F484313

General Info

Members Datasets Scaffolds Average Seq Length
874 362 853 253

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0000550|Ga0501033_0000550_1435_2331
Length 298
Sequence MAVVRWQPWGPDPLTHGFVSPFVPSLFLVLRAGGSRRGTPGDRTLTMAKWIPLWLHRLSSPPTFYGFAGKVRPWAIGLALVLGAAALYGGLVLAPPDYQQGDDYRIIFIHVPSAWMSLFIYAVMGVAAFVALVWRIKLAEVVAMESAPVGAAFTFITLVTGSLWGERMWGTWWTWDARLTSELVLLFLYLGVIGLYHAFEDRRQGARAAAFLAIVGIVNVPIVHFSVKWWNTLHQGSTVSLFGQSHIAADMLWPLLTMMLATKCYYVASLCGRVRADLLALEGGKDWVRRIATGEAPR

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
9 2739367700 Dyella sp. YR388 Isolate Unclassified
10 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
11 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
12 2884411467 Dyella sp. AD56 Isolate Rhizosphere
13 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
14 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
15 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
16 2919085039 Luteibacter sp. 1214 Isolate Unclassified
17 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
18 2928963466 Dyella japonica 1073 Isolate Unclassified
19 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
34 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
35 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
36 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
37 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
144 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
225 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
226 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
227 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
233 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
241 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
242 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
243 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
245 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
246 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
249 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
257 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
258 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
263 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
264 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
290 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
291 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
296 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
297 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
314 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
319 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
352 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
353 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
354 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
357 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
358 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 639633007 Azoarcus olearius BH72 Isolate Unclassified
362 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0.46
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 0
Rhizoplane 2.4
Rhizosphere 79.18
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001236 3300001979 Bacteria 11564
2 JGI24739J22299_10000042 3300001989 Bacteria 34840
3 JGI24739J22299_10000993 3300001989 Bacteria 10563
4 JGI24737J22298_10006310 3300001990 Bacteria 4056
5 JGI24735J21928_10003420 3300002067 Bacteria 5412
6 JGI24735J21928_10024489 3300002067 Bacteria 1826
7 JGI25156J39149_1000899 3300002705 Bacteria 14621
8 JGI25162J39368_1000068 3300002737 Bacteria 129594
9 JGI25162J39368_1000529 3300002737 Bacteria 28464
10 JGI25162J39368_1001106 3300002737 Bacteria 16314
11 JGI25162J39368_1001478 3300002737 Bacteria 12327
12 JGI25154J39366_1001879 3300002738 Bacteria 6381
13 JGI25154J39366_1010050 3300002738 Bacteria 1136
14 JGI25154J39366_1010317 3300002738 Bacteria 1110
15 JGI25157J39369_1000503 3300002741 Bacteria 24065
16 JGI25157J39369_1000649 3300002741 Bacteria 19381
17 JGI25157J39369_1001287 3300002741 Bacteria 10064
18 JGI25164J39214_1000102 3300002772 Bacteria 83707
19 JGI25164J39214_1000142 3300002772 Bacteria 68956
20 JGI25164J39214_1000366 3300002772 Bacteria 26967
21 JGI25152J39213_1002252 3300002773 Bacteria 7451
22 JGI25152J39213_1028829 3300002773 Bacteria 880
23 JGI25165J46597_1000058 3300003214 Bacteria 212833
24 JGI25165J46597_1000090 3300003214 Bacteria 168833
25 JGI25165J46597_1000405 3300003214 Bacteria 45672
26 rootH2_10011619 3300003320 Bacteria 16641
27 rootH1_10137617 3300003323 Bacteria 1937
28 Ga0006562J51391_1073184 3300003578 Bacteria 5000
29 Ga0006562J51391_1073185 3300003578 Bacteria 4400
30 Ga0055538_1002179 3300003751 Bacteria 3048
31 Ga0055539_1002596 3300003752 Bacteria 2705
32 Ga0055525_1000282 3300003759 Bacteria 46609
33 Ga0055527_1000105 3300003760 Bacteria 60329
34 Ga0055527_1000630 3300003760 Bacteria 11018
35 Ga0055535_1000034 3300003761 Bacteria 181954
36 Ga0055535_1000150 3300003761 Bacteria 74086
37 Ga0055535_1000765 3300003761 Bacteria 23814
38 Ga0055535_1001421 3300003761 Bacteria 12270
39 Ga0055542_1000081 3300003762 Bacteria 129595
40 Ga0055542_1000112 3300003762 Bacteria 107429
41 Ga0055542_1000198 3300003762 Bacteria 74085
42 Ga0055542_1000685 3300003762 Bacteria 26937
43 Ga0055542_1001350 3300003762 Bacteria 12637
44 Ga0055542_1001389 3300003762 Bacteria 12270
45 Ga0055529_1000083 3300003763 Bacteria 146729
46 Ga0055529_1000305 3300003763 Bacteria 56629
47 Ga0055529_1000343 3300003763 Bacteria 51957
48 Ga0055529_1001168 3300003763 Bacteria 10792
49 Ga0055526_1000096 3300003771 Bacteria 80897
50 Ga0055526_1001604 3300003771 Bacteria 15880
51 Ga0065165_1003057 3300005262 Bacteria 12525
52 Ga0065707_10002428 3300005295 Bacteria 4879
53 Ga0070658_10004472 3300005327 Bacteria 11385
54 Ga0070658_10014082 3300005327 Bacteria 6422
55 Ga0070658_10174126 3300005327 Bacteria 1809
56 Ga0070658_10302896 3300005327 Bacteria 1363
57 Ga0070676_10024456 3300005328 Bacteria 3403
58 Ga0070683_100091824 3300005329 Bacteria 2851
59 Ga0070683_100601474 3300005329 Bacteria 1052
60 Ga0070690_100175201 3300005330 Bacteria 1479
61 Ga0070670_100317729 3300005331 Bacteria 1364
62 Ga0068869_100102689 3300005334 Bacteria 2165
63 Ga0068869_100210437 3300005334 Bacteria 1537
64 Ga0068869_100236318 3300005334 Unclassified 1454
65 Ga0070666_10000005 3300005335 Bacteria 343092
66 Ga0070666_10000139 3300005335 Bacteria 50346
67 Ga0070666_10393476 3300005335 Bacteria 996
68 Ga0070680_100180304 3300005336 Bacteria 1779
69 Ga0068868_100045123 3300005338 Bacteria 3448
70 Ga0068868_100074319 3300005338 Bacteria 2714
71 Ga0070660_100074431 3300005339 Bacteria 2657
72 Ga0070689_100009283 3300005340 Bacteria 6969
73 Ga0070689_100053928 3300005340 Bacteria 3113
74 Ga0070689_100488236 3300005340 Bacteria 1053
75 Ga0070661_100007743 3300005344 Bacteria 7415
76 Ga0070661_100015169 3300005344 Bacteria 5437
77 Ga0070661_100044109 3300005344 Bacteria 3257
78 Ga0070692_10020685 3300005345 Bacteria 3192
79 Ga0070692_10059760 3300005345 Bacteria 2004
80 Ga0070668_100026666 3300005347 Bacteria 4386
81 Ga0070668_100149973 3300005347 Bacteria 1885
82 Ga0070668_100253299 3300005347 Bacteria 1462
83 Ga0070668_100635041 3300005347 Bacteria 937
84 Ga0070669_100016493 3300005353 Bacteria 5271
85 Ga0070675_100169335 3300005354 Bacteria 1883
86 Ga0070671_100077210 3300005355 Bacteria 2783
87 Ga0070674_100817241 3300005356 Bacteria 806
88 Ga0070673_100120549 3300005364 Bacteria 2188
89 Ga0070688_100469755 3300005365 Bacteria 944
90 Ga0070659_100005821 3300005366 Bacteria 8880
91 Ga0070659_100071149 3300005366 Bacteria 2765
92 Ga0070667_100001757 3300005367 Bacteria 19320
93 Ga0070667_100018857 3300005367 Bacteria 5721
94 Ga0070667_100024951 3300005367 Bacteria 4967
95 Ga0070667_100043858 3300005367 Bacteria 3754
96 Ga0070667_100064127 3300005367 Bacteria 3116
97 Ga0070667_100280190 3300005367 Bacteria 1497
98 Ga0070667_100337760 3300005367 Bacteria 1362
99 Ga0070703_10000036 3300005406 Bacteria 65827
100 Ga0070714_100000939 3300005435 Bacteria 20729
101 Ga0070714_100007346 3300005435 Bacteria 8570
102 Ga0070713_100002465 3300005436 Bacteria 12079
103 Ga0070711_100032343 3300005439 Bacteria 3477
104 Ga0070694_100005045 3300005444 Bacteria 7966
105 Ga0070708_100247660 3300005445 Bacteria 1674
106 Ga0070708_100253996 3300005445 Bacteria 1652
107 Ga0070663_100001061 3300005455 Bacteria 15042
108 Ga0070663_100001649 3300005455 Bacteria 12338
109 Ga0070663_100019477 3300005455 Bacteria 4474
110 Ga0070678_100050056 3300005456 Bacteria 3019
111 Ga0070678_100154575 3300005456 Bacteria 1852
112 Ga0070662_100034892 3300005457 Bacteria 3549
113 Ga0070662_100149260 3300005457 Bacteria 1818
114 Ga0070662_100219424 3300005457 Bacteria 1517
115 Ga0070662_100267179 3300005457 Bacteria 1380
116 Ga0070681_10000058 3300005458 Bacteria 79062
117 Ga0070681_10003155 3300005458 Bacteria 15329
118 Ga0070681_10024225 3300005458 Bacteria 6110
119 Ga0070681_10074309 3300005458 Bacteria 3360
120 Ga0070681_10418641 3300005458 Bacteria 1251
121 Ga0070681_10585883 3300005458 Bacteria 1029
122 Ga0068867_100191650 3300005459 Bacteria 1632
123 Ga0068867_100233942 3300005459 Bacteria 1487
124 Ga0070685_10000308 3300005466 Bacteria 30701
125 Ga0070685_10001904 3300005466 Bacteria 10846
126 Ga0070685_10107427 3300005466 Bacteria 1714
127 Ga0070707_100081326 3300005468 Bacteria 3128
128 Ga0070698_100271679 3300005471 Bacteria 1627
129 Ga0070698_100379145 3300005471 Unclassified 1347
130 Ga0070679_100077287 3300005530 Bacteria 3318
131 Ga0070679_100088874 3300005530 Bacteria 3076
132 Ga0070679_100302295 3300005530 Bacteria 1550
133 Ga0070679_100344694 3300005530 Bacteria 1438
134 Ga0070684_100012608 3300005535 Bacteria 6779
135 Ga0068853_100003826 3300005539 Bacteria 11527
136 Ga0068853_100021361 3300005539 Bacteria 5396
137 Ga0068853_100052054 3300005539 Bacteria 3526
138 Ga0068853_100111517 3300005539 Bacteria 2430
139 Ga0068853_100193373 3300005539 Bacteria 1849
140 Ga0068853_100446917 3300005539 Bacteria 1215
141 Ga0070672_100034754 3300005543 Bacteria 3827
142 Ga0070672_100098629 3300005543 Bacteria 2366
143 Ga0070686_100133620 3300005544 Bacteria 1719
144 Ga0070686_100136361 3300005544 Bacteria 1703
145 Ga0070696_100001471 3300005546 Bacteria 15424
146 Ga0070696_100008073 3300005546 Bacteria 7035
147 Ga0070693_100020137 3300005547 Bacteria 3513
148 Ga0070693_100035759 3300005547 Bacteria 2757
149 Ga0070693_100188758 3300005547 Bacteria 1332
150 Ga0070665_100000057 3300005548 Bacteria 237271
151 Ga0070665_100000786 3300005548 Bacteria 41741
152 Ga0070665_100016441 3300005548 Bacteria 7418
153 Ga0070665_100021003 3300005548 Bacteria 6564
154 Ga0070665_100053328 3300005548 Bacteria 4055
155 Ga0070665_100054474 3300005548 Bacteria 4011
156 Ga0070665_100100784 3300005548 Bacteria 2892
157 Ga0070704_100032088 3300005549 Bacteria 3539
158 Ga0068855_100020683 3300005563 Bacteria 7892
159 Ga0068855_100030567 3300005563 Bacteria 6440
160 Ga0068855_100072014 3300005563 Bacteria 4018
161 Ga0070664_100373813 3300005564 Bacteria 1300
162 Ga0068857_100025352 3300005577 Bacteria 5221
163 Ga0068857_100075914 3300005577 Bacteria 2996
164 Ga0068857_100087856 3300005577 Bacteria 2781
165 Ga0068856_100002901 3300005614 Bacteria 17553
166 Ga0068856_100013146 3300005614 Bacteria 8020
167 Ga0068856_100194948 3300005614 Bacteria 2040
168 Ga0068856_100244011 3300005614 Bacteria 1811
169 Ga0068852_100007756 3300005616 Bacteria 7855
170 Ga0068852_100037184 3300005616 Bacteria 4079
171 Ga0068852_100092176 3300005616 Bacteria 2713
172 Ga0068852_100134564 3300005616 Bacteria 2281
173 Ga0068852_100210891 3300005616 Bacteria 1843
174 Ga0068852_100356509 3300005616 Bacteria 1430
175 Ga0068859_100012737 3300005617 Bacteria 8451
176 Ga0068859_100013022 3300005617 Bacteria 8356
177 Ga0068859_100166560 3300005617 Bacteria 2284
178 Ga0068859_100607966 3300005617 Bacteria 1186
179 Ga0068861_100047445 3300005719 Bacteria 3242
180 Ga0068861_100371257 3300005719 Bacteria 1261
181 Ga0068851_10011405 3300005834 Bacteria 4167
182 Ga0068851_10033803 3300005834 Bacteria 2550
183 Ga0068863_100011269 3300005841 Bacteria 8660
184 Ga0068863_100053186 3300005841 Bacteria 3837
185 Ga0068863_100138343 3300005841 Bacteria 2327
186 Ga0068863_100158018 3300005841 Bacteria 2171
187 Ga0068863_100393411 3300005841 Bacteria 1355
188 Ga0068858_100000799 3300005842 Bacteria 32951
