 2617
397 Ga0157372_10178337 3300013307 Bacteria 2459
398 Ga0157372_10210106 3300013307 Bacteria 2255
399 Ga0157372_10225257 3300013307 Bacteria 2174
400 Ga0157372_10321435 3300013307 Bacteria 1802
401 Ga0157372_10514886 3300013307 Bacteria 1395
402 Ga0157375_10000619 3300013308 Bacteria 31534
403 Ga0157375_10011699 3300013308 Bacteria 7755
404 Ga0157375_10062153 3300013308 Bacteria 3710
405 Ga0157375_10276498 3300013308 Bacteria 1842
406 Ga0157375_10423317 3300013308 Bacteria 1498
407 Ga0163163_10000499 3300014325 Bacteria 35349
408 Ga0163163_10001833 3300014325 Bacteria 17940
409 Ga0163163_10071426 3300014325 Bacteria 3459
410 Ga0163163_10115435 3300014325 Bacteria 2716
411 Ga0163163_10229914 3300014325 Bacteria 1903
412 Ga0163163_10236577 3300014325 Bacteria 1876
413 Ga0157380_10000174 3300014326 Bacteria 37217
414 Ga0157380_10003845 3300014326 Bacteria 10345
415 Ga0157380_10006056 3300014326 Bacteria 8474
416 Ga0157380_10033793 3300014326 Bacteria 3940
417 Ga0157380_10201513 3300014326 Bacteria 1766
418 Ga0182008_10000053 3300014497 Bacteria 102934
419 Ga0157377_10012471 3300014745 Bacteria 4275
420 Ga0157377_10064866 3300014745 Bacteria 2096
421 Ga0157379_10001386 3300014968 Bacteria 19826
422 Ga0157379_10024256 3300014968 Bacteria 5385
423 Ga0157379_10108486 3300014968 Bacteria 2493
424 Ga0157379_10134357 3300014968 Bacteria 2228
425 Ga0157379_10244657 3300014968 Bacteria 1627
426 Ga0157379_10386536 3300014968 Bacteria 1284
427 Ga0157376_10000798 3300014969 Bacteria 20658
428 Ga0157376_10002100 3300014969 Bacteria 13399
429 Ga0157376_10055901 3300014969 Bacteria 3295
430 Ga0157376_10230177 3300014969 Bacteria 1721
431 Ga0157376_10265989 3300014969 Bacteria 1609
432 Ga0182006_1000270 3300015261 Bacteria 46578
433 Ga0163161_10071986 3300017792 Bacteria 2531
434 Ga0163161_10171834 3300017792 Bacteria 1658
435 Ga0163161_10193193 3300017792 Bacteria 1566
436 Ga0207426_1000059 3300025302 Bacteria 363842
437 Ga0207697_10029727 3300025315 Bacteria 2237
438 Ga0207656_10000749 3300025321 Bacteria 10631
439 Ga0207656_10002904 3300025321 Bacteria 5844
440 Ga0207656_10102980 3300025321 Bacteria 1311
441 Ga0207682_10016291 3300025893 Bacteria 2899
442 Ga0207642_10154944 3300025899 Unclassified 1224
443 Ga0207710_10003944 3300025900 Bacteria 6544
444 Ga0207710_10004413 3300025900 Bacteria 6143
445 Ga0207680_10000108 3300025903 Bacteria 38066
446 Ga0207680_10023781 3300025903 Bacteria 3351
447 Ga0207680_10029990 3300025903 Bacteria 3062
448 Ga0207680_10153135 3300025903 Bacteria 1539
449 Ga0207680_10188619 3300025903 Bacteria 1398
450 Ga0207647_10000050 3300025904 Bacteria 88099
451 Ga0207645_10018557 3300025907 Bacteria 4573
452 Ga0207645_10170415 3300025907 Bacteria 1427
453 Ga0207643_10003946 3300025908 Bacteria 7984
454 Ga0207705_10003522 3300025909 Bacteria 11931
455 Ga0207705_10004003 3300025909 Bacteria 11212
456 Ga0207705_10026286 3300025909 Bacteria 4152
457 Ga0207705_10111435 3300025909 Bacteria 2022
458 Ga0207705_10217638 3300025909 Bacteria 1450
459 Ga0207705_10313810 3300025909 Bacteria 1204
460 Ga0207654_10001573 3300025911 Bacteria 11985
461 Ga0207654_10005154 3300025911 Bacteria 6593
462 Ga0207654_10066742 3300025911 Bacteria 2123
463 Ga0207654_10308749 3300025911 Bacteria 1078
464 Ga0207707_10001470 3300025912 Bacteria 21804
465 Ga0207707_10002754 3300025912 Bacteria 15674
466 Ga0207707_10022737 3300025912 Bacteria 5483
467 Ga0207707_10054892 3300025912 Bacteria 3467
468 Ga0207707_10082552 3300025912 Bacteria 2806
469 Ga0207695_10000023 3300025913 Bacteria 657903
470 Ga0207695_10000031 3300025913 Bacteria 526801
471 Ga0207695_10000110 3300025913 Bacteria 250079
472 Ga0207695_10002344 3300025913 Bacteria 28132
473 Ga0207695_10028819 3300025913 Bacteria 6147
474 Ga0207695_10061324 3300025913 Bacteria 3887
475 Ga0207695_10064274 3300025913 Bacteria 3779
476 Ga0207695_10139675 3300025913 Bacteria 2372
477 Ga0207671_10000925 3300025914 Bacteria 36841
478 Ga0207671_10003957 3300025914 Bacteria 14415
479 Ga0207671_10015072 3300025914 Bacteria 6075
480 Ga0207671_10030657 3300025914 Bacteria 4009
481 Ga0207660_10004358 3300025917 Bacteria 9225
482 Ga0207662_10011300 3300025918 Unclassified 4946
483 Ga0207657_10012180 3300025919 Bacteria 8499
484 Ga0207657_10058804 3300025919 Bacteria 3306
485 Ga0207657_10269804 3300025919 Bacteria 1353
486 Ga0207649_10003147 3300025920 Bacteria 9054
487 Ga0207649_10041557 3300025920 Bacteria 2799
488 Ga0207649_10078676 3300025920 Bacteria 2128
489 Ga0207649_10234816 3300025920 Bacteria 1313
490 Ga0207652_10000074 3300025921 Bacteria 108397
491 Ga0207652_10000942 3300025921 Bacteria 27351
492 Ga0207652_10001229 3300025921 Bacteria 22941
493 Ga0207652_10166028 3300025921 Bacteria 1979
494 Ga0207652_10368146 3300025921 Bacteria 1297
495 Ga0207652_10446859 3300025921 Bacteria 1165
496 Ga0207681_10339474 3300025923 Bacteria 1199
497 Ga0207694_10012838 3300025924 Bacteria 6308
498 Ga0207694_10020081 3300025924 Bacteria 5053
499 Ga0207650_10008539 3300025925 Bacteria 6994
500 Ga0207650_10031450 3300025925 Bacteria 3833
501 Ga0207650_10069130 3300025925 Bacteria 2653
502 Ga0207659_10006857 3300025926 Bacteria 7005
503 Ga0207659_10018772 3300025926 Bacteria 4539
504 Ga0207659_10274612 3300025926 Bacteria 1376
505 Ga0207687_10167260 3300025927 Bacteria 1693
506 Ga0207687_10179791 3300025927 Bacteria 1638
507 Ga0207700_10309229 3300025928 Bacteria 1367
508 Ga0207690_10008634 3300025932 Bacteria 6041
509 Ga0207690_10014218 3300025932 Bacteria 4803
510 Ga0207706_10002124 3300025933 Bacteria 19411
511 Ga0207706_10013304 3300025933 Bacteria 7487
512 Ga0207706_10057700 3300025933 Bacteria 3420
513 Ga0207706_10094248 3300025933 Bacteria 2633
514 Ga0207706_10308651 3300025933 Bacteria 1378
515 Ga0207686_10001998 3300025934 Bacteria 11249
516 Ga0207686_10036685 3300025934 Bacteria 2953
517 Ga0207686_10300972 3300025934 Bacteria 1191
518 Ga0207670_10021414 3300025936 Bacteria 3989
519 Ga0207670_10059712 3300025936 Bacteria 2594
520 Ga0207670_10100189 3300025936 Bacteria 2068
521 Ga0207670_10186272 3300025936 Bacteria 1567
522 Ga0207669_10064033 3300025937 Bacteria 2273
523 Ga0207669_10090642 3300025937 Bacteria 1989
524 Ga0207704_10130886 3300025938 Bacteria 1737
525 Ga0207691_10000549 3300025940 Bacteria 37607
526 Ga0207691_10034712 3300025940 Bacteria 4689
527 Ga0207691_10141802 3300025940 Bacteria 2117
528 Ga0207689_10001398 3300025942 Bacteria 23013
529 Ga0207689_10025482 3300025942 Bacteria 4956
530 Ga0207689_10031756 3300025942 Bacteria 4393
531 Ga0207689_10116372 3300025942 Bacteria 2197
532 Ga0207661_10003834 3300025944 Bacteria 10483
533 Ga0207661_10034494 3300025944 Bacteria 3936
534 Ga0207661_10043853 3300025944 Bacteria 3531
535 Ga0207661_10140585 3300025944 Bacteria 2077
536 Ga0207661_10330189 3300025944 Bacteria 1373
537 Ga0207679_10000408 3300025945 Bacteria 30790
538 Ga0207679_10007934 3300025945 Bacteria 6749
539 Ga0207679_10133873 3300025945 Bacteria 1993
540 Ga0207679_10220471 3300025945 Bacteria 1595
541 Ga0207667_10000144 3300025949 Bacteria 108295
542 Ga0207667_10000773 3300025949 Bacteria 41528
543 Ga0207667_10006879 3300025949 Bacteria 13741
544 Ga0207667_10016655 3300025949 Bacteria 8296
545 Ga0207667_10024655 3300025949 Bacteria 6599
546 Ga0207667_10112046 3300025949 Bacteria 2814
547 Ga0207667_10148118 3300025949 Bacteria 2416
548 Ga0207667_10379426 3300025949 Bacteria 1440
549 Ga0207651_10000231 3300025960 Bacteria 24055
550 Ga0207651_10031683 3300025960 Bacteria 3384
551 Ga0207651_10093079 3300025960 Bacteria 2212
552 Ga0207651_10168249 3300025960 Bacteria 1726
553 Ga0207712_10001368 3300025961 Bacteria 16692
554 Ga0207712_10001805 3300025961 Bacteria 14147
555 Ga0207712_10018237 3300025961 Bacteria 4569
556 Ga0207712_10056597 3300025961 Bacteria 2763
557 Ga0207712_10075955 3300025961 Bacteria 2430
558 Ga0207712_10151399 3300025961 Bacteria 1792
559 Ga0207712_10179103 3300025961 Bacteria 1663
560 Ga0207668_10000639 3300025972 Bacteria 21609
561 Ga0207668_10108693 3300025972 Bacteria 2076
562 Ga0207668_10378447 3300025972 Bacteria 1191
563 Ga0207640_10126428 3300025981 Bacteria 1841
564 Ga0207640_10141988 3300025981 Bacteria 1752
565 Ga0207640_10186932 3300025981 Bacteria 1558
566 Ga0207640_10225111 3300025981 Bacteria 1439
567 Ga0207658_10000942 3300025986 Bacteria 24008
568 Ga0207658_10021496 3300025986 Bacteria 4481
569 Ga0207677_10001537 3300026023 Bacteria 12210
570 Ga0207677_10002319 3300026023 Bacteria 9990
571 Ga0207677_10012359 3300026023 Bacteria 4905
572 Ga0207677_10036418 3300026023 Bacteria 3207
573 Ga0207677_10178129 3300026023 Bacteria 1670
574 Ga0207677_10429518 3300026023 Bacteria 1127
575 Ga0207703_10001495 3300026035 Bacteria 21327
576 Ga0207703_10008239 3300026035 Bacteria 8235
577 Ga0207703_10024850 3300026035 Bacteria 4713
578 Ga0207703_10044403 3300026035 Unclassified 3572
579 Ga0207703_10100254 3300026035 Bacteria 2453
580 Ga0207639_10008794 3300026041 Bacteria 6939
581 Ga0207639_10021703 3300026041 Bacteria 4615
582 Ga0207639_10025344 3300026041 Bacteria 4300
583 Ga0207639_10033542 3300026041 Bacteria 3788
584 Ga0207639_10041522 3300026041 Bacteria 3442
585 Ga0207639_10164611 3300026041 Bacteria 1872
586 Ga0207639_10191234 3300026041 Bacteria 1748
587 Ga0207639_10219030 3300026041 Bacteria 1643
588 Ga0207678_10008491 3300026067 Bacteria 9054
589 Ga0207678_10060450 3300026067 Bacteria 3259
590 Ga0207678_10277976 3300026067 Bacteria 1437
591 Ga0207678_10354078 3300026067 Bacteria 1266
592 Ga0207702_10089251 3300026078 Bacteria 2695
593 Ga0207702_10138633 3300026078 Bacteria 2198
594 Ga0207702_10622404 3300026078 Bacteria 1060
595 Ga0207641_10000048 3300026088 Bacteria 178206
