F484313
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 874 | 362 | 853 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0000550|Ga0501033_0000550_1435_2331 |
| Length | 298 |
| Sequence | MAVVRWQPWGPDPLTHGFVSPFVPSLFLVLRAGGSRRGTPGDRTLTMAKWIPLWLHRLSSPPTFYGFAGKVRPWAIGLALVLGAAALYGGLVLAPPDYQQGDDYRIIFIHVPSAWMSLFIYAVMGVAAFVALVWRIKLAEVVAMESAPVGAAFTFITLVTGSLWGERMWGTWWTWDARLTSELVLLFLYLGVIGLYHAFEDRRQGARAAAFLAIVGIVNVPIVHFSVKWWNTLHQGSTVSLFGQSHIAADMLWPLLTMMLATKCYYVASLCGRVRADLLALEGGKDWVRRIATGEAPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 3 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 4 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 5 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 6 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 7 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 8 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 9 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 10 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 11 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 12 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 13 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 14 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 15 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 16 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 17 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 18 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 19 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 23 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 24 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 25 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 26 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 27 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 28 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 30 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 31 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 32 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 33 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 34 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 226 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 227 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 233 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 240 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 241 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 242 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 243 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 249 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 257 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 263 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 264 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 265 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 266 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 267 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 268 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 269 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 274 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 309 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 310 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 311 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 312 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 313 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 314 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 315 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 316 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 353 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 354 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 357 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 358 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 361 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 362 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.14 |
| Metatranscriptomes | 0.46 |
| Isolates | 2.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.95 |
| Nodule | 0 |
| Rhizoplane | 2.4 |
| Rhizosphere | 79.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001236 | 3300001979 | Bacteria | 11564 |
| 2 | JGI24739J22299_10000042 | 3300001989 | Bacteria | 34840 |
| 3 | JGI24739J22299_10000993 | 3300001989 | Bacteria | 10563 |
| 4 | JGI24737J22298_10006310 | 3300001990 | Bacteria | 4056 |
| 5 | JGI24735J21928_10003420 | 3300002067 | Bacteria | 5412 |
| 6 | JGI24735J21928_10024489 | 3300002067 | Bacteria | 1826 |
| 7 | JGI25156J39149_1000899 | 3300002705 | Bacteria | 14621 |
| 8 | JGI25162J39368_1000068 | 3300002737 | Bacteria | 129594 |
| 9 | JGI25162J39368_1000529 | 3300002737 | Bacteria | 28464 |
| 10 | JGI25162J39368_1001106 | 3300002737 | Bacteria | 16314 |
| 11 | JGI25162J39368_1001478 | 3300002737 | Bacteria | 12327 |
| 12 | JGI25154J39366_1001879 | 3300002738 | Bacteria | 6381 |
| 13 | JGI25154J39366_1010050 | 3300002738 | Bacteria | 1136 |
| 14 | JGI25154J39366_1010317 | 3300002738 | Bacteria | 1110 |
| 15 | JGI25157J39369_1000503 | 3300002741 | Bacteria | 24065 |
| 16 | JGI25157J39369_1000649 | 3300002741 | Bacteria | 19381 |
| 17 | JGI25157J39369_1001287 | 3300002741 | Bacteria | 10064 |
| 18 | JGI25164J39214_1000102 | 3300002772 | Bacteria | 83707 |
| 19 | JGI25164J39214_1000142 | 3300002772 | Bacteria | 68956 |
| 20 | JGI25164J39214_1000366 | 3300002772 | Bacteria | 26967 |
| 21 | JGI25152J39213_1002252 | 3300002773 | Bacteria | 7451 |
| 22 | JGI25152J39213_1028829 | 3300002773 | Bacteria | 880 |
| 23 | JGI25165J46597_1000058 | 3300003214 | Bacteria | 212833 |
| 24 | JGI25165J46597_1000090 | 3300003214 | Bacteria | 168833 |
| 25 | JGI25165J46597_1000405 | 3300003214 | Bacteria | 45672 |
| 26 | rootH2_10011619 | 3300003320 | Bacteria | 16641 |
| 27 | rootH1_10137617 | 3300003323 | Bacteria | 1937 |
| 28 | Ga0006562J51391_1073184 | 3300003578 | Bacteria | 5000 |
| 29 | Ga0006562J51391_1073185 | 3300003578 | Bacteria | 4400 |
| 30 | Ga0055538_1002179 | 3300003751 | Bacteria | 3048 |
| 31 | Ga0055539_1002596 | 3300003752 | Bacteria | 2705 |
| 32 | Ga0055525_1000282 | 3300003759 | Bacteria | 46609 |
| 33 | Ga0055527_1000105 | 3300003760 | Bacteria | 60329 |
| 34 | Ga0055527_1000630 | 3300003760 | Bacteria | 11018 |
| 35 | Ga0055535_1000034 | 3300003761 | Bacteria | 181954 |
| 36 | Ga0055535_1000150 | 3300003761 | Bacteria | 74086 |
| 37 | Ga0055535_1000765 | 3300003761 | Bacteria | 23814 |
| 38 | Ga0055535_1001421 | 3300003761 | Bacteria | 12270 |
| 39 | Ga0055542_1000081 | 3300003762 | Bacteria | 129595 |
| 40 | Ga0055542_1000112 | 3300003762 | Bacteria | 107429 |
| 41 | Ga0055542_1000198 | 3300003762 | Bacteria | 74085 |
| 42 | Ga0055542_1000685 | 3300003762 | Bacteria | 26937 |
| 43 | Ga0055542_1001350 | 3300003762 | Bacteria | 12637 |
| 44 | Ga0055542_1001389 | 3300003762 | Bacteria | 12270 |
| 45 | Ga0055529_1000083 | 3300003763 | Bacteria | 146729 |
| 46 | Ga0055529_1000305 | 3300003763 | Bacteria | 56629 |
| 47 | Ga0055529_1000343 | 3300003763 | Bacteria | 51957 |
| 48 | Ga0055529_1001168 | 3300003763 | Bacteria | 10792 |
| 49 | Ga0055526_1000096 | 3300003771 | Bacteria | 80897 |
| 50 | Ga0055526_1001604 | 3300003771 | Bacteria | 15880 |
| 51 | Ga0065165_1003057 | 3300005262 | Bacteria | 12525 |
| 52 | Ga0065707_10002428 | 3300005295 | Bacteria | 4879 |
| 53 | Ga0070658_10004472 | 3300005327 | Bacteria | 11385 |
| 54 | Ga0070658_10014082 | 3300005327 | Bacteria | 6422 |
| 55 | Ga0070658_10174126 | 3300005327 | Bacteria | 1809 |
| 56 | Ga0070658_10302896 | 3300005327 | Bacteria | 1363 |
| 57 | Ga0070676_10024456 | 3300005328 | Bacteria | 3403 |
| 58 | Ga0070683_100091824 | 3300005329 | Bacteria | 2851 |
| 59 | Ga0070683_100601474 | 3300005329 | Bacteria | 1052 |
| 60 | Ga0070690_100175201 | 3300005330 | Bacteria | 1479 |
| 61 | Ga0070670_100317729 | 3300005331 | Bacteria | 1364 |
| 62 | Ga0068869_100102689 | 3300005334 | Bacteria | 2165 |
| 63 | Ga0068869_100210437 | 3300005334 | Bacteria | 1537 |
| 64 | Ga0068869_100236318 | 3300005334 | Unclassified | 1454 |
| 65 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 66 | Ga0070666_10000139 | 3300005335 | Bacteria | 50346 |
| 67 | Ga0070666_10393476 | 3300005335 | Bacteria | 996 |
| 68 | Ga0070680_100180304 | 3300005336 | Bacteria | 1779 |
| 69 | Ga0068868_100045123 | 3300005338 | Bacteria | 3448 |
| 70 | Ga0068868_100074319 | 3300005338 | Bacteria | 2714 |
| 71 | Ga0070660_100074431 | 3300005339 | Bacteria | 2657 |
| 72 | Ga0070689_100009283 | 3300005340 | Bacteria | 6969 |
| 73 | Ga0070689_100053928 | 3300005340 | Bacteria | 3113 |
| 74 | Ga0070689_100488236 | 3300005340 | Bacteria | 1053 |
| 75 | Ga0070661_100007743 | 3300005344 | Bacteria | 7415 |
| 76 | Ga0070661_100015169 | 3300005344 | Bacteria | 5437 |
| 77 | Ga0070661_100044109 | 3300005344 | Bacteria | 3257 |
| 78 | Ga0070692_10020685 | 3300005345 | Bacteria | 3192 |
| 79 | Ga0070692_10059760 | 3300005345 | Bacteria | 2004 |
| 80 | Ga0070668_100026666 | 3300005347 | Bacteria | 4386 |
| 81 | Ga0070668_100149973 | 3300005347 | Bacteria | 1885 |
| 82 | Ga0070668_100253299 | 3300005347 | Bacteria | 1462 |
| 83 | Ga0070668_100635041 | 3300005347 | Bacteria | 937 |
| 84 | Ga0070669_100016493 | 3300005353 | Bacteria | 5271 |
| 85 | Ga0070675_100169335 | 3300005354 | Bacteria | 1883 |
| 86 | Ga0070671_100077210 | 3300005355 | Bacteria | 2783 |
| 87 | Ga0070674_100817241 | 3300005356 | Bacteria | 806 |
| 88 | Ga0070673_100120549 | 3300005364 | Bacteria | 2188 |
| 89 | Ga0070688_100469755 | 3300005365 | Bacteria | 944 |
| 90 | Ga0070659_100005821 | 3300005366 | Bacteria | 8880 |
| 91 | Ga0070659_100071149 | 3300005366 | Bacteria | 2765 |
| 92 | Ga0070667_100001757 | 3300005367 | Bacteria | 19320 |
| 93 | Ga0070667_100018857 | 3300005367 | Bacteria | 5721 |
| 94 | Ga0070667_100024951 | 3300005367 | Bacteria | 4967 |
| 95 | Ga0070667_100043858 | 3300005367 | Bacteria | 3754 |
| 96 | Ga0070667_100064127 | 3300005367 | Bacteria | 3116 |
| 97 | Ga0070667_100280190 | 3300005367 | Bacteria | 1497 |
| 98 | Ga0070667_100337760 | 3300005367 | Bacteria | 1362 |
| 99 | Ga0070703_10000036 | 3300005406 | Bacteria | 65827 |
| 100 | Ga0070714_100000939 | 3300005435 | Bacteria | 20729 |
| 101 | Ga0070714_100007346 | 3300005435 | Bacteria | 8570 |
| 102 | Ga0070713_100002465 | 3300005436 | Bacteria | 12079 |
| 103 | Ga0070711_100032343 | 3300005439 | Bacteria | 3477 |
| 104 | Ga0070694_100005045 | 3300005444 | Bacteria | 7966 |
| 105 | Ga0070708_100247660 | 3300005445 | Bacteria | 1674 |
| 106 | Ga0070708_100253996 | 3300005445 | Bacteria | 1652 |
| 107 | Ga0070663_100001061 | 3300005455 | Bacteria | 15042 |
| 108 | Ga0070663_100001649 | 3300005455 | Bacteria | 12338 |
| 109 | Ga0070663_100019477 | 3300005455 | Bacteria | 4474 |
| 110 | Ga0070678_100050056 | 3300005456 | Bacteria | 3019 |