189 Ga0068858_100117829 3300005842 Bacteria 2482
190 Ga0068858_100397588 3300005842 Unclassified 1324
191 Ga0068860_100004414 3300005843 Bacteria 14368
192 Ga0068860_100083730 3300005843 Bacteria 3034
193 Ga0068860_100275915 3300005843 Bacteria 1642
194 Ga0068860_100489826 3300005843 Bacteria 1226
195 Ga0068862_100000354 3300005844 Bacteria 49717
196 Ga0068862_100033844 3300005844 Bacteria 4322
197 Ga0081455_10222099 3300005937 Bacteria 1399
198 Ga0081540_1002130 3300005983 Bacteria 16480
199 Ga0070712_100414713 3300006175 Bacteria 1115
200 Ga0075369_10015806 3300006186 Bacteria 3035
201 Ga0097621_100059618 3300006237 Bacteria 3126
202 Ga0068871_100068577 3300006358 Bacteria 2912
203 Ga0068871_100118007 3300006358 Bacteria 2238
204 Ga0075428_100034175 3300006844 Bacteria 5609
205 Ga0075430_100061388 3300006846 Bacteria 3158
206 Ga0075434_100000030 3300006871 Bacteria 64435
207 Ga0075429_100018264 3300006880 Bacteria 6072
208 Ga0068865_100020670 3300006881 Bacteria 4272
209 Ga0068865_100026562 3300006881 Bacteria 3819
210 Ga0068865_100056814 3300006881 Bacteria 2728
211 Ga0068865_100291414 3300006881 Bacteria 1303
212 Ga0068865_100428952 3300006881 Bacteria 1089
213 Ga0097620_100012737 3300006931 Bacteria 8451
214 Ga0097620_100013022 3300006931 Bacteria 8356
215 Ga0097620_100166555 3300006931 Bacteria 2284
216 Ga0097620_100608063 3300006931 Bacteria 1186
217 Ga0075435_100002432 3300007076 Bacteria 12359
218 Ga0105240_10001717 3300009093 Bacteria 36977
219 Ga0105240_10013498 3300009093 Bacteria 11219
220 Ga0105240_10013812 3300009093 Bacteria 11061
221 Ga0105240_10014038 3300009093 Bacteria 10956
222 Ga0105240_10032191 3300009093 Bacteria 6791
223 Ga0105240_10068714 3300009093 Bacteria 4388
224 Ga0105240_10141706 3300009093 Bacteria 2873
225 Ga0105240_10761909 3300009093 Bacteria 1051
226 Ga0105240_10911026 3300009093 Bacteria 945
227 Ga0111539_10006818 3300009094 Bacteria 14687
228 Ga0111539_10047083 3300009094 Bacteria 5156
229 Ga0105245_10073921 3300009098 Bacteria 3101
230 Ga0105245_10123332 3300009098 Bacteria 2423
231 Ga0105243_10000357 3300009148 Bacteria 48866
232 Ga0105241_10065438 3300009174 Bacteria 2809
233 Ga0105241_10097513 3300009174 Bacteria 2331
234 Ga0105241_10431087 3300009174 Bacteria 1162
235 Ga0105242_10000916 3300009176 Bacteria 22943
236 Ga0105242_10014282 3300009176 Bacteria 6151
237 Ga0105248_10002035 3300009177 Bacteria 22415
238 Ga0105248_10096988 3300009177 Bacteria 3321
239 Ga0105248_10121135 3300009177 Bacteria 2951
240 Ga0105248_10187894 3300009177 Bacteria 2328
241 Ga0105248_10471252 3300009177 Bacteria 1415
242 Ga0105248_10566420 3300009177 Bacteria 1282
243 Ga0105237_10000023 3300009545 Bacteria 226144
244 Ga0105237_10011644 3300009545 Bacteria 9306
245 Ga0105237_10021706 3300009545 Bacteria 6596
246 Ga0105237_10059162 3300009545 Bacteria 3834
247 Ga0105237_10175091 3300009545 Bacteria 2146
248 Ga0105238_10000060 3300009551 Bacteria 129934
249 Ga0105238_10002702 3300009551 Bacteria 17642
250 Ga0105238_10010019 3300009551 Bacteria 9505
251 Ga0105238_10014943 3300009551 Bacteria 7859
252 Ga0105238_10022955 3300009551 Bacteria 6359
253 Ga0105238_10035037 3300009551 Bacteria 5104
254 Ga0105238_10075221 3300009551 Bacteria 3369
255 Ga0105238_10119806 3300009551 Bacteria 2612
256 Ga0105238_10546496 3300009551 Bacteria 1162
257 Ga0105249_10002169 3300009553 Bacteria 17001
258 Ga0105249_10002972 3300009553 Bacteria 14620
259 Ga0105249_10064839 3300009553 Bacteria 3359
260 Ga0105249_10120212 3300009553 Bacteria 2495
261 Ga0105239_10000044 3300010375 Bacteria 187680
262 Ga0105239_10002329 3300010375 Bacteria 24241
263 Ga0105239_10018736 3300010375 Bacteria 7647
264 Ga0105239_10052378 3300010375 Bacteria 4476
265 Ga0105239_10077614 3300010375 Bacteria 3655
266 Ga0105239_10128629 3300010375 Bacteria 2816
267 Ga0105239_10153558 3300010375 Bacteria 2570
268 Ga0157314_1000333 3300012500 Bacteria 4914
269 Ga0157373_10027152 3300013100 Bacteria 4131
270 Ga0157373_10064953 3300013100 Bacteria 2583
271 Ga0157373_10084842 3300013100 Bacteria 2232
272 Ga0157373_10157281 3300013100 Bacteria 1599
273 Ga0157373_10238940 3300013100 Bacteria 1284
274 Ga0157371_10031728 3300013102 Bacteria 3805
275 Ga0157371_10138140 3300013102 Bacteria 1736
276 Ga0157370_10001227 3300013104 Bacteria 32113
277 Ga0157370_10005668 3300013104 Bacteria 13956
278 Ga0157370_10038481 3300013104 Bacteria 4626
279 Ga0157370_10082858 3300013104 Bacteria 3016
280 Ga0157370_10319581 3300013104 Bacteria 1432
281 Ga0157370_10450822 3300013104 Bacteria 1183
282 Ga0157369_10000097 3300013105 Bacteria 121042
283 Ga0157369_10015187 3300013105 Bacteria 8692
284 Ga0157374_10376486 3300013296 Bacteria 1414
285 Ga0157378_10867206 3300013297 Bacteria 932
286 Ga0163162_10000016 3300013306 Bacteria 250836
287 Ga0163162_10020407 3300013306 Bacteria 6511
288 Ga0163162_10040638 3300013306 Bacteria 4652
289 Ga0163162_10124268 3300013306 Bacteria 2686
290 Ga0163162_10224765 3300013306 Bacteria 2007
291 Ga0163162_10767982 3300013306 Bacteria 1082
292 Ga0157372_10000470 3300013307 Bacteria 44468
293 Ga0157372_10005441 3300013307 Bacteria 13531
294 Ga0157372_10027676 3300013307 Bacteria 6178
295 Ga0157372_10156970 3300013307 Bacteria 2628
296 Ga0157372_10290687 3300013307 Bacteria 1901
297 Ga0157372_10686846 3300013307 Bacteria 1191
298 Ga0157375_10000867 3300013308 Bacteria 26326
299 Ga0157375_10380330 3300013308 Bacteria 1579
300 Ga0163163_10000970 3300014325 Bacteria 24383
301 Ga0163163_10234627 3300014325 Bacteria 1884
302 Ga0157380_10127818 3300014326 Bacteria 2163
303 Ga0157379_10043948 3300014968 Bacteria 3989
304 Ga0157379_10143915 3300014968 Bacteria 2150
305 Ga0157376_10008311 3300014969 Bacteria 7482
306 Ga0157376_10015545 3300014969 Bacteria 5753
307 Ga0157376_10076148 3300014969 Bacteria 2866
308 Ga0157376_10310690 3300014969 Bacteria 1495
309 Ga0182006_1096392 3300015261 Bacteria 1056
310 Ga0183368_1003 3300015687 Bacteria 1276390
311 Ga0163161_10239854 3300017792 Bacteria 1410
312 Ga0163161_10328668 3300017792 Bacteria 1210
313 Ga0206353_10652245 3300020082 Bacteria 1281
314 Ga0209435_113829 3300025206 Bacteria 856
315 Ga0209760_100462 3300025207 Bacteria 9090
316 Ga0209784_100016 3300025224 Bacteria 481036
317 Ga0209674_100012 3300025226 Bacteria 950162
318 Ga0209674_100244 3300025226 Bacteria 45968
319 Ga0209674_100318 3300025226 Bacteria 31053
320 Ga0209674_102989 3300025226 Bacteria 3274
321 Ga0209672_100007 3300025228 Bacteria 959482
322 Ga0209672_100016 3300025228 Bacteria 522604
323 Ga0209672_100078 3300025228 Bacteria 156926
324 Ga0209672_100673 3300025228 Bacteria 17260
325 Ga0209672_100845 3300025228 Bacteria 14106
326 Ga0209563_100169 3300025230 Bacteria 46948
327 Ga0207427_100019 3300025231 Bacteria 513977
328 Ga0207427_100033 3300025231 Bacteria 338459
329 Ga0207427_100123 3300025231 Bacteria 98859
330 Ga0209437_100012 3300025233 Bacteria 792625
331 Ga0209437_100105 3300025233 Bacteria 220034
332 Ga0209437_100192 3300025233 Bacteria 122888
333 Ga0209437_100227 3300025233 Bacteria 98939
334 Ga0209258_100012 3300025242 Bacteria 825544
335 Ga0209258_100039 3300025242 Bacteria 386366
336 Ga0209258_100046 3300025242 Bacteria 369794
337 Ga0209258_100095 3300025242 Bacteria 223270
338 Ga0209258_100308 3300025242 Bacteria 77195
339 Ga0209258_101017 3300025242 Bacteria 12688
340 Ga0209646_1000307 3300025246 Bacteria 39199
341 Ga0209646_1000581 3300025246 Bacteria 15100
342 Ga0209026_1000012 3300025250 Bacteria 480426
343 Ga0209026_1000140 3300025250 Bacteria 115081
344 Ga0209026_1000249 3300025250 Bacteria 68455
345 Ga0209026_1000623 3300025250 Bacteria 22318
346 Ga0209026_1005476 3300025250 Bacteria 3409
347 Ga0209677_105627 3300025253 Bacteria 3214
348 Ga0209148_1000001 3300025254 Bacteria 2545271
349 Ga0209148_1000005 3300025254 Bacteria 1806504
350 Ga0209148_1000014 3300025254 Bacteria 925277
351 Ga0209148_1000039 3300025254 Bacteria 482479
352 Ga0209148_1000087 3300025254 Bacteria 260905
353 Ga0209148_1000098 3300025254 Bacteria 233172
354 Ga0209759_1000750 3300025256 Bacteria 28083
355 Ga0209759_1000852 3300025256 Bacteria 23718
356 Ga0209759_1000957 3300025256 Bacteria 20487
357 Ga0209759_1005344 3300025256 Bacteria 4524
358 Ga0209129_1007635 3300025258 Bacteria 3170
359 Ga0209233_1000002 3300025261 Bacteria 2501366
360 Ga0209233_1000080 3300025261 Bacteria 338459
361 Ga0209233_1000283 3300025261 Bacteria 70137
362 Ga0209455_1000010 3300025272 Bacteria 959482
363 Ga0209455_1000034 3300025272 Bacteria 483129
364 Ga0209455_1000039 3300025272 Bacteria 437734
365 Ga0209455_1000126 3300025272 Bacteria 165771
366 Ga0209455_1012247 3300025272 Bacteria 2064
367 Ga0209758_1002406 3300025297 Bacteria 19172
368 Ga0209758_1015870 3300025297 Bacteria 3868
369 Ga0209758_1054388 3300025297 Bacteria 1368
370 Ga0209051_1006850 3300025303 Bacteria 6340
371 Ga0207697_10090836 3300025315 Bacteria 1294
372 Ga0207656_10000302 3300025321 Bacteria 17096
373 Ga0207656_10001499 3300025321 Bacteria 7733
374 Ga0207653_10000008 3300025885 Bacteria 197323
375 Ga0207710_10104707 3300025900 Bacteria 1338
376 Ga0207680_10000005 3300025903 Bacteria 660983
377 Ga0207680_10000892 3300025903 Bacteria 14088
378 Ga0207680_10002436 3300025903 Bacteria 8677
379 Ga0207680_10331950 3300025903 Bacteria 1065
380 Ga0207647_10004964 3300025904 Bacteria 9808
381 Ga0207647_10014022 3300025904 Bacteria 5546
382 Ga0207699_10426022 3300025906 Bacteria 948
383 Ga0207645_10019755 3300025907 Bacteria 4414
384 Ga0207643_10061333 3300025908 Bacteria 2148
385 Ga0207654_10014936 3300025911 Bacteria 4020
386 Ga0207654_10100599 3300025911 Bacteria 1781
387 Ga0207654_10141697 3300025911 Bacteria 1534
388 Ga0207707_10000641 3300025912 Bacteria 34523
389 Ga0207707_10006499 3300025912 Bacteria 10209
390 Ga0207707_10028395 3300025912 Bacteria 4890
391 Ga0207707_10070210 3300025912 Bacteria 3053
392 Ga0207707_10081282 3300025912 Bacteria 2829
393 Ga0207707_10418443 3300025912 Bacteria 1149
394 Ga0207695_10000033 3300025913 Bacteria 507477
395 Ga0207695_10000182 3300025913 Bacteria 184125
396 Ga0207695_10000294 3300025913 Bacteria 123676
397 Ga0207695_10001068 3300025913 Bacteria 47945
398 Ga0207695_10002599 3300025913 Bacteria 26471
399 Ga0207695_10016454 3300025913 Bacteria 8652
400 Ga0207695_10041406 3300025913 Bacteria 4931
401 Ga0207695_10049940 3300025913 Bacteria 4403
402 Ga0207695_10160462 3300025913 Bacteria 2180
403 Ga0207695_10233888 3300025913 Bacteria 1741
404 Ga0207695_10240770 3300025913 Bacteria 1711
405 Ga0207671_10000020 3300025914 Bacteria 309636
406 Ga0207671_10000033 3300025914 Bacteria 245869
407 Ga0207671_10004485 3300025914 Bacteria 13308
408 Ga0207671_10005611 3300025914 Bacteria 11513
409 Ga0207671_10008000 3300025914 Bacteria 9055
410 Ga0207671_10038159 3300025914 Bacteria 3561
411 Ga0207671_10099159 3300025914 Bacteria 2205
412 Ga0207671_10193923 3300025914 Bacteria 1585
413 Ga0207663_10491918 3300025916 Bacteria 952
414 Ga0207660_10315276 3300025917 Bacteria 1248
415 Ga0207657_10213453 3300025919 Bacteria 1548
416 Ga0207649_10044527 3300025920 Bacteria 2717
417 Ga0207652_10048611 3300025921 Bacteria 3626
418 Ga0207652_10180745 3300025921 Bacteria 1896
419 Ga0207646_10057903 3300025922 Bacteria 3462
420 Ga0207681_10067551 3300025923 Bacteria 2479
421 Ga0207694_10000332 3300025924 Bacteria 44554
422 Ga0207694_10000487 3300025924 Bacteria 35975
423 Ga0207694_10001035 3300025924 Bacteria 24204
424 Ga0207694_10007924 3300025924 Bacteria 8038
425 Ga0207694_10039531 3300025924 Bacteria 3630
426 Ga0207694_10145124 3300025924 Bacteria 1910
427 Ga0207650_10055870 3300025925 Bacteria 2932
428 Ga0207650_10174958 3300025925 Bacteria 1708
429 Ga0207659_10281151 3300025926 Bacteria 1360
430 Ga0207687_10048905 3300025927 Bacteria 2939
431 Ga0207700_10016208 3300025928 Bacteria 4945
432 Ga0207664_10000036 3300025929 Bacteria 173396
433 Ga0207664_10000901 3300025929 Bacteria 20063
434 Ga0207644_10061871 3300025931 Bacteria 2713
435 Ga0207644_10070309 3300025931 Bacteria 2558
436 Ga0207690_10001378 3300025932 Bacteria 15253
437 Ga0207690_10093964 3300025932 Bacteria 2126
438 Ga0207690_10106675 3300025932 Bacteria 2010
439 Ga0207690_10262864 3300025932 Bacteria 1338
440 Ga0207706_10008621 3300025933 Bacteria 9396
441 Ga0207706_10063947 3300025933 Bacteria 3239
442 Ga0207686_10000170 3300025934 Bacteria 49724
443 Ga0207686_10082136 3300025934 Bacteria 2106