596 Ga0207641_10000890 3300026088 Bacteria 31183
597 Ga0207641_10003559 3300026088 Bacteria 13766
598 Ga0207641_10036683 3300026088 Bacteria 4092
599 Ga0207641_10132141 3300026088 Bacteria 2243
600 Ga0207641_10147942 3300026088 Bacteria 2125
601 Ga0207641_10211171 3300026088 Bacteria 1795
602 Ga0207641_10591383 3300026088 Bacteria 1086
603 Ga0207648_10012771 3300026089 Bacteria 7848
604 Ga0207648_10016719 3300026089 Bacteria 6694
605 Ga0207648_10036279 3300026089 Bacteria 4342
606 Ga0207648_10043490 3300026089 Bacteria 3942
607 Ga0207648_10062881 3300026089 Bacteria 3236
608 Ga0207648_10063327 3300026089 Bacteria 3224
609 Ga0207648_10077795 3300026089 Bacteria 2893
610 Ga0207648_10079711 3300026089 Bacteria 2856
611 Ga0207648_10097823 3300026089 Bacteria 2569
612 Ga0207648_10337462 3300026089 Bacteria 1357
613 Ga0207676_10007252 3300026095 Bacteria 7853
614 Ga0207676_10023539 3300026095 Bacteria 4546
615 Ga0207676_10115800 3300026095 Bacteria 2251
616 Ga0207676_10196544 3300026095 Bacteria 1779
617 Ga0207676_10201940 3300026095 Bacteria 1757
618 Ga0207674_10006350 3300026116 Bacteria 13916
619 Ga0207674_10033875 3300026116 Bacteria 5343
620 Ga0207674_10047591 3300026116 Bacteria 4394
621 Ga0207674_10055408 3300026116 Bacteria 4031
622 Ga0207674_10113772 3300026116 Bacteria 2679
623 Ga0207674_10118122 3300026116 Bacteria 2622
624 Ga0207674_10129479 3300026116 Bacteria 2488
625 Ga0207674_10175658 3300026116 Bacteria 2094
626 Ga0207674_10460437 3300026116 Bacteria 1229
627 Ga0207675_100002480 3300026118 Bacteria 18271
628 Ga0207675_100004172 3300026118 Bacteria 13985
629 Ga0207675_100041592 3300026118 Bacteria 4292
630 Ga0207675_100191008 3300026118 Bacteria 1964
631 Ga0207675_100256227 3300026118 Bacteria 1695
632 Ga0207675_100274520 3300026118 Unclassified 1637
633 Ga0207683_10009230 3300026121 Bacteria 8404
634 Ga0207683_10201519 3300026121 Bacteria 1809
635 Ga0207698_10017469 3300026142 Bacteria 4868
636 Ga0207698_10035232 3300026142 Bacteria 3659
637 Ga0207698_10057907 3300026142 Bacteria 3000
638 Ga0207698_10081340 3300026142 Bacteria 2614
639 Ga0207698_10121189 3300026142 Bacteria 2214
640 Ga0207698_10362872 3300026142 Bacteria 1372
641 Ga0209971_1010305 3300027682 Bacteria 2213
642 Ga0209974_10015827 3300027876 Bacteria 2504
643 Ga0207428_10114269 3300027907 Bacteria 2075
644 Ga0207428_10176102 3300027907 Bacteria 1618
645 Ga0268266_10000014 3300028379 Bacteria 644033
646 Ga0268266_10046754 3300028379 Bacteria 3705
647 Ga0268265_10000662 3300028380 Bacteria 34143
648 Ga0268265_10145578 3300028380 Bacteria 1990
649 Ga0268265_10159452 3300028380 Bacteria 1914
650 Ga0268264_10000041 3300028381 Bacteria 372501
651 Ga0268264_10000950 3300028381 Bacteria 29935
652 Ga0268264_10001550 3300028381 Bacteria 21303
653 Ga0268264_10004303 3300028381 Bacteria 12148
654 Ga0268264_10010959 3300028381 Bacteria 7488
655 Ga0268264_10020078 3300028381 Bacteria 5459
656 Ga0268264_10111010 3300028381 Bacteria 2401
657 Ga0268264_10116380 3300028381 Bacteria 2350
658 Ga0265337_1053442 3300028556 Bacteria 1132
659 Ga0265319_1000024 3300028563 Bacteria 144981
660 Ga0265319_1005291 3300028563 Bacteria 6211
661 Ga0265322_10021854 3300028654 Bacteria 1832
662 Ga0265322_10033668 3300028654 Bacteria 1461
663 Ga0307517_10028299 3300028786 Bacteria 6689
664 Ga0307517_10056242 3300028786 Bacteria 3843
665 Ga0307515_10000002 3300028794 Bacteria 1231751
666 Ga0307515_10000039 3300028794 Bacteria 323229
667 Ga0265338_10068391 3300028800 Bacteria 3060
668 Ga0265324_10014904 3300029957 Bacteria 2865
669 Ga0265324_10018435 3300029957 Bacteria 2524
670 Ga0307511_10000122 3300030521 Bacteria 70869
671 Ga0265328_10020370 3300031239 Bacteria 2539
672 Ga0265320_10001210 3300031240 Bacteria 18956
673 Ga0265320_10004206 3300031240 Bacteria 9459
674 Ga0265325_10042533 3300031241 Bacteria 2375
675 Ga0265327_10000209 3300031251 Bacteria 122633
676 Ga0265327_10000368 3300031251 Bacteria 85604
677 Ga0265327_10000450 3300031251 Bacteria 74345
678 Ga0265327_10000574 3300031251 Bacteria 62215
679 Ga0265327_10000811 3300031251 Bacteria 47322
680 Ga0265327_10010600 3300031251 Bacteria 6454
681 Ga0265327_10035910 3300031251 Bacteria 2732
682 Ga0265327_10041982 3300031251 Bacteria 2459
683 Ga0307509_10138045 3300031507 Bacteria 2380
684 Ga0265313_10130601 3300031595 Bacteria 1088
685 Ga0307508_10000559 3300031616 Bacteria 44219
686 Ga0265314_10001696 3300031711 Bacteria 23946
687 Ga0307413_10186071 3300031824 Bacteria 1486
688 Ga0307410_10273745 3300031852 Bacteria 1322
689 Ga0307406_10048222 3300031901 Bacteria 2689
690 Ga0307416_100225965 3300032002 Bacteria 1800
691 Ga0307414_10001307 3300032004 Bacteria 12873
692 Ga0316593_10057904 3300032168 Bacteria 1320
693 Ga0307510_10000615 3300033180 Bacteria 36175
694 Ga0307510_10211390 3300033180 Bacteria 1462
695 Ga0373929_0000001 3300035085 Bacteria 956023
696 Ga0373924_0087645 3300035410 Bacteria 1329
697 Ga0373933_0055165 3300035724 Bacteria 2383
698 Ga0373947_0105322 3300035725 Bacteria 1777
699 Ga0373947_0149681 3300035725 Unclassified 1502
700 Ga0373937_0056226 3300036401 Bacteria 3613
701 Ga0373937_0200195 3300036401 Bacteria 1877
702 Ga0373937_0250991 3300036401 Bacteria 1668
703 Ga0395899_0003607 3300037312 Bacteria 12242
704 Ga0395899_0032866 3300037312 Bacteria 3898
705 Ga0395899_0052141 3300037312 Bacteria 3033
706 Ga0395900_0058464 3300037418 Bacteria 3969
707 Ga0395900_0071857 3300037418 Bacteria 3557
708 Ga0395900_0102964 3300037418 Bacteria 2933
709 Ga0395900_0173545 3300037418 Bacteria 2193
710 Ga0395900_0426261 3300037418 Bacteria 1286
711 Ga0395898_0004078 3300037466 Bacteria 16030
712 Ga0395898_0004670 3300037466 Bacteria 14929
713 Ga0395898_0013786 3300037466 Bacteria 8309
714 Ga0395898_0268154 3300037466 Bacteria 1628
715 Ga0395905_0001073 3300037471 Bacteria 34468
716 Ga0395905_0018814 3300037471 Bacteria 6551
717 Ga0395905_0061145 3300037471 Bacteria 3523
718 Ga0395905_0134267 3300037471 Bacteria 2328
719 Ga0395901_0002083 3300038443 Bacteria 20509
720 Ga0395901_0006414 3300038443 Bacteria 11920
721 Ga0395901_0050159 3300038443 Bacteria 4337
722 Ga0395901_0294133 3300038443 Bacteria 1684
723 Ga0436365_0081746 3300039437 Bacteria 17336
724 Ga0436365_1248268 3300039437 Bacteria 25465
725 Ga0451849_0746662 3300041505 Bacteria 1303
726 Ga0439449_0005909 3300042007 Bacteria 4676
727 Ga0451577_0000023 3300042876 Bacteria 419051
728 Ga0451577_0004954 3300042876 Bacteria 13843
729 Ga0451577_0039022 3300042876 Bacteria 4268
730 Ga0451577_0206165 3300042876 Bacteria 1775
731 Ga0466969_0000612 3300044656 Bacteria 19295
732 Ga0466972_0000039 3300044658 Bacteria 135618
733 Ga0466972_0007139 3300044658 Bacteria 5611
734 Ga0466972_0018317 3300044658 Bacteria 3499
735 Ga0453684_0023992 3300044712 Bacteria 8944
736 Ga0453684_0061470 3300044712 Bacteria 4822
737 Ga0453684_0290603 3300044712 Bacteria 1861
738 Ga0466968_0098319 3300044735 Bacteria 1304
739 Ga0466957_0004285 3300044842 Bacteria 7911
740 Ga0466957_0023080 3300044842 Bacteria 3674
741 Ga0466960_0108543 3300044901 Bacteria 1439
742 Ga0466959_0000002 3300045049 Bacteria 362671
743 Ga0466967_0147911 3300045976 Bacteria 2193
744 Ga0495629_0030351 3300046459 Bacteria 3833
745 Ga0495638_0041781 3300046460 Bacteria 2899
746 Ga0495638_0111690 3300046460 Bacteria 1623
747 Ga0495606_0023054 3300046507 Bacteria 4522
748 Ga0495618_0064406 3300046514 Bacteria 2329
749 Ga0495630_0039693 3300046517 Bacteria 3519
750 Ga0495648_0000729 3300046524 Bacteria 35114
751 Ga0495640_0203557 3300046533 Bacteria 1254
752 Ga0495586_0069535 3300046535 Bacteria 1922
753 Ga0495587_0034069 3300046536 Bacteria 3072
754 Ga0495597_0043155 3300046542 Bacteria 2009
755 Ga0495645_0085214 3300046543 Bacteria 2262
756 Ga0495645_0216424 3300046543 Bacteria 1291
757 Ga0495667_0061751 3300046559 Bacteria 2456
758 Ga0495668_0003157 3300046616 Bacteria 12703
759 Ga0495611_0000316 3300046648 Bacteria 32353
760 Ga0495635_0065078 3300046663 Bacteria 2502
761 Ga0495657_0110001 3300046675 Unclassified 1747
762 Ga0495599_0098943 3300046678 Bacteria 1818
763 Ga0495623_0250200 3300046679 Bacteria 997
764 Ga0495658_0001038 3300046683 Bacteria 14680
765 Ga0495613_0166910 3300046689 Bacteria 1564
766 Ga0495600_0270391 3300046809 Bacteria 1078
767 Ga0495604_0172447 3300047317 Bacteria 1520
768 Ga0495674_0033659 3300047319 Bacteria 4640
769 Ga0495674_0124114 3300047319 Bacteria 2180
770 Ga0495674_0215275 3300047319 Bacteria 1590
771 Ga0495672_0034698 3300047320 Bacteria 3114
772 Ga0495687_000001 3300047443 Bacteria 1215582
773 Ga0495684_0089845 3300047471 Bacteria 2327
774 Ga0496102_0404100 3300048905 Bacteria 1284
775 Ga0496104_0401564 3300048907 Bacteria 1283
776 Ga0496109_0033713 3300048912 Bacteria 4608
777 Ga0496110_0325144 3300048913 Bacteria 1401
778 Ga0496122_0000876 3300048925 Bacteria 56653
779 Ga0496123_0000777 3300048926 Bacteria 51679
780 Ga0496125_0078267 3300048928 Bacteria 2543
781 Ga0501031_0004191 3300049568 Bacteria 9316
782 Ga0501032_0006084 3300049569 Bacteria 8894
783 Ga0501032_0055065 3300049569 Bacteria 2676
784 Ga0501032_0117772 3300049569 Bacteria 1756
785 Ga0501033_0012835 3300049570 Bacteria 6389
786 Ga0501034_0000399 3300049571 Bacteria 73348
787 Ga0501034_0001952 3300049571 Bacteria 26110
788 Ga0501034_0003741 3300049571 Bacteria 17186
789 Ga0501034_0004761 3300049571 Bacteria 15020
790 Ga0501034_0122751 3300049571 Bacteria 2583
791 Ga0501034_0159730 3300049571 Bacteria 2226
792 Ga0501034_0376929 3300049571 Bacteria 1344
793 Ga0501036_0114367 3300049572 Bacteria 2280
794 Ga0501036_0250446 3300049572 Bacteria 1484
795 Ga0501037_0002106 3300049573 Bacteria 14423
796 Ga0501037_0002722 3300049573 Bacteria 12784