| 111 | Ga0070678_100154575 | 3300005456 | Bacteria | 1852 |
| 112 | Ga0070662_100034892 | 3300005457 | Bacteria | 3549 |
| 113 | Ga0070662_100149260 | 3300005457 | Bacteria | 1818 |
| 114 | Ga0070662_100219424 | 3300005457 | Bacteria | 1517 |
| 115 | Ga0070662_100267179 | 3300005457 | Bacteria | 1380 |
| 116 | Ga0070681_10000058 | 3300005458 | Bacteria | 79062 |
| 117 | Ga0070681_10003155 | 3300005458 | Bacteria | 15329 |
| 118 | Ga0070681_10024225 | 3300005458 | Bacteria | 6110 |
| 119 | Ga0070681_10074309 | 3300005458 | Bacteria | 3360 |
| 120 | Ga0070681_10418641 | 3300005458 | Bacteria | 1251 |
| 121 | Ga0070681_10585883 | 3300005458 | Bacteria | 1029 |
| 122 | Ga0068867_100191650 | 3300005459 | Bacteria | 1632 |
| 123 | Ga0068867_100233942 | 3300005459 | Bacteria | 1487 |
| 124 | Ga0070685_10000308 | 3300005466 | Bacteria | 30701 |
| 125 | Ga0070685_10001904 | 3300005466 | Bacteria | 10846 |
| 126 | Ga0070685_10107427 | 3300005466 | Bacteria | 1714 |
| 127 | Ga0070707_100081326 | 3300005468 | Bacteria | 3128 |
| 128 | Ga0070698_100271679 | 3300005471 | Bacteria | 1627 |
| 129 | Ga0070698_100379145 | 3300005471 | Unclassified | 1347 |
| 130 | Ga0070679_100077287 | 3300005530 | Bacteria | 3318 |
| 131 | Ga0070679_100088874 | 3300005530 | Bacteria | 3076 |
| 132 | Ga0070679_100302295 | 3300005530 | Bacteria | 1550 |
| 133 | Ga0070679_100344694 | 3300005530 | Bacteria | 1438 |
| 134 | Ga0070684_100012608 | 3300005535 | Bacteria | 6779 |
| 135 | Ga0068853_100003826 | 3300005539 | Bacteria | 11527 |
| 136 | Ga0068853_100021361 | 3300005539 | Bacteria | 5396 |
| 137 | Ga0068853_100052054 | 3300005539 | Bacteria | 3526 |
| 138 | Ga0068853_100111517 | 3300005539 | Bacteria | 2430 |
| 139 | Ga0068853_100193373 | 3300005539 | Bacteria | 1849 |
| 140 | Ga0068853_100446917 | 3300005539 | Bacteria | 1215 |
| 141 | Ga0070672_100034754 | 3300005543 | Bacteria | 3827 |
| 142 | Ga0070672_100098629 | 3300005543 | Bacteria | 2366 |
| 143 | Ga0070686_100133620 | 3300005544 | Bacteria | 1719 |
| 144 | Ga0070686_100136361 | 3300005544 | Bacteria | 1703 |
| 145 | Ga0070696_100001471 | 3300005546 | Bacteria | 15424 |
| 146 | Ga0070696_100008073 | 3300005546 | Bacteria | 7035 |
| 147 | Ga0070693_100020137 | 3300005547 | Bacteria | 3513 |
| 148 | Ga0070693_100035759 | 3300005547 | Bacteria | 2757 |
| 149 | Ga0070693_100188758 | 3300005547 | Bacteria | 1332 |
| 150 | Ga0070665_100000057 | 3300005548 | Bacteria | 237271 |
| 151 | Ga0070665_100000786 | 3300005548 | Bacteria | 41741 |
| 152 | Ga0070665_100016441 | 3300005548 | Bacteria | 7418 |
| 153 | Ga0070665_100021003 | 3300005548 | Bacteria | 6564 |
| 154 | Ga0070665_100053328 | 3300005548 | Bacteria | 4055 |
| 155 | Ga0070665_100054474 | 3300005548 | Bacteria | 4011 |
| 156 | Ga0070665_100100784 | 3300005548 | Bacteria | 2892 |
| 157 | Ga0070704_100032088 | 3300005549 | Bacteria | 3539 |
| 158 | Ga0068855_100020683 | 3300005563 | Bacteria | 7892 |
| 159 | Ga0068855_100030567 | 3300005563 | Bacteria | 6440 |
| 160 | Ga0068855_100072014 | 3300005563 | Bacteria | 4018 |
| 161 | Ga0070664_100373813 | 3300005564 | Bacteria | 1300 |
| 162 | Ga0068857_100025352 | 3300005577 | Bacteria | 5221 |
| 163 | Ga0068857_100075914 | 3300005577 | Bacteria | 2996 |
| 164 | Ga0068857_100087856 | 3300005577 | Bacteria | 2781 |
| 165 | Ga0068856_100002901 | 3300005614 | Bacteria | 17553 |
| 166 | Ga0068856_100013146 | 3300005614 | Bacteria | 8020 |
| 167 | Ga0068856_100194948 | 3300005614 | Bacteria | 2040 |
| 168 | Ga0068856_100244011 | 3300005614 | Bacteria | 1811 |
| 169 | Ga0068852_100007756 | 3300005616 | Bacteria | 7855 |
| 170 | Ga0068852_100037184 | 3300005616 | Bacteria | 4079 |
| 171 | Ga0068852_100092176 | 3300005616 | Bacteria | 2713 |
| 172 | Ga0068852_100134564 | 3300005616 | Bacteria | 2281 |
| 173 | Ga0068852_100210891 | 3300005616 | Bacteria | 1843 |
| 174 | Ga0068852_100356509 | 3300005616 | Bacteria | 1430 |
| 175 | Ga0068859_100012737 | 3300005617 | Bacteria | 8451 |
| 176 | Ga0068859_100013022 | 3300005617 | Bacteria | 8356 |
| 177 | Ga0068859_100166560 | 3300005617 | Bacteria | 2284 |
| 178 | Ga0068859_100607966 | 3300005617 | Bacteria | 1186 |
| 179 | Ga0068861_100047445 | 3300005719 | Bacteria | 3242 |
| 180 | Ga0068861_100371257 | 3300005719 | Bacteria | 1261 |
| 181 | Ga0068851_10011405 | 3300005834 | Bacteria | 4167 |
| 182 | Ga0068851_10033803 | 3300005834 | Bacteria | 2550 |
| 183 | Ga0068863_100011269 | 3300005841 | Bacteria | 8660 |
| 184 | Ga0068863_100053186 | 3300005841 | Bacteria | 3837 |
| 185 | Ga0068863_100138343 | 3300005841 | Bacteria | 2327 |
| 186 | Ga0068863_100158018 | 3300005841 | Bacteria | 2171 |
| 187 | Ga0068863_100393411 | 3300005841 | Bacteria | 1355 |
| 188 | Ga0068858_100000799 | 3300005842 | Bacteria | 32951 |
| 189 | Ga0068858_100117829 | 3300005842 | Bacteria | 2482 |
| 190 | Ga0068858_100397588 | 3300005842 | Unclassified | 1324 |
| 191 | Ga0068860_100004414 | 3300005843 | Bacteria | 14368 |
| 192 | Ga0068860_100083730 | 3300005843 | Bacteria | 3034 |
| 193 | Ga0068860_100275915 | 3300005843 | Bacteria | 1642 |
| 194 | Ga0068860_100489826 | 3300005843 | Bacteria | 1226 |
| 195 | Ga0068862_100000354 | 3300005844 | Bacteria | 49717 |
| 196 | Ga0068862_100033844 | 3300005844 | Bacteria | 4322 |
| 197 | Ga0081455_10222099 | 3300005937 | Bacteria | 1399 |
| 198 | Ga0081540_1002130 | 3300005983 | Bacteria | 16480 |
| 199 | Ga0070712_100414713 | 3300006175 | Bacteria | 1115 |
| 200 | Ga0075369_10015806 | 3300006186 | Bacteria | 3035 |
| 201 | Ga0097621_100059618 | 3300006237 | Bacteria | 3126 |
| 202 | Ga0068871_100068577 | 3300006358 | Bacteria | 2912 |
| 203 | Ga0068871_100118007 | 3300006358 | Bacteria | 2238 |
| 204 | Ga0075428_100034175 | 3300006844 | Bacteria | 5609 |
| 205 | Ga0075430_100061388 | 3300006846 | Bacteria | 3158 |
| 206 | Ga0075434_100000030 | 3300006871 | Bacteria | 64435 |
| 207 | Ga0075429_100018264 | 3300006880 | Bacteria | 6072 |
| 208 | Ga0068865_100020670 | 3300006881 | Bacteria | 4272 |
| 209 | Ga0068865_100026562 | 3300006881 | Bacteria | 3819 |
| 210 | Ga0068865_100056814 | 3300006881 | Bacteria | 2728 |
| 211 | Ga0068865_100291414 | 3300006881 | Bacteria | 1303 |
| 212 | Ga0068865_100428952 | 3300006881 | Bacteria | 1089 |
| 213 | Ga0097620_100012737 | 3300006931 | Bacteria | 8451 |
| 214 | Ga0097620_100013022 | 3300006931 | Bacteria | 8356 |
| 215 | Ga0097620_100166555 | 3300006931 | Bacteria | 2284 |
| 216 | Ga0097620_100608063 | 3300006931 | Bacteria | 1186 |
| 217 | Ga0075435_100002432 | 3300007076 | Bacteria | 12359 |
| 218 | Ga0105240_10001717 | 3300009093 | Bacteria | 36977 |
| 219 | Ga0105240_10013498 | 3300009093 | Bacteria | 11219 |
| 220 | Ga0105240_10013812 | 3300009093 | Bacteria | 11061 |
| 221 | Ga0105240_10014038 | 3300009093 | Bacteria | 10956 |
| 222 | Ga0105240_10032191 | 3300009093 | Bacteria | 6791 |
| 223 | Ga0105240_10068714 | 3300009093 | Bacteria | 4388 |
| 224 | Ga0105240_10141706 | 3300009093 | Bacteria | 2873 |
| 225 | Ga0105240_10761909 | 3300009093 | Bacteria | 1051 |
| 226 | Ga0105240_10911026 | 3300009093 | Bacteria | 945 |
| 227 | Ga0111539_10006818 | 3300009094 | Bacteria | 14687 |
| 228 | Ga0111539_10047083 | 3300009094 | Bacteria | 5156 |
| 229 | Ga0105245_10073921 | 3300009098 | Bacteria | 3101 |
| 230 | Ga0105245_10123332 | 3300009098 | Bacteria | 2423 |
| 231 | Ga0105243_10000357 | 3300009148 | Bacteria | 48866 |
| 232 | Ga0105241_10065438 | 3300009174 | Bacteria | 2809 |
| 233 | Ga0105241_10097513 | 3300009174 | Bacteria | 2331 |
| 234 | Ga0105241_10431087 | 3300009174 | Bacteria | 1162 |
| 235 | Ga0105242_10000916 | 3300009176 | Bacteria | 22943 |
| 236 | Ga0105242_10014282 | 3300009176 | Bacteria | 6151 |
| 237 | Ga0105248_10002035 | 3300009177 | Bacteria | 22415 |
| 238 | Ga0105248_10096988 | 3300009177 | Bacteria | 3321 |
| 239 | Ga0105248_10121135 | 3300009177 | Bacteria | 2951 |
| 240 | Ga0105248_10187894 | 3300009177 | Bacteria | 2328 |
| 241 | Ga0105248_10471252 | 3300009177 | Bacteria | 1415 |
| 242 | Ga0105248_10566420 | 3300009177 | Bacteria | 1282 |
| 243 | Ga0105237_10000023 | 3300009545 | Bacteria | 226144 |
| 244 | Ga0105237_10011644 | 3300009545 | Bacteria | 9306 |
| 245 | Ga0105237_10021706 | 3300009545 | Bacteria | 6596 |
| 246 | Ga0105237_10059162 | 3300009545 | Bacteria | 3834 |
| 247 | Ga0105237_10175091 | 3300009545 | Bacteria | 2146 |
| 248 | Ga0105238_10000060 | 3300009551 | Bacteria | 129934 |
| 249 | Ga0105238_10002702 | 3300009551 | Bacteria | 17642 |
| 250 | Ga0105238_10010019 | 3300009551 | Bacteria | 9505 |
| 251 | Ga0105238_10014943 | 3300009551 | Bacteria | 7859 |
| 252 | Ga0105238_10022955 | 3300009551 | Bacteria | 6359 |
| 253 | Ga0105238_10035037 | 3300009551 | Bacteria | 5104 |
| 254 | Ga0105238_10075221 | 3300009551 | Bacteria | 3369 |
| 255 | Ga0105238_10119806 | 3300009551 | Bacteria | 2612 |
| 256 | Ga0105238_10546496 | 3300009551 | Bacteria | 1162 |
| 257 | Ga0105249_10002169 | 3300009553 | Bacteria | 17001 |
| 258 | Ga0105249_10002972 | 3300009553 | Bacteria | 14620 |
| 259 | Ga0105249_10064839 | 3300009553 | Bacteria | 3359 |
| 260 | Ga0105249_10120212 | 3300009553 | Bacteria | 2495 |
| 261 | Ga0105239_10000044 | 3300010375 | Bacteria | 187680 |
| 262 | Ga0105239_10002329 | 3300010375 | Bacteria | 24241 |
| 263 | Ga0105239_10018736 | 3300010375 | Bacteria | 7647 |
| 264 | Ga0105239_10052378 | 3300010375 | Bacteria | 4476 |
| 265 | Ga0105239_10077614 | 3300010375 | Bacteria | 3655 |
| 266 | Ga0105239_10128629 | 3300010375 | Bacteria | 2816 |
| 267 | Ga0105239_10153558 | 3300010375 | Bacteria | 2570 |
| 268 | Ga0157314_1000333 | 3300012500 | Bacteria | 4914 |
| 269 | Ga0157373_10027152 | 3300013100 | Bacteria | 4131 |
| 270 | Ga0157373_10064953 | 3300013100 | Bacteria | 2583 |
| 271 | Ga0157373_10084842 | 3300013100 | Bacteria | 2232 |
| 272 | Ga0157373_10157281 | 3300013100 | Bacteria | 1599 |
| 273 | Ga0157373_10238940 | 3300013100 | Bacteria | 1284 |
| 274 | Ga0157371_10031728 | 3300013102 | Bacteria | 3805 |
| 275 | Ga0157371_10138140 | 3300013102 | Bacteria | 1736 |
| 276 | Ga0157370_10001227 | 3300013104 | Bacteria | 32113 |
| 277 | Ga0157370_10005668 | 3300013104 | Bacteria | 13956 |
| 278 | Ga0157370_10038481 | 3300013104 | Bacteria | 4626 |
| 279 | Ga0157370_10082858 | 3300013104 | Bacteria | 3016 |
| 280 | Ga0157370_10319581 | 3300013104 | Bacteria | 1432 |
| 281 | Ga0157370_10450822 | 3300013104 | Bacteria | 1183 |
| 282 | Ga0157369_10000097 | 3300013105 | Bacteria | 121042 |
| 283 | Ga0157369_10015187 | 3300013105 | Bacteria | 8692 |
| 284 | Ga0157374_10376486 | 3300013296 | Bacteria | 1414 |
| 285 | Ga0157378_10867206 | 3300013297 | Bacteria | 932 |
| 286 | Ga0163162_10000016 | 3300013306 | Bacteria | 250836 |
| 287 | Ga0163162_10020407 | 3300013306 | Bacteria | 6511 |
| 288 | Ga0163162_10040638 | 3300013306 | Bacteria | 4652 |