444 Ga0207686_10414213 3300025934 Bacteria 1029
445 Ga0207709_10000091 3300025935 Bacteria 144622
446 Ga0207670_10002849 3300025936 Bacteria 9128
447 Ga0207670_10124769 3300025936 Bacteria 1877
448 Ga0207669_10646639 3300025937 Bacteria 864
449 Ga0207704_10051710 3300025938 Bacteria 2486
450 Ga0207704_10058952 3300025938 Bacteria 2367
451 Ga0207704_10111132 3300025938 Bacteria 1853
452 Ga0207704_10214075 3300025938 Bacteria 1420
453 Ga0207704_10228012 3300025938 Bacteria 1383
454 Ga0207691_10004047 3300025940 Bacteria 14216
455 Ga0207691_10141568 3300025940 Bacteria 2119
456 Ga0207691_10309695 3300025940 Bacteria 1355
457 Ga0207711_10053220 3300025941 Bacteria 3471
458 Ga0207711_10076510 3300025941 Bacteria 2915
459 Ga0207711_10193280 3300025941 Bacteria 1855
460 Ga0207689_10028306 3300025942 Bacteria 4688
461 Ga0207689_10059518 3300025942 Bacteria 3142
462 Ga0207689_10656351 3300025942 Bacteria 884
463 Ga0207661_10185419 3300025944 Bacteria 1820
464 Ga0207679_10233207 3300025945 Bacteria 1555
465 Ga0207667_10000130 3300025949 Bacteria 115321
466 Ga0207667_10001289 3300025949 Bacteria 31377
467 Ga0207667_10031186 3300025949 Bacteria 5756
468 Ga0207667_10047100 3300025949 Bacteria 4564
469 Ga0207667_10115267 3300025949 Bacteria 2769
470 Ga0207667_10124665 3300025949 Bacteria 2653
471 Ga0207667_10249130 3300025949 Bacteria 1817
472 Ga0207667_10376233 3300025949 Bacteria 1447
473 Ga0207712_10000288 3300025961 Bacteria 47902
474 Ga0207712_10000677 3300025961 Bacteria 26367
475 Ga0207712_10075447 3300025961 Bacteria 2437
476 Ga0207712_10214400 3300025961 Bacteria 1535
477 Ga0207668_10165228 3300025972 Bacteria 1729
478 Ga0207668_10206568 3300025972 Bacteria 1568
479 Ga0207640_10003468 3300025981 Bacteria 8492
480 Ga0207640_10101119 3300025981 Bacteria 2022
481 Ga0207640_10117064 3300025981 Bacteria 1901
482 Ga0207658_10001333 3300025986 Bacteria 19334
483 Ga0207658_10031575 3300025986 Bacteria 3763
484 Ga0207658_10540140 3300025986 Bacteria 1042
485 Ga0207703_10001120 3300026035 Bacteria 25309
486 Ga0207703_10036724 3300026035 Bacteria 3901
487 Ga0207703_10050802 3300026035 Bacteria 3358
488 Ga0207639_10001096 3300026041 Bacteria 18406
489 Ga0207639_10002655 3300026041 Bacteria 11998
490 Ga0207639_10003408 3300026041 Bacteria 10693
491 Ga0207639_10008066 3300026041 Bacteria 7199
492 Ga0207639_10008230 3300026041 Bacteria 7141
493 Ga0207639_10011603 3300026041 Bacteria 6122
494 Ga0207639_10094754 3300026041 Bacteria 2397
495 Ga0207639_10197062 3300026041 Bacteria 1724
496 Ga0207639_10532087 3300026041 Bacteria 1077
497 Ga0207678_10003102 3300026067 Bacteria 15050
498 Ga0207678_10011976 3300026067 Bacteria 7617
499 Ga0207678_10032619 3300026067 Bacteria 4539
500 Ga0207678_10131037 3300026067 Bacteria 2139
501 Ga0207678_10194393 3300026067 Bacteria 1734
502 Ga0207678_10200199 3300026067 Bacteria 1707
503 Ga0207678_10693491 3300026067 Bacteria 896
504 Ga0207702_10000340 3300026078 Bacteria 53705
505 Ga0207702_10029161 3300026078 Bacteria 4590
506 Ga0207702_10053888 3300026078 Bacteria 3406
507 Ga0207702_10106436 3300026078 Bacteria 2485
508 Ga0207702_10107722 3300026078 Bacteria 2472
509 Ga0207702_10121622 3300026078 Bacteria 2337
510 Ga0207702_10302808 3300026078 Bacteria 1517
511 Ga0207641_10030081 3300026088 Bacteria 4496
512 Ga0207641_10089759 3300026088 Bacteria 2686
513 Ga0207641_10120752 3300026088 Bacteria 2338
514 Ga0207641_10189016 3300026088 Bacteria 1892
515 Ga0207641_10357061 3300026088 Bacteria 1394
516 Ga0207641_10436414 3300026088 Bacteria 1263
517 Ga0207648_10048514 3300026089 Bacteria 3717
518 Ga0207648_10075262 3300026089 Bacteria 2943
519 Ga0207648_10148216 3300026089 Bacteria 2070
520 Ga0207676_10700140 3300026095 Bacteria 981
521 Ga0207674_10000218 3300026116 Bacteria 71563
522 Ga0207674_10019334 3300026116 Bacteria 7379
523 Ga0207674_10092754 3300026116 Bacteria 3009
524 Ga0207674_10104787 3300026116 Bacteria 2806
525 Ga0207674_10472676 3300026116 Bacteria 1212
526 Ga0207675_100069569 3300026118 Bacteria 3290
527 Ga0207683_10174862 3300026121 Bacteria 1945
528 Ga0207683_10194847 3300026121 Bacteria 1840
529 Ga0207698_10005033 3300026142 Bacteria 8105
530 Ga0207698_10073753 3300026142 Bacteria 2719
531 Ga0207698_10093018 3300026142 Bacteria 2474
532 Ga0207698_10404863 3300026142 Bacteria 1305
533 Ga0207698_10959975 3300026142 Bacteria 864
534 Ga0209371_1000072 3300027312 Bacteria 199942
535 Ga0207428_10113109 3300027907 Bacteria 2087
536 Ga0268266_10000001 3300028379 Bacteria 4040580
537 Ga0268266_10000004 3300028379 Bacteria 1495817
538 Ga0268266_10000006 3300028379 Bacteria 1410021
539 Ga0268266_10030884 3300028379 Bacteria 4550
540 Ga0268266_10067829 3300028379 Bacteria 3088
541 Ga0268266_10134875 3300028379 Bacteria 2210
542 Ga0268266_10466868 3300028379 Bacteria 1201
543 Ga0268265_10000775 3300028380 Bacteria 30819
544 Ga0268265_10005679 3300028380 Bacteria 8520
545 Ga0268265_10152847 3300028380 Bacteria 1949
546 Ga0268264_10005953 3300028381 Bacteria 10322
547 Ga0268264_10072876 3300028381 Bacteria 2913
548 Ga0268264_10083899 3300028381 Bacteria 2730
549 Ga0268264_10654758 3300028381 Bacteria 1040
550 Ga0307517_10148851 3300028786 Bacteria 1614
551 Ga0307515_10088808 3300028794 Bacteria 3901
552 Ga0268256_1000065 3300030500 Bacteria 199943
553 Ga0316177_1024630 3300030731 Bacteria 2584
554 Ga0316180_1144547 3300030736 Bacteria 7953
555 Ga0316182_1010238 3300030745 Bacteria 3042
556 Ga0265328_10044255 3300031239 Bacteria 1637
557 Ga0307509_10000138 3300031507 Bacteria 108694
558 Ga0307508_10436776 3300031616 Bacteria 901
559 Ga0265314_10034269 3300031711 Bacteria 3713
560 Ga0316576_10033220 3300031727 Bacteria 3671
561 Ga0316578_10099080 3300031728 Bacteria 1746
562 Ga0307516_10368341 3300031730 Bacteria 1100
563 Ga0307413_10060324 3300031824 Bacteria 2335
564 Ga0307413_10108800 3300031824 Bacteria 1851
565 Ga0307410_10050512 3300031852 Bacteria 2797
566 Ga0307406_10424049 3300031901 Bacteria 1061
567 Ga0307416_100178554 3300032002 Bacteria 1987
568 Ga0307411_10360689 3300032005 Bacteria 1188
569 Ga0316583_10030412 3300032133 Bacteria 1923
570 Ga0316580_10015706 3300032139 Bacteria 2317
571 Ga0307510_10020810 3300033180 Bacteria 7659
572 Ga0316596_1000148 3300033541 Bacteria 9709
573 Ga0373934_0148399 3300035086 Bacteria 960
574 Ga0373944_0001829 3300035089 Bacteria 5375
575 Ga0316574_0297099 3300035398 Bacteria 1027
576 Ga0373937_0767201 3300036401 Bacteria 912
577 Ga0316582_0292050 3300036647 Bacteria 1119
578 Ga0316584_0461025 3300036712 Bacteria 897
579 Ga0373925_0287663 3300037068 Bacteria 1325
580 Ga0395899_0000175 3300037312 Bacteria 95781
581 Ga0395899_0083556 3300037312 Bacteria 2321
582 Ga0395900_0000012 3300037418 Bacteria 401198
583 Ga0395900_0000590 3300037418 Bacteria 49754
584 Ga0395900_0003017 3300037418 Bacteria 18319
585 Ga0395900_0020607 3300037418 Bacteria 6735
586 Ga0395900_0113437 3300037418 Bacteria 2782
587 Ga0395900_0387197 3300037418 Bacteria 1365
588 Ga0395898_0000034 3300037466 Bacteria 356745
589 Ga0395898_0000197 3300037466 Bacteria 155187
590 Ga0395898_0084511 3300037466 Bacteria 3059
591 Ga0395898_0187964 3300037466 Bacteria 1974
592 Ga0395898_0261181 3300037466 Bacteria 1652
593 Ga0395905_0004097 3300037471 Bacteria 15271
594 Ga0395905_0530847 3300037471 Bacteria 1077
595 Ga0395905_0595365 3300037471 Bacteria 1007
596 Ga0395901_0002395 3300038443 Bacteria 19062
597 Ga0395901_0096876 3300038443 Bacteria 3092
598 Ga0395901_0099480 3300038443 Bacteria 3049
599 Ga0395901_0321976 3300038443 Bacteria 1599
600 Ga0395901_0527910 3300038443 Bacteria 1198
601 Ga0439436_0040842 3300041404 Bacteria 1328
602 Ga0451791_0120622 3300041451 Bacteria 1437
603 Ga0451791_0417054 3300041451 Bacteria 993
604 Ga0451800_0794950 3300041459 Bacteria 1539
605 Ga0451802_1053210 3300041460 Bacteria 4101
606 Ga0451804_0827444 3300041463 Bacteria 1574
607 Ga0451853_1117054 3300041512 Bacteria 3860
608 Ga0451853_1932253 3300041512 Bacteria 1068
609 Ga0451853_3149850 3300041512 Bacteria 2491
610 Ga0439431_0034331 3300041997 Bacteria 1271
611 Ga0439432_033213 3300042006 Bacteria 1661
612 Ga0439449_0025587 3300042007 Bacteria 2205
613 Ga0466969_0003088 3300044656 Bacteria 8879
614 Ga0466969_0006890 3300044656 Bacteria 6049
615 Ga0466969_0042668 3300044656 Bacteria 2263
616 Ga0466969_0052049 3300044656 Bacteria 2013
617 Ga0466982_0000020 3300044672 Bacteria 99164
618 Ga0466965_0030627 3300044683 Bacteria 2622
619 Ga0466965_0054319 3300044683 Bacteria 1991
620 Ga0466966_0089385 3300044684 Bacteria 1913
621 Ga0466966_0097134 3300044684 Bacteria 1824
622 Ga0466966_0182397 3300044684 Bacteria 1274
623 Ga0466961_0009198 3300044693 Bacteria 6290
624 Ga0466961_0011333 3300044693 Bacteria 5701
625 Ga0466961_0012228 3300044693 Bacteria 5488
626 Ga0466961_0033217 3300044693 Bacteria 3316
627 Ga0466961_0193868 3300044693 Bacteria 1258
628 Ga0466964_0007547 3300044706 Bacteria 4069
629 Ga0466964_0082481 3300044706 Bacteria 1383
630 Ga0453684_0003957 3300044712 Bacteria 32397
631 Ga0453684_0044943 3300044712 Bacteria 5899
632 Ga0453684_0216116 3300044712 Bacteria 2224
633 Ga0466971_0004168 3300044719 Bacteria 6230
634 Ga0466971_0005065 3300044719 Bacteria 5709
635 Ga0466971_0019375 3300044719 Bacteria 3021
636 Ga0466968_0010922 3300044735 Bacteria 3529
637 Ga0466968_0013147 3300044735 Bacteria 3250
638 Ga0466970_0001017 3300044765 Bacteria 13518
639 Ga0466970_0016399 3300044765 Bacteria 3818
640 Ga0466970_0040551 3300044765 Bacteria 2472
641 Ga0466970_0156709 3300044765 Bacteria 1258
642 Ga0466957_0015342 3300044842 Bacteria 4476
643 Ga0466957_0054609 3300044842 Bacteria 2439
644 Ga0466957_0230339 3300044842 Bacteria 1226
645 Ga0466960_0006030 3300044901 Bacteria 4839
646 Ga0466959_0001920 3300045049 Bacteria 13067
647 Ga0466959_0019916 3300045049 Bacteria 4938
648 Ga0466959_0058121 3300045049 Bacteria 2817
649 Ga0466959_0070366 3300045049 Bacteria 2534
650 Ga0466959_0096720 3300045049 Bacteria 2116
651 Ga0466958_0005201 3300045836 Bacteria 6972
652 Ga0466958_0022314 3300045836 Bacteria 3706
653 Ga0466967_0203723 3300045976 Bacteria 1875
654 Ga0466967_0296892 3300045976 Bacteria 1554
655 Ga0495638_0000058 3300046460 Bacteria 192656
656 Ga0495638_0000159 3300046460 Bacteria 106490
657 Ga0495638_0000161 3300046460 Bacteria 104406
658 Ga0495650_0000197 3300046471 Bacteria 131300
659 Ga0495650_0000590 3300046471 Bacteria 50202
660 Ga0495607_0000508 3300046501 Bacteria 38562
661 Ga0495607_0041187 3300046501 Bacteria 2745
662 Ga0495606_0000940 3300046507 Bacteria 42915
663 Ga0495606_0009272 3300046507 Bacteria 8352
664 Ga0495610_0001937 3300046512 Bacteria 17835
665 Ga0495643_0000420 3300046522 Bacteria 55396
666 Ga0495648_0037193 3300046524 Bacteria 3130
667 Ga0495665_0138228 3300046531 Bacteria 1274
668 Ga0495640_0224766 3300046533 Bacteria 1183
669 Ga0495609_0026658 3300046538 Bacteria 2645
670 Ga0495597_0000445 3300046542 Bacteria 35362
671 Ga0495633_0001876 3300046558 Bacteria 15349
672 Ga0495625_0026760 3300046660 Bacteria 4351
673 Ga0495625_0113192 3300046660 Bacteria 1853
674 Ga0495659_0036396 3300046664 Bacteria 1739
675 Ga0495658_0023452 3300046683 Bacteria 3275
676 Ga0495658_0116546 3300046683 Bacteria 1611
677 Ga0495649_0001668 3300046694 Bacteria 16496
678 Ga0495649_0002293 3300046694 Bacteria 13595
679 Ga0495672_0000483 3300047320 Bacteria 47007
680 Ga0495687_000317 3300047443 Bacteria 62824
681 Ga0495684_0065199 3300047471 Bacteria 2769
682 Ga0495686_0000175 3300047472 Bacteria 122163
683 Ga0495686_0017603 3300047472 Bacteria 4808
684 Ga0496101_0025554 3300048904 Bacteria 4099
685 Ga0496102_0008206 3300048905 Bacteria 8939
686 Ga0496103_0006595 3300048906 Bacteria 6922
687 Ga0496104_0000011 3300048907 Bacteria 459358
688 Ga0496104_0538061 3300048907 Bacteria 1079
689 Ga0496105_0000014 3300048908 Bacteria 220911
690 Ga0496105_0016340 3300048908 Bacteria 5924
691 Ga0496105_0110018 3300048908 Bacteria 2274
692 Ga0496105_0348013 3300048908 Bacteria 1184
693 Ga0496106_0181925 3300048909 Bacteria 1669
694 Ga0496114_0280556 3300048917 Bacteria 1469
695 Ga0496114_0395867 3300048917 Bacteria 1223
696 Ga0496115_0000025 3300048918 Bacteria 151658
697 Ga0496115_0000293 3300048918 Bacteria 43225
698 Ga0496115_0000974 3300048918 Bacteria 20806
699 Ga0496115_0022193 3300048918 Bacteria 4914
700 Ga0496117_0019447 3300048920 Bacteria 5576
701 Ga0496117_0062426 3300048920 Bacteria 2553