797 Ga0501037_0024528 3300049573 Bacteria 4460
798 Ga0501038_0014847 3300049574 Bacteria 7093
799 Ga0501038_0026682 3300049574 Bacteria 5143
800 Ga0501039_0013726 3300049575 Bacteria 6197
801 Ga0501043_0008083 3300049579 Bacteria 8301
802 Ga0501043_0030462 3300049579 Bacteria 4240
803 Ga0501043_0123616 3300049579 Bacteria 2029
804 Ga0501043_0354251 3300049579 Bacteria 1115
805 Ga0501046_0074556 3300049580 Bacteria 2632
806 Ga0501047_0007662 3300049581 Bacteria 10170
807 Ga0501047_0376061 3300049581 Bacteria 1255
808 Ga0501067_0023993 3300049583 Bacteria 3382
809 Ga0501067_0031262 3300049583 Bacteria 2954
810 Ga0501070_0221249 3300049586 Bacteria 1552
811 Ga0501073_0010966 3300049589 Bacteria 6630
812 Ga0501074_0008264 3300049590 Bacteria 7545
813 Ga0501202_000479 3300049652 Bacteria 5704
814 Ga0501217_005940 3300049661 Bacteria 2573
815 Ga0501223_000506 3300049663 Bacteria 9452
816 Ga0501224_000674 3300049664 Bacteria 4254
817 Ga0501233_000572 3300049668 Bacteria 5983
818 Ga0501235_032644 3300049669 Bacteria 1178
819 Ga0501250_001689 3300049680 Bacteria 1881
820 Ga0501252_002344 3300049682 Bacteria 1872
821 Ga0501259_000316 3300049688 Bacteria 7659
822 Ga0501261_012254 3300049690 Bacteria 1152
823 Ga0501219_000931 3300049703 Bacteria 3551
824 Ga0501221_001361 3300049704 Bacteria 4026
825 Ga0501225_0000782 3300049705 Bacteria 9942
826 Ga0501225_0017687 3300049705 Bacteria 1979
827 Ga0501234_000503 3300049707 Bacteria 6004
828 Ga0501245_000412 3300049708 Bacteria 5157
829 Ga0501079_0047494 3300049741 Bacteria 3312
830 Ga0501080_0214118 3300049742 Bacteria 1765
831 Ga0501083_0002808 3300049744 Bacteria 12018
832 Ga0501083_0208482 3300049744 Bacteria 1274
833 Ga0501232_006986 3300049757 Bacteria 1177
834 Ga0501266_002255 3300049763 Bacteria 2440
835 Ga0501035_0022258 3300049822 Bacteria 5820
836 Ga0501035_0025743 3300049822 Bacteria 5393
837 Ga0501035_0026724 3300049822 Bacteria 5279
838 Ga0501035_0109967 3300049822 Bacteria 2416
839 Ga0501044_0003545 3300049823 Bacteria 17566
840 Ga0501044_0018651 3300049823 Bacteria 7432
841 Ga0501044_0021617 3300049823 Bacteria 6860
842 Ga0501044_0140905 3300049823 Bacteria 2400
843 Ga0501044_0141400 3300049823 Bacteria 2395
844 Ga0501044_0200150 3300049823 Bacteria 1956
845 Ga0501045_0230668 3300049824 Bacteria 1378
846 Ga0501284_00011 3300050005 Bacteria 131008
847 nmdc:mga0k408_245116_c1 3300050493 Bacteria 1070
848 nmdc:mga05p37_148186_c1 3300050507 Bacteria 2872
849 nmdc:mga05p37_194378_c1 3300050507 Unclassified 2461
850 nmdc:mga05p37_6154_c1 3300050507 Bacteria 5009
851 nmdc:mga05p37_703725_c1 3300050507 Bacteria 1122
852 nmdc:mga09592_69357_c1 3300050508 Bacteria 2991
853 nmdc:mga0qj67_271037_c1 3300050509 Bacteria 1376
854 nmdc:mga0qj67_38975_c1 3300050509 Bacteria 3730
855 nmdc:mga06r32_13952_c1 3300050510 Bacteria 7290
856 nmdc:mga06r32_23480_c1 3300050510 Bacteria 5706
857 nmdc:mga08y16_120340_c1 3300050511 Bacteria 2732
858 nmdc:mga0n895_144049_c1 3300050512 Bacteria 2412
859 nmdc:mga0n895_96389_c1 3300050512 Bacteria 2963
860 nmdc:mga08x19_36_c1 3300050514 Bacteria 179752
861 Ga0495619_0046804 3300053085 Bacteria 2846
862 Ga0495619_0057302 3300053085 Bacteria 2585
863 Ga0500578_0014967 3300053086 Bacteria 4983
864 Ga0500583_0000075 3300053092 Bacteria 59561
865 Ga0500583_0000796 3300053092 Bacteria 9111
866 Ga0500583_0000989 3300053092 Bacteria 8077
867 Ga0500568_0016276 3300053139 Bacteria 3311
868 Ga0500589_009515 3300053147 Bacteria 4113
869 Ga0500622_0054836 3300053156 Bacteria 2043
870 Ga0500622_0101515 3300053156 Bacteria 1416
871 Ga0500611_000031 3300053727 Bacteria 85821

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10000574 Ga0265327_1000057449 293
2 3300028563 Ga0265319_1005291 Ga0265319_10052913 295
3 3300042876 Ga0451577_0206165 Ga0451577_0206165_660_1604 298
4 3300006237 Ga0097621_100016846 Ga0097621_1000168463 299
5 3300005458 Ga0070681_10044327 Ga0070681_100443273 301
6 3300009551 Ga0105238_10008890 Ga0105238_100088904 301
7 3300025913 Ga0207695_10064274 Ga0207695_100642742 301
8 3300044901 Ga0466960_0108543 Ga0466960_0108543_487_1392 301
9 3300053139 Ga0500568_0016276 Ga0500568_0016276_1616_2521 301
10 3300005616 Ga0068852_100023529 Ga0068852_1000235292 302
11 3300009174 Ga0105241_10135519 Ga0105241_101355192 302
12 3300010375 Ga0105239_10001527 Ga0105239_1000152715 302
13 3300014968 Ga0157379_10244657 Ga0157379_102446572 302
14 3300025907 Ga0207645_10170415 Ga0207645_101704151 302
15 3300026023 Ga0207677_10429518 Ga0207677_104295181 302
16 3300026118 Ga0207675_100191008 Ga0207675_1001910083 302
17 3300031616 Ga0307508_10000559 Ga0307508_1000055911 302
18 3300044656 Ga0466969_0000612 Ga0466969_0000612_12399_13316 302
19 3300044735 Ga0466968_0098319 Ga0466968_0098319_151_1092 302
20 3300045049 Ga0466959_0000002 Ga0466959_0000002_246039_246956 302
21 3300049570 Ga0501033_0012835 Ga0501033_0012835_45_953 302
22 3300049690 Ga0501261_012254 Ga0501261_012254_201_1109 302
23 3300050509 nmdc:mga0qj67_271037_c1 nmdc:mga0qj67_271037_c1_448_1356 302
24 3300042007 Ga0439449_0005909 Ga0439449_0005909_1766_2746 304
25 3300025936 Ga0207670_10186272 Ga0207670_101862721 305
26 3300025321 Ga0207656_10102980 Ga0207656_101029801 306
27 3300037418 Ga0395900_0102964 Ga0395900_0102964_256_1212 306
28 3300005334 Ga0068869_100026133 Ga0068869_1000261333 307
29 3300005335 Ga0070666_10000043 Ga0070666_1000004339 307
30 3300005616 Ga0068852_100026331 Ga0068852_1000263315 307
31 3300005617 Ga0068859_100000012 Ga0068859_100000012142 307
32 3300005618 Ga0068864_100005117 Ga0068864_1000051179 307
33 3300005834 Ga0068851_10178396 Ga0068851_101783961 307
34 3300005841 Ga0068863_100006838 Ga0068863_1000068389 307
35 3300005842 Ga0068858_100005154 Ga0068858_10000515413 307
36 3300005844 Ga0068862_100000995 Ga0068862_1000009954 307
37 3300006237 Ga0097621_100206975 Ga0097621_1002069752 307
38 3300006931 Ga0097620_100000012 Ga0097620_100000012142 307
39 3300009098 Ga0105245_10167309 Ga0105245_101673093 307
40 3300009101 Ga0105247_10006231 Ga0105247_100062316 307
41 3300009174 Ga0105241_10001105 Ga0105241_1000110515 307
42 3300009545 Ga0105237_10000725 Ga0105237_1000072526 307
43 3300013105 Ga0157369_10344186 Ga0157369_103441862 307
44 3300013306 Ga0163162_10004470 Ga0163162_100044707 307
45 3300014325 Ga0163163_10115435 Ga0163163_101154353 307
46 3300014968 Ga0157379_10108486 Ga0157379_101084862 307
47 3300014969 Ga0157376_10055901 Ga0157376_100559012 307
48 3300025900 Ga0207710_10004413 Ga0207710_100044133 307
49 3300025903 Ga0207680_10000108 Ga0207680_1000010832 307
50 3300025911 Ga0207654_10005154 Ga0207654_100051542 307
51 3300025927 Ga0207687_10167260 Ga0207687_101672601 307
52 3300025942 Ga0207689_10001398 Ga0207689_1000139818 307
53 3300025961 Ga0207712_10018237 Ga0207712_100182372 307
54 3300026035 Ga0207703_10001495 Ga0207703_1000149517 307
55 3300026088 Ga0207641_10000048 Ga0207641_1000004812 307
56 3300026095 Ga0207676_10007252 Ga0207676_100072522 307
57 3300028380 Ga0268265_10000662 Ga0268265_1000066220 307
58 3300050507 nmdc:mga05p37_703725_c1 nmdc:mga05p37_703725_c1_122_1063 307
59 3300013297 Ga0157378_10124509 Ga0157378_101245092 308
60 3300005328 Ga0070676_10000103 Ga0070676_100001038 310
61 3300005338 Ga0068868_100000358 Ga0068868_10000035811 310
62 3300005339 Ga0070660_100157651 Ga0070660_1001576512 310
63 3300005347 Ga0070668_100000308 Ga0070668_10000030819 310
64 3300005354 Ga0070675_100060036 Ga0070675_1000600362 310
65 3300005364 Ga0070673_100000232 Ga0070673_10000023215 310
66 3300005367 Ga0070667_100000583 Ga0070667_10000058318 310
67 3300005367 Ga0070667_100154928 Ga0070667_1001549282 310
68 3300005459 Ga0068867_100018459 Ga0068867_1000184592 310
69 3300005539 Ga0068853_100030060 Ga0068853_1000300602 310
70 3300005543 Ga0070672_100000345 Ga0070672_10000034517 310
71 3300005548 Ga0070665_100001618 Ga0070665_10000161817 310
72 3300005563 Ga0068855_100028910 Ga0068855_1000289103 310
73 3300005564 Ga0070664_100062879 Ga0070664_1000628793 310
74 3300005616 Ga0068852_100035776 Ga0068852_1000357762 310
75 3300005618 Ga0068864_100004460 Ga0068864_1000044602 310
76 3300005834 Ga0068851_10007180 Ga0068851_100071804 310
77 3300005841 Ga0068863_100001439 Ga0068863_1000014396 310
78 3300005842 Ga0068858_100005079 Ga0068858_1000050795 310
79 3300005843 Ga0068860_100000662 Ga0068860_10000066218 310
80 3300006237 Ga0097621_100021813 Ga0097621_1000218135 310
81 3300006358 Ga0068871_100039722 Ga0068871_1000397222 310
82 3300006881 Ga0068865_100000668 Ga0068865_10000066811 310
83 3300006914 Ga0075436_100000145 Ga0075436_1000001455 310
84 3300009093 Ga0105240_10148232 Ga0105240_101482322 310
85 3300009098 Ga0105245_10278965 Ga0105245_102789652 310
86 3300009148 Ga0105243_10189580 Ga0105243_101895802 310
87 3300009176 Ga0105242_10433148 Ga0105242_104331482 310
88 3300009545 Ga0105237_10163378 Ga0105237_101633782 310
89 3300009551 Ga0105238_10062082 Ga0105238_100620825 310
90 3300009553 Ga0105249_10000682 Ga0105249_1000068211 310
91 3300010375 Ga0105239_10089304 Ga0105239_100893043 310
92 3300011119 Ga0105246_10036756 Ga0105246_100367563 310
93 3300013296 Ga0157374_10000484 Ga0157374_1000048418 310
94 3300013297 Ga0157378_10051359 Ga0157378_100513594 310
95 3300013306 Ga0163162_10000484 Ga0163162_1000048418 310
96 3300013308 Ga0157375_10000619 Ga0157375_1000061918 310
97 3300014325 Ga0163163_10000499 Ga0163163_1000049918 310
98 3300014326 Ga0157380_10201513 Ga0157380_102015132 310
99 3300014968 Ga0157379_10001386 Ga0157379_100013864 310
100 3300014969 Ga0157376_10000798 Ga0157376_100007987 310
101 3300025321 Ga0207656_10002904 Ga0207656_100029045 310
102 3300025903 Ga0207680_10023781 Ga0207680_100237812 310