| 289 | Ga0163162_10124268 | 3300013306 | Bacteria | 2686 |
| 290 | Ga0163162_10224765 | 3300013306 | Bacteria | 2007 |
| 291 | Ga0163162_10767982 | 3300013306 | Bacteria | 1082 |
| 292 | Ga0157372_10000470 | 3300013307 | Bacteria | 44468 |
| 293 | Ga0157372_10005441 | 3300013307 | Bacteria | 13531 |
| 294 | Ga0157372_10027676 | 3300013307 | Bacteria | 6178 |
| 295 | Ga0157372_10156970 | 3300013307 | Bacteria | 2628 |
| 296 | Ga0157372_10290687 | 3300013307 | Bacteria | 1901 |
| 297 | Ga0157372_10686846 | 3300013307 | Bacteria | 1191 |
| 298 | Ga0157375_10000867 | 3300013308 | Bacteria | 26326 |
| 299 | Ga0157375_10380330 | 3300013308 | Bacteria | 1579 |
| 300 | Ga0163163_10000970 | 3300014325 | Bacteria | 24383 |
| 301 | Ga0163163_10234627 | 3300014325 | Bacteria | 1884 |
| 302 | Ga0157380_10127818 | 3300014326 | Bacteria | 2163 |
| 303 | Ga0157379_10043948 | 3300014968 | Bacteria | 3989 |
| 304 | Ga0157379_10143915 | 3300014968 | Bacteria | 2150 |
| 305 | Ga0157376_10008311 | 3300014969 | Bacteria | 7482 |
| 306 | Ga0157376_10015545 | 3300014969 | Bacteria | 5753 |
| 307 | Ga0157376_10076148 | 3300014969 | Bacteria | 2866 |
| 308 | Ga0157376_10310690 | 3300014969 | Bacteria | 1495 |
| 309 | Ga0182006_1096392 | 3300015261 | Bacteria | 1056 |
| 310 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 311 | Ga0163161_10239854 | 3300017792 | Bacteria | 1410 |
| 312 | Ga0163161_10328668 | 3300017792 | Bacteria | 1210 |
| 313 | Ga0206353_10652245 | 3300020082 | Bacteria | 1281 |
| 314 | Ga0209435_113829 | 3300025206 | Bacteria | 856 |
| 315 | Ga0209760_100462 | 3300025207 | Bacteria | 9090 |
| 316 | Ga0209784_100016 | 3300025224 | Bacteria | 481036 |
| 317 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 318 | Ga0209674_100244 | 3300025226 | Bacteria | 45968 |
| 319 | Ga0209674_100318 | 3300025226 | Bacteria | 31053 |
| 320 | Ga0209674_102989 | 3300025226 | Bacteria | 3274 |
| 321 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 322 | Ga0209672_100016 | 3300025228 | Bacteria | 522604 |
| 323 | Ga0209672_100078 | 3300025228 | Bacteria | 156926 |
| 324 | Ga0209672_100673 | 3300025228 | Bacteria | 17260 |
| 325 | Ga0209672_100845 | 3300025228 | Bacteria | 14106 |
| 326 | Ga0209563_100169 | 3300025230 | Bacteria | 46948 |
| 327 | Ga0207427_100019 | 3300025231 | Bacteria | 513977 |
| 328 | Ga0207427_100033 | 3300025231 | Bacteria | 338459 |
| 329 | Ga0207427_100123 | 3300025231 | Bacteria | 98859 |
| 330 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 331 | Ga0209437_100105 | 3300025233 | Bacteria | 220034 |
| 332 | Ga0209437_100192 | 3300025233 | Bacteria | 122888 |
| 333 | Ga0209437_100227 | 3300025233 | Bacteria | 98939 |
| 334 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 335 | Ga0209258_100039 | 3300025242 | Bacteria | 386366 |
| 336 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 337 | Ga0209258_100095 | 3300025242 | Bacteria | 223270 |
| 338 | Ga0209258_100308 | 3300025242 | Bacteria | 77195 |
| 339 | Ga0209258_101017 | 3300025242 | Bacteria | 12688 |
| 340 | Ga0209646_1000307 | 3300025246 | Bacteria | 39199 |
| 341 | Ga0209646_1000581 | 3300025246 | Bacteria | 15100 |
| 342 | Ga0209026_1000012 | 3300025250 | Bacteria | 480426 |
| 343 | Ga0209026_1000140 | 3300025250 | Bacteria | 115081 |
| 344 | Ga0209026_1000249 | 3300025250 | Bacteria | 68455 |
| 345 | Ga0209026_1000623 | 3300025250 | Bacteria | 22318 |
| 346 | Ga0209026_1005476 | 3300025250 | Bacteria | 3409 |
| 347 | Ga0209677_105627 | 3300025253 | Bacteria | 3214 |
| 348 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 349 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 350 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 351 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 352 | Ga0209148_1000087 | 3300025254 | Bacteria | 260905 |
| 353 | Ga0209148_1000098 | 3300025254 | Bacteria | 233172 |
| 354 | Ga0209759_1000750 | 3300025256 | Bacteria | 28083 |
| 355 | Ga0209759_1000852 | 3300025256 | Bacteria | 23718 |
| 356 | Ga0209759_1000957 | 3300025256 | Bacteria | 20487 |
| 357 | Ga0209759_1005344 | 3300025256 | Bacteria | 4524 |
| 358 | Ga0209129_1007635 | 3300025258 | Bacteria | 3170 |
| 359 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 360 | Ga0209233_1000080 | 3300025261 | Bacteria | 338459 |
| 361 | Ga0209233_1000283 | 3300025261 | Bacteria | 70137 |
| 362 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 363 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 364 | Ga0209455_1000039 | 3300025272 | Bacteria | 437734 |
| 365 | Ga0209455_1000126 | 3300025272 | Bacteria | 165771 |
| 366 | Ga0209455_1012247 | 3300025272 | Bacteria | 2064 |
| 367 | Ga0209758_1002406 | 3300025297 | Bacteria | 19172 |
| 368 | Ga0209758_1015870 | 3300025297 | Bacteria | 3868 |
| 369 | Ga0209758_1054388 | 3300025297 | Bacteria | 1368 |
| 370 | Ga0209051_1006850 | 3300025303 | Bacteria | 6340 |
| 371 | Ga0207697_10090836 | 3300025315 | Bacteria | 1294 |
| 372 | Ga0207656_10000302 | 3300025321 | Bacteria | 17096 |
| 373 | Ga0207656_10001499 | 3300025321 | Bacteria | 7733 |
| 374 | Ga0207653_10000008 | 3300025885 | Bacteria | 197323 |
| 375 | Ga0207710_10104707 | 3300025900 | Bacteria | 1338 |
| 376 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 377 | Ga0207680_10000892 | 3300025903 | Bacteria | 14088 |
| 378 | Ga0207680_10002436 | 3300025903 | Bacteria | 8677 |
| 379 | Ga0207680_10331950 | 3300025903 | Bacteria | 1065 |
| 380 | Ga0207647_10004964 | 3300025904 | Bacteria | 9808 |
| 381 | Ga0207647_10014022 | 3300025904 | Bacteria | 5546 |
| 382 | Ga0207699_10426022 | 3300025906 | Bacteria | 948 |
| 383 | Ga0207645_10019755 | 3300025907 | Bacteria | 4414 |
| 384 | Ga0207643_10061333 | 3300025908 | Bacteria | 2148 |
| 385 | Ga0207654_10014936 | 3300025911 | Bacteria | 4020 |
| 386 | Ga0207654_10100599 | 3300025911 | Bacteria | 1781 |
| 387 | Ga0207654_10141697 | 3300025911 | Bacteria | 1534 |
| 388 | Ga0207707_10000641 | 3300025912 | Bacteria | 34523 |
| 389 | Ga0207707_10006499 | 3300025912 | Bacteria | 10209 |
| 390 | Ga0207707_10028395 | 3300025912 | Bacteria | 4890 |
| 391 | Ga0207707_10070210 | 3300025912 | Bacteria | 3053 |
| 392 | Ga0207707_10081282 | 3300025912 | Bacteria | 2829 |
| 393 | Ga0207707_10418443 | 3300025912 | Bacteria | 1149 |
| 394 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 395 | Ga0207695_10000182 | 3300025913 | Bacteria | 184125 |
| 396 | Ga0207695_10000294 | 3300025913 | Bacteria | 123676 |
| 397 | Ga0207695_10001068 | 3300025913 | Bacteria | 47945 |
| 398 | Ga0207695_10002599 | 3300025913 | Bacteria | 26471 |
| 399 | Ga0207695_10016454 | 3300025913 | Bacteria | 8652 |
| 400 | Ga0207695_10041406 | 3300025913 | Bacteria | 4931 |
| 401 | Ga0207695_10049940 | 3300025913 | Bacteria | 4403 |
| 402 | Ga0207695_10160462 | 3300025913 | Bacteria | 2180 |
| 403 | Ga0207695_10233888 | 3300025913 | Bacteria | 1741 |
| 404 | Ga0207695_10240770 | 3300025913 | Bacteria | 1711 |
| 405 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 406 | Ga0207671_10000033 | 3300025914 | Bacteria | 245869 |
| 407 | Ga0207671_10004485 | 3300025914 | Bacteria | 13308 |
| 408 | Ga0207671_10005611 | 3300025914 | Bacteria | 11513 |
| 409 | Ga0207671_10008000 | 3300025914 | Bacteria | 9055 |
| 410 | Ga0207671_10038159 | 3300025914 | Bacteria | 3561 |
| 411 | Ga0207671_10099159 | 3300025914 | Bacteria | 2205 |
| 412 | Ga0207671_10193923 | 3300025914 | Bacteria | 1585 |
| 413 | Ga0207663_10491918 | 3300025916 | Bacteria | 952 |
| 414 | Ga0207660_10315276 | 3300025917 | Bacteria | 1248 |
| 415 | Ga0207657_10213453 | 3300025919 | Bacteria | 1548 |
| 416 | Ga0207649_10044527 | 3300025920 | Bacteria | 2717 |
| 417 | Ga0207652_10048611 | 3300025921 | Bacteria | 3626 |
| 418 | Ga0207652_10180745 | 3300025921 | Bacteria | 1896 |
| 419 | Ga0207646_10057903 | 3300025922 | Bacteria | 3462 |
| 420 | Ga0207681_10067551 | 3300025923 | Bacteria | 2479 |
| 421 | Ga0207694_10000332 | 3300025924 | Bacteria | 44554 |
| 422 | Ga0207694_10000487 | 3300025924 | Bacteria | 35975 |
| 423 | Ga0207694_10001035 | 3300025924 | Bacteria | 24204 |
| 424 | Ga0207694_10007924 | 3300025924 | Bacteria | 8038 |
| 425 | Ga0207694_10039531 | 3300025924 | Bacteria | 3630 |
| 426 | Ga0207694_10145124 | 3300025924 | Bacteria | 1910 |
| 427 | Ga0207650_10055870 | 3300025925 | Bacteria | 2932 |
| 428 | Ga0207650_10174958 | 3300025925 | Bacteria | 1708 |
| 429 | Ga0207659_10281151 | 3300025926 | Bacteria | 1360 |
| 430 | Ga0207687_10048905 | 3300025927 | Bacteria | 2939 |
| 431 | Ga0207700_10016208 | 3300025928 | Bacteria | 4945 |
| 432 | Ga0207664_10000036 | 3300025929 | Bacteria | 173396 |
| 433 | Ga0207664_10000901 | 3300025929 | Bacteria | 20063 |
| 434 | Ga0207644_10061871 | 3300025931 | Bacteria | 2713 |
| 435 | Ga0207644_10070309 | 3300025931 | Bacteria | 2558 |
| 436 | Ga0207690_10001378 | 3300025932 | Bacteria | 15253 |
| 437 | Ga0207690_10093964 | 3300025932 | Bacteria | 2126 |
| 438 | Ga0207690_10106675 | 3300025932 | Bacteria | 2010 |
| 439 | Ga0207690_10262864 | 3300025932 | Bacteria | 1338 |
| 440 | Ga0207706_10008621 | 3300025933 | Bacteria | 9396 |
| 441 | Ga0207706_10063947 | 3300025933 | Bacteria | 3239 |
| 442 | Ga0207686_10000170 | 3300025934 | Bacteria | 49724 |
| 443 | Ga0207686_10082136 | 3300025934 | Bacteria | 2106 |
| 444 | Ga0207686_10414213 | 3300025934 | Bacteria | 1029 |
| 445 | Ga0207709_10000091 | 3300025935 | Bacteria | 144622 |
| 446 | Ga0207670_10002849 | 3300025936 | Bacteria | 9128 |
| 447 | Ga0207670_10124769 | 3300025936 | Bacteria | 1877 |
| 448 | Ga0207669_10646639 | 3300025937 | Bacteria | 864 |
| 449 | Ga0207704_10051710 | 3300025938 | Bacteria | 2486 |
| 450 | Ga0207704_10058952 | 3300025938 | Bacteria | 2367 |
| 451 | Ga0207704_10111132 | 3300025938 | Bacteria | 1853 |
| 452 | Ga0207704_10214075 | 3300025938 | Bacteria | 1420 |
| 453 | Ga0207704_10228012 | 3300025938 | Bacteria | 1383 |
| 454 | Ga0207691_10004047 | 3300025940 | Bacteria | 14216 |
| 455 | Ga0207691_10141568 | 3300025940 | Bacteria | 2119 |
| 456 | Ga0207691_10309695 | 3300025940 | Bacteria | 1355 |
| 457 | Ga0207711_10053220 | 3300025941 | Bacteria | 3471 |
| 458 | Ga0207711_10076510 | 3300025941 | Bacteria | 2915 |
| 459 | Ga0207711_10193280 | 3300025941 | Bacteria | 1855 |
| 460 | Ga0207689_10028306 | 3300025942 | Bacteria | 4688 |
| 461 | Ga0207689_10059518 | 3300025942 | Bacteria | 3142 |
| 462 | Ga0207689_10656351 | 3300025942 | Bacteria | 884 |
| 463 | Ga0207661_10185419 | 3300025944 | Bacteria | 1820 |
| 464 | Ga0207679_10233207 | 3300025945 | Bacteria | 1555 |
| 465 | Ga0207667_10000130 | 3300025949 | Bacteria | 115321 |
| 466 | Ga0207667_10001289 | 3300025949 | Bacteria | 31377 |
| 467 | Ga0207667_10031186 | 3300025949 | Bacteria | 5756 |
| 468 | Ga0207667_10047100 | 3300025949 | Bacteria | 4564 |