702 Ga0496117_0100838 3300048920 Bacteria 1828
703 Ga0496118_0004230 3300048921 Bacteria 17222
704 Ga0496118_0009467 3300048921 Bacteria 9835
705 Ga0496118_0018702 3300048921 Bacteria 6229
706 Ga0496119_0001095 3300048922 Bacteria 34129
707 Ga0496119_0062380 3300048922 Bacteria 2221
708 Ga0496120_0000656 3300048923 Bacteria 50861
709 Ga0496120_0013968 3300048923 Bacteria 5374
710 Ga0496121_0004079 3300048924 Bacteria 20060
711 Ga0496121_0009617 3300048924 Bacteria 11074
712 Ga0496121_0042777 3300048924 Bacteria 3934
713 Ga0496121_0087285 3300048924 Bacteria 2449
714 Ga0496121_0184405 3300048924 Bacteria 1502
715 Ga0496122_0038152 3300048925 Bacteria 3854
716 Ga0496123_0001240 3300048926 Bacteria 37029
717 Ga0496124_0002427 3300048927 Bacteria 24450
718 Ga0496125_0000344 3300048928 Bacteria 88380
719 Ga0496125_0009742 3300048928 Bacteria 9807
720 Ga0496126_0000057 3300048929 Bacteria 276781
721 Ga0496126_0003518 3300048929 Bacteria 19705
722 Ga0496126_0023183 3300048929 Bacteria 6018
723 Ga0496126_0059039 3300048929 Bacteria 3456
724 Ga0496126_0114480 3300048929 Bacteria 2346
725 Ga0495678_000347 3300049459 Bacteria 48195
726 Ga0501031_0018033 3300049568 Bacteria 4591
727 Ga0501031_0024897 3300049568 Bacteria 3903
728 Ga0501031_0046675 3300049568 Bacteria 2824
729 Ga0501032_0000994 3300049569 Bacteria 22837
730 Ga0501032_0007509 3300049569 Bacteria 7963
731 Ga0501032_0012956 3300049569 Bacteria 5939
732 Ga0501032_0036367 3300049569 Bacteria 3361
733 Ga0501032_0151679 3300049569 Bacteria 1523
734 Ga0501033_0000550 3300049570 Bacteria 34940
735 Ga0501033_0006764 3300049570 Bacteria 8956
736 Ga0501033_0008456 3300049570 Bacteria 7969
737 Ga0501033_0060705 3300049570 Bacteria 2788
738 Ga0501034_0000769 3300049571 Bacteria 48050
739 Ga0501034_0001262 3300049571 Bacteria 34347
740 Ga0501034_0002423 3300049571 Bacteria 22561
741 Ga0501034_0022793 3300049571 Bacteria 6379
742 Ga0501034_0039328 3300049571 Bacteria 4791
743 Ga0501034_0102777 3300049571 Bacteria 2851
744 Ga0501036_0020650 3300049572 Bacteria 5532
745 Ga0501036_0047657 3300049572 Bacteria 3628
746 Ga0501036_0117080 3300049572 Bacteria 2250
747 Ga0501037_0010539 3300049573 Bacteria 6789
748 Ga0501037_0050867 3300049573 Bacteria 3031
749 Ga0501037_0069638 3300049573 Bacteria 2560
750 Ga0501037_0101647 3300049573 Bacteria 2074
751 Ga0501038_0003208 3300049574 Bacteria 15263
752 Ga0501038_0011175 3300049574 Bacteria 8199
753 Ga0501038_0016661 3300049574 Bacteria 6661
754 Ga0501038_0033729 3300049574 Bacteria 4507
755 Ga0501038_0120395 3300049574 Bacteria 2165
756 Ga0501038_0180829 3300049574 Bacteria 1701
757 Ga0501038_0219132 3300049574 Bacteria 1519
758 Ga0501038_0304105 3300049574 Bacteria 1251
759 Ga0501039_0003438 3300049575 Bacteria 11824
760 Ga0501039_0089749 3300049575 Bacteria 2395
761 Ga0501039_0111912 3300049575 Bacteria 2134
762 Ga0501042_0032210 3300049578 Bacteria 3712
763 Ga0501042_0177115 3300049578 Bacteria 1538
764 Ga0501043_0001679 3300049579 Bacteria 19220
765 Ga0501043_0022649 3300049579 Bacteria 4925
766 Ga0501043_0033718 3300049579 Bacteria 4029
767 Ga0501043_0078288 3300049579 Bacteria 2597
768 Ga0501043_0083758 3300049579 Bacteria 2507
769 Ga0501046_0001275 3300049580 Bacteria 24406
770 Ga0501046_0026065 3300049580 Bacteria 4777
771 Ga0501046_0051077 3300049580 Bacteria 3264
772 Ga0501046_0104255 3300049580 Bacteria 2173
773 Ga0501047_0000446 3300049581 Bacteria 45717
774 Ga0501047_0015182 3300049581 Bacteria 7332
775 Ga0501047_0016313 3300049581 Bacteria 7087
776 Ga0501047_0046648 3300049581 Bacteria 4187
777 Ga0501047_0072674 3300049581 Bacteria 3310
778 Ga0501047_0156480 3300049581 Bacteria 2152
779 Ga0501047_0266593 3300049581 Bacteria 1559
780 Ga0501067_0004497 3300049583 Bacteria 7693
781 Ga0501067_0027913 3300049583 Bacteria 3128
782 Ga0501068_0023128 3300049584 Bacteria 3640
783 Ga0501068_0027610 3300049584 Bacteria 3352
784 Ga0501069_0002920 3300049585 Bacteria 8772
785 Ga0501070_0010811 3300049586 Bacteria 7710
786 Ga0501070_0032545 3300049586 Bacteria 4364
787 Ga0501070_0073895 3300049586 Bacteria 2821
788 Ga0501070_0081453 3300049586 Bacteria 2678
789 Ga0501070_0093200 3300049586 Bacteria 2492
790 Ga0501071_0022609 3300049587 Bacteria 4384
791 Ga0501072_0001232 3300049588 Bacteria 19103
792 Ga0501072_0067873 3300049588 Bacteria 2814
793 Ga0501073_0003183 3300049589 Bacteria 12318
794 Ga0501073_0003698 3300049589 Bacteria 11488
795 Ga0501073_0010811 3300049589 Bacteria 6685
796 Ga0501073_0092858 3300049589 Bacteria 2097
797 Ga0501073_0124857 3300049589 Bacteria 1784
798 Ga0501073_0240851 3300049589 Bacteria 1249
799 Ga0501073_0287951 3300049589 Bacteria 1133
800 Ga0501074_0115626 3300049590 Bacteria 1919
801 Ga0501074_0135081 3300049590 Bacteria 1764
802 Ga0501074_0272882 3300049590 Bacteria 1202
803 Ga0501077_0127499 3300049593 Bacteria 1613
804 Ga0501079_0042478 3300049741 Bacteria 3510
805 Ga0501079_0122036 3300049741 Bacteria 2026
806 Ga0501080_0003297 3300049742 Bacteria 14263
807 Ga0501080_0062906 3300049742 Bacteria 3454
808 Ga0501080_0095913 3300049742 Bacteria 2753
809 Ga0501080_0135246 3300049742 Bacteria 2281
810 Ga0501080_0195615 3300049742 Bacteria 1857
811 Ga0501080_0227193 3300049742 Bacteria 1706
812 Ga0501083_0000225 3300049744 Bacteria 36374
813 Ga0501083_0066365 3300049744 Bacteria 2402
814 Ga0501280_038846 3300049776 Bacteria 766
815 Ga0501035_0021974 3300049822 Bacteria 5861
816 Ga0501035_0039997 3300049822 Bacteria 4240
817 Ga0501035_0084771 3300049822 Bacteria 2794
818 Ga0501035_0090024 3300049822 Bacteria 2701
819 Ga0501035_0142153 3300049822 Bacteria 2086
820 Ga0501035_0238283 3300049822 Bacteria 1548
821 Ga0501044_0001236 3300049823 Bacteria 30366
822 Ga0501044_0001646 3300049823 Bacteria 26227
823 Ga0501044_0012392 3300049823 Bacteria 9230
824 Ga0501044_0017345 3300049823 Bacteria 7722
825 Ga0501044_0096134 3300049823 Bacteria 2984
826 Ga0501044_0096304 3300049823 Bacteria 2981
827 Ga0501044_0156699 3300049823 Bacteria 2256
828 Ga0501044_0169854 3300049823 Bacteria 2153
829 Ga0501044_0242320 3300049823 Bacteria 1746
830 Ga0501044_0260492 3300049823 Bacteria 1672
831 Ga0501044_0371690 3300049823 Bacteria 1346
832 Ga0501045_0118996 3300049824 Bacteria 1961
833 Ga0501045_0131719 3300049824 Bacteria 1859
834 nmdc:mga09592_568_c1 3300050508 Bacteria 28030
835 nmdc:mga09592_93885_c1 3300050508 Bacteria 2566
836 nmdc:mga0qj67_25480_c1 3300050509 Bacteria 4570
837 nmdc:mga08y16_287981_c1 3300050511 Bacteria 1694
838 nmdc:mga0rr50_105622_c1 3300050513 Bacteria 2221
839 nmdc:mga0sz30_10261_c1 3300050516 Bacteria 3586
840 Ga0500643_005125 3300053087 Bacteria 5721
841 Ga0500651_0010117 3300053093 Bacteria 5638
842 Ga0500566_0206585 3300053094 Bacteria 987
843 Ga0500568_0000145 3300053139 Bacteria 62300
844 Ga0500639_193770 3300053163 Bacteria 882
845 Ga0500636_0132008 3300053177 Bacteria 1390
846 Ga0501084_0210351 3300054114 Bacteria 1641
847 Ga0501082_0015830 3300060353 Bacteria 6485
848 Ga0501082_0095259 3300060353 Bacteria 2572
849 Ga0501082_0238714 3300060353 Bacteria 1582
850 Ga0466962_0004731 3300061719 Bacteria 6543
851 Ga0466962_0006238 3300061719 Bacteria 5725
852 Ga0466962_0012527 3300061719 Bacteria 4077
853 Ga0466962_0022735 3300061719 Bacteria 3013

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046664 Ga0495659_0036396 Ga0495659_0036396_1097_1711 204
2 3300025926 Ga0207659_10281151 Ga0207659_102811512 220
3 3300048908 Ga0496105_0110018 Ga0496105_0110018_32_697 220
4 3300005617 Ga0068859_100166560 Ga0068859_1001665602 222
5 3300005842 Ga0068858_100397588 Ga0068858_1003975883 222
6 3300006931 Ga0097620_100166555 Ga0097620_1001665552 222
7 3300025941 Ga0207711_10076510 Ga0207711_100765103 222
8 3300031852 Ga0307410_10050512 Ga0307410_100505124 225
9 3300031901 Ga0307406_10424049 Ga0307406_104240492 225
10 3300032005 Ga0307411_10360689 Ga0307411_103606891 225
11 3300049776 Ga0501280_038846 Ga0501280_038846_33_713 225
12 3300037471 Ga0395905_0004097 Ga0395905_0004097_5724_6512 230
13 3300006871 Ga0075434_100000030 Ga0075434_10000003078 231
14 3300007076 Ga0075435_100002432 Ga0075435_1000024328 231
15 3300050513 nmdc:mga0rr50_105622_c1 nmdc:mga0rr50_105622_c1_992_1687 231
16 3300005445 Ga0070708_100253996 Ga0070708_1002539963 236
17 3300005471 Ga0070698_100271679 Ga0070698_1002716792 236
18 3300026116 Ga0207674_10472676 Ga0207674_104726762 236
19 3300037418 Ga0395900_0387197 Ga0395900_0387197_27_932 238
20 3300037471 Ga0395905_0595365 Ga0395905_0595365_23_817 238
21 3300017792 Ga0163161_10239854 Ga0163161_102398541 239
22 iso_pu_bacteria 2690315857 2691331760 239
23 iso_pu_bacteria 2919534386 2919537023 239
24 iso_pu_bacteria 8002392321 8002392955 239
25 3300005458 Ga0070681_10000058 Ga0070681_1000005850 242
26 3300025912 Ga0207707_10000641 Ga0207707_1000064116 242
27 iso_pu_bacteria 2887630918 2887633659 242
28 3300010375 Ga0105239_10153558 Ga0105239_101535584 243
29 3300026078 Ga0207702_10029161 Ga0207702_100291615 243
30 3300026121 Ga0207683_10194847 Ga0207683_101948472 243
31 3300048924 Ga0496121_0004079 Ga0496121_0004079_3478_4257 243
32 3300049823 Ga0501044_0169854 Ga0501044_0169854_1284_2042 243
33 iso_pu_bacteria 2574179768 2574431577 243
34 iso_pu_bacteria 2881714928 2881716281 243
35 3300005327 Ga0070658_10302896 Ga0070658_103028962 244
36 3300005339 Ga0070660_100074431 Ga0070660_1000744312 244
37 3300005344 Ga0070661_100007743 Ga0070661_1000077436 244
38 3300005347 Ga0070668_100635041 Ga0070668_1006350412 244
39 3300005354 Ga0070675_100169335 Ga0070675_1001693352 244
40 3300005356 Ga0070674_100817241 Ga0070674_1008172411 244
41 3300005367 Ga0070667_100064127 Ga0070667_1000641271 244
42 3300005457 Ga0070662_100219424 Ga0070662_1002194242 244
43 3300005535 Ga0070684_100012608 Ga0070684_1000126084 244
44 3300005539 Ga0068853_100003826 Ga0068853_1000038268 244
45 3300005546 Ga0070696_100001471 Ga0070696_1000014717 244
46 3300005563 Ga0068855_100030567 Ga0068855_1000305672 244
47 3300005577 Ga0068857_100075914 Ga0068857_1000759143 244
48 3300005614 Ga0068856_100013146 Ga0068856_1000131469 244
49 3300005616 Ga0068852_100356509 Ga0068852_1003565092 244
50 3300009093 Ga0105240_10032191 Ga0105240_100321911 244
51 3300009093 Ga0105240_10141706 Ga0105240_101417064 244
52 3300009545 Ga0105237_10175091 Ga0105237_101750912 244
53 3300009551 Ga0105238_10022955 Ga0105238_100229559 244
54 3300010375 Ga0105239_10077614 Ga0105239_100776141 244
55 3300013100 Ga0157373_10064953 Ga0157373_100649535 244
56 3300013104 Ga0157370_10082858 Ga0157370_100828585 244
57 3300013105 Ga0157369_10015187 Ga0157369_100151879 244
58 3300013306 Ga0163162_10767982 Ga0163162_107679821 244
59 3300013307 Ga0157372_10000470 Ga0157372_1000047033 244
60 3300013307 Ga0157372_10686846 Ga0157372_106868462 244
61 3300025904 Ga0207647_10004964 Ga0207647_100049644 244
62 3300025911 Ga0207654_10014936 Ga0207654_100149362 244
63 3300025913 Ga0207695_10000182 Ga0207695_1000018294 244
64 3300025914 Ga0207671_10005611 Ga0207671_1000561114 244
65 3300025914 Ga0207671_10193923 Ga0207671_101939232 244
66 3300025933 Ga0207706_10063947 Ga0207706_100639472 244
67 3300025937 Ga0207669_10646639 Ga0207669_106466391 244
68 3300025940 Ga0207691_10309695 Ga0207691_103096953 244
69 3300025944 Ga0207661_10185419 Ga0207661_101854193 244
70 3300025949 Ga0207667_10001289 Ga0207667_1000128926 244
71 3300025949 Ga0207667_10047100 Ga0207667_100471002 244
72 3300026041 Ga0207639_10003408 Ga0207639_100034082 244
73 3300026078 Ga0207702_10053888 Ga0207702_100538882 244
74 3300026078 Ga0207702_10106436 Ga0207702_101064363 244
75 3300048905 Ga0496102_0008206 Ga0496102_0008206_3748_4515 244
76 iso_pu_bacteria 2547132512 2548846484 244
77 3300005295 Ga0065707_10002428 Ga0065707_100024286 245
78 3300005330 Ga0070690_100175201 Ga0070690_1001752011 245
79 3300005334 Ga0068869_100236318 Ga0068869_1002363183 245
80 3300005340 Ga0070689_100053928 Ga0070689_1000539283 245
81 3300005406 Ga0070703_10000036 Ga0070703_1000003642 245
82 3300005444 Ga0070694_100005045 Ga0070694_10000504511 245
83 3300005445 Ga0070708_100247660 Ga0070708_1002476603 245
84 3300005468 Ga0070707_100081326 Ga0070707_1000813262 245
85 3300005471 Ga0070698_100379145 Ga0070698_1003791451 245
86 3300005544 Ga0070686_100136361 Ga0070686_1001363612 245
87 3300005549 Ga0070704_100032088 Ga0070704_1000320883 245
88 3300005617 Ga0068859_100013022 Ga0068859_1000130224 245