103 3300025909 Ga0207705_10003522 Ga0207705_100035229 310
104 3300025913 Ga0207695_10139675 Ga0207695_101396752 310
105 3300025927 Ga0207687_10179791 Ga0207687_101797912 310
106 3300025934 Ga0207686_10300972 Ga0207686_103009721 310
107 3300025940 Ga0207691_10000549 Ga0207691_1000054918 310
108 3300025945 Ga0207679_10220471 Ga0207679_102204711 310
109 3300025949 Ga0207667_10148118 Ga0207667_101481182 310
110 3300025960 Ga0207651_10000231 Ga0207651_1000023112 310
111 3300025961 Ga0207712_10151399 Ga0207712_101513992 310
112 3300025972 Ga0207668_10000639 Ga0207668_100006398 310
113 3300025986 Ga0207658_10000942 Ga0207658_1000094219 310
114 3300026023 Ga0207677_10001537 Ga0207677_100015378 310
115 3300026035 Ga0207703_10008239 Ga0207703_100082395 310
116 3300026041 Ga0207639_10025344 Ga0207639_100253442 310
117 3300026088 Ga0207641_10000890 Ga0207641_100008909 310
118 3300026089 Ga0207648_10016719 Ga0207648_100167192 310
119 3300026095 Ga0207676_10023539 Ga0207676_100235392 310
120 3300026142 Ga0207698_10017469 Ga0207698_100174693 310
121 3300028379 Ga0268266_10046754 Ga0268266_100467542 310
122 3300028381 Ga0268264_10001550 Ga0268264_1000155018 310
123 3300048905 Ga0496102_0404100 Ga0496102_0404100_313_1269 310
124 3300048912 Ga0496109_0033713 Ga0496109_0033713_1826_2782 310
125 3300050514 nmdc:mga08x19_36_c1 nmdc:mga08x19_36_c1_2267_3217 310
126 3300027682 Ga0209971_1010305 Ga0209971_10103052 311
127 3300027876 Ga0209974_10015827 Ga0209974_100158272 311
128 3300028654 Ga0265322_10033668 Ga0265322_100336682 311
129 3300029957 Ga0265324_10014904 Ga0265324_100149041 311
130 3300031239 Ga0265328_10020370 Ga0265328_100203702 311
131 3300031251 Ga0265327_10010600 Ga0265327_100106005 311
132 iso_pu_bacteria 2738541283 2738756062 311
133 iso_pu_bacteria 2775506987 2776616081 311
134 3300004799 Ga0058863_11897022 Ga0058863_118970222 312
135 3300004803 Ga0058862_10028396 Ga0058862_100283963 312
136 3300005327 Ga0070658_10009081 Ga0070658_100090811 312
137 3300005336 Ga0070680_100001109 Ga0070680_1000011098 312
138 3300005345 Ga0070692_10255199 Ga0070692_102551991 312
139 3300005455 Ga0070663_100225988 Ga0070663_1002259881 312
140 3300005455 Ga0070663_100244775 Ga0070663_1002447751 312
141 3300005458 Ga0070681_10005409 Ga0070681_1000540911 312
142 3300005530 Ga0070679_100031280 Ga0070679_1000312803 312
143 3300005563 Ga0068855_100087593 Ga0068855_1000875934 312
144 3300005578 Ga0068854_100095628 Ga0068854_1000956282 312
145 3300005614 Ga0068856_100149457 Ga0068856_1001494571 312
146 3300013100 Ga0157373_10049038 Ga0157373_100490383 312
147 3300013102 Ga0157371_10039145 Ga0157371_100391454 312
148 3300013104 Ga0157370_10000673 Ga0157370_1000067317 312
149 3300013105 Ga0157369_10006046 Ga0157369_1000604611 312
150 3300013307 Ga0157372_10041409 Ga0157372_100414096 312
151 3300025909 Ga0207705_10004003 Ga0207705_1000400310 312
152 3300025912 Ga0207707_10002754 Ga0207707_1000275411 312
153 3300025919 Ga0207657_10269804 Ga0207657_102698042 312
154 3300025921 Ga0207652_10000074 Ga0207652_1000007492 312
155 3300025921 Ga0207652_10000942 Ga0207652_1000094219 312
156 3300025921 Ga0207652_10446859 Ga0207652_104468591 312
157 3300025949 Ga0207667_10016655 Ga0207667_1001665511 312
158 3300026067 Ga0207678_10008491 Ga0207678_100084919 312
159 3300026067 Ga0207678_10277976 Ga0207678_102779762 312
160 3300026078 Ga0207702_10089251 Ga0207702_100892512 312
161 3300037312 Ga0395899_0032866 Ga0395899_0032866_1231_2169 312
162 3300037418 Ga0395900_0058464 Ga0395900_0058464_2381_3319 312
163 3300037418 Ga0395900_0426261 Ga0395900_0426261_168_1106 312
164 3300037466 Ga0395898_0013786 Ga0395898_0013786_2862_3800 312
165 3300037466 Ga0395898_0268154 Ga0395898_0268154_449_1387 312
166 3300038443 Ga0395901_0050159 Ga0395901_0050159_1135_2073 312
167 3300005329 Ga0070683_100013464 Ga0070683_1000134647 313
168 3300005337 Ga0070682_100163862 Ga0070682_1001638622 313
169 3300005344 Ga0070661_100003722 Ga0070661_1000037227 313
170 3300005366 Ga0070659_100026117 Ga0070659_1000261172 313
171 3300005455 Ga0070663_100313151 Ga0070663_1003131512 313
172 3300005535 Ga0070684_100011702 Ga0070684_1000117028 313
173 3300005539 Ga0068853_100000097 Ga0068853_1000000978 313
174 3300005564 Ga0070664_100011562 Ga0070664_1000115622 313
175 3300005577 Ga0068857_100435101 Ga0068857_1004351011 313
176 3300013100 Ga0157373_10045344 Ga0157373_100453441 313
177 3300013100 Ga0157373_10069976 Ga0157373_100699762 313
178 3300013102 Ga0157371_10020600 Ga0157371_100206004 313
179 3300013307 Ga0157372_10321435 Ga0157372_103214352 313
180 3300025920 Ga0207649_10078676 Ga0207649_100786762 313
181 3300025932 Ga0207690_10008634 Ga0207690_100086342 313
182 3300025944 Ga0207661_10003834 Ga0207661_100038343 313
183 3300025945 Ga0207679_10000408 Ga0207679_1000040820 313
184 3300026041 Ga0207639_10008794 Ga0207639_100087946 313
185 3300026067 Ga0207678_10354078 Ga0207678_103540781 313
186 3300026116 Ga0207674_10006350 Ga0207674_100063501 313
187 3300028786 Ga0307517_10028299 Ga0307517_100282994 313
188 3300032168 Ga0316593_10057904 Ga0316593_100579041 313
189 3300035085 Ga0373929_0000001 Ga0373929_0000001_63689_64684 313
190 3300044658 Ga0466972_0018317 Ga0466972_0018317_1053_2039 313
191 3300046675 Ga0495657_0110001 Ga0495657_0110001_328_1269 313
192 3300046809 Ga0495600_0270391 Ga0495600_0270391_108_1049 313
193 iso_pu_bacteria 2738541278 2738727099 313
194 3300005834 Ga0068851_10000252 Ga0068851_1000025210 314
195 3300006871 Ga0075434_100134102 Ga0075434_1001341022 314
196 3300009553 Ga0105249_10347647 Ga0105249_103476472 314
197 3300014326 Ga0157380_10003845 Ga0157380_100038453 314
198 3300025321 Ga0207656_10000749 Ga0207656_100007495 314
199 3300025961 Ga0207712_10179103 Ga0207712_101791031 314
200 3300028556 Ga0265337_1053442 Ga0265337_10534421 314
201 3300028563 Ga0265319_1000024 Ga0265319_100002432 314
202 3300028654 Ga0265322_10021854 Ga0265322_100218542 314
203 3300031240 Ga0265320_10001210 Ga0265320_1000121017 314
204 3300031240 Ga0265320_10004206 Ga0265320_100042066 314
205 3300031241 Ga0265325_10042533 Ga0265325_100425333 314
206 3300031251 Ga0265327_10000450 Ga0265327_1000045030 314
207 3300031251 Ga0265327_10035910 Ga0265327_100359102 314
208 3300031595 Ga0265313_10130601 Ga0265313_101306011 314
209 3300031711 Ga0265314_10001696 Ga0265314_1000169615 314
210 3300042876 Ga0451577_0000023 Ga0451577_0000023_395892_396893 314
211 3300044712 Ga0453684_0023992 Ga0453684_0023992_2614_3618 314
212 3300050512 nmdc:mga0n895_144049_c1 nmdc:mga0n895_144049_c1_971_2017 314
213 3300005289 Ga0065704_10001598 Ga0065704_100015985 315
214 3300005434 Ga0070709_10000005 Ga0070709_100000055 315
215 3300005466 Ga0070685_10002988 Ga0070685_100029882 315
216 3300005539 Ga0068853_100000501 Ga0068853_1000005013 315
217 3300005563 Ga0068855_100138006 Ga0068855_1001380063 315
218 3300005577 Ga0068857_100022608 Ga0068857_1000226083 315
219 3300005616 Ga0068852_100001785 Ga0068852_1000017854 315
220 3300005843 Ga0068860_100007619 Ga0068860_1000076195 315
221 3300006871 Ga0075434_100323199 Ga0075434_1003231992 315
222 3300006881 Ga0068865_100219682 Ga0068865_1002196822 315
223 3300009093 Ga0105240_10000147 Ga0105240_1000014793 315
224 3300009093 Ga0105240_10000168 Ga0105240_1000016888 315
225 3300009093 Ga0105240_10012035 Ga0105240_100120354 315
226 3300009093 Ga0105240_10015585 Ga0105240_100155853 315
227 3300009093 Ga0105240_10050139 Ga0105240_100501392 315
228 3300009147 Ga0114129_10528836 Ga0114129_105288362 315
229 3300009545 Ga0105237_10000394 Ga0105237_1000039429 315
230 3300009545 Ga0105237_10008284 Ga0105237_100082849 315
231 3300009545 Ga0105237_10023397 Ga0105237_100233975 315
232 3300010375 Ga0105239_10001529 Ga0105239_1000152918 315
233 3300010375 Ga0105239_10016372 Ga0105239_100163725 315
234 3300010375 Ga0105239_10139506 Ga0105239_101395062 315
235 3300013102 Ga0157371_10001603 Ga0157371_100016036 315
236 3300013104 Ga0157370_10006476 Ga0157370_100064764 315
237 3300013104 Ga0157370_10012429 Ga0157370_100124295 315
238 3300013105 Ga0157369_10020699 Ga0157369_100206993 315
239 3300013307 Ga0157372_10000317 Ga0157372_1000031726 315
240 3300014497 Ga0182008_10000053 Ga0182008_1000005371 315
241 3300015261 Ga0182006_1000270 Ga0182006_100027044 315
242 3300025903 Ga0207680_10188619 Ga0207680_101886191 315
243 3300025909 Ga0207705_10026286 Ga0207705_100262863 315
244 3300025911 Ga0207654_10308749 Ga0207654_103087491 315
245 3300025913 Ga0207695_10000023 Ga0207695_10000023214 315
246 3300025913 Ga0207695_10000031 Ga0207695_10000031355 315
247 3300025913 Ga0207695_10028819 Ga0207695_100288193 315
248 3300025914 Ga0207671_10000925 Ga0207671_100009251 315
249 3300025924 Ga0207694_10012838 Ga0207694_100128384 315
250 3300025928 Ga0207700_10309229 Ga0207700_103092291 315
251 3300025949 Ga0207667_10000773 Ga0207667_1000077316 315
252 3300025972 Ga0207668_10378447 Ga0207668_103784471 315
253 3300026041 Ga0207639_10041522 Ga0207639_100415222 315
254 3300026041 Ga0207639_10164611 Ga0207639_101646112 315
255 3300026116 Ga0207674_10055408 Ga0207674_100554084 315
256 3300026142 Ga0207698_10035232 Ga0207698_100352322 315
257 3300028381 Ga0268264_10000950 Ga0268264_100009506 315
258 3300032004 Ga0307414_10001307 Ga0307414_100013074 315
259 3300035725 Ga0373947_0149681 Ga0373947_0149681_284_1321 315
260 3300041505 Ga0451849_0746662 Ga0451849_0746662_334_1293 315
261 3300048925 Ga0496122_0000876 Ga0496122_0000876_19334_20437 315
262 3300048926 Ga0496123_0000777 Ga0496123_0000777_28869_29972 315
263 3300048928 Ga0496125_0078267 Ga0496125_0078267_1474_2526 315
264 3300049744 Ga0501083_0002808 Ga0501083_0002808_9111_10148 315