| 469 | Ga0207667_10115267 | 3300025949 | Bacteria | 2769 |
| 470 | Ga0207667_10124665 | 3300025949 | Bacteria | 2653 |
| 471 | Ga0207667_10249130 | 3300025949 | Bacteria | 1817 |
| 472 | Ga0207667_10376233 | 3300025949 | Bacteria | 1447 |
| 473 | Ga0207712_10000288 | 3300025961 | Bacteria | 47902 |
| 474 | Ga0207712_10000677 | 3300025961 | Bacteria | 26367 |
| 475 | Ga0207712_10075447 | 3300025961 | Bacteria | 2437 |
| 476 | Ga0207712_10214400 | 3300025961 | Bacteria | 1535 |
| 477 | Ga0207668_10165228 | 3300025972 | Bacteria | 1729 |
| 478 | Ga0207668_10206568 | 3300025972 | Bacteria | 1568 |
| 479 | Ga0207640_10003468 | 3300025981 | Bacteria | 8492 |
| 480 | Ga0207640_10101119 | 3300025981 | Bacteria | 2022 |
| 481 | Ga0207640_10117064 | 3300025981 | Bacteria | 1901 |
| 482 | Ga0207658_10001333 | 3300025986 | Bacteria | 19334 |
| 483 | Ga0207658_10031575 | 3300025986 | Bacteria | 3763 |
| 484 | Ga0207658_10540140 | 3300025986 | Bacteria | 1042 |
| 485 | Ga0207703_10001120 | 3300026035 | Bacteria | 25309 |
| 486 | Ga0207703_10036724 | 3300026035 | Bacteria | 3901 |
| 487 | Ga0207703_10050802 | 3300026035 | Bacteria | 3358 |
| 488 | Ga0207639_10001096 | 3300026041 | Bacteria | 18406 |
| 489 | Ga0207639_10002655 | 3300026041 | Bacteria | 11998 |
| 490 | Ga0207639_10003408 | 3300026041 | Bacteria | 10693 |
| 491 | Ga0207639_10008066 | 3300026041 | Bacteria | 7199 |
| 492 | Ga0207639_10008230 | 3300026041 | Bacteria | 7141 |
| 493 | Ga0207639_10011603 | 3300026041 | Bacteria | 6122 |
| 494 | Ga0207639_10094754 | 3300026041 | Bacteria | 2397 |
| 495 | Ga0207639_10197062 | 3300026041 | Bacteria | 1724 |
| 496 | Ga0207639_10532087 | 3300026041 | Bacteria | 1077 |
| 497 | Ga0207678_10003102 | 3300026067 | Bacteria | 15050 |
| 498 | Ga0207678_10011976 | 3300026067 | Bacteria | 7617 |
| 499 | Ga0207678_10032619 | 3300026067 | Bacteria | 4539 |
| 500 | Ga0207678_10131037 | 3300026067 | Bacteria | 2139 |
| 501 | Ga0207678_10194393 | 3300026067 | Bacteria | 1734 |
| 502 | Ga0207678_10200199 | 3300026067 | Bacteria | 1707 |
| 503 | Ga0207678_10693491 | 3300026067 | Bacteria | 896 |
| 504 | Ga0207702_10000340 | 3300026078 | Bacteria | 53705 |
| 505 | Ga0207702_10029161 | 3300026078 | Bacteria | 4590 |
| 506 | Ga0207702_10053888 | 3300026078 | Bacteria | 3406 |
| 507 | Ga0207702_10106436 | 3300026078 | Bacteria | 2485 |
| 508 | Ga0207702_10107722 | 3300026078 | Bacteria | 2472 |
| 509 | Ga0207702_10121622 | 3300026078 | Bacteria | 2337 |
| 510 | Ga0207702_10302808 | 3300026078 | Bacteria | 1517 |
| 511 | Ga0207641_10030081 | 3300026088 | Bacteria | 4496 |
| 512 | Ga0207641_10089759 | 3300026088 | Bacteria | 2686 |
| 513 | Ga0207641_10120752 | 3300026088 | Bacteria | 2338 |
| 514 | Ga0207641_10189016 | 3300026088 | Bacteria | 1892 |
| 515 | Ga0207641_10357061 | 3300026088 | Bacteria | 1394 |
| 516 | Ga0207641_10436414 | 3300026088 | Bacteria | 1263 |
| 517 | Ga0207648_10048514 | 3300026089 | Bacteria | 3717 |
| 518 | Ga0207648_10075262 | 3300026089 | Bacteria | 2943 |
| 519 | Ga0207648_10148216 | 3300026089 | Bacteria | 2070 |
| 520 | Ga0207676_10700140 | 3300026095 | Bacteria | 981 |
| 521 | Ga0207674_10000218 | 3300026116 | Bacteria | 71563 |
| 522 | Ga0207674_10019334 | 3300026116 | Bacteria | 7379 |
| 523 | Ga0207674_10092754 | 3300026116 | Bacteria | 3009 |
| 524 | Ga0207674_10104787 | 3300026116 | Bacteria | 2806 |
| 525 | Ga0207674_10472676 | 3300026116 | Bacteria | 1212 |
| 526 | Ga0207675_100069569 | 3300026118 | Bacteria | 3290 |
| 527 | Ga0207683_10174862 | 3300026121 | Bacteria | 1945 |
| 528 | Ga0207683_10194847 | 3300026121 | Bacteria | 1840 |
| 529 | Ga0207698_10005033 | 3300026142 | Bacteria | 8105 |
| 530 | Ga0207698_10073753 | 3300026142 | Bacteria | 2719 |
| 531 | Ga0207698_10093018 | 3300026142 | Bacteria | 2474 |
| 532 | Ga0207698_10404863 | 3300026142 | Bacteria | 1305 |
| 533 | Ga0207698_10959975 | 3300026142 | Bacteria | 864 |
| 534 | Ga0209371_1000072 | 3300027312 | Bacteria | 199942 |
| 535 | Ga0207428_10113109 | 3300027907 | Bacteria | 2087 |
| 536 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 537 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 538 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 539 | Ga0268266_10030884 | 3300028379 | Bacteria | 4550 |
| 540 | Ga0268266_10067829 | 3300028379 | Bacteria | 3088 |
| 541 | Ga0268266_10134875 | 3300028379 | Bacteria | 2210 |
| 542 | Ga0268266_10466868 | 3300028379 | Bacteria | 1201 |
| 543 | Ga0268265_10000775 | 3300028380 | Bacteria | 30819 |
| 544 | Ga0268265_10005679 | 3300028380 | Bacteria | 8520 |
| 545 | Ga0268265_10152847 | 3300028380 | Bacteria | 1949 |
| 546 | Ga0268264_10005953 | 3300028381 | Bacteria | 10322 |
| 547 | Ga0268264_10072876 | 3300028381 | Bacteria | 2913 |
| 548 | Ga0268264_10083899 | 3300028381 | Bacteria | 2730 |
| 549 | Ga0268264_10654758 | 3300028381 | Bacteria | 1040 |
| 550 | Ga0307517_10148851 | 3300028786 | Bacteria | 1614 |
| 551 | Ga0307515_10088808 | 3300028794 | Bacteria | 3901 |
| 552 | Ga0268256_1000065 | 3300030500 | Bacteria | 199943 |
| 553 | Ga0316177_1024630 | 3300030731 | Bacteria | 2584 |
| 554 | Ga0316180_1144547 | 3300030736 | Bacteria | 7953 |
| 555 | Ga0316182_1010238 | 3300030745 | Bacteria | 3042 |
| 556 | Ga0265328_10044255 | 3300031239 | Bacteria | 1637 |
| 557 | Ga0307509_10000138 | 3300031507 | Bacteria | 108694 |
| 558 | Ga0307508_10436776 | 3300031616 | Bacteria | 901 |
| 559 | Ga0265314_10034269 | 3300031711 | Bacteria | 3713 |
| 560 | Ga0316576_10033220 | 3300031727 | Bacteria | 3671 |
| 561 | Ga0316578_10099080 | 3300031728 | Bacteria | 1746 |
| 562 | Ga0307516_10368341 | 3300031730 | Bacteria | 1100 |
| 563 | Ga0307413_10060324 | 3300031824 | Bacteria | 2335 |
| 564 | Ga0307413_10108800 | 3300031824 | Bacteria | 1851 |
| 565 | Ga0307410_10050512 | 3300031852 | Bacteria | 2797 |
| 566 | Ga0307406_10424049 | 3300031901 | Bacteria | 1061 |
| 567 | Ga0307416_100178554 | 3300032002 | Bacteria | 1987 |
| 568 | Ga0307411_10360689 | 3300032005 | Bacteria | 1188 |
| 569 | Ga0316583_10030412 | 3300032133 | Bacteria | 1923 |
| 570 | Ga0316580_10015706 | 3300032139 | Bacteria | 2317 |
| 571 | Ga0307510_10020810 | 3300033180 | Bacteria | 7659 |
| 572 | Ga0316596_1000148 | 3300033541 | Bacteria | 9709 |
| 573 | Ga0373934_0148399 | 3300035086 | Bacteria | 960 |
| 574 | Ga0373944_0001829 | 3300035089 | Bacteria | 5375 |
| 575 | Ga0316574_0297099 | 3300035398 | Bacteria | 1027 |
| 576 | Ga0373937_0767201 | 3300036401 | Bacteria | 912 |
| 577 | Ga0316582_0292050 | 3300036647 | Bacteria | 1119 |
| 578 | Ga0316584_0461025 | 3300036712 | Bacteria | 897 |
| 579 | Ga0373925_0287663 | 3300037068 | Bacteria | 1325 |
| 580 | Ga0395899_0000175 | 3300037312 | Bacteria | 95781 |
| 581 | Ga0395899_0083556 | 3300037312 | Bacteria | 2321 |
| 582 | Ga0395900_0000012 | 3300037418 | Bacteria | 401198 |
| 583 | Ga0395900_0000590 | 3300037418 | Bacteria | 49754 |
| 584 | Ga0395900_0003017 | 3300037418 | Bacteria | 18319 |
| 585 | Ga0395900_0020607 | 3300037418 | Bacteria | 6735 |
| 586 | Ga0395900_0113437 | 3300037418 | Bacteria | 2782 |
| 587 | Ga0395900_0387197 | 3300037418 | Bacteria | 1365 |
| 588 | Ga0395898_0000034 | 3300037466 | Bacteria | 356745 |
| 589 | Ga0395898_0000197 | 3300037466 | Bacteria | 155187 |
| 590 | Ga0395898_0084511 | 3300037466 | Bacteria | 3059 |
| 591 | Ga0395898_0187964 | 3300037466 | Bacteria | 1974 |
| 592 | Ga0395898_0261181 | 3300037466 | Bacteria | 1652 |
| 593 | Ga0395905_0004097 | 3300037471 | Bacteria | 15271 |
| 594 | Ga0395905_0530847 | 3300037471 | Bacteria | 1077 |
| 595 | Ga0395905_0595365 | 3300037471 | Bacteria | 1007 |
| 596 | Ga0395901_0002395 | 3300038443 | Bacteria | 19062 |
| 597 | Ga0395901_0096876 | 3300038443 | Bacteria | 3092 |
| 598 | Ga0395901_0099480 | 3300038443 | Bacteria | 3049 |
| 599 | Ga0395901_0321976 | 3300038443 | Bacteria | 1599 |
| 600 | Ga0395901_0527910 | 3300038443 | Bacteria | 1198 |
| 601 | Ga0439436_0040842 | 3300041404 | Bacteria | 1328 |
| 602 | Ga0451791_0120622 | 3300041451 | Bacteria | 1437 |
| 603 | Ga0451791_0417054 | 3300041451 | Bacteria | 993 |
| 604 | Ga0451800_0794950 | 3300041459 | Bacteria | 1539 |
| 605 | Ga0451802_1053210 | 3300041460 | Bacteria | 4101 |
| 606 | Ga0451804_0827444 | 3300041463 | Bacteria | 1574 |
| 607 | Ga0451853_1117054 | 3300041512 | Bacteria | 3860 |
| 608 | Ga0451853_1932253 | 3300041512 | Bacteria | 1068 |
| 609 | Ga0451853_3149850 | 3300041512 | Bacteria | 2491 |
| 610 | Ga0439431_0034331 | 3300041997 | Bacteria | 1271 |
| 611 | Ga0439432_033213 | 3300042006 | Bacteria | 1661 |
| 612 | Ga0439449_0025587 | 3300042007 | Bacteria | 2205 |
| 613 | Ga0466969_0003088 | 3300044656 | Bacteria | 8879 |
| 614 | Ga0466969_0006890 | 3300044656 | Bacteria | 6049 |
| 615 | Ga0466969_0042668 | 3300044656 | Bacteria | 2263 |
| 616 | Ga0466969_0052049 | 3300044656 | Bacteria | 2013 |
| 617 | Ga0466982_0000020 | 3300044672 | Bacteria | 99164 |
| 618 | Ga0466965_0030627 | 3300044683 | Bacteria | 2622 |
| 619 | Ga0466965_0054319 | 3300044683 | Bacteria | 1991 |
| 620 | Ga0466966_0089385 | 3300044684 | Bacteria | 1913 |
| 621 | Ga0466966_0097134 | 3300044684 | Bacteria | 1824 |
| 622 | Ga0466966_0182397 | 3300044684 | Bacteria | 1274 |
| 623 | Ga0466961_0009198 | 3300044693 | Bacteria | 6290 |
| 624 | Ga0466961_0011333 | 3300044693 | Bacteria | 5701 |
| 625 | Ga0466961_0012228 | 3300044693 | Bacteria | 5488 |
| 626 | Ga0466961_0033217 | 3300044693 | Bacteria | 3316 |
| 627 | Ga0466961_0193868 | 3300044693 | Bacteria | 1258 |
| 628 | Ga0466964_0007547 | 3300044706 | Bacteria | 4069 |
| 629 | Ga0466964_0082481 | 3300044706 | Bacteria | 1383 |
| 630 | Ga0453684_0003957 | 3300044712 | Bacteria | 32397 |
| 631 | Ga0453684_0044943 | 3300044712 | Bacteria | 5899 |
| 632 | Ga0453684_0216116 | 3300044712 | Bacteria | 2224 |
| 633 | Ga0466971_0004168 | 3300044719 | Bacteria | 6230 |
| 634 | Ga0466971_0005065 | 3300044719 | Bacteria | 5709 |
| 635 | Ga0466971_0019375 | 3300044719 | Bacteria | 3021 |
| 636 | Ga0466968_0010922 | 3300044735 | Bacteria | 3529 |
| 637 | Ga0466968_0013147 | 3300044735 | Bacteria | 3250 |
| 638 | Ga0466970_0001017 | 3300044765 | Bacteria | 13518 |
| 639 | Ga0466970_0016399 | 3300044765 | Bacteria | 3818 |
| 640 | Ga0466970_0040551 | 3300044765 | Bacteria | 2472 |
| 641 | Ga0466970_0156709 | 3300044765 | Bacteria | 1258 |
| 642 | Ga0466957_0015342 | 3300044842 | Bacteria | 4476 |
| 643 | Ga0466957_0054609 | 3300044842 | Bacteria | 2439 |
| 644 | Ga0466957_0230339 | 3300044842 | Bacteria | 1226 |
| 645 | Ga0466960_0006030 | 3300044901 | Bacteria | 4839 |
| 646 | Ga0466959_0001920 | 3300045049 | Bacteria | 13067 |
| 647 | Ga0466959_0019916 | 3300045049 | Bacteria | 4938 |
| 648 | Ga0466959_0058121 | 3300045049 | Bacteria | 2817 |
| 649 | Ga0466959_0070366 | 3300045049 | Bacteria | 2534 |