89 3300005843 Ga0068860_100489826 Ga0068860_1004898261 245
90 3300005844 Ga0068862_100033844 Ga0068862_1000338442 245
91 3300006844 Ga0075428_100034175 Ga0075428_1000341753 245
92 3300006931 Ga0097620_100013022 Ga0097620_1000130229 245
93 3300009093 Ga0105240_10911026 Ga0105240_109110262 245
94 3300009094 Ga0111539_10006818 Ga0111539_100068189 245
95 3300009094 Ga0111539_10047083 Ga0111539_100470836 245
96 3300009148 Ga0105243_10000357 Ga0105243_1000035725 245
97 3300009174 Ga0105241_10431087 Ga0105241_104310872 245
98 3300009176 Ga0105242_10000916 Ga0105242_100009162 245
99 3300009177 Ga0105248_10096988 Ga0105248_100969882 245
100 3300009553 Ga0105249_10120212 Ga0105249_101202123 245
101 3300014968 Ga0157379_10043948 Ga0157379_100439484 245
102 3300025885 Ga0207653_10000008 Ga0207653_10000008181 245
103 3300025911 Ga0207654_10100599 Ga0207654_101005991 245
104 3300025922 Ga0207646_10057903 Ga0207646_100579036 245
105 3300025934 Ga0207686_10000170 Ga0207686_1000017025 245
106 3300025935 Ga0207709_10000091 Ga0207709_10000091107 245
107 3300025961 Ga0207712_10214400 Ga0207712_102144002 245
108 3300026035 Ga0207703_10050802 Ga0207703_100508024 245
109 3300026095 Ga0207676_10700140 Ga0207676_107001401 245
110 3300027907 Ga0207428_10113109 Ga0207428_101131092 245
111 3300028380 Ga0268265_10005679 Ga0268265_1000567911 245
112 3300028381 Ga0268264_10072876 Ga0268264_100728764 245
113 3300031727 Ga0316576_10033220 Ga0316576_100332203 245
114 3300031728 Ga0316578_10099080 Ga0316578_100990802 245
115 3300031730 Ga0307516_10368341 Ga0307516_103683411 245
116 3300032133 Ga0316583_10030412 Ga0316583_100304123 245
117 3300032139 Ga0316580_10015706 Ga0316580_100157062 245
118 3300035398 Ga0316574_0297099 Ga0316574_0297099_156_893 245
119 3300036647 Ga0316582_0292050 Ga0316582_0292050_161_898 245
120 3300049569 Ga0501032_0012956 Ga0501032_0012956_1683_2444 245
121 3300049571 Ga0501034_0000769 Ga0501034_0000769_14560_15321 245
122 3300049571 Ga0501034_0022793 Ga0501034_0022793_3738_4499 245
123 3300049571 Ga0501034_0102777 Ga0501034_0102777_1235_1996 245
124 3300049574 Ga0501038_0011175 Ga0501038_0011175_1423_2184 245
125 3300049574 Ga0501038_0219132 Ga0501038_0219132_745_1506 245
126 3300049579 Ga0501043_0033718 Ga0501043_0033718_2113_2874 245
127 3300049579 Ga0501043_0083758 Ga0501043_0083758_1076_1837 245
128 3300049581 Ga0501047_0000446 Ga0501047_0000446_39814_40575 245
129 3300049581 Ga0501047_0072674 Ga0501047_0072674_978_1739 245
130 3300049583 Ga0501067_0004497 Ga0501067_0004497_5133_5894 245
131 3300049584 Ga0501068_0027610 Ga0501068_0027610_1464_2225 245
132 3300049585 Ga0501069_0002920 Ga0501069_0002920_3722_4483 245
133 3300049586 Ga0501070_0032545 Ga0501070_0032545_40_801 245
134 3300049586 Ga0501070_0073895 Ga0501070_0073895_50_811 245
135 3300049588 Ga0501072_0001232 Ga0501072_0001232_5806_6567 245
136 3300049589 Ga0501073_0003698 Ga0501073_0003698_6071_6832 245
137 3300049589 Ga0501073_0092858 Ga0501073_0092858_270_1031 245
138 3300049589 Ga0501073_0287951 Ga0501073_0287951_240_1001 245
139 3300049590 Ga0501074_0115626 Ga0501074_0115626_889_1650 245
140 3300049590 Ga0501074_0135081 Ga0501074_0135081_732_1493 245
141 3300049741 Ga0501079_0042478 Ga0501079_0042478_1313_2074 245
142 3300049741 Ga0501079_0122036 Ga0501079_0122036_49_810 245
143 3300049742 Ga0501080_0095913 Ga0501080_0095913_1102_1863 245
144 3300049742 Ga0501080_0227193 Ga0501080_0227193_201_962 245
145 3300049744 Ga0501083_0000225 Ga0501083_0000225_7499_8260 245
146 3300049823 Ga0501044_0001646 Ga0501044_0001646_14600_15361 245
147 3300049823 Ga0501044_0371690 Ga0501044_0371690_83_844 245
148 3300049824 Ga0501045_0118996 Ga0501045_0118996_409_1170 245
149 3300050508 nmdc:mga09592_93885_c1 nmdc:mga09592_93885_c1_418_1158 245
150 3300050511 nmdc:mga08y16_287981_c1 nmdc:mga08y16_287981_c1_348_1088 245
151 3300054114 Ga0501084_0210351 Ga0501084_0210351_850_1611 245
152 3300060353 Ga0501082_0238714 Ga0501082_0238714_555_1316 245
153 3300002773 JGI25152J39213_1002252 JGI25152J39213_10022527 246
154 3300005841 Ga0068863_100053186 Ga0068863_1000531862 246
155 3300005842 Ga0068858_100117829 Ga0068858_1001178293 246
156 3300006846 Ga0075430_100061388 Ga0075430_1000613883 246
157 3300006880 Ga0075429_100018264 Ga0075429_1000182643 246
158 3300026088 Ga0207641_10030081 Ga0207641_100300816 246
159 3300031824 Ga0307413_10060324 Ga0307413_100603243 246
160 3300044712 Ga0453684_0216116 Ga0453684_0216116_76_831 246
161 3300050508 nmdc:mga09592_568_c1 nmdc:mga09592_568_c1_1370_2119 246
162 3300050509 nmdc:mga0qj67_25480_c1 nmdc:mga0qj67_25480_c1_2605_3354 246
163 iso_pu_bacteria 639633007 639789100 246
164 3300002738 JGI25154J39366_1001879 JGI25154J39366_10018797 247
165 3300003771 Ga0055526_1000096 Ga0055526_100009634 247
166 3300005983 Ga0081540_1002130 Ga0081540_10021307 247
167 3300013296 Ga0157374_10376486 Ga0157374_103764862 247
168 3300013306 Ga0163162_10224765 Ga0163162_102247651 247
169 3300014969 Ga0157376_10310690 Ga0157376_103106903 247
170 3300026116 Ga0207674_10092754 Ga0207674_100927542 247
171 3300031239 Ga0265328_10044255 Ga0265328_100442554 247
172 3300041451 Ga0451791_0417054 Ga0451791_0417054_202_954 247
173 3300041460 Ga0451802_1053210 Ga0451802_1053210_2054_2806 247
174 3300041512 Ga0451853_1117054 Ga0451853_1117054_1317_2069 247
175 3300041512 Ga0451853_1932253 Ga0451853_1932253_69_827 247
176 3300046460 Ga0495638_0000058 Ga0495638_0000058_147226_148011 247
177 3300046512 Ga0495610_0001937 Ga0495610_0001937_13148_13930 247
178 3300046522 Ga0495643_0000420 Ga0495643_0000420_40616_41398 247
179 3300046524 Ga0495648_0037193 Ga0495648_0037193_1795_2577 247
180 3300046538 Ga0495609_0026658 Ga0495609_0026658_1171_1953 247
181 3300046542 Ga0495597_0000445 Ga0495597_0000445_20510_21292 247
182 3300046558 Ga0495633_0001876 Ga0495633_0001876_4310_5116 247
183 3300046694 Ga0495649_0001668 Ga0495649_0001668_5591_6373 247
184 3300047320 Ga0495672_0000483 Ga0495672_0000483_14337_15119 247
185 3300047443 Ga0495687_000317 Ga0495687_000317_30948_31733 247
186 3300048906 Ga0496103_0006595 Ga0496103_0006595_439_1197 247
187 3300048918 Ga0496115_0000293 Ga0496115_0000293_4573_5331 247
188 3300048920 Ga0496117_0100838 Ga0496117_0100838_568_1326 247
189 3300048921 Ga0496118_0009467 Ga0496118_0009467_1636_2394 247
190 3300048927 Ga0496124_0002427 Ga0496124_0002427_23553_24407 247
191 3300048928 Ga0496125_0009742 Ga0496125_0009742_629_1483 247
192 3300048929 Ga0496126_0000057 Ga0496126_0000057_149958_150716 247
193 3300049459 Ga0495678_000347 Ga0495678_000347_14517_15299 247
194 3300053093 Ga0500651_0010117 Ga0500651_0010117_3569_4327 247
195 iso_pu_bacteria 2537561836 2538834053 247
196 iso_pu_bacteria 2643221562 2643830715 247
197 iso_pu_bacteria 2643221577 2643894085 247
198 iso_pu_bacteria 2643221685 2644476274 247
199 iso_pu_bacteria 2687453130 2687582856 247
200 iso_pu_bacteria 2739367700 2739731749 247
201 iso_pu_bacteria 2747842501 2748015668 247
202 iso_pu_bacteria 2884411467 2884414077 247
203 iso_pu_bacteria 2895395659 2895396710 247
204 iso_pu_bacteria 2919085039 2919085590 247
205 iso_pu_bacteria 2928963466 2928967346 247
206 iso_pu_bacteria 2939611941 2939614502 247
207 3300003771 Ga0055526_1001604 Ga0055526_10016048 248
208 3300005329 Ga0070683_100091824 Ga0070683_1000918244 248
209 3300005338 Ga0068868_100074319 Ga0068868_1000743191 248
210 3300005530 Ga0070679_100077287 Ga0070679_1000772872 248
211 3300005530 Ga0070679_100302295 Ga0070679_1003022953 248
212 3300014326 Ga0157380_10127818 Ga0157380_101278183 248
213 3300028794 Ga0307515_10088808 Ga0307515_100888084 248
214 3300031507 Ga0307509_10000138 Ga0307509_1000013871 248
215 3300031711 Ga0265314_10034269 Ga0265314_100342695 248
216 3300032002 Ga0307416_100178554 Ga0307416_1001785544 248
217 3300033541 Ga0316596_1000148 Ga0316596_100014810 248
218 3300036712 Ga0316584_0461025 Ga0316584_0461025_120_866 248
219 3300038443 Ga0395901_0096876 Ga0395901_0096876_149_898 248
220 3300041404 Ga0439436_0040842 Ga0439436_0040842_210_959 248
221 3300041997 Ga0439431_0034331 Ga0439431_0034331_468_1217 248
222 3300042007 Ga0439449_0025587 Ga0439449_0025587_124_873 248
223 3300044656 Ga0466969_0052049 Ga0466969_0052049_858_1613 248
224 3300044683 Ga0466965_0030627 Ga0466965_0030627_1436_2191 248
225 3300044684 Ga0466966_0097134 Ga0466966_0097134_626_1381 248
226 3300044712 Ga0453684_0003957 Ga0453684_0003957_4827_5576 248
227 3300044842 Ga0466957_0054609 Ga0466957_0054609_1551_2306 248
228 3300045049 Ga0466959_0096720 Ga0466959_0096720_837_1592 248
229 3300045976 Ga0466967_0296892 Ga0466967_0296892_363_1112 248
230 3300048908 Ga0496105_0348013 Ga0496105_0348013_178_969 248
231 3300048917 Ga0496114_0280556 Ga0496114_0280556_22_861 248
232 3300061719 Ga0466962_0022735 Ga0466962_0022735_1228_1983 248
233 3300005334 Ga0068869_100102689 Ga0068869_1001026893 249
234 3300005367 Ga0070667_100001757 Ga0070667_1000017575 249
235 3300005455 Ga0070663_100001061 Ga0070663_10000106110 249
236 3300005539 Ga0068853_100052054 Ga0068853_1000520542 249
237 3300005548 Ga0070665_100021003 Ga0070665_1000210034 249
238 3300005563 Ga0068855_100020683 Ga0068855_1000206838 249
239 3300005577 Ga0068857_100087856 Ga0068857_1000878562 249
240 3300005841 Ga0068863_100011269 Ga0068863_1000112698 249
241 3300009098 Ga0105245_10073921 Ga0105245_100739216 249
242 3300009174 Ga0105241_10097513 Ga0105241_100975133 249
243 3300009177 Ga0105248_10002035 Ga0105248_100020355 249
244 3300009545 Ga0105237_10021706 Ga0105237_100217064 249
245 3300009553 Ga0105249_10002169 Ga0105249_1000216912 249
246 3300010375 Ga0105239_10002329 Ga0105239_100023297 249
247 3300010375 Ga0105239_10018736 Ga0105239_100187363 249
248 3300014325 Ga0163163_10000970 Ga0163163_100009709 249
249 3300025303 Ga0209051_1006850 Ga0209051_10068504 249
250 3300025903 Ga0207680_10000892 Ga0207680_100008926 249
251 3300025911 Ga0207654_10141697 Ga0207654_101416973 249
252 3300025913 Ga0207695_10233888 Ga0207695_102338882 249
253 3300025914 Ga0207671_10038159 Ga0207671_100381595 249
254 3300025927 Ga0207687_10048905 Ga0207687_100489053 249
255 3300025932 Ga0207690_10262864 Ga0207690_102628642 249
256 3300025941 Ga0207711_10053220 Ga0207711_100532202 249
257 3300025942 Ga0207689_10656351 Ga0207689_106563511 249
258 3300025949 Ga0207667_10115267 Ga0207667_101152673 249
259 3300025961 Ga0207712_10000677 Ga0207712_100006774 249
260 3300025986 Ga0207658_10001333 Ga0207658_100013335 249
261 3300026041 Ga0207639_10001096 Ga0207639_1000109610 249
262 3300026041 Ga0207639_10008230 Ga0207639_100082306 249
263 3300026041 Ga0207639_10197062 Ga0207639_101970622 249
264 3300026067 Ga0207678_10003102 Ga0207678_100031025 249
265 3300026067 Ga0207678_10200199 Ga0207678_102001992 249
266 3300026088 Ga0207641_10089759 Ga0207641_100897594 249
267 3300026116 Ga0207674_10104787 Ga0207674_101047872 249
268 3300026142 Ga0207698_10959975 Ga0207698_109599751 249
269 3300028379 Ga0268266_10466868 Ga0268266_104668682 249
270 3300030731 Ga0316177_1024630 Ga0316177_10246302 249
271 3300030736 Ga0316180_1144547 Ga0316180_11445474 249
272 3300030745 Ga0316182_1010238 Ga0316182_10102382 249
273 3300044712 Ga0453684_0044943 Ga0453684_0044943_4981_5730 249
274 3300047472 Ga0495686_0017603 Ga0495686_0017603_2877_3641 249
275 3300048925 Ga0496122_0038152 Ga0496122_0038152_742_1506 249
276 3300048926 Ga0496123_0001240 Ga0496123_0001240_33935_34699 249
277 3300049569 Ga0501032_0000994 Ga0501032_0000994_929_1690 249
278 3300049570 Ga0501033_0008456 Ga0501033_0008456_6279_7040 249
279 3300049571 Ga0501034_0001262 Ga0501034_0001262_21130_21891 249
280 3300049572 Ga0501036_0020650 Ga0501036_0020650_3688_4449 249
281 3300049573 Ga0501037_0050867 Ga0501037_0050867_1328_2089 249
282 3300049574 Ga0501038_0003208 Ga0501038_0003208_4029_4790 249
283 3300049575 Ga0501039_0089749 Ga0501039_0089749_861_1622 249
284 3300049579 Ga0501043_0001679 Ga0501043_0001679_5902_6663 249
285 3300049580 Ga0501046_0001275 Ga0501046_0001275_11087_11848 249
286 3300049581 Ga0501047_0015182 Ga0501047_0015182_801_1562 249
287 3300049586 Ga0501070_0093200 Ga0501070_0093200_176_937 249
288 3300049589 Ga0501073_0010811 Ga0501073_0010811_543_1304 249
289 3300049823 Ga0501044_0001236 Ga0501044_0001236_12432_13193 249
290 3300053087 Ga0500643_005125 Ga0500643_005125_987_1751 249
291 iso_pu_bacteria 2891633521 2891636343 249
292 3300005329 Ga0070683_100601474 Ga0070683_1006014742 250