265 3300050512 nmdc:mga0n895_96389_c1 nmdc:mga0n895_96389_c1_521_1504 315
266 3300003320 rootH2_10016843 rootH2_100168432 316
267 3300005327 Ga0070658_10168037 Ga0070658_101680373 316
268 3300005329 Ga0070683_100002537 Ga0070683_1000025378 316
269 3300005331 Ga0070670_100189196 Ga0070670_1001891962 316
270 3300005335 Ga0070666_10008965 Ga0070666_100089653 316
271 3300005335 Ga0070666_10010785 Ga0070666_100107852 316
272 3300005338 Ga0068868_100010933 Ga0068868_1000109336 316
273 3300005338 Ga0068868_100113611 Ga0068868_1001136112 316
274 3300005338 Ga0068868_100156118 Ga0068868_1001561182 316
275 3300005339 Ga0070660_100110434 Ga0070660_1001104344 316
276 3300005347 Ga0070668_100216686 Ga0070668_1002166861 316
277 3300005354 Ga0070675_100338717 Ga0070675_1003387172 316
278 3300005355 Ga0070671_100099251 Ga0070671_1000992511 316
279 3300005355 Ga0070671_100162476 Ga0070671_1001624762 316
280 3300005365 Ga0070688_100002313 Ga0070688_1000023133 316
281 3300005367 Ga0070667_100062669 Ga0070667_1000626692 316
282 3300005367 Ga0070667_100304283 Ga0070667_1003042831 316
283 3300005457 Ga0070662_100004745 Ga0070662_1000047453 316
284 3300005459 Ga0068867_100075190 Ga0068867_1000751902 316
285 3300005459 Ga0068867_100078110 Ga0068867_1000781102 316
286 3300005535 Ga0070684_100218736 Ga0070684_1002187362 316
287 3300005539 Ga0068853_100236061 Ga0068853_1002360612 316
288 3300005548 Ga0070665_100000041 Ga0070665_100000041188 316
289 3300005548 Ga0070665_100707618 Ga0070665_1007076181 316
290 3300005563 Ga0068855_100000957 Ga0068855_10000095714 316
291 3300005564 Ga0070664_100257278 Ga0070664_1002572782 316
292 3300005577 Ga0068857_100061838 Ga0068857_1000618383 316
293 3300005578 Ga0068854_100059917 Ga0068854_1000599173 316
294 3300005614 Ga0068856_100071316 Ga0068856_1000713162 316
295 3300005614 Ga0068856_100288614 Ga0068856_1002886142 316
296 3300005615 Ga0070702_100025113 Ga0070702_1000251133 316
297 3300005616 Ga0068852_100116153 Ga0068852_1001161532 316
298 3300005617 Ga0068859_100015958 Ga0068859_1000159587 316
299 3300005617 Ga0068859_100056360 Ga0068859_1000563603 316
300 3300005617 Ga0068859_100064054 Ga0068859_1000640543 316
301 3300005618 Ga0068864_100054233 Ga0068864_1000542333 316
302 3300005842 Ga0068858_100015472 Ga0068858_1000154723 316
303 3300005842 Ga0068858_100283136 Ga0068858_1002831362 316
304 3300005843 Ga0068860_100000208 Ga0068860_10000020811 316
305 3300005843 Ga0068860_100385511 Ga0068860_1003855112 316
306 3300006358 Ga0068871_100043066 Ga0068871_1000430663 316
307 3300006931 Ga0097620_100015958 Ga0097620_1000159583 316
308 3300006931 Ga0097620_100056360 Ga0097620_1000563603 316
309 3300006931 Ga0097620_100064052 Ga0097620_1000640523 316
310 3300009093 Ga0105240_10000224 Ga0105240_1000022455 316
311 3300009545 Ga0105237_10020325 Ga0105237_100203253 316
312 3300009551 Ga0105238_10000247 Ga0105238_1000024718 316
313 3300010375 Ga0105239_10015328 Ga0105239_100153282 316
314 3300010375 Ga0105239_10156469 Ga0105239_101564692 316
315 3300013100 Ga0157373_10011321 Ga0157373_100113215 316
316 3300013102 Ga0157371_10001840 Ga0157371_1000184011 316
317 3300013102 Ga0157371_10023994 Ga0157371_100239944 316
318 3300013104 Ga0157370_10002442 Ga0157370_1000244222 316
319 3300013306 Ga0163162_10001520 Ga0163162_1000152018 316
320 3300013306 Ga0163162_10011289 Ga0163162_100112892 316
321 3300013306 Ga0163162_10040262 Ga0163162_100402622 316
322 3300013306 Ga0163162_10211306 Ga0163162_102113062 316
323 3300013307 Ga0157372_10008771 Ga0157372_100087718 316
324 3300013307 Ga0157372_10068608 Ga0157372_100686082 316
325 3300013308 Ga0157375_10062153 Ga0157375_100621535 316
326 3300013308 Ga0157375_10423317 Ga0157375_104233172 316
327 3300014325 Ga0163163_10001833 Ga0163163_100018331 316
328 3300014325 Ga0163163_10229914 Ga0163163_102299142 316
329 3300014968 Ga0157379_10024256 Ga0157379_100242563 316
330 3300014968 Ga0157379_10386536 Ga0157379_103865361 316
331 3300025899 Ga0207642_10154944 Ga0207642_101549441 316
332 3300025903 Ga0207680_10029990 Ga0207680_100299902 316
333 3300025903 Ga0207680_10153135 Ga0207680_101531351 316
334 3300025907 Ga0207645_10018557 Ga0207645_100185574 316
335 3300025912 Ga0207707_10022737 Ga0207707_100227372 316
336 3300025913 Ga0207695_10002344 Ga0207695_100023447 316
337 3300025914 Ga0207671_10003957 Ga0207671_1000395712 316
338 3300025920 Ga0207649_10003147 Ga0207649_100031475 316
339 3300025924 Ga0207694_10020081 Ga0207694_100200813 316
340 3300025926 Ga0207659_10018772 Ga0207659_100187722 316
341 3300025926 Ga0207659_10274612 Ga0207659_102746122 316
342 3300025933 Ga0207706_10002124 Ga0207706_100021248 316
343 3300025933 Ga0207706_10057700 Ga0207706_100577002 316
344 3300025933 Ga0207706_10094248 Ga0207706_100942482 316
345 3300025936 Ga0207670_10059712 Ga0207670_100597122 316
346 3300025936 Ga0207670_10100189 Ga0207670_101001892 316
347 3300025942 Ga0207689_10031756 Ga0207689_100317562 316
348 3300025944 Ga0207661_10043853 Ga0207661_100438534 316
349 3300025945 Ga0207679_10007934 Ga0207679_100079346 316
350 3300025949 Ga0207667_10006879 Ga0207667_1000687910 316
351 3300025960 Ga0207651_10031683 Ga0207651_100316832 316
352 3300025981 Ga0207640_10225111 Ga0207640_102251112 316
353 3300025986 Ga0207658_10021496 Ga0207658_100214962 316
354 3300026023 Ga0207677_10012359 Ga0207677_100123592 316
355 3300026023 Ga0207677_10036418 Ga0207677_100364182 316
356 3300026035 Ga0207703_10024850 Ga0207703_100248503 316
357 3300026035 Ga0207703_10044403 Ga0207703_100444033 316
358 3300026041 Ga0207639_10219030 Ga0207639_102190302 316
359 3300026078 Ga0207702_10138633 Ga0207702_101386332 316
360 3300026089 Ga0207648_10012771 Ga0207648_100127714 316
361 3300026089 Ga0207648_10077795 Ga0207648_100777953 316
362 3300026089 Ga0207648_10079711 Ga0207648_100797112 316
363 3300026121 Ga0207683_10009230 Ga0207683_100092305 316
364 3300028379 Ga0268266_10000014 Ga0268266_100000147 316
365 3300028381 Ga0268264_10000041 Ga0268264_1000004174 316
366 3300028786 Ga0307517_10056242 Ga0307517_100562423 316
367 3300035410 Ga0373924_0087645 Ga0373924_0087645_123_1073 316
368 3300035724 Ga0373933_0055165 Ga0373933_0055165_1070_2020 316
369 3300036401 Ga0373937_0056226 Ga0373937_0056226_838_1788 316
370 3300037312 Ga0395899_0052141 Ga0395899_0052141_379_1329 316
371 3300037418 Ga0395900_0071857 Ga0395900_0071857_2506_3456 316
372 3300037418 Ga0395900_0173545 Ga0395900_0173545_1109_2059 316
373 3300037466 Ga0395898_0004078 Ga0395898_0004078_5380_6330 316
374 3300037471 Ga0395905_0018814 Ga0395905_0018814_2297_3283 316
375 3300037471 Ga0395905_0061145 Ga0395905_0061145_1479_2429 316
376 3300038443 Ga0395901_0002083 Ga0395901_0002083_570_1520 316
377 3300038443 Ga0395901_0294133 Ga0395901_0294133_619_1605 316
378 3300044658 Ga0466972_0007139 Ga0466972_0007139_3716_4675 316
379 3300046514 Ga0495618_0064406 Ga0495618_0064406_1099_2049 316
380 3300046517 Ga0495630_0039693 Ga0495630_0039693_2199_3149 316
381 3300046524 Ga0495648_0000729 Ga0495648_0000729_13799_14758 316
382 3300046535 Ga0495586_0069535 Ga0495586_0069535_251_1201 316
383 3300046536 Ga0495587_0034069 Ga0495587_0034069_2094_3044 316
384 3300046542 Ga0495597_0043155 Ga0495597_0043155_1005_1964 316
385 3300046543 Ga0495645_0216424 Ga0495645_0216424_83_1033 316
386 3300046559 Ga0495667_0061751 Ga0495667_0061751_278_1228 316
387 3300046663 Ga0495635_0065078 Ga0495635_0065078_842_1792 316
388 3300046678 Ga0495599_0098943 Ga0495599_0098943_364_1314 316
389 3300046689 Ga0495613_0166910 Ga0495613_0166910_40_990 316
390 3300047317 Ga0495604_0172447 Ga0495604_0172447_168_1118 316
391 3300047319 Ga0495674_0124114 Ga0495674_0124114_733_1683 316
392 3300047443 Ga0495687_000001 Ga0495687_000001_83587_84546 316
393 3300047471 Ga0495684_0089845 Ga0495684_0089845_1156_2106 316
394 3300048907 Ga0496104_0401564 Ga0496104_0401564_93_1157 316
395 3300048913 Ga0496110_0325144 Ga0496110_0325144_232_1290 316
396 3300053085 Ga0495619_0057302 Ga0495619_0057302_1559_2509 316
397 3300053092 Ga0500583_0000989 Ga0500583_0000989_739_1698 316
398 3300053156 Ga0500622_0054836 Ga0500622_0054836_978_1937 316
399 3300002459 JGI24751J29686_10000523 JGI24751J29686_100005237 317
400 3300003203 JGI25406J46586_10042359 JGI25406J46586_100423591 317
401 3300003320 rootH2_10008717 rootH2_100087174 317
402 3300003320 rootH2_10009544 rootH2_1000954420 317
403 3300003320 rootH2_10043528 rootH2_100435282 317
404 3300003322 rootL2_10048659 rootL2_100486593 317
405 3300003322 rootL2_10049027 rootL2_100490275 317
406 3300003323 rootH1_10027473 rootH1_100274737 317
407 3300003354 JGI25160J50197_1000391 JGI25160J50197_100039121 317
408 3300005288 Ga0065714_10008149 Ga0065714_100081493 317
409 3300005290 Ga0065712_10005043 Ga0065712_100050433 317
410 3300005290 Ga0065712_10005395 Ga0065712_100053953 317
411 3300005290 Ga0065712_10084305 Ga0065712_100843052 317
412 3300005290 Ga0065712_10087336 Ga0065712_100873362 317
413 3300005293 Ga0065715_10170227 Ga0065715_101702272 317
414 3300005295 Ga0065707_10005338 Ga0065707_100053382 317
415 3300005327 Ga0070658_10006339 Ga0070658_100063399 317
416 3300005327 Ga0070658_10091759 Ga0070658_100917592 317
417 3300005328 Ga0070676_10236260 Ga0070676_102362601 317
418 3300005329 Ga0070683_100021425 Ga0070683_1000214252 317
419 3300005330 Ga0070690_100011893 Ga0070690_1000118931 317
420 3300005331 Ga0070670_100042984 Ga0070670_1000429843 317
421 3300005331 Ga0070670_100044182 Ga0070670_1000441823 317
422 3300005331 Ga0070670_100077802 Ga0070670_1000778022 317
423 3300005333 Ga0070677_10023834 Ga0070677_100238342 317
424 3300005334 Ga0068869_100116676 Ga0068869_1001166762 317