| 650 | Ga0466959_0096720 | 3300045049 | Bacteria | 2116 |
| 651 | Ga0466958_0005201 | 3300045836 | Bacteria | 6972 |
| 652 | Ga0466958_0022314 | 3300045836 | Bacteria | 3706 |
| 653 | Ga0466967_0203723 | 3300045976 | Bacteria | 1875 |
| 654 | Ga0466967_0296892 | 3300045976 | Bacteria | 1554 |
| 655 | Ga0495638_0000058 | 3300046460 | Bacteria | 192656 |
| 656 | Ga0495638_0000159 | 3300046460 | Bacteria | 106490 |
| 657 | Ga0495638_0000161 | 3300046460 | Bacteria | 104406 |
| 658 | Ga0495650_0000197 | 3300046471 | Bacteria | 131300 |
| 659 | Ga0495650_0000590 | 3300046471 | Bacteria | 50202 |
| 660 | Ga0495607_0000508 | 3300046501 | Bacteria | 38562 |
| 661 | Ga0495607_0041187 | 3300046501 | Bacteria | 2745 |
| 662 | Ga0495606_0000940 | 3300046507 | Bacteria | 42915 |
| 663 | Ga0495606_0009272 | 3300046507 | Bacteria | 8352 |
| 664 | Ga0495610_0001937 | 3300046512 | Bacteria | 17835 |
| 665 | Ga0495643_0000420 | 3300046522 | Bacteria | 55396 |
| 666 | Ga0495648_0037193 | 3300046524 | Bacteria | 3130 |
| 667 | Ga0495665_0138228 | 3300046531 | Bacteria | 1274 |
| 668 | Ga0495640_0224766 | 3300046533 | Bacteria | 1183 |
| 669 | Ga0495609_0026658 | 3300046538 | Bacteria | 2645 |
| 670 | Ga0495597_0000445 | 3300046542 | Bacteria | 35362 |
| 671 | Ga0495633_0001876 | 3300046558 | Bacteria | 15349 |
| 672 | Ga0495625_0026760 | 3300046660 | Bacteria | 4351 |
| 673 | Ga0495625_0113192 | 3300046660 | Bacteria | 1853 |
| 674 | Ga0495659_0036396 | 3300046664 | Bacteria | 1739 |
| 675 | Ga0495658_0023452 | 3300046683 | Bacteria | 3275 |
| 676 | Ga0495658_0116546 | 3300046683 | Bacteria | 1611 |
| 677 | Ga0495649_0001668 | 3300046694 | Bacteria | 16496 |
| 678 | Ga0495649_0002293 | 3300046694 | Bacteria | 13595 |
| 679 | Ga0495672_0000483 | 3300047320 | Bacteria | 47007 |
| 680 | Ga0495687_000317 | 3300047443 | Bacteria | 62824 |
| 681 | Ga0495684_0065199 | 3300047471 | Bacteria | 2769 |
| 682 | Ga0495686_0000175 | 3300047472 | Bacteria | 122163 |
| 683 | Ga0495686_0017603 | 3300047472 | Bacteria | 4808 |
| 684 | Ga0496101_0025554 | 3300048904 | Bacteria | 4099 |
| 685 | Ga0496102_0008206 | 3300048905 | Bacteria | 8939 |
| 686 | Ga0496103_0006595 | 3300048906 | Bacteria | 6922 |
| 687 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 688 | Ga0496104_0538061 | 3300048907 | Bacteria | 1079 |
| 689 | Ga0496105_0000014 | 3300048908 | Bacteria | 220911 |
| 690 | Ga0496105_0016340 | 3300048908 | Bacteria | 5924 |
| 691 | Ga0496105_0110018 | 3300048908 | Bacteria | 2274 |
| 692 | Ga0496105_0348013 | 3300048908 | Bacteria | 1184 |
| 693 | Ga0496106_0181925 | 3300048909 | Bacteria | 1669 |
| 694 | Ga0496114_0280556 | 3300048917 | Bacteria | 1469 |
| 695 | Ga0496114_0395867 | 3300048917 | Bacteria | 1223 |
| 696 | Ga0496115_0000025 | 3300048918 | Bacteria | 151658 |
| 697 | Ga0496115_0000293 | 3300048918 | Bacteria | 43225 |
| 698 | Ga0496115_0000974 | 3300048918 | Bacteria | 20806 |
| 699 | Ga0496115_0022193 | 3300048918 | Bacteria | 4914 |
| 700 | Ga0496117_0019447 | 3300048920 | Bacteria | 5576 |
| 701 | Ga0496117_0062426 | 3300048920 | Bacteria | 2553 |
| 702 | Ga0496117_0100838 | 3300048920 | Bacteria | 1828 |
| 703 | Ga0496118_0004230 | 3300048921 | Bacteria | 17222 |
| 704 | Ga0496118_0009467 | 3300048921 | Bacteria | 9835 |
| 705 | Ga0496118_0018702 | 3300048921 | Bacteria | 6229 |
| 706 | Ga0496119_0001095 | 3300048922 | Bacteria | 34129 |
| 707 | Ga0496119_0062380 | 3300048922 | Bacteria | 2221 |
| 708 | Ga0496120_0000656 | 3300048923 | Bacteria | 50861 |
| 709 | Ga0496120_0013968 | 3300048923 | Bacteria | 5374 |
| 710 | Ga0496121_0004079 | 3300048924 | Bacteria | 20060 |
| 711 | Ga0496121_0009617 | 3300048924 | Bacteria | 11074 |
| 712 | Ga0496121_0042777 | 3300048924 | Bacteria | 3934 |
| 713 | Ga0496121_0087285 | 3300048924 | Bacteria | 2449 |
| 714 | Ga0496121_0184405 | 3300048924 | Bacteria | 1502 |
| 715 | Ga0496122_0038152 | 3300048925 | Bacteria | 3854 |
| 716 | Ga0496123_0001240 | 3300048926 | Bacteria | 37029 |
| 717 | Ga0496124_0002427 | 3300048927 | Bacteria | 24450 |
| 718 | Ga0496125_0000344 | 3300048928 | Bacteria | 88380 |
| 719 | Ga0496125_0009742 | 3300048928 | Bacteria | 9807 |
| 720 | Ga0496126_0000057 | 3300048929 | Bacteria | 276781 |
| 721 | Ga0496126_0003518 | 3300048929 | Bacteria | 19705 |
| 722 | Ga0496126_0023183 | 3300048929 | Bacteria | 6018 |
| 723 | Ga0496126_0059039 | 3300048929 | Bacteria | 3456 |
| 724 | Ga0496126_0114480 | 3300048929 | Bacteria | 2346 |
| 725 | Ga0495678_000347 | 3300049459 | Bacteria | 48195 |
| 726 | Ga0501031_0018033 | 3300049568 | Bacteria | 4591 |
| 727 | Ga0501031_0024897 | 3300049568 | Bacteria | 3903 |
| 728 | Ga0501031_0046675 | 3300049568 | Bacteria | 2824 |
| 729 | Ga0501032_0000994 | 3300049569 | Bacteria | 22837 |
| 730 | Ga0501032_0007509 | 3300049569 | Bacteria | 7963 |
| 731 | Ga0501032_0012956 | 3300049569 | Bacteria | 5939 |
| 732 | Ga0501032_0036367 | 3300049569 | Bacteria | 3361 |
| 733 | Ga0501032_0151679 | 3300049569 | Bacteria | 1523 |
| 734 | Ga0501033_0000550 | 3300049570 | Bacteria | 34940 |
| 735 | Ga0501033_0006764 | 3300049570 | Bacteria | 8956 |
| 736 | Ga0501033_0008456 | 3300049570 | Bacteria | 7969 |
| 737 | Ga0501033_0060705 | 3300049570 | Bacteria | 2788 |
| 738 | Ga0501034_0000769 | 3300049571 | Bacteria | 48050 |
| 739 | Ga0501034_0001262 | 3300049571 | Bacteria | 34347 |
| 740 | Ga0501034_0002423 | 3300049571 | Bacteria | 22561 |
| 741 | Ga0501034_0022793 | 3300049571 | Bacteria | 6379 |
| 742 | Ga0501034_0039328 | 3300049571 | Bacteria | 4791 |
| 743 | Ga0501034_0102777 | 3300049571 | Bacteria | 2851 |
| 744 | Ga0501036_0020650 | 3300049572 | Bacteria | 5532 |
| 745 | Ga0501036_0047657 | 3300049572 | Bacteria | 3628 |
| 746 | Ga0501036_0117080 | 3300049572 | Bacteria | 2250 |
| 747 | Ga0501037_0010539 | 3300049573 | Bacteria | 6789 |
| 748 | Ga0501037_0050867 | 3300049573 | Bacteria | 3031 |
| 749 | Ga0501037_0069638 | 3300049573 | Bacteria | 2560 |
| 750 | Ga0501037_0101647 | 3300049573 | Bacteria | 2074 |
| 751 | Ga0501038_0003208 | 3300049574 | Bacteria | 15263 |
| 752 | Ga0501038_0011175 | 3300049574 | Bacteria | 8199 |
| 753 | Ga0501038_0016661 | 3300049574 | Bacteria | 6661 |
| 754 | Ga0501038_0033729 | 3300049574 | Bacteria | 4507 |
| 755 | Ga0501038_0120395 | 3300049574 | Bacteria | 2165 |
| 756 | Ga0501038_0180829 | 3300049574 | Bacteria | 1701 |
| 757 | Ga0501038_0219132 | 3300049574 | Bacteria | 1519 |
| 758 | Ga0501038_0304105 | 3300049574 | Bacteria | 1251 |
| 759 | Ga0501039_0003438 | 3300049575 | Bacteria | 11824 |
| 760 | Ga0501039_0089749 | 3300049575 | Bacteria | 2395 |
| 761 | Ga0501039_0111912 | 3300049575 | Bacteria | 2134 |
| 762 | Ga0501042_0032210 | 3300049578 | Bacteria | 3712 |
| 763 | Ga0501042_0177115 | 3300049578 | Bacteria | 1538 |
| 764 | Ga0501043_0001679 | 3300049579 | Bacteria | 19220 |
| 765 | Ga0501043_0022649 | 3300049579 | Bacteria | 4925 |
| 766 | Ga0501043_0033718 | 3300049579 | Bacteria | 4029 |
| 767 | Ga0501043_0078288 | 3300049579 | Bacteria | 2597 |
| 768 | Ga0501043_0083758 | 3300049579 | Bacteria | 2507 |
| 769 | Ga0501046_0001275 | 3300049580 | Bacteria | 24406 |
| 770 | Ga0501046_0026065 | 3300049580 | Bacteria | 4777 |
| 771 | Ga0501046_0051077 | 3300049580 | Bacteria | 3264 |
| 772 | Ga0501046_0104255 | 3300049580 | Bacteria | 2173 |
| 773 | Ga0501047_0000446 | 3300049581 | Bacteria | 45717 |
| 774 | Ga0501047_0015182 | 3300049581 | Bacteria | 7332 |
| 775 | Ga0501047_0016313 | 3300049581 | Bacteria | 7087 |
| 776 | Ga0501047_0046648 | 3300049581 | Bacteria | 4187 |
| 777 | Ga0501047_0072674 | 3300049581 | Bacteria | 3310 |
| 778 | Ga0501047_0156480 | 3300049581 | Bacteria | 2152 |
| 779 | Ga0501047_0266593 | 3300049581 | Bacteria | 1559 |
| 780 | Ga0501067_0004497 | 3300049583 | Bacteria | 7693 |
| 781 | Ga0501067_0027913 | 3300049583 | Bacteria | 3128 |
| 782 | Ga0501068_0023128 | 3300049584 | Bacteria | 3640 |
| 783 | Ga0501068_0027610 | 3300049584 | Bacteria | 3352 |
| 784 | Ga0501069_0002920 | 3300049585 | Bacteria | 8772 |
| 785 | Ga0501070_0010811 | 3300049586 | Bacteria | 7710 |
| 786 | Ga0501070_0032545 | 3300049586 | Bacteria | 4364 |
| 787 | Ga0501070_0073895 | 3300049586 | Bacteria | 2821 |
| 788 | Ga0501070_0081453 | 3300049586 | Bacteria | 2678 |
| 789 | Ga0501070_0093200 | 3300049586 | Bacteria | 2492 |
| 790 | Ga0501071_0022609 | 3300049587 | Bacteria | 4384 |
| 791 | Ga0501072_0001232 | 3300049588 | Bacteria | 19103 |
| 792 | Ga0501072_0067873 | 3300049588 | Bacteria | 2814 |
| 793 | Ga0501073_0003183 | 3300049589 | Bacteria | 12318 |
| 794 | Ga0501073_0003698 | 3300049589 | Bacteria | 11488 |
| 795 | Ga0501073_0010811 | 3300049589 | Bacteria | 6685 |
| 796 | Ga0501073_0092858 | 3300049589 | Bacteria | 2097 |
| 797 | Ga0501073_0124857 | 3300049589 | Bacteria | 1784 |
| 798 | Ga0501073_0240851 | 3300049589 | Bacteria | 1249 |
| 799 | Ga0501073_0287951 | 3300049589 | Bacteria | 1133 |
| 800 | Ga0501074_0115626 | 3300049590 | Bacteria | 1919 |
| 801 | Ga0501074_0135081 | 3300049590 | Bacteria | 1764 |
| 802 | Ga0501074_0272882 | 3300049590 | Bacteria | 1202 |
| 803 | Ga0501077_0127499 | 3300049593 | Bacteria | 1613 |
| 804 | Ga0501079_0042478 | 3300049741 | Bacteria | 3510 |
| 805 | Ga0501079_0122036 | 3300049741 | Bacteria | 2026 |
| 806 | Ga0501080_0003297 | 3300049742 | Bacteria | 14263 |
| 807 | Ga0501080_0062906 | 3300049742 | Bacteria | 3454 |
| 808 | Ga0501080_0095913 | 3300049742 | Bacteria | 2753 |
| 809 | Ga0501080_0135246 | 3300049742 | Bacteria | 2281 |
| 810 | Ga0501080_0195615 | 3300049742 | Bacteria | 1857 |
| 811 | Ga0501080_0227193 | 3300049742 | Bacteria | 1706 |
| 812 | Ga0501083_0000225 | 3300049744 | Bacteria | 36374 |
| 813 | Ga0501083_0066365 | 3300049744 | Bacteria | 2402 |
| 814 | Ga0501280_038846 | 3300049776 | Bacteria | 766 |
| 815 | Ga0501035_0021974 | 3300049822 | Bacteria | 5861 |
| 816 | Ga0501035_0039997 | 3300049822 | Bacteria | 4240 |
| 817 | Ga0501035_0084771 | 3300049822 | Bacteria | 2794 |
| 818 | Ga0501035_0090024 | 3300049822 | Bacteria | 2701 |
| 819 | Ga0501035_0142153 | 3300049822 | Bacteria | 2086 |
| 820 | Ga0501035_0238283 | 3300049822 | Bacteria | 1548 |
| 821 | Ga0501044_0001236 | 3300049823 | Bacteria | 30366 |
| 822 | Ga0501044_0001646 | 3300049823 | Bacteria | 26227 |
| 823 | Ga0501044_0012392 | 3300049823 | Bacteria | 9230 |
| 824 | Ga0501044_0017345 | 3300049823 | Bacteria | 7722 |
| 825 | Ga0501044_0096134 | 3300049823 | Bacteria | 2984 |
| 826 | Ga0501044_0096304 | 3300049823 | Bacteria | 2981 |
| 827 | Ga0501044_0156699 | 3300049823 | Bacteria | 2256 |
| 828 | Ga0501044_0169854 | 3300049823 | Bacteria | 2153 |
| 829 | Ga0501044_0242320 | 3300049823 | Bacteria | 1746 |
| 830 | Ga0501044_0260492 | 3300049823 | Bacteria | 1672 |
| 831 | Ga0501044_0371690 | 3300049823 | Bacteria | 1346 |