293 3300005335 Ga0070666_10000139 Ga0070666_1000013936 250
294 3300025916 Ga0207663_10491918 Ga0207663_104919181 250
295 3300031824 Ga0307413_10108800 Ga0307413_101088003 250
296 3300035086 Ga0373934_0148399 Ga0373934_0148399_134_904 250
297 3300035089 Ga0373944_0001829 Ga0373944_0001829_3169_3939 250
298 3300036401 Ga0373937_0767201 Ga0373937_0767201_71_841 250
299 3300037068 Ga0373925_0287663 Ga0373925_0287663_323_1093 250
300 3300041459 Ga0451800_0794950 Ga0451800_0794950_719_1471 250
301 3300041512 Ga0451853_3149850 Ga0451853_3149850_666_1418 250
302 3300046531 Ga0495665_0138228 Ga0495665_0138228_87_857 250
303 3300046683 Ga0495658_0023452 Ga0495658_0023452_1768_2538 250
304 3300047471 Ga0495684_0065199 Ga0495684_0065199_777_1547 250
305 3300053094 Ga0500566_0206585 Ga0500566_0206585_123_893 250
306 3300002705 JGI25156J39149_1000899 JGI25156J39149_10008999 251
307 3300002737 JGI25162J39368_1000068 JGI25162J39368_100006818 251
308 3300002737 JGI25162J39368_1000529 JGI25162J39368_10005294 251
309 3300002737 JGI25162J39368_1001106 JGI25162J39368_100110617 251
310 3300002737 JGI25162J39368_1001478 JGI25162J39368_10014787 251
311 3300002738 JGI25154J39366_1010050 JGI25154J39366_10100502 251
312 3300002738 JGI25154J39366_1010317 JGI25154J39366_10103172 251
313 3300002741 JGI25157J39369_1000503 JGI25157J39369_100050315 251
314 3300002741 JGI25157J39369_1000649 JGI25157J39369_100064910 251
315 3300002741 JGI25157J39369_1001287 JGI25157J39369_100128711 251
316 3300002772 JGI25164J39214_1000102 JGI25164J39214_100010220 251
317 3300002772 JGI25164J39214_1000142 JGI25164J39214_100014224 251
318 3300002772 JGI25164J39214_1000366 JGI25164J39214_10003667 251
319 3300003214 JGI25165J46597_1000058 JGI25165J46597_1000058140 251
320 3300003214 JGI25165J46597_1000090 JGI25165J46597_100009030 251
321 3300003214 JGI25165J46597_1000405 JGI25165J46597_100040541 251
322 3300003320 rootH2_10011619 rootH2_100116194 251
323 3300003323 rootH1_10137617 rootH1_101376172 251
324 3300003751 Ga0055538_1002179 Ga0055538_10021792 251
325 3300003752 Ga0055539_1002596 Ga0055539_10025962 251
326 3300003759 Ga0055525_1000282 Ga0055525_100028243 251
327 3300003760 Ga0055527_1000105 Ga0055527_100010537 251
328 3300003760 Ga0055527_1000630 Ga0055527_10006305 251
329 3300003761 Ga0055535_1000034 Ga0055535_100003477 251
330 3300003761 Ga0055535_1000150 Ga0055535_100015033 251
331 3300003761 Ga0055535_1000765 Ga0055535_100076510 251
332 3300003761 Ga0055535_1001421 Ga0055535_10014217 251
333 3300003762 Ga0055542_1000081 Ga0055542_100008118 251
334 3300003762 Ga0055542_1000112 Ga0055542_100011217 251
335 3300003762 Ga0055542_1000198 Ga0055542_100019837 251
336 3300003762 Ga0055542_1000685 Ga0055542_100068524 251
337 3300003762 Ga0055542_1001350 Ga0055542_100135010 251
338 3300003762 Ga0055542_1001389 Ga0055542_10013897 251
339 3300003763 Ga0055529_1000083 Ga0055529_1000083141 251
340 3300003763 Ga0055529_1000305 Ga0055529_100030555 251
341 3300003763 Ga0055529_1000343 Ga0055529_100034319 251
342 3300003763 Ga0055529_1001168 Ga0055529_100116811 251
343 3300005327 Ga0070658_10004472 Ga0070658_1000447215 251
344 3300005327 Ga0070658_10014082 Ga0070658_100140825 251
345 3300005327 Ga0070658_10174126 Ga0070658_101741263 251
346 3300005328 Ga0070676_10024456 Ga0070676_100244565 251
347 3300005331 Ga0070670_100317729 Ga0070670_1003177292 251
348 3300005334 Ga0068869_100210437 Ga0068869_1002104373 251
349 3300005335 Ga0070666_10000005 Ga0070666_10000005230 251
350 3300005335 Ga0070666_10393476 Ga0070666_103934761 251
351 3300005336 Ga0070680_100180304 Ga0070680_1001803043 251
352 3300005338 Ga0068868_100045123 Ga0068868_1000451234 251
353 3300005340 Ga0070689_100009283 Ga0070689_1000092837 251
354 3300005340 Ga0070689_100488236 Ga0070689_1004882362 251
355 3300005344 Ga0070661_100015169 Ga0070661_1000151692 251
356 3300005344 Ga0070661_100044109 Ga0070661_1000441093 251
357 3300005345 Ga0070692_10020685 Ga0070692_100206853 251
358 3300005345 Ga0070692_10059760 Ga0070692_100597603 251
359 3300005347 Ga0070668_100026666 Ga0070668_1000266665 251
360 3300005347 Ga0070668_100149973 Ga0070668_1001499733 251
361 3300005347 Ga0070668_100253299 Ga0070668_1002532992 251
362 3300005353 Ga0070669_100016493 Ga0070669_1000164935 251
363 3300005355 Ga0070671_100077210 Ga0070671_1000772103 251
364 3300005364 Ga0070673_100120549 Ga0070673_1001205493 251
365 3300005365 Ga0070688_100469755 Ga0070688_1004697551 251
366 3300005366 Ga0070659_100005821 Ga0070659_1000058214 251
367 3300005366 Ga0070659_100071149 Ga0070659_1000711494 251
368 3300005367 Ga0070667_100018857 Ga0070667_1000188576 251
369 3300005367 Ga0070667_100024951 Ga0070667_1000249513 251
370 3300005367 Ga0070667_100043858 Ga0070667_1000438584 251
371 3300005367 Ga0070667_100280190 Ga0070667_1002801902 251
372 3300005367 Ga0070667_100337760 Ga0070667_1003377601 251
373 3300005435 Ga0070714_100000939 Ga0070714_10000093914 251
374 3300005435 Ga0070714_100007346 Ga0070714_1000073464 251
375 3300005436 Ga0070713_100002465 Ga0070713_1000024657 251
376 3300005439 Ga0070711_100032343 Ga0070711_1000323434 251
377 3300005455 Ga0070663_100001649 Ga0070663_1000016498 251
378 3300005456 Ga0070678_100050056 Ga0070678_1000500563 251
379 3300005456 Ga0070678_100154575 Ga0070678_1001545753 251
380 3300005457 Ga0070662_100034892 Ga0070662_1000348924 251
381 3300005457 Ga0070662_100149260 Ga0070662_1001492604 251
382 3300005458 Ga0070681_10003155 Ga0070681_100031553 251
383 3300005458 Ga0070681_10024225 Ga0070681_100242255 251
384 3300005458 Ga0070681_10074309 Ga0070681_100743094 251
385 3300005458 Ga0070681_10418641 Ga0070681_104186412 251
386 3300005458 Ga0070681_10585883 Ga0070681_105858832 251
387 3300005459 Ga0068867_100191650 Ga0068867_1001916502 251
388 3300005459 Ga0068867_100233942 Ga0068867_1002339422 251
389 3300005466 Ga0070685_10000308 Ga0070685_1000030821 251
390 3300005466 Ga0070685_10001904 Ga0070685_100019045 251
391 3300005466 Ga0070685_10107427 Ga0070685_101074273 251
392 3300005530 Ga0070679_100088874 Ga0070679_1000888744 251
393 3300005530 Ga0070679_100344694 Ga0070679_1003446942 251
394 3300005539 Ga0068853_100021361 Ga0068853_1000213612 251
395 3300005539 Ga0068853_100111517 Ga0068853_1001115173 251
396 3300005539 Ga0068853_100193373 Ga0068853_1001933733 251
397 3300005539 Ga0068853_100446917 Ga0068853_1004469172 251
398 3300005543 Ga0070672_100034754 Ga0070672_1000347545 251
399 3300005543 Ga0070672_100098629 Ga0070672_1000986292 251
400 3300005544 Ga0070686_100133620 Ga0070686_1001336203 251
401 3300005546 Ga0070696_100008073 Ga0070696_1000080737 251
402 3300005547 Ga0070693_100020137 Ga0070693_1000201372 251
403 3300005547 Ga0070693_100035759 Ga0070693_1000357591 251
404 3300005547 Ga0070693_100188758 Ga0070693_1001887582 251
405 3300005548 Ga0070665_100000057 Ga0070665_100000057192 251
406 3300005548 Ga0070665_100000786 Ga0070665_1000007867 251
407 3300005548 Ga0070665_100016441 Ga0070665_1000164417 251
408 3300005548 Ga0070665_100053328 Ga0070665_1000533283 251
409 3300005548 Ga0070665_100054474 Ga0070665_1000544745 251
410 3300005548 Ga0070665_100100784 Ga0070665_1001007844 251
411 3300005563 Ga0068855_100072014 Ga0068855_1000720144 251
412 3300005564 Ga0070664_100373813 Ga0070664_1003738131 251
413 3300005614 Ga0068856_100002901 Ga0068856_10000290114 251
414 3300005614 Ga0068856_100194948 Ga0068856_1001949482 251
415 3300005614 Ga0068856_100244011 Ga0068856_1002440113 251
416 3300005616 Ga0068852_100007756 Ga0068852_1000077562 251
417 3300005616 Ga0068852_100037184 Ga0068852_1000371844 251
418 3300005616 Ga0068852_100092176 Ga0068852_1000921763 251
419 3300005616 Ga0068852_100210891 Ga0068852_1002108912 251
420 3300005617 Ga0068859_100012737 Ga0068859_1000127373 251
421 3300005617 Ga0068859_100607966 Ga0068859_1006079662 251
422 3300005719 Ga0068861_100047445 Ga0068861_1000474453 251
423 3300005719 Ga0068861_100371257 Ga0068861_1003712572 251
424 3300005834 Ga0068851_10011405 Ga0068851_100114054 251
425 3300005841 Ga0068863_100138343 Ga0068863_1001383433 251
426 3300005841 Ga0068863_100158018 Ga0068863_1001580183 251
427 3300005841 Ga0068863_100393411 Ga0068863_1003934112 251
428 3300005842 Ga0068858_100000799 Ga0068858_10000079919 251
429 3300005843 Ga0068860_100004414 Ga0068860_1000044145 251
430 3300005843 Ga0068860_100083730 Ga0068860_1000837302 251
431 3300005843 Ga0068860_100275915 Ga0068860_1002759152 251
432 3300005844 Ga0068862_100000354 Ga0068862_10000035423 251
433 3300005937 Ga0081455_10222099 Ga0081455_102220993 251
434 3300006175 Ga0070712_100414713 Ga0070712_1004147132 251
435 3300006186 Ga0075369_10015806 Ga0075369_100158063 251
436 3300006237 Ga0097621_100059618 Ga0097621_1000596184 251
437 3300006358 Ga0068871_100068577 Ga0068871_1000685772 251
438 3300006358 Ga0068871_100118007 Ga0068871_1001180072 251
439 3300006881 Ga0068865_100020670 Ga0068865_1000206705 251
440 3300006881 Ga0068865_100026562 Ga0068865_1000265624 251
441 3300006881 Ga0068865_100056814 Ga0068865_1000568142 251
442 3300006881 Ga0068865_100291414 Ga0068865_1002914141 251
443 3300006881 Ga0068865_100428952 Ga0068865_1004289523 251
444 3300006931 Ga0097620_100012737 Ga0097620_1000127373 251
445 3300006931 Ga0097620_100608063 Ga0097620_1006080633 251
446 3300009093 Ga0105240_10001717 Ga0105240_1000171729 251
447 3300009093 Ga0105240_10013812 Ga0105240_100138126 251
448 3300009093 Ga0105240_10014038 Ga0105240_100140385 251
449 3300009093 Ga0105240_10068714 Ga0105240_100687145 251
450 3300009098 Ga0105245_10123332 Ga0105245_101233324 251
451 3300009174 Ga0105241_10065438 Ga0105241_100654381 251
452 3300009176 Ga0105242_10014282 Ga0105242_100142827 251
453 3300009177 Ga0105248_10121135 Ga0105248_101211353 251
454 3300009177 Ga0105248_10187894 Ga0105248_101878943 251
455 3300009177 Ga0105248_10471252 Ga0105248_104712523 251
456 3300009177 Ga0105248_10566420 Ga0105248_105664202 251
457 3300009545 Ga0105237_10011644 Ga0105237_100116449 251
458 3300009545 Ga0105237_10059162 Ga0105237_100591623 251
459 3300009551 Ga0105238_10000060 Ga0105238_10000060110 251
460 3300009551 Ga0105238_10002702 Ga0105238_100027029 251
461 3300009551 Ga0105238_10010019 Ga0105238_100100196 251
462 3300009551 Ga0105238_10014943 Ga0105238_100149434 251
463 3300009551 Ga0105238_10035037 Ga0105238_100350374 251
464 3300009551 Ga0105238_10075221 Ga0105238_100752215 251
465 3300009551 Ga0105238_10119806 Ga0105238_101198062 251
466 3300009551 Ga0105238_10546496 Ga0105238_105464961 251
467 3300009553 Ga0105249_10002972 Ga0105249_100029729 251
468 3300009553 Ga0105249_10064839 Ga0105249_100648394 251
469 3300010375 Ga0105239_10000044 Ga0105239_1000004485 251
470 3300010375 Ga0105239_10052378 Ga0105239_100523783 251
471 3300013100 Ga0157373_10027152 Ga0157373_100271524 251
472 3300013100 Ga0157373_10084842 Ga0157373_100848421 251
473 3300013100 Ga0157373_10157281 Ga0157373_101572813 251
474 3300013100 Ga0157373_10238940 Ga0157373_102389403 251
475 3300013102 Ga0157371_10031728 Ga0157371_100317282 251
476 3300013102 Ga0157371_10138140 Ga0157371_101381402 251
477 3300013104 Ga0157370_10001227 Ga0157370_1000122712 251
478 3300013104 Ga0157370_10005668 Ga0157370_100056684 251
479 3300013104 Ga0157370_10038481 Ga0157370_100384814 251
480 3300013104 Ga0157370_10319581 Ga0157370_103195813 251
481 3300013104 Ga0157370_10450822 Ga0157370_104508223 251
482 3300013105 Ga0157369_10000097 Ga0157369_1000009710 251
483 3300013297 Ga0157378_10867206 Ga0157378_108672061 251
484 3300013306 Ga0163162_10000016 Ga0163162_10000016183 251
485 3300013306 Ga0163162_10020407 Ga0163162_100204076 251
486 3300013306 Ga0163162_10040638 Ga0163162_100406385 251
487 3300013306 Ga0163162_10124268 Ga0163162_101242684 251
488 3300013307 Ga0157372_10005441 Ga0157372_100054414 251
489 3300013307 Ga0157372_10027676 Ga0157372_100276767 251
490 3300013307 Ga0157372_10156970 Ga0157372_101569704 251
491 3300013307 Ga0157372_10290687 Ga0157372_102906873 251
492 3300013308 Ga0157375_10000867 Ga0157375_1000086719 251
493 3300013308 Ga0157375_10380330 Ga0157375_103803303 251
494 3300014325 Ga0163163_10234627 Ga0163163_102346273 251
495 3300014968 Ga0157379_10143915 Ga0157379_101439152 251
496 3300014969 Ga0157376_10008311 Ga0157376_100083115 251
497 3300014969 Ga0157376_10015545 Ga0157376_100155454 251
498 3300014969 Ga0157376_10076148 Ga0157376_100761483 251