425 3300005335 Ga0070666_10214398 Ga0070666_102143981 317
426 3300005336 Ga0070680_100139397 Ga0070680_1001393974 317
427 3300005337 Ga0070682_100001222 Ga0070682_1000012225 317
428 3300005338 Ga0068868_100023528 Ga0068868_1000235285 317
429 3300005338 Ga0068868_100035794 Ga0068868_1000357943 317
430 3300005338 Ga0068868_100084289 Ga0068868_1000842892 317
431 3300005338 Ga0068868_100228677 Ga0068868_1002286771 317
432 3300005339 Ga0070660_100154298 Ga0070660_1001542981 317
433 3300005340 Ga0070689_100013710 Ga0070689_1000137102 317
434 3300005340 Ga0070689_100054252 Ga0070689_1000542523 317
435 3300005340 Ga0070689_100177674 Ga0070689_1001776742 317
436 3300005340 Ga0070689_100230095 Ga0070689_1002300952 317
437 3300005341 Ga0070691_10011704 Ga0070691_100117043 317
438 3300005343 Ga0070687_100066040 Ga0070687_1000660402 317
439 3300005344 Ga0070661_100291045 Ga0070661_1002910451 317
440 3300005347 Ga0070668_100124154 Ga0070668_1001241542 317
441 3300005347 Ga0070668_100426451 Ga0070668_1004264511 317
442 3300005353 Ga0070669_100082384 Ga0070669_1000823842 317
443 3300005354 Ga0070675_100019600 Ga0070675_1000196005 317
444 3300005354 Ga0070675_100022363 Ga0070675_1000223633 317
445 3300005355 Ga0070671_100008263 Ga0070671_1000082633 317
446 3300005355 Ga0070671_100065974 Ga0070671_1000659742 317
447 3300005356 Ga0070674_100015249 Ga0070674_1000152492 317
448 3300005356 Ga0070674_100133037 Ga0070674_1001330372 317
449 3300005364 Ga0070673_100015106 Ga0070673_1000151062 317
450 3300005364 Ga0070673_100030266 Ga0070673_1000302662 317
451 3300005364 Ga0070673_100039411 Ga0070673_1000394111 317
452 3300005364 Ga0070673_100165717 Ga0070673_1001657171 317
453 3300005364 Ga0070673_100321580 Ga0070673_1003215801 317
454 3300005365 Ga0070688_100013129 Ga0070688_1000131293 317
455 3300005365 Ga0070688_100041662 Ga0070688_1000416623 317
456 3300005366 Ga0070659_100003286 Ga0070659_1000032865 317
457 3300005366 Ga0070659_100339075 Ga0070659_1003390751 317
458 3300005367 Ga0070667_100008582 Ga0070667_1000085825 317
459 3300005367 Ga0070667_100170495 Ga0070667_1001704952 317
460 3300005455 Ga0070663_100091453 Ga0070663_1000914532 317
461 3300005456 Ga0070678_100279444 Ga0070678_1002794442 317
462 3300005457 Ga0070662_100003591 Ga0070662_1000035918 317
463 3300005458 Ga0070681_10046320 Ga0070681_100463204 317
464 3300005458 Ga0070681_10066331 Ga0070681_100663313 317
465 3300005458 Ga0070681_10074154 Ga0070681_100741542 317
466 3300005459 Ga0068867_100026320 Ga0068867_1000263203 317
467 3300005459 Ga0068867_100060080 Ga0068867_1000600802 317
468 3300005459 Ga0068867_100133897 Ga0068867_1001338972 317
469 3300005459 Ga0068867_100219902 Ga0068867_1002199022 317
470 3300005466 Ga0070685_10004337 Ga0070685_100043371 317
471 3300005466 Ga0070685_10010428 Ga0070685_100104286 317
472 3300005471 Ga0070698_100000866 Ga0070698_10000086611 317
473 3300005471 Ga0070698_100003054 Ga0070698_10000305411 317
474 3300005471 Ga0070698_100389607 Ga0070698_1003896071 317
475 3300005530 Ga0070679_100010138 Ga0070679_1000101385 317
476 3300005530 Ga0070679_100104310 Ga0070679_1001043101 317
477 3300005535 Ga0070684_100008118 Ga0070684_1000081185 317
478 3300005535 Ga0070684_100010258 Ga0070684_1000102585 317
479 3300005539 Ga0068853_100014007 Ga0068853_1000140073 317
480 3300005539 Ga0068853_100512523 Ga0068853_1005125231 317
481 3300005543 Ga0070672_100216034 Ga0070672_1002160342 317
482 3300005544 Ga0070686_100183996 Ga0070686_1001839962 317
483 3300005563 Ga0068855_100000704 Ga0068855_10000070422 317
484 3300005563 Ga0068855_100012898 Ga0068855_1000128986 317
485 3300005563 Ga0068855_100029350 Ga0068855_1000293506 317
486 3300005563 Ga0068855_100059952 Ga0068855_1000599524 317
487 3300005563 Ga0068855_100129819 Ga0068855_1001298192 317
488 3300005564 Ga0070664_100022602 Ga0070664_1000226027 317
489 3300005564 Ga0070664_100149551 Ga0070664_1001495512 317
490 3300005577 Ga0068857_100031575 Ga0068857_1000315754 317
491 3300005577 Ga0068857_100052589 Ga0068857_1000525893 317
492 3300005577 Ga0068857_100097054 Ga0068857_1000970543 317
493 3300005577 Ga0068857_100166228 Ga0068857_1001662282 317
494 3300005578 Ga0068854_100063658 Ga0068854_1000636583 317
495 3300005578 Ga0068854_100133600 Ga0068854_1001336002 317
496 3300005614 Ga0068856_100007898 Ga0068856_1000078988 317
497 3300005614 Ga0068856_100039447 Ga0068856_1000394471 317
498 3300005614 Ga0068856_100051092 Ga0068856_1000510924 317
499 3300005615 Ga0070702_100071258 Ga0070702_1000712582 317
500 3300005616 Ga0068852_100000503 Ga0068852_1000005033 317
501 3300005616 Ga0068852_100017293 Ga0068852_1000172936 317
502 3300005617 Ga0068859_100091984 Ga0068859_1000919842 317
503 3300005617 Ga0068859_100178112 Ga0068859_1001781123 317
504 3300005618 Ga0068864_100037534 Ga0068864_1000375343 317
505 3300005618 Ga0068864_100091855 Ga0068864_1000918552 317
506 3300005618 Ga0068864_100129762 Ga0068864_1001297622 317
507 3300005618 Ga0068864_100154783 Ga0068864_1001547832 317
508 3300005718 Ga0068866_10020849 Ga0068866_100208493 317
509 3300005719 Ga0068861_100018453 Ga0068861_1000184533 317
510 3300005719 Ga0068861_100080555 Ga0068861_1000805552 317
511 3300005719 Ga0068861_100152547 Ga0068861_1001525472 317
512 3300005719 Ga0068861_100197842 Ga0068861_1001978422 317
513 3300005834 Ga0068851_10093735 Ga0068851_100937352 317
514 3300005840 Ga0068870_10068105 Ga0068870_100681052 317
515 3300005841 Ga0068863_100012618 Ga0068863_1000126185 317
516 3300005841 Ga0068863_100025607 Ga0068863_1000256073 317
517 3300005841 Ga0068863_100127766 Ga0068863_1001277662 317
518 3300005841 Ga0068863_100198507 Ga0068863_1001985072 317
519 3300005841 Ga0068863_100228489 Ga0068863_1002284892 317
520 3300005842 Ga0068858_100099889 Ga0068858_1000998893 317
521 3300005842 Ga0068858_100506182 Ga0068858_1005061821 317
522 3300005843 Ga0068860_100008645 Ga0068860_1000086459 317
523 3300005843 Ga0068860_100009954 Ga0068860_1000099545 317
524 3300005843 Ga0068860_100010746 Ga0068860_1000107467 317
525 3300005843 Ga0068860_100022849 Ga0068860_1000228495 317
526 3300005844 Ga0068862_100117931 Ga0068862_1001179312 317
527 3300005844 Ga0068862_100176292 Ga0068862_1001762922 317
528 3300005844 Ga0068862_100460084 Ga0068862_1004600841 317
529 3300005983 Ga0081540_1004197 Ga0081540_10041976 317
530 3300005985 Ga0081539_10000641 Ga0081539_1000064164 317
531 3300006237 Ga0097621_100013920 Ga0097621_1000139201 317
532 3300006237 Ga0097621_100021374 Ga0097621_1000213742 317
533 3300006237 Ga0097621_100042206 Ga0097621_1000422061 317
534 3300006237 Ga0097621_100396830 Ga0097621_1003968301 317
535 3300006358 Ga0068871_100041002 Ga0068871_1000410022 317
536 3300006358 Ga0068871_100052147 Ga0068871_1000521473 317
537 3300006358 Ga0068871_100067970 Ga0068871_1000679704 317
538 3300006358 Ga0068871_100189228 Ga0068871_1001892282 317
539 3300006358 Ga0068871_100277916 Ga0068871_1002779162 317
540 3300006844 Ga0075428_100003010 Ga0075428_10000301010 317
541 3300006844 Ga0075428_100009333 Ga0075428_1000093333 317
542 3300006844 Ga0075428_100145976 Ga0075428_1001459761 317
543 3300006846 Ga0075430_100010608 Ga0075430_1000106082 317
544 3300006847 Ga0075431_100014282 Ga0075431_1000142823 317
545 3300006847 Ga0075431_100040230 Ga0075431_1000402304 317
546 3300006880 Ga0075429_100001277 Ga0075429_1000012779 317
547 3300006880 Ga0075429_100006151 Ga0075429_1000061512 317
548 3300006880 Ga0075429_100010161 Ga0075429_1000101617 317
549 3300006881 Ga0068865_100239471 Ga0068865_1002394713 317
550 3300006931 Ga0097620_100015117 Ga0097620_1000151173 317
551 3300006931 Ga0097620_100091984 Ga0097620_1000919842 317
552 3300006931 Ga0097620_100178108 Ga0097620_1001781083 317
553 3300009093 Ga0105240_10002232 Ga0105240_100022326 317
554 3300009093 Ga0105240_10011606 Ga0105240_100116062 317
555 3300009094 Ga0111539_10106295 Ga0111539_101062953 317
556 3300009094 Ga0111539_10300926 Ga0111539_103009262 317
557 3300009094 Ga0111539_10347418 Ga0111539_103474182 317
558 3300009098 Ga0105245_10418514 Ga0105245_104185141 317
559 3300009101 Ga0105247_10003609 Ga0105247_100036095 317
560 3300009147 Ga0114129_10050987 Ga0114129_100509875 317
561 3300009147 Ga0114129_10156378 Ga0114129_101563783 317
562 3300009174 Ga0105241_10003487 Ga0105241_1000348711 317
563 3300009176 Ga0105242_10004172 Ga0105242_100041725 317
564 3300009176 Ga0105242_10023320 Ga0105242_100233202 317
565 3300009176 Ga0105242_10138177 Ga0105242_101381771 317
566 3300009176 Ga0105242_10176648 Ga0105242_101766482 317
567 3300009176 Ga0105242_10291805 Ga0105242_102918052 317
568 3300009176 Ga0105242_10340758 Ga0105242_103407581 317
569 3300009177 Ga0105248_10080222 Ga0105248_100802223 317
570 3300009545 Ga0105237_10031327 Ga0105237_100313272 317
571 3300009545 Ga0105237_10163384 Ga0105237_101633842 317
572 3300009545 Ga0105237_10176590 Ga0105237_101765902 317
573 3300009553 Ga0105249_10001215 Ga0105249_1000121515 317
574 3300009553 Ga0105249_10006750 Ga0105249_100067505 317
575 3300009553 Ga0105249_10007592 Ga0105249_100075928 317
576 3300009553 Ga0105249_10130907 Ga0105249_101309072 317
577 3300009553 Ga0105249_10736266 Ga0105249_107362661 317
578 3300010375 Ga0105239_10000370 Ga0105239_1000037052 317
579 3300010375 Ga0105239_10016797 Ga0105239_100167976 317
580 3300010375 Ga0105239_10115880 Ga0105239_101158803 317
581 3300013100 Ga0157373_10002303 Ga0157373_100023035 317
582 3300013100 Ga0157373_10036875 Ga0157373_100368751 317
583 3300013102 Ga0157371_10002945 Ga0157371_1000294522 317
584 3300013102 Ga0157371_10004684 Ga0157371_100046843 317
585 3300013102 Ga0157371_10006217 Ga0157371_100062174 317
586 3300013102 Ga0157371_10010000 Ga0157371_100100003 317