| 832 | Ga0501045_0118996 | 3300049824 | Bacteria | 1961 |
| 833 | Ga0501045_0131719 | 3300049824 | Bacteria | 1859 |
| 834 | nmdc:mga09592_568_c1 | 3300050508 | Bacteria | 28030 |
| 835 | nmdc:mga09592_93885_c1 | 3300050508 | Bacteria | 2566 |
| 836 | nmdc:mga0qj67_25480_c1 | 3300050509 | Bacteria | 4570 |
| 837 | nmdc:mga08y16_287981_c1 | 3300050511 | Bacteria | 1694 |
| 838 | nmdc:mga0rr50_105622_c1 | 3300050513 | Bacteria | 2221 |
| 839 | nmdc:mga0sz30_10261_c1 | 3300050516 | Bacteria | 3586 |
| 840 | Ga0500643_005125 | 3300053087 | Bacteria | 5721 |
| 841 | Ga0500651_0010117 | 3300053093 | Bacteria | 5638 |
| 842 | Ga0500566_0206585 | 3300053094 | Bacteria | 987 |
| 843 | Ga0500568_0000145 | 3300053139 | Bacteria | 62300 |
| 844 | Ga0500639_193770 | 3300053163 | Bacteria | 882 |
| 845 | Ga0500636_0132008 | 3300053177 | Bacteria | 1390 |
| 846 | Ga0501084_0210351 | 3300054114 | Bacteria | 1641 |
| 847 | Ga0501082_0015830 | 3300060353 | Bacteria | 6485 |
| 848 | Ga0501082_0095259 | 3300060353 | Bacteria | 2572 |
| 849 | Ga0501082_0238714 | 3300060353 | Bacteria | 1582 |
| 850 | Ga0466962_0004731 | 3300061719 | Bacteria | 6543 |
| 851 | Ga0466962_0006238 | 3300061719 | Bacteria | 5725 |
| 852 | Ga0466962_0012527 | 3300061719 | Bacteria | 4077 |
| 853 | Ga0466962_0022735 | 3300061719 | Bacteria | 3013 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046664 | Ga0495659_0036396 | Ga0495659_0036396_1097_1711 | 204 |
| 2 | 3300025926 | Ga0207659_10281151 | Ga0207659_102811512 | 220 |
| 3 | 3300048908 | Ga0496105_0110018 | Ga0496105_0110018_32_697 | 220 |
| 4 | 3300005617 | Ga0068859_100166560 | Ga0068859_1001665602 | 222 |
| 5 | 3300005842 | Ga0068858_100397588 | Ga0068858_1003975883 | 222 |
| 6 | 3300006931 | Ga0097620_100166555 | Ga0097620_1001665552 | 222 |
| 7 | 3300025941 | Ga0207711_10076510 | Ga0207711_100765103 | 222 |
| 8 | 3300031852 | Ga0307410_10050512 | Ga0307410_100505124 | 225 |
| 9 | 3300031901 | Ga0307406_10424049 | Ga0307406_104240492 | 225 |
| 10 | 3300032005 | Ga0307411_10360689 | Ga0307411_103606891 | 225 |
| 11 | 3300049776 | Ga0501280_038846 | Ga0501280_038846_33_713 | 225 |
| 12 | 3300037471 | Ga0395905_0004097 | Ga0395905_0004097_5724_6512 | 230 |
| 13 | 3300006871 | Ga0075434_100000030 | Ga0075434_10000003078 | 231 |
| 14 | 3300007076 | Ga0075435_100002432 | Ga0075435_1000024328 | 231 |
| 15 | 3300050513 | nmdc:mga0rr50_105622_c1 | nmdc:mga0rr50_105622_c1_992_1687 | 231 |
| 16 | 3300005445 | Ga0070708_100253996 | Ga0070708_1002539963 | 236 |
| 17 | 3300005471 | Ga0070698_100271679 | Ga0070698_1002716792 | 236 |
| 18 | 3300026116 | Ga0207674_10472676 | Ga0207674_104726762 | 236 |
| 19 | 3300037418 | Ga0395900_0387197 | Ga0395900_0387197_27_932 | 238 |
| 20 | 3300037471 | Ga0395905_0595365 | Ga0395905_0595365_23_817 | 238 |
| 21 | 3300017792 | Ga0163161_10239854 | Ga0163161_102398541 | 239 |
| 22 | iso_pu_bacteria | 2690315857 | 2691331760 | 239 |
| 23 | iso_pu_bacteria | 2919534386 | 2919537023 | 239 |
| 24 | iso_pu_bacteria | 8002392321 | 8002392955 | 239 |
| 25 | 3300005458 | Ga0070681_10000058 | Ga0070681_1000005850 | 242 |
| 26 | 3300025912 | Ga0207707_10000641 | Ga0207707_1000064116 | 242 |
| 27 | iso_pu_bacteria | 2887630918 | 2887633659 | 242 |
| 28 | 3300010375 | Ga0105239_10153558 | Ga0105239_101535584 | 243 |
| 29 | 3300026078 | Ga0207702_10029161 | Ga0207702_100291615 | 243 |
| 30 | 3300026121 | Ga0207683_10194847 | Ga0207683_101948472 | 243 |
| 31 | 3300048924 | Ga0496121_0004079 | Ga0496121_0004079_3478_4257 | 243 |
| 32 | 3300049823 | Ga0501044_0169854 | Ga0501044_0169854_1284_2042 | 243 |
| 33 | iso_pu_bacteria | 2574179768 | 2574431577 | 243 |
| 34 | iso_pu_bacteria | 2881714928 | 2881716281 | 243 |
| 35 | 3300005327 | Ga0070658_10302896 | Ga0070658_103028962 | 244 |
| 36 | 3300005339 | Ga0070660_100074431 | Ga0070660_1000744312 | 244 |
| 37 | 3300005344 | Ga0070661_100007743 | Ga0070661_1000077436 | 244 |
| 38 | 3300005347 | Ga0070668_100635041 | Ga0070668_1006350412 | 244 |
| 39 | 3300005354 | Ga0070675_100169335 | Ga0070675_1001693352 | 244 |
| 40 | 3300005356 | Ga0070674_100817241 | Ga0070674_1008172411 | 244 |
| 41 | 3300005367 | Ga0070667_100064127 | Ga0070667_1000641271 | 244 |
| 42 | 3300005457 | Ga0070662_100219424 | Ga0070662_1002194242 | 244 |
| 43 | 3300005535 | Ga0070684_100012608 | Ga0070684_1000126084 | 244 |
| 44 | 3300005539 | Ga0068853_100003826 | Ga0068853_1000038268 | 244 |
| 45 | 3300005546 | Ga0070696_100001471 | Ga0070696_1000014717 | 244 |
| 46 | 3300005563 | Ga0068855_100030567 | Ga0068855_1000305672 | 244 |
| 47 | 3300005577 | Ga0068857_100075914 | Ga0068857_1000759143 | 244 |
| 48 | 3300005614 | Ga0068856_100013146 | Ga0068856_1000131469 | 244 |
| 49 | 3300005616 | Ga0068852_100356509 | Ga0068852_1003565092 | 244 |
| 50 | 3300009093 | Ga0105240_10032191 | Ga0105240_100321911 | 244 |
| 51 | 3300009093 | Ga0105240_10141706 | Ga0105240_101417064 | 244 |
| 52 | 3300009545 | Ga0105237_10175091 | Ga0105237_101750912 | 244 |
| 53 | 3300009551 | Ga0105238_10022955 | Ga0105238_100229559 | 244 |
| 54 | 3300010375 | Ga0105239_10077614 | Ga0105239_100776141 | 244 |
| 55 | 3300013100 | Ga0157373_10064953 | Ga0157373_100649535 | 244 |
| 56 | 3300013104 | Ga0157370_10082858 | Ga0157370_100828585 | 244 |
| 57 | 3300013105 | Ga0157369_10015187 | Ga0157369_100151879 | 244 |
| 58 | 3300013306 | Ga0163162_10767982 | Ga0163162_107679821 | 244 |
| 59 | 3300013307 | Ga0157372_10000470 | Ga0157372_1000047033 | 244 |
| 60 | 3300013307 | Ga0157372_10686846 | Ga0157372_106868462 | 244 |
| 61 | 3300025904 | Ga0207647_10004964 | Ga0207647_100049644 | 244 |
| 62 | 3300025911 | Ga0207654_10014936 | Ga0207654_100149362 | 244 |
| 63 | 3300025913 | Ga0207695_10000182 | Ga0207695_1000018294 | 244 |
| 64 | 3300025914 | Ga0207671_10005611 | Ga0207671_1000561114 | 244 |
| 65 | 3300025914 | Ga0207671_10193923 | Ga0207671_101939232 | 244 |
| 66 | 3300025933 | Ga0207706_10063947 | Ga0207706_100639472 | 244 |
| 67 | 3300025937 | Ga0207669_10646639 | Ga0207669_106466391 | 244 |
| 68 | 3300025940 | Ga0207691_10309695 | Ga0207691_103096953 | 244 |
| 69 | 3300025944 | Ga0207661_10185419 | Ga0207661_101854193 | 244 |
| 70 | 3300025949 | Ga0207667_10001289 | Ga0207667_1000128926 | 244 |
| 71 | 3300025949 | Ga0207667_10047100 | Ga0207667_100471002 | 244 |
| 72 | 3300026041 | Ga0207639_10003408 | Ga0207639_100034082 | 244 |
| 73 | 3300026078 | Ga0207702_10053888 | Ga0207702_100538882 | 244 |
| 74 | 3300026078 | Ga0207702_10106436 | Ga0207702_101064363 | 244 |
| 75 | 3300048905 | Ga0496102_0008206 | Ga0496102_0008206_3748_4515 | 244 |
| 76 | iso_pu_bacteria | 2547132512 | 2548846484 | 244 |
| 77 | 3300005295 | Ga0065707_10002428 | Ga0065707_100024286 | 245 |
| 78 | 3300005330 | Ga0070690_100175201 | Ga0070690_1001752011 | 245 |
| 79 | 3300005334 | Ga0068869_100236318 | Ga0068869_1002363183 | 245 |
| 80 | 3300005340 | Ga0070689_100053928 | Ga0070689_1000539283 | 245 |
| 81 | 3300005406 | Ga0070703_10000036 | Ga0070703_1000003642 | 245 |
| 82 | 3300005444 | Ga0070694_100005045 | Ga0070694_10000504511 | 245 |
| 83 | 3300005445 | Ga0070708_100247660 | Ga0070708_1002476603 | 245 |
| 84 | 3300005468 | Ga0070707_100081326 | Ga0070707_1000813262 | 245 |
| 85 | 3300005471 | Ga0070698_100379145 | Ga0070698_1003791451 | 245 |
| 86 | 3300005544 | Ga0070686_100136361 | Ga0070686_1001363612 | 245 |
| 87 | 3300005549 | Ga0070704_100032088 | Ga0070704_1000320883 | 245 |
| 88 | 3300005617 | Ga0068859_100013022 | Ga0068859_1000130224 | 245 |
| 89 | 3300005843 | Ga0068860_100489826 | Ga0068860_1004898261 | 245 |
| 90 | 3300005844 | Ga0068862_100033844 | Ga0068862_1000338442 | 245 |
| 91 | 3300006844 | Ga0075428_100034175 | Ga0075428_1000341753 | 245 |
| 92 | 3300006931 | Ga0097620_100013022 | Ga0097620_1000130229 | 245 |
| 93 | 3300009093 | Ga0105240_10911026 | Ga0105240_109110262 | 245 |
| 94 | 3300009094 | Ga0111539_10006818 | Ga0111539_100068189 | 245 |
| 95 | 3300009094 | Ga0111539_10047083 | Ga0111539_100470836 | 245 |
| 96 | 3300009148 | Ga0105243_10000357 | Ga0105243_1000035725 | 245 |
| 97 | 3300009174 | Ga0105241_10431087 | Ga0105241_104310872 | 245 |
| 98 | 3300009176 | Ga0105242_10000916 | Ga0105242_100009162 | 245 |
| 99 | 3300009177 | Ga0105248_10096988 | Ga0105248_100969882 | 245 |
| 100 | 3300009553 | Ga0105249_10120212 | Ga0105249_101202123 | 245 |
| 101 | 3300014968 | Ga0157379_10043948 | Ga0157379_100439484 | 245 |
| 102 | 3300025885 | Ga0207653_10000008 | Ga0207653_10000008181 | 245 |
| 103 | 3300025911 | Ga0207654_10100599 | Ga0207654_101005991 | 245 |
| 104 | 3300025922 | Ga0207646_10057903 | Ga0207646_100579036 | 245 |
| 105 | 3300025934 | Ga0207686_10000170 | Ga0207686_1000017025 | 245 |
| 106 | 3300025935 | Ga0207709_10000091 | Ga0207709_10000091107 | 245 |
| 107 | 3300025961 | Ga0207712_10214400 | Ga0207712_102144002 | 245 |
| 108 | 3300026035 | Ga0207703_10050802 | Ga0207703_100508024 | 245 |
| 109 | 3300026095 | Ga0207676_10700140 | Ga0207676_107001401 | 245 |
| 110 | 3300027907 | Ga0207428_10113109 | Ga0207428_101131092 | 245 |
| 111 | 3300028380 | Ga0268265_10005679 | Ga0268265_1000567911 | 245 |
| 112 | 3300028381 | Ga0268264_10072876 | Ga0268264_100728764 | 245 |
| 113 | 3300031727 | Ga0316576_10033220 | Ga0316576_100332203 | 245 |
| 114 | 3300031728 | Ga0316578_10099080 | Ga0316578_100990802 | 245 |
| 115 | 3300031730 | Ga0307516_10368341 | Ga0307516_103683411 | 245 |
| 116 | 3300032133 | Ga0316583_10030412 | Ga0316583_100304123 | 245 |
| 117 | 3300032139 | Ga0316580_10015706 | Ga0316580_100157062 | 245 |
| 118 | 3300035398 | Ga0316574_0297099 | Ga0316574_0297099_156_893 | 245 |
| 119 | 3300036647 | Ga0316582_0292050 | Ga0316582_0292050_161_898 | 245 |
| 120 | 3300049569 | Ga0501032_0012956 | Ga0501032_0012956_1683_2444 | 245 |
| 121 | 3300049571 | Ga0501034_0000769 | Ga0501034_0000769_14560_15321 | 245 |
| 122 | 3300049571 | Ga0501034_0022793 | Ga0501034_0022793_3738_4499 | 245 |
| 123 | 3300049571 | Ga0501034_0102777 | Ga0501034_0102777_1235_1996 | 245 |
| 124 | 3300049574 | Ga0501038_0011175 | Ga0501038_0011175_1423_2184 | 245 |
| 125 | 3300049574 | Ga0501038_0219132 | Ga0501038_0219132_745_1506 | 245 |
| 126 | 3300049579 | Ga0501043_0033718 | Ga0501043_0033718_2113_2874 | 245 |
| 127 | 3300049579 | Ga0501043_0083758 | Ga0501043_0083758_1076_1837 | 245 |
| 128 | 3300049581 | Ga0501047_0000446 | Ga0501047_0000446_39814_40575 | 245 |
| 129 | 3300049581 | Ga0501047_0072674 | Ga0501047_0072674_978_1739 | 245 |
| 130 | 3300049583 | Ga0501067_0004497 | Ga0501067_0004497_5133_5894 | 245 |
| 131 | 3300049584 | Ga0501068_0027610 | Ga0501068_0027610_1464_2225 | 245 |
| 132 | 3300049585 | Ga0501069_0002920 | Ga0501069_0002920_3722_4483 | 245 |
| 133 | 3300049586 | Ga0501070_0032545 | Ga0501070_0032545_40_801 | 245 |
| 134 | 3300049586 | Ga0501070_0073895 | Ga0501070_0073895_50_811 | 245 |