499 3300015261 Ga0182006_1096392 Ga0182006_10963921 251
500 3300015687 Ga0183368_1003 Ga0183368_1003987 251
501 3300017792 Ga0163161_10328668 Ga0163161_103286683 251
502 3300020082 Ga0206353_10652245 Ga0206353_106522453 251
503 3300025206 Ga0209435_113829 Ga0209435_1138291 251
504 3300025207 Ga0209760_100462 Ga0209760_1004627 251
505 3300025224 Ga0209784_100016 Ga0209784_100016377 251
506 3300025226 Ga0209674_100012 Ga0209674_100012733 251
507 3300025226 Ga0209674_100244 Ga0209674_10024413 251
508 3300025226 Ga0209674_100318 Ga0209674_10031812 251
509 3300025226 Ga0209674_102989 Ga0209674_1029894 251
510 3300025228 Ga0209672_100007 Ga0209672_100007129 251
511 3300025228 Ga0209672_100016 Ga0209672_100016444 251
512 3300025228 Ga0209672_100078 Ga0209672_100078121 251
513 3300025228 Ga0209672_100673 Ga0209672_10067320 251
514 3300025228 Ga0209672_100845 Ga0209672_1008452 251
515 3300025230 Ga0209563_100169 Ga0209563_1001695 251
516 3300025231 Ga0207427_100019 Ga0207427_10001937 251
517 3300025231 Ga0207427_100033 Ga0207427_100033177 251
518 3300025231 Ga0207427_100123 Ga0207427_10012340 251
519 3300025233 Ga0209437_100012 Ga0209437_100012206 251
520 3300025233 Ga0209437_100105 Ga0209437_10010575 251
521 3300025233 Ga0209437_100192 Ga0209437_100192108 251
522 3300025233 Ga0209437_100227 Ga0209437_10022756 251
523 3300025242 Ga0209258_100012 Ga0209258_100012581 251
524 3300025242 Ga0209258_100039 Ga0209258_100039383 251
525 3300025242 Ga0209258_100046 Ga0209258_100046208 251
526 3300025242 Ga0209258_100095 Ga0209258_100095123 251
527 3300025242 Ga0209258_100308 Ga0209258_10030844 251
528 3300025242 Ga0209258_101017 Ga0209258_1010177 251
529 3300025246 Ga0209646_1000307 Ga0209646_100030742 251
530 3300025246 Ga0209646_1000581 Ga0209646_100058113 251
531 3300025250 Ga0209026_1000012 Ga0209026_1000012109 251
532 3300025250 Ga0209026_1000140 Ga0209026_100014072 251
533 3300025250 Ga0209026_1000249 Ga0209026_100024943 251
534 3300025250 Ga0209026_1000623 Ga0209026_100062320 251
535 3300025250 Ga0209026_1005476 Ga0209026_10054763 251
536 3300025253 Ga0209677_105627 Ga0209677_1056274 251
537 3300025254 Ga0209148_1000001 Ga0209148_10000011648 251
538 3300025254 Ga0209148_1000005 Ga0209148_1000005711 251
539 3300025254 Ga0209148_1000014 Ga0209148_100001475 251
540 3300025254 Ga0209148_1000039 Ga0209148_1000039335 251
541 3300025254 Ga0209148_1000087 Ga0209148_1000087138 251
542 3300025254 Ga0209148_1000098 Ga0209148_100009879 251
543 3300025256 Ga0209759_1000750 Ga0209759_10007507 251
544 3300025256 Ga0209759_1000852 Ga0209759_100085213 251
545 3300025256 Ga0209759_1000957 Ga0209759_10009573 251
546 3300025256 Ga0209759_1005344 Ga0209759_10053443 251
547 3300025261 Ga0209233_1000002 Ga0209233_1000002584 251
548 3300025261 Ga0209233_1000080 Ga0209233_1000080177 251
549 3300025261 Ga0209233_1000283 Ga0209233_100028340 251
550 3300025272 Ga0209455_1000010 Ga0209455_1000010129 251
551 3300025272 Ga0209455_1000034 Ga0209455_1000034336 251
552 3300025272 Ga0209455_1000039 Ga0209455_1000039383 251
553 3300025272 Ga0209455_1000126 Ga0209455_100012639 251
554 3300025272 Ga0209455_1012247 Ga0209455_10122472 251
555 3300025297 Ga0209758_1054388 Ga0209758_10543882 251
556 3300025315 Ga0207697_10090836 Ga0207697_100908362 251
557 3300025321 Ga0207656_10000302 Ga0207656_100003025 251
558 3300025900 Ga0207710_10104707 Ga0207710_101047072 251
559 3300025903 Ga0207680_10000005 Ga0207680_10000005588 251
560 3300025903 Ga0207680_10002436 Ga0207680_100024363 251
561 3300025903 Ga0207680_10331950 Ga0207680_103319502 251
562 3300025904 Ga0207647_10014022 Ga0207647_100140223 251
563 3300025906 Ga0207699_10426022 Ga0207699_104260222 251
564 3300025907 Ga0207645_10019755 Ga0207645_100197553 251
565 3300025908 Ga0207643_10061333 Ga0207643_100613333 251
566 3300025912 Ga0207707_10006499 Ga0207707_100064998 251
567 3300025912 Ga0207707_10028395 Ga0207707_100283955 251
568 3300025912 Ga0207707_10070210 Ga0207707_100702103 251
569 3300025912 Ga0207707_10081282 Ga0207707_100812823 251
570 3300025912 Ga0207707_10418443 Ga0207707_104184432 251
571 3300025913 Ga0207695_10000033 Ga0207695_10000033187 251
572 3300025913 Ga0207695_10000294 Ga0207695_1000029494 251
573 3300025913 Ga0207695_10016454 Ga0207695_100164545 251
574 3300025913 Ga0207695_10049940 Ga0207695_100499402 251
575 3300025913 Ga0207695_10160462 Ga0207695_101604623 251
576 3300025913 Ga0207695_10240770 Ga0207695_102407704 251
577 3300025914 Ga0207671_10004485 Ga0207671_1000448510 251
578 3300025914 Ga0207671_10008000 Ga0207671_100080005 251
579 3300025914 Ga0207671_10099159 Ga0207671_100991592 251
580 3300025917 Ga0207660_10315276 Ga0207660_103152762 251
581 3300025919 Ga0207657_10213453 Ga0207657_102134532 251
582 3300025920 Ga0207649_10044527 Ga0207649_100445273 251
583 3300025921 Ga0207652_10048611 Ga0207652_100486115 251
584 3300025921 Ga0207652_10180745 Ga0207652_101807452 251
585 3300025923 Ga0207681_10067551 Ga0207681_100675513 251
586 3300025924 Ga0207694_10000332 Ga0207694_1000033244 251
587 3300025924 Ga0207694_10000487 Ga0207694_100004879 251
588 3300025924 Ga0207694_10001035 Ga0207694_100010357 251
589 3300025924 Ga0207694_10007924 Ga0207694_100079244 251
590 3300025924 Ga0207694_10039531 Ga0207694_100395314 251
591 3300025924 Ga0207694_10145124 Ga0207694_101451243 251
592 3300025925 Ga0207650_10055870 Ga0207650_100558702 251
593 3300025925 Ga0207650_10174958 Ga0207650_101749582 251
594 3300025928 Ga0207700_10016208 Ga0207700_100162082 251
595 3300025929 Ga0207664_10000036 Ga0207664_10000036168 251
596 3300025929 Ga0207664_10000901 Ga0207664_100009015 251
597 3300025931 Ga0207644_10061871 Ga0207644_100618713 251
598 3300025931 Ga0207644_10070309 Ga0207644_100703093 251
599 3300025932 Ga0207690_10001378 Ga0207690_100013785 251
600 3300025932 Ga0207690_10093964 Ga0207690_100939641 251
601 3300025932 Ga0207690_10106675 Ga0207690_101066752 251
602 3300025933 Ga0207706_10008621 Ga0207706_100086215 251
603 3300025934 Ga0207686_10082136 Ga0207686_100821363 251
604 3300025934 Ga0207686_10414213 Ga0207686_104142131 251
605 3300025936 Ga0207670_10002849 Ga0207670_100028497 251
606 3300025936 Ga0207670_10124769 Ga0207670_101247692 251
607 3300025938 Ga0207704_10051710 Ga0207704_100517104 251
608 3300025938 Ga0207704_10058952 Ga0207704_100589524 251
609 3300025938 Ga0207704_10111132 Ga0207704_101111321 251
610 3300025938 Ga0207704_10214075 Ga0207704_102140753 251
611 3300025938 Ga0207704_10228012 Ga0207704_102280122 251
612 3300025940 Ga0207691_10004047 Ga0207691_100040477 251
613 3300025940 Ga0207691_10141568 Ga0207691_101415682 251
614 3300025941 Ga0207711_10193280 Ga0207711_101932802 251
615 3300025942 Ga0207689_10028306 Ga0207689_100283064 251
616 3300025942 Ga0207689_10059518 Ga0207689_100595184 251
617 3300025945 Ga0207679_10233207 Ga0207679_102332072 251
618 3300025949 Ga0207667_10031186 Ga0207667_100311866 251
619 3300025949 Ga0207667_10124665 Ga0207667_101246652 251
620 3300025949 Ga0207667_10249130 Ga0207667_102491302 251
621 3300025949 Ga0207667_10376233 Ga0207667_103762332 251
622 3300025961 Ga0207712_10000288 Ga0207712_1000028836 251
623 3300025961 Ga0207712_10075447 Ga0207712_100754472 251
624 3300025972 Ga0207668_10165228 Ga0207668_101652283 251
625 3300025972 Ga0207668_10206568 Ga0207668_102065683 251
626 3300025981 Ga0207640_10101119 Ga0207640_101011193 251
627 3300025981 Ga0207640_10117064 Ga0207640_101170644 251
628 3300025986 Ga0207658_10031575 Ga0207658_100315753 251
629 3300025986 Ga0207658_10540140 Ga0207658_105401401 251
630 3300026035 Ga0207703_10001120 Ga0207703_1000112010 251
631 3300026041 Ga0207639_10002655 Ga0207639_100026555 251
632 3300026041 Ga0207639_10008066 Ga0207639_100080668 251
633 3300026041 Ga0207639_10011603 Ga0207639_100116036 251
634 3300026041 Ga0207639_10094754 Ga0207639_100947542 251
635 3300026041 Ga0207639_10532087 Ga0207639_105320871 251
636 3300026067 Ga0207678_10011976 Ga0207678_100119765 251
637 3300026067 Ga0207678_10131037 Ga0207678_101310374 251
638 3300026067 Ga0207678_10194393 Ga0207678_101943933 251
639 3300026067 Ga0207678_10693491 Ga0207678_106934911 251
640 3300026078 Ga0207702_10000340 Ga0207702_1000034041 251
641 3300026078 Ga0207702_10107722 Ga0207702_101077223 251
642 3300026078 Ga0207702_10121622 Ga0207702_101216222 251
643 3300026078 Ga0207702_10302808 Ga0207702_103028082 251
644 3300026088 Ga0207641_10120752 Ga0207641_101207523 251
645 3300026088 Ga0207641_10189016 Ga0207641_101890162 251
646 3300026088 Ga0207641_10357061 Ga0207641_103570613 251
647 3300026088 Ga0207641_10436414 Ga0207641_104364142 251
648 3300026089 Ga0207648_10048514 Ga0207648_100485141 251
649 3300026089 Ga0207648_10075262 Ga0207648_100752623 251
650 3300026089 Ga0207648_10148216 Ga0207648_101482163 251
651 3300026116 Ga0207674_10019334 Ga0207674_100193343 251
652 3300026118 Ga0207675_100069569 Ga0207675_1000695693 251
653 3300026121 Ga0207683_10174862 Ga0207683_101748623 251
654 3300026142 Ga0207698_10073753 Ga0207698_100737532 251
655 3300026142 Ga0207698_10093018 Ga0207698_100930183 251
656 3300026142 Ga0207698_10404863 Ga0207698_104048631 251
657 3300027312 Ga0209371_1000072 Ga0209371_100007262 251
658 3300028379 Ga0268266_10000001 Ga0268266_100000012844 251
659 3300028379 Ga0268266_10000004 Ga0268266_10000004943 251
660 3300028379 Ga0268266_10000006 Ga0268266_10000006128 251
661 3300028379 Ga0268266_10030884 Ga0268266_100308844 251
662 3300028379 Ga0268266_10067829 Ga0268266_100678293 251
663 3300028379 Ga0268266_10134875 Ga0268266_101348754 251
664 3300028380 Ga0268265_10000775 Ga0268265_1000077511 251
665 3300028380 Ga0268265_10152847 Ga0268265_101528472 251
666 3300028381 Ga0268264_10005953 Ga0268264_100059537 251
667 3300028381 Ga0268264_10083899 Ga0268264_100838993 251
668 3300028381 Ga0268264_10654758 Ga0268264_106547582 251
669 3300028786 Ga0307517_10148851 Ga0307517_101488512 251
670 3300030500 Ga0268256_1000065 Ga0268256_100006562 251
671 3300031616 Ga0307508_10436776 Ga0307508_104367761 251
672 3300033180 Ga0307510_10020810 Ga0307510_100208105 251
673 3300037312 Ga0395899_0000175 Ga0395899_0000175_91643_92401 251
674 3300037312 Ga0395899_0083556 Ga0395899_0083556_672_1445 251
675 3300037418 Ga0395900_0000012 Ga0395900_0000012_356979_357737 251
676 3300037418 Ga0395900_0000590 Ga0395900_0000590_14598_15353 251
677 3300037418 Ga0395900_0003017 Ga0395900_0003017_8235_8990 251
678 3300037418 Ga0395900_0113437 Ga0395900_0113437_384_1142 251
679 3300037466 Ga0395898_0000034 Ga0395898_0000034_191446_192204 251
680 3300037466 Ga0395898_0000197 Ga0395898_0000197_8887_9645 251
681 3300037466 Ga0395898_0084511 Ga0395898_0084511_1184_1957 251
682 3300037466 Ga0395898_0187964 Ga0395898_0187964_981_1736 251
683 3300037466 Ga0395898_0261181 Ga0395898_0261181_795_1553 251
684 3300037471 Ga0395905_0530847 Ga0395905_0530847_20_793 251
685 3300038443 Ga0395901_0002395 Ga0395901_0002395_8618_9376 251
686 3300038443 Ga0395901_0099480 Ga0395901_0099480_205_963 251
687 3300038443 Ga0395901_0321976 Ga0395901_0321976_301_1059 251
688 3300038443 Ga0395901_0527910 Ga0395901_0527910_28_786 251
689 3300041451 Ga0451791_0120622 Ga0451791_0120622_514_1320 251
690 3300041463 Ga0451804_0827444 Ga0451804_0827444_687_1490 251
691 3300042006 Ga0439432_033213 Ga0439432_033213_711_1469 251
692 3300044656 Ga0466969_0003088 Ga0466969_0003088_1169_1930 251
693 3300044656 Ga0466969_0006890 Ga0466969_0006890_598_1356 251
694 3300044684 Ga0466966_0089385 Ga0466966_0089385_1114_1875 251
695 3300044684 Ga0466966_0182397 Ga0466966_0182397_210_968 251
696 3300044693 Ga0466961_0009198 Ga0466961_0009198_4476_5234 251
697 3300044693 Ga0466961_0011333 Ga0466961_0011333_1683_2441 251
698 3300044693 Ga0466961_0012228 Ga0466961_0012228_1864_2625 251
699 3300044693 Ga0466961_0033217 Ga0466961_0033217_548_1306 251
700 3300044693 Ga0466961_0193868 Ga0466961_0193868_307_1065 251
701 3300044706 Ga0466964_0082481 Ga0466964_0082481_92_850 251
702 3300044719 Ga0466971_0004168 Ga0466971_0004168_4371_5129 251
703 3300044719 Ga0466971_0005065 Ga0466971_0005065_1723_2481 251
704 3300044765 Ga0466970_0001017 Ga0466970_0001017_6816_7607 251
705 3300044765 Ga0466970_0016399 Ga0466970_0016399_1241_1999 251
706 3300044765 Ga0466970_0156709 Ga0466970_0156709_307_1065 251
707 3300044842 Ga0466957_0015342 Ga0466957_0015342_1476_2234 251
708 3300045049 Ga0466959_0001920 Ga0466959_0001920_11081_11842 251