587 3300013102 Ga0157371_10079965 Ga0157371_100799652 317
588 3300013104 Ga0157370_10061605 Ga0157370_100616055 317
589 3300013104 Ga0157370_10188489 Ga0157370_101884892 317
590 3300013104 Ga0157370_10497213 Ga0157370_104972131 317
591 3300013105 Ga0157369_10005363 Ga0157369_1000536314 317
592 3300013105 Ga0157369_10042847 Ga0157369_100428473 317
593 3300013105 Ga0157369_10135356 Ga0157369_101353562 317
594 3300013296 Ga0157374_10008174 Ga0157374_100081744 317
595 3300013296 Ga0157374_10258798 Ga0157374_102587982 317
596 3300013296 Ga0157374_10281103 Ga0157374_102811032 317
597 3300013297 Ga0157378_10002633 Ga0157378_100026332 317
598 3300013297 Ga0157378_10016242 Ga0157378_100162424 317
599 3300013297 Ga0157378_10021011 Ga0157378_100210116 317
600 3300013297 Ga0157378_10024687 Ga0157378_100246871 317
601 3300013297 Ga0157378_10117790 Ga0157378_101177903 317
602 3300013297 Ga0157378_10122157 Ga0157378_101221572 317
603 3300013297 Ga0157378_10309322 Ga0157378_103093222 317
604 3300013306 Ga0163162_10012241 Ga0163162_100122418 317
605 3300013306 Ga0163162_10122684 Ga0163162_101226843 317
606 3300013306 Ga0163162_10134112 Ga0163162_101341122 317
607 3300013306 Ga0163162_10245938 Ga0163162_102459381 317
608 3300013306 Ga0163162_10616806 Ga0163162_106168061 317
609 3300013307 Ga0157372_10002225 Ga0157372_100022258 317
610 3300013307 Ga0157372_10025878 Ga0157372_100258787 317
611 3300013307 Ga0157372_10030136 Ga0157372_100301363 317
612 3300013307 Ga0157372_10045321 Ga0157372_100453213 317
613 3300013307 Ga0157372_10092305 Ga0157372_100923052 317
614 3300013307 Ga0157372_10138015 Ga0157372_101380152 317
615 3300013307 Ga0157372_10153519 Ga0157372_101535192 317
616 3300013307 Ga0157372_10158282 Ga0157372_101582822 317
617 3300013307 Ga0157372_10178337 Ga0157372_101783373 317
618 3300013307 Ga0157372_10210106 Ga0157372_102101062 317
619 3300013307 Ga0157372_10225257 Ga0157372_102252572 317
620 3300013307 Ga0157372_10514886 Ga0157372_105148861 317
621 3300013308 Ga0157375_10011699 Ga0157375_100116995 317
622 3300013308 Ga0157375_10276498 Ga0157375_102764982 317
623 3300014325 Ga0163163_10071426 Ga0163163_100714261 317
624 3300014325 Ga0163163_10236577 Ga0163163_102365772 317
625 3300014326 Ga0157380_10000174 Ga0157380_100001744 317
626 3300014326 Ga0157380_10006056 Ga0157380_100060563 317
627 3300014326 Ga0157380_10033793 Ga0157380_100337933 317
628 3300014745 Ga0157377_10012471 Ga0157377_100124713 317
629 3300014745 Ga0157377_10064866 Ga0157377_100648662 317
630 3300014968 Ga0157379_10134357 Ga0157379_101343572 317
631 3300014969 Ga0157376_10002100 Ga0157376_100021007 317
632 3300014969 Ga0157376_10230177 Ga0157376_102301771 317
633 3300014969 Ga0157376_10265989 Ga0157376_102659892 317
634 3300017792 Ga0163161_10071986 Ga0163161_100719862 317
635 3300017792 Ga0163161_10171834 Ga0163161_101718342 317
636 3300017792 Ga0163161_10193193 Ga0163161_101931931 317
637 3300025302 Ga0207426_1000059 Ga0207426_100005988 317
638 3300025315 Ga0207697_10029727 Ga0207697_100297272 317
639 3300025893 Ga0207682_10016291 Ga0207682_100162912 317
640 3300025900 Ga0207710_10003944 Ga0207710_100039443 317
641 3300025904 Ga0207647_10000050 Ga0207647_1000005063 317
642 3300025908 Ga0207643_10003946 Ga0207643_100039463 317
643 3300025909 Ga0207705_10111435 Ga0207705_101114352 317
644 3300025909 Ga0207705_10217638 Ga0207705_102176382 317
645 3300025909 Ga0207705_10313810 Ga0207705_103138101 317
646 3300025911 Ga0207654_10001573 Ga0207654_100015733 317
647 3300025911 Ga0207654_10066742 Ga0207654_100667422 317
648 3300025912 Ga0207707_10001470 Ga0207707_100014701 317
649 3300025912 Ga0207707_10054892 Ga0207707_100548922 317
650 3300025912 Ga0207707_10082552 Ga0207707_100825523 317
651 3300025913 Ga0207695_10000110 Ga0207695_1000011082 317
652 3300025913 Ga0207695_10061324 Ga0207695_100613242 317
653 3300025914 Ga0207671_10015072 Ga0207671_100150722 317
654 3300025914 Ga0207671_10030657 Ga0207671_100306572 317
655 3300025917 Ga0207660_10004358 Ga0207660_1000435810 317
656 3300025918 Ga0207662_10011300 Ga0207662_100113005 317
657 3300025919 Ga0207657_10012180 Ga0207657_100121806 317
658 3300025919 Ga0207657_10058804 Ga0207657_100588041 317
659 3300025920 Ga0207649_10041557 Ga0207649_100415572 317
660 3300025920 Ga0207649_10234816 Ga0207649_102348161 317
661 3300025921 Ga0207652_10001229 Ga0207652_100012293 317
662 3300025921 Ga0207652_10166028 Ga0207652_101660282 317
663 3300025921 Ga0207652_10368146 Ga0207652_103681462 317
664 3300025923 Ga0207681_10339474 Ga0207681_103394741 317
665 3300025925 Ga0207650_10008539 Ga0207650_100085392 317
666 3300025925 Ga0207650_10031450 Ga0207650_100314503 317
667 3300025925 Ga0207650_10069130 Ga0207650_100691302 317
668 3300025926 Ga0207659_10006857 Ga0207659_100068576 317
669 3300025932 Ga0207690_10014218 Ga0207690_100142183 317
670 3300025933 Ga0207706_10013304 Ga0207706_100133049 317
671 3300025933 Ga0207706_10308651 Ga0207706_103086512 317
672 3300025934 Ga0207686_10001998 Ga0207686_100019982 317
673 3300025934 Ga0207686_10036685 Ga0207686_100366853 317
674 3300025936 Ga0207670_10021414 Ga0207670_100214143 317
675 3300025937 Ga0207669_10064033 Ga0207669_100640331 317
676 3300025937 Ga0207669_10090642 Ga0207669_100906423 317
677 3300025938 Ga0207704_10130886 Ga0207704_101308862 317
678 3300025940 Ga0207691_10034712 Ga0207691_100347123 317
679 3300025940 Ga0207691_10141802 Ga0207691_101418022 317
680 3300025942 Ga0207689_10025482 Ga0207689_100254824 317
681 3300025942 Ga0207689_10116372 Ga0207689_101163723 317
682 3300025944 Ga0207661_10034494 Ga0207661_100344942 317
683 3300025944 Ga0207661_10140585 Ga0207661_101405852 317
684 3300025944 Ga0207661_10330189 Ga0207661_103301892 317
685 3300025945 Ga0207679_10133873 Ga0207679_101338732 317
686 3300025949 Ga0207667_10000144 Ga0207667_1000014448 317
687 3300025949 Ga0207667_10024655 Ga0207667_100246555 317
688 3300025949 Ga0207667_10112046 Ga0207667_101120462 317
689 3300025949 Ga0207667_10379426 Ga0207667_103794261 317
690 3300025960 Ga0207651_10093079 Ga0207651_100930792 317
691 3300025960 Ga0207651_10168249 Ga0207651_101682492 317
692 3300025961 Ga0207712_10001368 Ga0207712_100013687 317
693 3300025961 Ga0207712_10001805 Ga0207712_100018057 317
694 3300025961 Ga0207712_10056597 Ga0207712_100565973 317
695 3300025961 Ga0207712_10075955 Ga0207712_100759553 317
696 3300025972 Ga0207668_10108693 Ga0207668_101086932 317
697 3300025981 Ga0207640_10126428 Ga0207640_101264282 317
698 3300025981 Ga0207640_10141988 Ga0207640_101419881 317
699 3300025981 Ga0207640_10186932 Ga0207640_101869321 317
700 3300026023 Ga0207677_10002319 Ga0207677_100023193 317
701 3300026023 Ga0207677_10178129 Ga0207677_101781292 317
702 3300026035 Ga0207703_10100254 Ga0207703_101002541 317
703 3300026041 Ga0207639_10021703 Ga0207639_100217031 317
704 3300026041 Ga0207639_10033542 Ga0207639_100335423 317
705 3300026041 Ga0207639_10191234 Ga0207639_101912342 317
706 3300026067 Ga0207678_10060450 Ga0207678_100604502 317
707 3300026078 Ga0207702_10622404 Ga0207702_106224041 317
708 3300026088 Ga0207641_10003559 Ga0207641_100035595 317
709 3300026088 Ga0207641_10036683 Ga0207641_100366832 317
710 3300026088 Ga0207641_10132141 Ga0207641_101321412 317
711 3300026088 Ga0207641_10147942 Ga0207641_101479422 317
712 3300026088 Ga0207641_10211171 Ga0207641_102111712 317
713 3300026088 Ga0207641_10591383 Ga0207641_105913831 317
714 3300026089 Ga0207648_10036279 Ga0207648_100362794 317
715 3300026089 Ga0207648_10043490 Ga0207648_100434902 317
716 3300026089 Ga0207648_10062881 Ga0207648_100628813 317
717 3300026089 Ga0207648_10063327 Ga0207648_100633272 317
718 3300026089 Ga0207648_10097823 Ga0207648_100978233 317
719 3300026089 Ga0207648_10337462 Ga0207648_103374621 317
720 3300026095 Ga0207676_10115800 Ga0207676_101158001 317
721 3300026095 Ga0207676_10196544 Ga0207676_101965441 317
722 3300026095 Ga0207676_10201940 Ga0207676_102019402 317
723 3300026116 Ga0207674_10033875 Ga0207674_100338754 317
724 3300026116 Ga0207674_10047591 Ga0207674_100475913 317
725 3300026116 Ga0207674_10113772 Ga0207674_101137721 317
726 3300026116 Ga0207674_10118122 Ga0207674_101181222 317
727 3300026116 Ga0207674_10129479 Ga0207674_101294792 317
728 3300026116 Ga0207674_10175658 Ga0207674_101756581 317
729 3300026116 Ga0207674_10460437 Ga0207674_104604371 317
730 3300026118 Ga0207675_100002480 Ga0207675_1000024803 317
731 3300026118 Ga0207675_100004172 Ga0207675_1000041725 317
732 3300026118 Ga0207675_100041592 Ga0207675_1000415923 317
733 3300026118 Ga0207675_100256227 Ga0207675_1002562272 317
734 3300026118 Ga0207675_100274520 Ga0207675_1002745201 317
735 3300026121 Ga0207683_10201519 Ga0207683_102015192 317
736 3300026142 Ga0207698_10057907 Ga0207698_100579072 317
737 3300026142 Ga0207698_10081340 Ga0207698_100813401 317
738 3300026142 Ga0207698_10121189 Ga0207698_101211891 317
739 3300026142 Ga0207698_10362872 Ga0207698_103628721 317
740 3300027907 Ga0207428_10114269 Ga0207428_101142692 317
741 3300027907 Ga0207428_10176102 Ga0207428_101761021 317
742 3300028380 Ga0268265_10145578 Ga0268265_101455782 317
743 3300028380 Ga0268265_10159452 Ga0268265_101594522 317
744 3300028381 Ga0268264_10004303 Ga0268264_100043035 317
745 3300028381 Ga0268264_10010959 Ga0268264_100109592 317
746 3300028381 Ga0268264_10020078 Ga0268264_100200783 317
747 3300028381 Ga0268264_10111010 Ga0268264_101110101 317
748 3300028381 Ga0268264_10116380 Ga0268264_101163802 317
749 3300028794 Ga0307515_10000002 Ga0307515_10000002842 317
750 3300028794 Ga0307515_10000039 Ga0307515_1000003965 317
751 3300028800 Ga0265338_10068391 Ga0265338_100683912 317