| 135 | 3300049588 | Ga0501072_0001232 | Ga0501072_0001232_5806_6567 | 245 |
| 136 | 3300049589 | Ga0501073_0003698 | Ga0501073_0003698_6071_6832 | 245 |
| 137 | 3300049589 | Ga0501073_0092858 | Ga0501073_0092858_270_1031 | 245 |
| 138 | 3300049589 | Ga0501073_0287951 | Ga0501073_0287951_240_1001 | 245 |
| 139 | 3300049590 | Ga0501074_0115626 | Ga0501074_0115626_889_1650 | 245 |
| 140 | 3300049590 | Ga0501074_0135081 | Ga0501074_0135081_732_1493 | 245 |
| 141 | 3300049741 | Ga0501079_0042478 | Ga0501079_0042478_1313_2074 | 245 |
| 142 | 3300049741 | Ga0501079_0122036 | Ga0501079_0122036_49_810 | 245 |
| 143 | 3300049742 | Ga0501080_0095913 | Ga0501080_0095913_1102_1863 | 245 |
| 144 | 3300049742 | Ga0501080_0227193 | Ga0501080_0227193_201_962 | 245 |
| 145 | 3300049744 | Ga0501083_0000225 | Ga0501083_0000225_7499_8260 | 245 |
| 146 | 3300049823 | Ga0501044_0001646 | Ga0501044_0001646_14600_15361 | 245 |
| 147 | 3300049823 | Ga0501044_0371690 | Ga0501044_0371690_83_844 | 245 |
| 148 | 3300049824 | Ga0501045_0118996 | Ga0501045_0118996_409_1170 | 245 |
| 149 | 3300050508 | nmdc:mga09592_93885_c1 | nmdc:mga09592_93885_c1_418_1158 | 245 |
| 150 | 3300050511 | nmdc:mga08y16_287981_c1 | nmdc:mga08y16_287981_c1_348_1088 | 245 |
| 151 | 3300054114 | Ga0501084_0210351 | Ga0501084_0210351_850_1611 | 245 |
| 152 | 3300060353 | Ga0501082_0238714 | Ga0501082_0238714_555_1316 | 245 |
| 153 | 3300002773 | JGI25152J39213_1002252 | JGI25152J39213_10022527 | 246 |
| 154 | 3300005841 | Ga0068863_100053186 | Ga0068863_1000531862 | 246 |
| 155 | 3300005842 | Ga0068858_100117829 | Ga0068858_1001178293 | 246 |
| 156 | 3300006846 | Ga0075430_100061388 | Ga0075430_1000613883 | 246 |
| 157 | 3300006880 | Ga0075429_100018264 | Ga0075429_1000182643 | 246 |
| 158 | 3300026088 | Ga0207641_10030081 | Ga0207641_100300816 | 246 |
| 159 | 3300031824 | Ga0307413_10060324 | Ga0307413_100603243 | 246 |
| 160 | 3300044712 | Ga0453684_0216116 | Ga0453684_0216116_76_831 | 246 |
| 161 | 3300050508 | nmdc:mga09592_568_c1 | nmdc:mga09592_568_c1_1370_2119 | 246 |
| 162 | 3300050509 | nmdc:mga0qj67_25480_c1 | nmdc:mga0qj67_25480_c1_2605_3354 | 246 |
| 163 | iso_pu_bacteria | 639633007 | 639789100 | 246 |
| 164 | 3300002738 | JGI25154J39366_1001879 | JGI25154J39366_10018797 | 247 |
| 165 | 3300003771 | Ga0055526_1000096 | Ga0055526_100009634 | 247 |
| 166 | 3300005983 | Ga0081540_1002130 | Ga0081540_10021307 | 247 |
| 167 | 3300013296 | Ga0157374_10376486 | Ga0157374_103764862 | 247 |
| 168 | 3300013306 | Ga0163162_10224765 | Ga0163162_102247651 | 247 |
| 169 | 3300014969 | Ga0157376_10310690 | Ga0157376_103106903 | 247 |
| 170 | 3300026116 | Ga0207674_10092754 | Ga0207674_100927542 | 247 |
| 171 | 3300031239 | Ga0265328_10044255 | Ga0265328_100442554 | 247 |
| 172 | 3300041451 | Ga0451791_0417054 | Ga0451791_0417054_202_954 | 247 |
| 173 | 3300041460 | Ga0451802_1053210 | Ga0451802_1053210_2054_2806 | 247 |
| 174 | 3300041512 | Ga0451853_1117054 | Ga0451853_1117054_1317_2069 | 247 |
| 175 | 3300041512 | Ga0451853_1932253 | Ga0451853_1932253_69_827 | 247 |
| 176 | 3300046460 | Ga0495638_0000058 | Ga0495638_0000058_147226_148011 | 247 |
| 177 | 3300046512 | Ga0495610_0001937 | Ga0495610_0001937_13148_13930 | 247 |
| 178 | 3300046522 | Ga0495643_0000420 | Ga0495643_0000420_40616_41398 | 247 |
| 179 | 3300046524 | Ga0495648_0037193 | Ga0495648_0037193_1795_2577 | 247 |
| 180 | 3300046538 | Ga0495609_0026658 | Ga0495609_0026658_1171_1953 | 247 |
| 181 | 3300046542 | Ga0495597_0000445 | Ga0495597_0000445_20510_21292 | 247 |
| 182 | 3300046558 | Ga0495633_0001876 | Ga0495633_0001876_4310_5116 | 247 |
| 183 | 3300046694 | Ga0495649_0001668 | Ga0495649_0001668_5591_6373 | 247 |
| 184 | 3300047320 | Ga0495672_0000483 | Ga0495672_0000483_14337_15119 | 247 |
| 185 | 3300047443 | Ga0495687_000317 | Ga0495687_000317_30948_31733 | 247 |
| 186 | 3300048906 | Ga0496103_0006595 | Ga0496103_0006595_439_1197 | 247 |
| 187 | 3300048918 | Ga0496115_0000293 | Ga0496115_0000293_4573_5331 | 247 |
| 188 | 3300048920 | Ga0496117_0100838 | Ga0496117_0100838_568_1326 | 247 |
| 189 | 3300048921 | Ga0496118_0009467 | Ga0496118_0009467_1636_2394 | 247 |
| 190 | 3300048927 | Ga0496124_0002427 | Ga0496124_0002427_23553_24407 | 247 |
| 191 | 3300048928 | Ga0496125_0009742 | Ga0496125_0009742_629_1483 | 247 |
| 192 | 3300048929 | Ga0496126_0000057 | Ga0496126_0000057_149958_150716 | 247 |
| 193 | 3300049459 | Ga0495678_000347 | Ga0495678_000347_14517_15299 | 247 |
| 194 | 3300053093 | Ga0500651_0010117 | Ga0500651_0010117_3569_4327 | 247 |
| 195 | iso_pu_bacteria | 2537561836 | 2538834053 | 247 |
| 196 | iso_pu_bacteria | 2643221562 | 2643830715 | 247 |
| 197 | iso_pu_bacteria | 2643221577 | 2643894085 | 247 |
| 198 | iso_pu_bacteria | 2643221685 | 2644476274 | 247 |
| 199 | iso_pu_bacteria | 2687453130 | 2687582856 | 247 |
| 200 | iso_pu_bacteria | 2739367700 | 2739731749 | 247 |
| 201 | iso_pu_bacteria | 2747842501 | 2748015668 | 247 |
| 202 | iso_pu_bacteria | 2884411467 | 2884414077 | 247 |
| 203 | iso_pu_bacteria | 2895395659 | 2895396710 | 247 |
| 204 | iso_pu_bacteria | 2919085039 | 2919085590 | 247 |
| 205 | iso_pu_bacteria | 2928963466 | 2928967346 | 247 |
| 206 | iso_pu_bacteria | 2939611941 | 2939614502 | 247 |
| 207 | 3300003771 | Ga0055526_1001604 | Ga0055526_10016048 | 248 |
| 208 | 3300005329 | Ga0070683_100091824 | Ga0070683_1000918244 | 248 |
| 209 | 3300005338 | Ga0068868_100074319 | Ga0068868_1000743191 | 248 |
| 210 | 3300005530 | Ga0070679_100077287 | Ga0070679_1000772872 | 248 |
| 211 | 3300005530 | Ga0070679_100302295 | Ga0070679_1003022953 | 248 |
| 212 | 3300014326 | Ga0157380_10127818 | Ga0157380_101278183 | 248 |
| 213 | 3300028794 | Ga0307515_10088808 | Ga0307515_100888084 | 248 |
| 214 | 3300031507 | Ga0307509_10000138 | Ga0307509_1000013871 | 248 |
| 215 | 3300031711 | Ga0265314_10034269 | Ga0265314_100342695 | 248 |
| 216 | 3300032002 | Ga0307416_100178554 | Ga0307416_1001785544 | 248 |
| 217 | 3300033541 | Ga0316596_1000148 | Ga0316596_100014810 | 248 |
| 218 | 3300036712 | Ga0316584_0461025 | Ga0316584_0461025_120_866 | 248 |
| 219 | 3300038443 | Ga0395901_0096876 | Ga0395901_0096876_149_898 | 248 |
| 220 | 3300041404 | Ga0439436_0040842 | Ga0439436_0040842_210_959 | 248 |
| 221 | 3300041997 | Ga0439431_0034331 | Ga0439431_0034331_468_1217 | 248 |
| 222 | 3300042007 | Ga0439449_0025587 | Ga0439449_0025587_124_873 | 248 |
| 223 | 3300044656 | Ga0466969_0052049 | Ga0466969_0052049_858_1613 | 248 |
| 224 | 3300044683 | Ga0466965_0030627 | Ga0466965_0030627_1436_2191 | 248 |
| 225 | 3300044684 | Ga0466966_0097134 | Ga0466966_0097134_626_1381 | 248 |
| 226 | 3300044712 | Ga0453684_0003957 | Ga0453684_0003957_4827_5576 | 248 |
| 227 | 3300044842 | Ga0466957_0054609 | Ga0466957_0054609_1551_2306 | 248 |
| 228 | 3300045049 | Ga0466959_0096720 | Ga0466959_0096720_837_1592 | 248 |
| 229 | 3300045976 | Ga0466967_0296892 | Ga0466967_0296892_363_1112 | 248 |
| 230 | 3300048908 | Ga0496105_0348013 | Ga0496105_0348013_178_969 | 248 |
| 231 | 3300048917 | Ga0496114_0280556 | Ga0496114_0280556_22_861 | 248 |
| 232 | 3300061719 | Ga0466962_0022735 | Ga0466962_0022735_1228_1983 | 248 |
| 233 | 3300005334 | Ga0068869_100102689 | Ga0068869_1001026893 | 249 |
| 234 | 3300005367 | Ga0070667_100001757 | Ga0070667_1000017575 | 249 |
| 235 | 3300005455 | Ga0070663_100001061 | Ga0070663_10000106110 | 249 |
| 236 | 3300005539 | Ga0068853_100052054 | Ga0068853_1000520542 | 249 |
| 237 | 3300005548 | Ga0070665_100021003 | Ga0070665_1000210034 | 249 |
| 238 | 3300005563 | Ga0068855_100020683 | Ga0068855_1000206838 | 249 |
| 239 | 3300005577 | Ga0068857_100087856 | Ga0068857_1000878562 | 249 |
| 240 | 3300005841 | Ga0068863_100011269 | Ga0068863_1000112698 | 249 |
| 241 | 3300009098 | Ga0105245_10073921 | Ga0105245_100739216 | 249 |
| 242 | 3300009174 | Ga0105241_10097513 | Ga0105241_100975133 | 249 |
| 243 | 3300009177 | Ga0105248_10002035 | Ga0105248_100020355 | 249 |
| 244 | 3300009545 | Ga0105237_10021706 | Ga0105237_100217064 | 249 |
| 245 | 3300009553 | Ga0105249_10002169 | Ga0105249_1000216912 | 249 |
| 246 | 3300010375 | Ga0105239_10002329 | Ga0105239_100023297 | 249 |
| 247 | 3300010375 | Ga0105239_10018736 | Ga0105239_100187363 | 249 |
| 248 | 3300014325 | Ga0163163_10000970 | Ga0163163_100009709 | 249 |
| 249 | 3300025303 | Ga0209051_1006850 | Ga0209051_10068504 | 249 |
| 250 | 3300025903 | Ga0207680_10000892 | Ga0207680_100008926 | 249 |
| 251 | 3300025911 | Ga0207654_10141697 | Ga0207654_101416973 | 249 |
| 252 | 3300025913 | Ga0207695_10233888 | Ga0207695_102338882 | 249 |
| 253 | 3300025914 | Ga0207671_10038159 | Ga0207671_100381595 | 249 |
| 254 | 3300025927 | Ga0207687_10048905 | Ga0207687_100489053 | 249 |
| 255 | 3300025932 | Ga0207690_10262864 | Ga0207690_102628642 | 249 |
| 256 | 3300025941 | Ga0207711_10053220 | Ga0207711_100532202 | 249 |
| 257 | 3300025942 | Ga0207689_10656351 | Ga0207689_106563511 | 249 |
| 258 | 3300025949 | Ga0207667_10115267 | Ga0207667_101152673 | 249 |
| 259 | 3300025961 | Ga0207712_10000677 | Ga0207712_100006774 | 249 |
| 260 | 3300025986 | Ga0207658_10001333 | Ga0207658_100013335 | 249 |
| 261 | 3300026041 | Ga0207639_10001096 | Ga0207639_1000109610 | 249 |
| 262 | 3300026041 | Ga0207639_10008230 | Ga0207639_100082306 | 249 |
| 263 | 3300026041 | Ga0207639_10197062 | Ga0207639_101970622 | 249 |
| 264 | 3300026067 | Ga0207678_10003102 | Ga0207678_100031025 | 249 |
| 265 | 3300026067 | Ga0207678_10200199 | Ga0207678_102001992 | 249 |
| 266 | 3300026088 | Ga0207641_10089759 | Ga0207641_100897594 | 249 |
| 267 | 3300026116 | Ga0207674_10104787 | Ga0207674_101047872 | 249 |
| 268 | 3300026142 | Ga0207698_10959975 | Ga0207698_109599751 | 249 |
| 269 | 3300028379 | Ga0268266_10466868 | Ga0268266_104668682 | 249 |
| 270 | 3300030731 | Ga0316177_1024630 | Ga0316177_10246302 | 249 |
| 271 | 3300030736 | Ga0316180_1144547 | Ga0316180_11445474 | 249 |
| 272 | 3300030745 | Ga0316182_1010238 | Ga0316182_10102382 | 249 |
| 273 | 3300044712 | Ga0453684_0044943 | Ga0453684_0044943_4981_5730 | 249 |
| 274 | 3300047472 | Ga0495686_0017603 | Ga0495686_0017603_2877_3641 | 249 |
| 275 | 3300048925 | Ga0496122_0038152 | Ga0496122_0038152_742_1506 | 249 |
| 276 | 3300048926 | Ga0496123_0001240 | Ga0496123_0001240_33935_34699 | 249 |
| 277 | 3300049569 | Ga0501032_0000994 | Ga0501032_0000994_929_1690 | 249 |
| 278 | 3300049570 | Ga0501033_0008456 | Ga0501033_0008456_6279_7040 | 249 |
| 279 | 3300049571 | Ga0501034_0001262 | Ga0501034_0001262_21130_21891 | 249 |
| 280 | 3300049572 | Ga0501036_0020650 | Ga0501036_0020650_3688_4449 | 249 |
| 281 | 3300049573 | Ga0501037_0050867 | Ga0501037_0050867_1328_2089 | 249 |
| 282 | 3300049574 | Ga0501038_0003208 | Ga0501038_0003208_4029_4790 | 249 |
| 283 | 3300049575 | Ga0501039_0089749 | Ga0501039_0089749_861_1622 | 249 |