709 3300045049 Ga0466959_0019916 Ga0466959_0019916_1557_2315 251
710 3300045049 Ga0466959_0058121 Ga0466959_0058121_1639_2397 251
711 3300045049 Ga0466959_0070366 Ga0466959_0070366_1557_2315 251
712 3300045836 Ga0466958_0005201 Ga0466958_0005201_783_1541 251
713 3300045836 Ga0466958_0022314 Ga0466958_0022314_986_1744 251
714 3300045976 Ga0466967_0203723 Ga0466967_0203723_554_1330 251
715 3300046460 Ga0495638_0000159 Ga0495638_0000159_13721_14479 251
716 3300046460 Ga0495638_0000161 Ga0495638_0000161_44094_44852 251
717 3300046471 Ga0495650_0000197 Ga0495650_0000197_102916_103674 251
718 3300046471 Ga0495650_0000590 Ga0495650_0000590_10802_11557 251
719 3300046501 Ga0495607_0000508 Ga0495607_0000508_23410_24177 251
720 3300046501 Ga0495607_0041187 Ga0495607_0041187_411_1178 251
721 3300046507 Ga0495606_0000940 Ga0495606_0000940_20850_21608 251
722 3300046507 Ga0495606_0009272 Ga0495606_0009272_3362_4129 251
723 3300046533 Ga0495640_0224766 Ga0495640_0224766_247_1023 251
724 3300046660 Ga0495625_0026760 Ga0495625_0026760_3187_3945 251
725 3300046660 Ga0495625_0113192 Ga0495625_0113192_40_795 251
726 3300046683 Ga0495658_0116546 Ga0495658_0116546_691_1470 251
727 3300046694 Ga0495649_0002293 Ga0495649_0002293_7135_7893 251
728 3300047472 Ga0495686_0000175 Ga0495686_0000175_106827_107594 251
729 3300048904 Ga0496101_0025554 Ga0496101_0025554_460_1239 251
730 3300048907 Ga0496104_0000011 Ga0496104_0000011_215754_216527 251
731 3300048907 Ga0496104_0538061 Ga0496104_0538061_246_1004 251
732 3300048908 Ga0496105_0000014 Ga0496105_0000014_215781_216554 251
733 3300048908 Ga0496105_0016340 Ga0496105_0016340_1533_2291 251
734 3300048909 Ga0496106_0181925 Ga0496106_0181925_362_1120 251
735 3300048917 Ga0496114_0395867 Ga0496114_0395867_248_1024 251
736 3300048918 Ga0496115_0000025 Ga0496115_0000025_389_1147 251
737 3300048918 Ga0496115_0000974 Ga0496115_0000974_13725_14483 251
738 3300048918 Ga0496115_0022193 Ga0496115_0022193_3253_4011 251
739 3300048920 Ga0496117_0019447 Ga0496117_0019447_4795_5553 251
740 3300048920 Ga0496117_0062426 Ga0496117_0062426_316_1074 251
741 3300048921 Ga0496118_0004230 Ga0496118_0004230_15893_16651 251
742 3300048921 Ga0496118_0018702 Ga0496118_0018702_2844_3611 251
743 3300048922 Ga0496119_0001095 Ga0496119_0001095_14541_15299 251
744 3300048922 Ga0496119_0062380 Ga0496119_0062380_1406_2164 251
745 3300048923 Ga0496120_0000656 Ga0496120_0000656_49320_50078 251
746 3300048923 Ga0496120_0013968 Ga0496120_0013968_3132_3890 251
747 3300048924 Ga0496121_0009617 Ga0496121_0009617_3689_4447 251
748 3300048924 Ga0496121_0042777 Ga0496121_0042777_2347_3105 251
749 3300048924 Ga0496121_0087285 Ga0496121_0087285_545_1303 251
750 3300048924 Ga0496121_0184405 Ga0496121_0184405_492_1247 251
751 3300048929 Ga0496126_0003518 Ga0496126_0003518_9134_9892 251
752 3300048929 Ga0496126_0023183 Ga0496126_0023183_855_1613 251
753 3300048929 Ga0496126_0059039 Ga0496126_0059039_1261_2016 251
754 3300048929 Ga0496126_0114480 Ga0496126_0114480_904_1662 251
755 3300049568 Ga0501031_0018033 Ga0501031_0018033_190_966 251
756 3300049568 Ga0501031_0024897 Ga0501031_0024897_2300_3076 251
757 3300049568 Ga0501031_0046675 Ga0501031_0046675_667_1425 251
758 3300049569 Ga0501032_0007509 Ga0501032_0007509_1688_2464 251
759 3300049569 Ga0501032_0036367 Ga0501032_0036367_1116_1874 251
760 3300049569 Ga0501032_0151679 Ga0501032_0151679_210_986 251
761 3300049570 Ga0501033_0000550 Ga0501033_0000550_1435_2331 251
762 3300049570 Ga0501033_0006764 Ga0501033_0006764_5379_6155 251
763 3300049570 Ga0501033_0060705 Ga0501033_0060705_1228_1986 251
764 3300049571 Ga0501034_0002423 Ga0501034_0002423_7494_8270 251
765 3300049571 Ga0501034_0039328 Ga0501034_0039328_1037_1807 251
766 3300049572 Ga0501036_0047657 Ga0501036_0047657_1938_2714 251
767 3300049572 Ga0501036_0117080 Ga0501036_0117080_454_1230 251
768 3300049573 Ga0501037_0010539 Ga0501037_0010539_3212_3988 251
769 3300049573 Ga0501037_0069638 Ga0501037_0069638_1101_1877 251
770 3300049573 Ga0501037_0101647 Ga0501037_0101647_57_815 251
771 3300049574 Ga0501038_0016661 Ga0501038_0016661_2280_3056 251
772 3300049574 Ga0501038_0033729 Ga0501038_0033729_882_1658 251
773 3300049574 Ga0501038_0120395 Ga0501038_0120395_1210_1986 251
774 3300049574 Ga0501038_0180829 Ga0501038_0180829_796_1554 251
775 3300049574 Ga0501038_0304105 Ga0501038_0304105_290_1060 251
776 3300049575 Ga0501039_0003438 Ga0501039_0003438_5899_6675 251
777 3300049575 Ga0501039_0111912 Ga0501039_0111912_473_1231 251
778 3300049578 Ga0501042_0032210 Ga0501042_0032210_2545_3303 251
779 3300049578 Ga0501042_0177115 Ga0501042_0177115_541_1317 251
780 3300049579 Ga0501043_0022649 Ga0501043_0022649_1348_2124 251
781 3300049579 Ga0501043_0078288 Ga0501043_0078288_655_1413 251
782 3300049580 Ga0501046_0026065 Ga0501046_0026065_2452_3228 251
783 3300049580 Ga0501046_0051077 Ga0501046_0051077_401_1177 251
784 3300049580 Ga0501046_0104255 Ga0501046_0104255_989_1747 251
785 3300049581 Ga0501047_0016313 Ga0501047_0016313_5125_5901 251
786 3300049581 Ga0501047_0046648 Ga0501047_0046648_1248_2006 251
787 3300049581 Ga0501047_0156480 Ga0501047_0156480_36_812 251
788 3300049581 Ga0501047_0266593 Ga0501047_0266593_718_1494 251
789 3300049583 Ga0501067_0027913 Ga0501067_0027913_1077_1853 251
790 3300049584 Ga0501068_0023128 Ga0501068_0023128_1315_2091 251
791 3300049586 Ga0501070_0010811 Ga0501070_0010811_2946_3722 251
792 3300049586 Ga0501070_0081453 Ga0501070_0081453_1269_2027 251
793 3300049587 Ga0501071_0022609 Ga0501071_0022609_1071_1847 251
794 3300049588 Ga0501072_0067873 Ga0501072_0067873_1284_2060 251
795 3300049589 Ga0501073_0003183 Ga0501073_0003183_5967_6743 251
796 3300049589 Ga0501073_0124857 Ga0501073_0124857_557_1315 251
797 3300049589 Ga0501073_0240851 Ga0501073_0240851_229_1005 251
798 3300049590 Ga0501074_0272882 Ga0501074_0272882_158_934 251
799 3300049593 Ga0501077_0127499 Ga0501077_0127499_131_892 251
800 3300049742 Ga0501080_0003297 Ga0501080_0003297_12617_13393 251
801 3300049742 Ga0501080_0062906 Ga0501080_0062906_1332_2090 251
802 3300049742 Ga0501080_0135246 Ga0501080_0135246_1468_2244 251
803 3300049742 Ga0501080_0195615 Ga0501080_0195615_550_1326 251
804 3300049744 Ga0501083_0066365 Ga0501083_0066365_1148_1924 251
805 3300049822 Ga0501035_0021974 Ga0501035_0021974_3624_4400 251
806 3300049822 Ga0501035_0039997 Ga0501035_0039997_2254_3012 251
807 3300049822 Ga0501035_0084771 Ga0501035_0084771_1015_1911 251
808 3300049822 Ga0501035_0090024 Ga0501035_0090024_1716_2492 251
809 3300049822 Ga0501035_0142153 Ga0501035_0142153_347_1120 251
810 3300049822 Ga0501035_0238283 Ga0501035_0238283_535_1293 251
811 3300049823 Ga0501044_0012392 Ga0501044_0012392_4847_5623 251
812 3300049823 Ga0501044_0017345 Ga0501044_0017345_2678_3448 251
813 3300049823 Ga0501044_0096134 Ga0501044_0096134_1796_2554 251
814 3300049823 Ga0501044_0096304 Ga0501044_0096304_723_1499 251
815 3300049823 Ga0501044_0156699 Ga0501044_0156699_24_800 251
816 3300049823 Ga0501044_0242320 Ga0501044_0242320_849_1625 251
817 3300049823 Ga0501044_0260492 Ga0501044_0260492_387_1145 251
818 3300049824 Ga0501045_0131719 Ga0501045_0131719_426_1184 251
819 3300050516 nmdc:mga0sz30_10261_c1 nmdc:mga0sz30_10261_c1_1776_2543 251
820 3300053139 Ga0500568_0000145 Ga0500568_0000145_54633_55409 251
821 3300053163 Ga0500639_193770 Ga0500639_193770_48_824 251
822 3300053177 Ga0500636_0132008 Ga0500636_0132008_138_914 251
823 3300060353 Ga0501082_0015830 Ga0501082_0015830_4937_5713 251
824 3300060353 Ga0501082_0095259 Ga0501082_0095259_1522_2298 251
825 3300061719 Ga0466962_0004731 Ga0466962_0004731_2693_3451 251
826 3300061719 Ga0466962_0012527 Ga0466962_0012527_893_1654 251
827 3300001979 JGI24740J21852_10001236 JGI24740J21852_100012367 252
828 3300001989 JGI24739J22299_10000042 JGI24739J22299_1000004232 252
829 3300001989 JGI24739J22299_10000993 JGI24739J22299_100009935 252
830 3300001990 JGI24737J22298_10006310 JGI24737J22298_100063103 252
831 3300002067 JGI24735J21928_10003420 JGI24735J21928_100034204 252
832 3300002067 JGI24735J21928_10024489 JGI24735J21928_100244893 252
833 3300002773 JGI25152J39213_1028829 JGI25152J39213_10288291 252
834 3300003578 Ga0006562J51391_1073184 Ga0006562J51391_10731844 252
835 3300003578 Ga0006562J51391_1073185 Ga0006562J51391_10731854 252
836 3300005262 Ga0065165_1003057 Ga0065165_10030578 252
837 3300005455 Ga0070663_100019477 Ga0070663_1000194773 252
838 3300005457 Ga0070662_100267179 Ga0070662_1002671791 252
839 3300005577 Ga0068857_100025352 Ga0068857_1000253524 252
840 3300005616 Ga0068852_100134564 Ga0068852_1001345642 252
841 3300005834 Ga0068851_10033803 Ga0068851_100338034 252
842 3300009093 Ga0105240_10013498 Ga0105240_100134988 252
843 3300009093 Ga0105240_10761909 Ga0105240_107619092 252
844 3300009545 Ga0105237_10000023 Ga0105237_100000239 252
845 3300010375 Ga0105239_10128629 Ga0105239_101286294 252
846 3300012500 Ga0157314_1000333 Ga0157314_10003337 252
847 3300025258 Ga0209129_1007635 Ga0209129_10076352 252
848 3300025297 Ga0209758_1002406 Ga0209758_10024069 252
849 3300025297 Ga0209758_1015870 Ga0209758_10158705 252
850 3300025321 Ga0207656_10001499 Ga0207656_100014992 252
851 3300025913 Ga0207695_10001068 Ga0207695_1000106815 252
852 3300025913 Ga0207695_10002599 Ga0207695_1000259916 252
853 3300025913 Ga0207695_10041406 Ga0207695_100414063 252
854 3300025914 Ga0207671_10000020 Ga0207671_10000020226 252
855 3300025914 Ga0207671_10000033 Ga0207671_1000003329 252
856 3300025949 Ga0207667_10000130 Ga0207667_10000130114 252
857 3300025981 Ga0207640_10003468 Ga0207640_100034688 252
858 3300026035 Ga0207703_10036724 Ga0207703_100367244 252
859 3300026067 Ga0207678_10032619 Ga0207678_100326193 252
860 3300026116 Ga0207674_10000218 Ga0207674_1000021873 252
861 3300026142 Ga0207698_10005033 Ga0207698_100050334 252
862 3300037418 Ga0395900_0020607 Ga0395900_0020607_1380_2165 252
863 3300044656 Ga0466969_0042668 Ga0466969_0042668_1134_1892 252
864 3300044672 Ga0466982_0000020 Ga0466982_0000020_66600_67358 252
865 3300044683 Ga0466965_0054319 Ga0466965_0054319_304_1062 252
866 3300044706 Ga0466964_0007547 Ga0466964_0007547_1397_2155 252
867 3300044719 Ga0466971_0019375 Ga0466971_0019375_1146_1904 252
868 3300044735 Ga0466968_0010922 Ga0466968_0010922_1399_2163 252
869 3300044735 Ga0466968_0013147 Ga0466968_0013147_1161_1919 252
870 3300044765 Ga0466970_0040551 Ga0466970_0040551_221_979 252
871 3300044842 Ga0466957_0230339 Ga0466957_0230339_127_885 252
872 3300044901 Ga0466960_0006030 Ga0466960_0006030_1752_2510 252
873 3300048928 Ga0496125_0000344 Ga0496125_0000344_72204_72962 252
874 3300061719 Ga0466962_0006238 Ga0466962_0006238_2133_2891 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

45

234

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8273 14 243
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8106 14 243
1ktm-assembly1.cif.gz_A solution structure of fat domain of focal adhesion kinase 0.5615 67 183
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.5327 71 194
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.5327 63 190
ID Description Score Start End Superfamily
af_Q08CE6_110_279_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8122 57 145 1.20.140.150
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7233 60 186 1.20.120.1770
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.692 60 186 1.20.120.1770
af_Q8S8F1_85_256_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5962 6 184 1.20.120.1770
af_F1LZS9_42_166_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5868 68 174 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A558DEJ1-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein) 0.9606 11 252 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A522IJA9-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein) 0.9583 1 252 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A2V1JTV0-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein) 0.9573 12 251 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A254TKK9-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein) 0.9572 27 249 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A0J8H019-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein) 0.9558 8 246 GO:0005886
GO:0015232
GO:0017004
GO:0020037

Feature Viewer

pLDDT pTM Quality
86.96 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map