752 3300029957 Ga0265324_10018435 Ga0265324_100184352 317
753 3300030521 Ga0307511_10000122 Ga0307511_1000012216 317
754 3300031251 Ga0265327_10000209 Ga0265327_1000020933 317
755 3300031251 Ga0265327_10000368 Ga0265327_1000036837 317
756 3300031251 Ga0265327_10000811 Ga0265327_100008116 317
757 3300031251 Ga0265327_10041982 Ga0265327_100419822 317
758 3300031507 Ga0307509_10138045 Ga0307509_101380452 317
759 3300031824 Ga0307413_10186071 Ga0307413_101860712 317
760 3300031852 Ga0307410_10273745 Ga0307410_102737452 317
761 3300031901 Ga0307406_10048222 Ga0307406_100482223 317
762 3300032002 Ga0307416_100225965 Ga0307416_1002259652 317
763 3300033180 Ga0307510_10000615 Ga0307510_1000061517 317
764 3300033180 Ga0307510_10211390 Ga0307510_102113902 317
765 3300035725 Ga0373947_0105322 Ga0373947_0105322_329_1285 317
766 3300036401 Ga0373937_0200195 Ga0373937_0200195_142_1098 317
767 3300036401 Ga0373937_0250991 Ga0373937_0250991_374_1330 317
768 3300037312 Ga0395899_0003607 Ga0395899_0003607_3738_4691 317
769 3300037466 Ga0395898_0004670 Ga0395898_0004670_2817_3770 317
770 3300037471 Ga0395905_0001073 Ga0395905_0001073_32123_33076 317
771 3300037471 Ga0395905_0134267 Ga0395905_0134267_222_1175 317
772 3300038443 Ga0395901_0006414 Ga0395901_0006414_1542_2495 317
773 3300039437 Ga0436365_0081746 Ga0436365_0081746_5176_6129 317
774 3300039437 Ga0436365_1248268 Ga0436365_1248268_15627_16580 317
775 3300042876 Ga0451577_0004954 Ga0451577_0004954_11235_12188 317
776 3300042876 Ga0451577_0039022 Ga0451577_0039022_2379_3332 317
777 3300044658 Ga0466972_0000039 Ga0466972_0000039_26941_27927 317
778 3300044712 Ga0453684_0061470 Ga0453684_0061470_2470_3504 317
779 3300044712 Ga0453684_0290603 Ga0453684_0290603_427_1380 317
780 3300044842 Ga0466957_0004285 Ga0466957_0004285_3045_4001 317
781 3300044842 Ga0466957_0023080 Ga0466957_0023080_1776_2762 317
782 3300045976 Ga0466967_0147911 Ga0466967_0147911_1194_2153 317
783 3300046459 Ga0495629_0030351 Ga0495629_0030351_1070_2026 317
784 3300046460 Ga0495638_0041781 Ga0495638_0041781_240_1232 317
785 3300046460 Ga0495638_0111690 Ga0495638_0111690_555_1508 317
786 3300046507 Ga0495606_0023054 Ga0495606_0023054_1964_2929 317
787 3300046533 Ga0495640_0203557 Ga0495640_0203557_253_1209 317
788 3300046543 Ga0495645_0085214 Ga0495645_0085214_682_1638 317
789 3300046616 Ga0495668_0003157 Ga0495668_0003157_2519_3472 317
790 3300046648 Ga0495611_0000316 Ga0495611_0000316_9765_10730 317
791 3300046679 Ga0495623_0250200 Ga0495623_0250200_22_978 317
792 3300046683 Ga0495658_0001038 Ga0495658_0001038_1133_2089 317
793 3300047319 Ga0495674_0033659 Ga0495674_0033659_2024_2980 317
794 3300047319 Ga0495674_0215275 Ga0495674_0215275_516_1484 317
795 3300047320 Ga0495672_0034698 Ga0495672_0034698_162_1115 317
796 3300049568 Ga0501031_0004191 Ga0501031_0004191_4988_5941 317
797 3300049569 Ga0501032_0006084 Ga0501032_0006084_883_1896 317
798 3300049569 Ga0501032_0055065 Ga0501032_0055065_678_1631 317
799 3300049569 Ga0501032_0117772 Ga0501032_0117772_87_1040 317
800 3300049571 Ga0501034_0000399 Ga0501034_0000399_1557_2510 317
801 3300049571 Ga0501034_0001952 Ga0501034_0001952_21658_22671 317
802 3300049571 Ga0501034_0003741 Ga0501034_0003741_6040_6993 317
803 3300049571 Ga0501034_0004761 Ga0501034_0004761_6115_7071 317
804 3300049571 Ga0501034_0122751 Ga0501034_0122751_367_1320 317
805 3300049571 Ga0501034_0159730 Ga0501034_0159730_272_1225 317
806 3300049571 Ga0501034_0376929 Ga0501034_0376929_50_1006 317
807 3300049572 Ga0501036_0114367 Ga0501036_0114367_522_1535 317
808 3300049572 Ga0501036_0250446 Ga0501036_0250446_88_1041 317
809 3300049573 Ga0501037_0002106 Ga0501037_0002106_6309_7262 317
810 3300049573 Ga0501037_0002722 Ga0501037_0002722_6176_7129 317
811 3300049573 Ga0501037_0024528 Ga0501037_0024528_1887_2900 317
812 3300049574 Ga0501038_0014847 Ga0501038_0014847_483_1436 317
813 3300049574 Ga0501038_0026682 Ga0501038_0026682_1319_2272 317
814 3300049575 Ga0501039_0013726 Ga0501039_0013726_354_1307 317
815 3300049579 Ga0501043_0008083 Ga0501043_0008083_1303_2256 317
816 3300049579 Ga0501043_0030462 Ga0501043_0030462_1520_2533 317
817 3300049579 Ga0501043_0123616 Ga0501043_0123616_102_1055 317
818 3300049579 Ga0501043_0354251 Ga0501043_0354251_98_1066 317
819 3300049580 Ga0501046_0074556 Ga0501046_0074556_882_1895 317
820 3300049581 Ga0501047_0007662 Ga0501047_0007662_4360_5346 317
821 3300049581 Ga0501047_0376061 Ga0501047_0376061_172_1125 317
822 3300049583 Ga0501067_0023993 Ga0501067_0023993_1919_2932 317
823 3300049583 Ga0501067_0031262 Ga0501067_0031262_728_1768 317
824 3300049586 Ga0501070_0221249 Ga0501070_0221249_311_1351 317
825 3300049589 Ga0501073_0010966 Ga0501073_0010966_5216_6229 317
826 3300049590 Ga0501074_0008264 Ga0501074_0008264_706_1719 317
827 3300049652 Ga0501202_000479 Ga0501202_000479_2537_3496 317
828 3300049661 Ga0501217_005940 Ga0501217_005940_95_1048 317
829 3300049663 Ga0501223_000506 Ga0501223_000506_2013_2972 317
830 3300049664 Ga0501224_000674 Ga0501224_000674_1566_2525 317
831 3300049668 Ga0501233_000572 Ga0501233_000572_2690_3649 317
832 3300049669 Ga0501235_032644 Ga0501235_032644_197_1150 317
833 3300049680 Ga0501250_001689 Ga0501250_001689_101_1054 317
834 3300049682 Ga0501252_002344 Ga0501252_002344_815_1774 317
835 3300049688 Ga0501259_000316 Ga0501259_000316_4434_5387 317
836 3300049703 Ga0501219_000931 Ga0501219_000931_1217_2173 317
837 3300049704 Ga0501221_001361 Ga0501221_001361_510_1469 317
838 3300049705 Ga0501225_0000782 Ga0501225_0000782_5464_6594 317
839 3300049705 Ga0501225_0017687 Ga0501225_0017687_598_1551 317
840 3300049707 Ga0501234_000503 Ga0501234_000503_2008_2967 317
841 3300049708 Ga0501245_000412 Ga0501245_000412_2615_3574 317
842 3300049741 Ga0501079_0047494 Ga0501079_0047494_1107_2120 317
843 3300049742 Ga0501080_0214118 Ga0501080_0214118_83_1036 317
844 3300049744 Ga0501083_0208482 Ga0501083_0208482_124_1137 317
845 3300049757 Ga0501232_006986 Ga0501232_006986_32_994 317
846 3300049763 Ga0501266_002255 Ga0501266_002255_663_1616 317
847 3300049822 Ga0501035_0022258 Ga0501035_0022258_2943_3896 317
848 3300049822 Ga0501035_0025743 Ga0501035_0025743_4129_5082 317
849 3300049822 Ga0501035_0026724 Ga0501035_0026724_3174_4187 317
850 3300049822 Ga0501035_0109967 Ga0501035_0109967_817_1773 317
851 3300049823 Ga0501044_0003545 Ga0501044_0003545_9314_10267 317
852 3300049823 Ga0501044_0018651 Ga0501044_0018651_1175_2188 317
853 3300049823 Ga0501044_0021617 Ga0501044_0021617_3854_4840 317
854 3300049823 Ga0501044_0140905 Ga0501044_0140905_493_1449 317
855 3300049823 Ga0501044_0141400 Ga0501044_0141400_254_1210 317
856 3300049823 Ga0501044_0200150 Ga0501044_0200150_928_1896 317
857 3300049824 Ga0501045_0230668 Ga0501045_0230668_143_1156 317
858 3300050005 Ga0501284_00011 Ga0501284_00011_2229_3185 317
859 3300050493 nmdc:mga0k408_245116_c1 nmdc:mga0k408_245116_c1_62_1048 317
860 3300050507 nmdc:mga05p37_148186_c1 nmdc:mga05p37_148186_c1_1043_1996 317
861 3300050507 nmdc:mga05p37_194378_c1 nmdc:mga05p37_194378_c1_367_1320 317
862 3300050507 nmdc:mga05p37_6154_c1 nmdc:mga05p37_6154_c1_1261_2247 317
863 3300050508 nmdc:mga09592_69357_c1 nmdc:mga09592_69357_c1_1556_2509 317
864 3300050509 nmdc:mga0qj67_38975_c1 nmdc:mga0qj67_38975_c1_644_1597 317
865 3300050510 nmdc:mga06r32_13952_c1 nmdc:mga06r32_13952_c1_5372_6325 317
866 3300050510 nmdc:mga06r32_23480_c1 nmdc:mga06r32_23480_c1_2662_3615 317
867 3300050511 nmdc:mga08y16_120340_c1 nmdc:mga08y16_120340_c1_1552_2505 317
868 3300053085 Ga0495619_0046804 Ga0495619_0046804_1616_2572 317
869 3300053086 Ga0500578_0014967 Ga0500578_0014967_635_1675 317
870 3300053092 Ga0500583_0000075 Ga0500583_0000075_1325_2311 317
871 3300053092 Ga0500583_0000796 Ga0500583_0000796_7387_8373 317
872 3300053147 Ga0500589_009515 Ga0500589_009515_1309_2301 317
873 3300053156 Ga0500622_0101515 Ga0500622_0101515_98_1084 317
874 3300053727 Ga0500611_000031 Ga0500611_000031_50047_51000 317

Structural Annotation

Top 5 Hits

ID Description Score Start End
4leh-assembly1.cif.gz_C crystal structure of a bile-acid 7-alpha dehydratase (closci_03134) from clostridium scindens atcc 35704 at 2.90 a resolution 0.7644 242 259
4l8o-assembly1.cif.gz_A crystal structure of a bile-acid 7-alpha dehydratase (clohylem_06634) from clostridium hylemonae dsm 15053 at 2.20 a resolution 0.71 242 259
5hv6-assembly1.cif.gz_A the atp binding domain of rifampin phosphotransferase from listeria monocytogenes 0.6791 132 261
7waf-assembly1.cif.gz_C trichodesmium erythraeum cyanophycin synthetase 1 (tecpha1) with atpgammas and 4x(beta-asp-arg) 0.6557 87 268
1jll-assembly1.cif.gz_B crystal structure analysis of the e197betaa mutant of e. coli scs 0.6399 87 259
ID Description Score Start End Superfamily
af_D4ADZ3_130_196_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8623 140 182 3.30.1490.20
1pk8A01 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8139 140 181 3.30.1490.20
5dmxB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8046 87 285 3.30.470.20
1auvB01 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8013 139 181 3.30.1490.20
af_P9WM01_47_220_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8007 242 259 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A838TNY5-F1-model_v4 Uncharacterized protein 0.9987 1 76
AF-A0A838TNY5-F1-model_v4 Uncharacterized protein 0.9858 1 76
AF-A0A4Q6CG82-F1-model_v4 deleted 0.985 172 317
AF-A0A2V6MBT6-F1-model_v4 ATP-grasp domain-containing protein 0.9823 170 317
AF-A0A519VZI3-F1-model_v4 ATP-grasp domain-containing protein 0.9808 180 317

Feature Viewer

pLDDT pTM Quality
93.63 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map