| 284 | 3300049579 | Ga0501043_0001679 | Ga0501043_0001679_5902_6663 | 249 |
| 285 | 3300049580 | Ga0501046_0001275 | Ga0501046_0001275_11087_11848 | 249 |
| 286 | 3300049581 | Ga0501047_0015182 | Ga0501047_0015182_801_1562 | 249 |
| 287 | 3300049586 | Ga0501070_0093200 | Ga0501070_0093200_176_937 | 249 |
| 288 | 3300049589 | Ga0501073_0010811 | Ga0501073_0010811_543_1304 | 249 |
| 289 | 3300049823 | Ga0501044_0001236 | Ga0501044_0001236_12432_13193 | 249 |
| 290 | 3300053087 | Ga0500643_005125 | Ga0500643_005125_987_1751 | 249 |
| 291 | iso_pu_bacteria | 2891633521 | 2891636343 | 249 |
| 292 | 3300005329 | Ga0070683_100601474 | Ga0070683_1006014742 | 250 |
| 293 | 3300005335 | Ga0070666_10000139 | Ga0070666_1000013936 | 250 |
| 294 | 3300025916 | Ga0207663_10491918 | Ga0207663_104919181 | 250 |
| 295 | 3300031824 | Ga0307413_10108800 | Ga0307413_101088003 | 250 |
| 296 | 3300035086 | Ga0373934_0148399 | Ga0373934_0148399_134_904 | 250 |
| 297 | 3300035089 | Ga0373944_0001829 | Ga0373944_0001829_3169_3939 | 250 |
| 298 | 3300036401 | Ga0373937_0767201 | Ga0373937_0767201_71_841 | 250 |
| 299 | 3300037068 | Ga0373925_0287663 | Ga0373925_0287663_323_1093 | 250 |
| 300 | 3300041459 | Ga0451800_0794950 | Ga0451800_0794950_719_1471 | 250 |
| 301 | 3300041512 | Ga0451853_3149850 | Ga0451853_3149850_666_1418 | 250 |
| 302 | 3300046531 | Ga0495665_0138228 | Ga0495665_0138228_87_857 | 250 |
| 303 | 3300046683 | Ga0495658_0023452 | Ga0495658_0023452_1768_2538 | 250 |
| 304 | 3300047471 | Ga0495684_0065199 | Ga0495684_0065199_777_1547 | 250 |
| 305 | 3300053094 | Ga0500566_0206585 | Ga0500566_0206585_123_893 | 250 |
| 306 | 3300002705 | JGI25156J39149_1000899 | JGI25156J39149_10008999 | 251 |
| 307 | 3300002737 | JGI25162J39368_1000068 | JGI25162J39368_100006818 | 251 |
| 308 | 3300002737 | JGI25162J39368_1000529 | JGI25162J39368_10005294 | 251 |
| 309 | 3300002737 | JGI25162J39368_1001106 | JGI25162J39368_100110617 | 251 |
| 310 | 3300002737 | JGI25162J39368_1001478 | JGI25162J39368_10014787 | 251 |
| 311 | 3300002738 | JGI25154J39366_1010050 | JGI25154J39366_10100502 | 251 |
| 312 | 3300002738 | JGI25154J39366_1010317 | JGI25154J39366_10103172 | 251 |
| 313 | 3300002741 | JGI25157J39369_1000503 | JGI25157J39369_100050315 | 251 |
| 314 | 3300002741 | JGI25157J39369_1000649 | JGI25157J39369_100064910 | 251 |
| 315 | 3300002741 | JGI25157J39369_1001287 | JGI25157J39369_100128711 | 251 |
| 316 | 3300002772 | JGI25164J39214_1000102 | JGI25164J39214_100010220 | 251 |
| 317 | 3300002772 | JGI25164J39214_1000142 | JGI25164J39214_100014224 | 251 |
| 318 | 3300002772 | JGI25164J39214_1000366 | JGI25164J39214_10003667 | 251 |
| 319 | 3300003214 | JGI25165J46597_1000058 | JGI25165J46597_1000058140 | 251 |
| 320 | 3300003214 | JGI25165J46597_1000090 | JGI25165J46597_100009030 | 251 |
| 321 | 3300003214 | JGI25165J46597_1000405 | JGI25165J46597_100040541 | 251 |
| 322 | 3300003320 | rootH2_10011619 | rootH2_100116194 | 251 |
| 323 | 3300003323 | rootH1_10137617 | rootH1_101376172 | 251 |
| 324 | 3300003751 | Ga0055538_1002179 | Ga0055538_10021792 | 251 |
| 325 | 3300003752 | Ga0055539_1002596 | Ga0055539_10025962 | 251 |
| 326 | 3300003759 | Ga0055525_1000282 | Ga0055525_100028243 | 251 |
| 327 | 3300003760 | Ga0055527_1000105 | Ga0055527_100010537 | 251 |
| 328 | 3300003760 | Ga0055527_1000630 | Ga0055527_10006305 | 251 |
| 329 | 3300003761 | Ga0055535_1000034 | Ga0055535_100003477 | 251 |
| 330 | 3300003761 | Ga0055535_1000150 | Ga0055535_100015033 | 251 |
| 331 | 3300003761 | Ga0055535_1000765 | Ga0055535_100076510 | 251 |
| 332 | 3300003761 | Ga0055535_1001421 | Ga0055535_10014217 | 251 |
| 333 | 3300003762 | Ga0055542_1000081 | Ga0055542_100008118 | 251 |
| 334 | 3300003762 | Ga0055542_1000112 | Ga0055542_100011217 | 251 |
| 335 | 3300003762 | Ga0055542_1000198 | Ga0055542_100019837 | 251 |
| 336 | 3300003762 | Ga0055542_1000685 | Ga0055542_100068524 | 251 |
| 337 | 3300003762 | Ga0055542_1001350 | Ga0055542_100135010 | 251 |
| 338 | 3300003762 | Ga0055542_1001389 | Ga0055542_10013897 | 251 |
| 339 | 3300003763 | Ga0055529_1000083 | Ga0055529_1000083141 | 251 |
| 340 | 3300003763 | Ga0055529_1000305 | Ga0055529_100030555 | 251 |
| 341 | 3300003763 | Ga0055529_1000343 | Ga0055529_100034319 | 251 |
| 342 | 3300003763 | Ga0055529_1001168 | Ga0055529_100116811 | 251 |
| 343 | 3300005327 | Ga0070658_10004472 | Ga0070658_1000447215 | 251 |
| 344 | 3300005327 | Ga0070658_10014082 | Ga0070658_100140825 | 251 |
| 345 | 3300005327 | Ga0070658_10174126 | Ga0070658_101741263 | 251 |
| 346 | 3300005328 | Ga0070676_10024456 | Ga0070676_100244565 | 251 |
| 347 | 3300005331 | Ga0070670_100317729 | Ga0070670_1003177292 | 251 |
| 348 | 3300005334 | Ga0068869_100210437 | Ga0068869_1002104373 | 251 |
| 349 | 3300005335 | Ga0070666_10000005 | Ga0070666_10000005230 | 251 |
| 350 | 3300005335 | Ga0070666_10393476 | Ga0070666_103934761 | 251 |
| 351 | 3300005336 | Ga0070680_100180304 | Ga0070680_1001803043 | 251 |
| 352 | 3300005338 | Ga0068868_100045123 | Ga0068868_1000451234 | 251 |
| 353 | 3300005340 | Ga0070689_100009283 | Ga0070689_1000092837 | 251 |
| 354 | 3300005340 | Ga0070689_100488236 | Ga0070689_1004882362 | 251 |
| 355 | 3300005344 | Ga0070661_100015169 | Ga0070661_1000151692 | 251 |
| 356 | 3300005344 | Ga0070661_100044109 | Ga0070661_1000441093 | 251 |
| 357 | 3300005345 | Ga0070692_10020685 | Ga0070692_100206853 | 251 |
| 358 | 3300005345 | Ga0070692_10059760 | Ga0070692_100597603 | 251 |
| 359 | 3300005347 | Ga0070668_100026666 | Ga0070668_1000266665 | 251 |
| 360 | 3300005347 | Ga0070668_100149973 | Ga0070668_1001499733 | 251 |
| 361 | 3300005347 | Ga0070668_100253299 | Ga0070668_1002532992 | 251 |
| 362 | 3300005353 | Ga0070669_100016493 | Ga0070669_1000164935 | 251 |
| 363 | 3300005355 | Ga0070671_100077210 | Ga0070671_1000772103 | 251 |
| 364 | 3300005364 | Ga0070673_100120549 | Ga0070673_1001205493 | 251 |
| 365 | 3300005365 | Ga0070688_100469755 | Ga0070688_1004697551 | 251 |
| 366 | 3300005366 | Ga0070659_100005821 | Ga0070659_1000058214 | 251 |
| 367 | 3300005366 | Ga0070659_100071149 | Ga0070659_1000711494 | 251 |
| 368 | 3300005367 | Ga0070667_100018857 | Ga0070667_1000188576 | 251 |
| 369 | 3300005367 | Ga0070667_100024951 | Ga0070667_1000249513 | 251 |
| 370 | 3300005367 | Ga0070667_100043858 | Ga0070667_1000438584 | 251 |
| 371 | 3300005367 | Ga0070667_100280190 | Ga0070667_1002801902 | 251 |
| 372 | 3300005367 | Ga0070667_100337760 | Ga0070667_1003377601 | 251 |
| 373 | 3300005435 | Ga0070714_100000939 | Ga0070714_10000093914 | 251 |
| 374 | 3300005435 | Ga0070714_100007346 | Ga0070714_1000073464 | 251 |
| 375 | 3300005436 | Ga0070713_100002465 | Ga0070713_1000024657 | 251 |
| 376 | 3300005439 | Ga0070711_100032343 | Ga0070711_1000323434 | 251 |
| 377 | 3300005455 | Ga0070663_100001649 | Ga0070663_1000016498 | 251 |
| 378 | 3300005456 | Ga0070678_100050056 | Ga0070678_1000500563 | 251 |
| 379 | 3300005456 | Ga0070678_100154575 | Ga0070678_1001545753 | 251 |
| 380 | 3300005457 | Ga0070662_100034892 | Ga0070662_1000348924 | 251 |
| 381 | 3300005457 | Ga0070662_100149260 | Ga0070662_1001492604 | 251 |
| 382 | 3300005458 | Ga0070681_10003155 | Ga0070681_100031553 | 251 |
| 383 | 3300005458 | Ga0070681_10024225 | Ga0070681_100242255 | 251 |
| 384 | 3300005458 | Ga0070681_10074309 | Ga0070681_100743094 | 251 |
| 385 | 3300005458 | Ga0070681_10418641 | Ga0070681_104186412 | 251 |
| 386 | 3300005458 | Ga0070681_10585883 | Ga0070681_105858832 | 251 |
| 387 | 3300005459 | Ga0068867_100191650 | Ga0068867_1001916502 | 251 |
| 388 | 3300005459 | Ga0068867_100233942 | Ga0068867_1002339422 | 251 |
| 389 | 3300005466 | Ga0070685_10000308 | Ga0070685_1000030821 | 251 |
| 390 | 3300005466 | Ga0070685_10001904 | Ga0070685_100019045 | 251 |
| 391 | 3300005466 | Ga0070685_10107427 | Ga0070685_101074273 | 251 |
| 392 | 3300005530 | Ga0070679_100088874 | Ga0070679_1000888744 | 251 |
| 393 | 3300005530 | Ga0070679_100344694 | Ga0070679_1003446942 | 251 |
| 394 | 3300005539 | Ga0068853_100021361 | Ga0068853_1000213612 | 251 |
| 395 | 3300005539 | Ga0068853_100111517 | Ga0068853_1001115173 | 251 |
| 396 | 3300005539 | Ga0068853_100193373 | Ga0068853_1001933733 | 251 |
| 397 | 3300005539 | Ga0068853_100446917 | Ga0068853_1004469172 | 251 |
| 398 | 3300005543 | Ga0070672_100034754 | Ga0070672_1000347545 | 251 |
| 399 | 3300005543 | Ga0070672_100098629 | Ga0070672_1000986292 | 251 |
| 400 | 3300005544 | Ga0070686_100133620 | Ga0070686_1001336203 | 251 |
| 401 | 3300005546 | Ga0070696_100008073 | Ga0070696_1000080737 | 251 |
| 402 | 3300005547 | Ga0070693_100020137 | Ga0070693_1000201372 | 251 |
| 403 | 3300005547 | Ga0070693_100035759 | Ga0070693_1000357591 | 251 |
| 404 | 3300005547 | Ga0070693_100188758 | Ga0070693_1001887582 | 251 |
| 405 | 3300005548 | Ga0070665_100000057 | Ga0070665_100000057192 | 251 |
| 406 | 3300005548 | Ga0070665_100000786 | Ga0070665_1000007867 | 251 |
| 407 | 3300005548 | Ga0070665_100016441 | Ga0070665_1000164417 | 251 |
| 408 | 3300005548 | Ga0070665_100053328 | Ga0070665_1000533283 | 251 |
| 409 | 3300005548 | Ga0070665_100054474 | Ga0070665_1000544745 | 251 |
| 410 | 3300005548 | Ga0070665_100100784 | Ga0070665_1001007844 | 251 |
| 411 | 3300005563 | Ga0068855_100072014 | Ga0068855_1000720144 | 251 |
| 412 | 3300005564 | Ga0070664_100373813 | Ga0070664_1003738131 | 251 |
| 413 | 3300005614 | Ga0068856_100002901 | Ga0068856_10000290114 | 251 |
| 414 | 3300005614 | Ga0068856_100194948 | Ga0068856_1001949482 | 251 |
| 415 | 3300005614 | Ga0068856_100244011 | Ga0068856_1002440113 | 251 |
| 416 | 3300005616 | Ga0068852_100007756 | Ga0068852_1000077562 | 251 |
| 417 | 3300005616 | Ga0068852_100037184 | Ga0068852_1000371844 | 251 |
| 418 | 3300005616 | Ga0068852_100092176 | Ga0068852_1000921763 | 251 |
| 419 | 3300005616 | Ga0068852_100210891 | Ga0068852_1002108912 | 251 |
| 420 | 3300005617 | Ga0068859_100012737 | Ga0068859_1000127373 | 251 |
| 421 | 3300005617 | Ga0068859_100607966 | Ga0068859_1006079662 | 251 |
| 422 | 3300005719 | Ga0068861_100047445 | Ga0068861_1000474453 | 251 |
| 423 | 3300005719 | Ga0068861_100371257 | Ga0068861_1003712572 | 251 |
| 424 | 3300005834 | Ga0068851_10011405 | Ga0068851_100114054 | 251 |
| 425 | 3300005841 | Ga0068863_100138343 | Ga0068863_1001383433 | 251 |
| 426 | 3300005841 | Ga0068863_100158018 | Ga0068863_1001580183 | 251 |
| 427 | 3300005841 | Ga0068863_100393411 | Ga0068863_1003934112 | 251 |
| 428 | 3300005842 | Ga0068858_100000799 | Ga0068858_10000079919 | 251 |
| 429 | 3300005843 | Ga0068860_100004414 | Ga0068860_1000044145 | 251 |
| 430 | 3300005843 | Ga0068860_100083730 | Ga0068860_1000837302 | 251 |
| 431 | 3300005843 | Ga0068860_100275915 | Ga0068860_1002759152 | 251 |
| 432 | 3300005844 | Ga0068862_100000354 | Ga0068862_10000035423 | 251 |
| 433 | 3300005937 | Ga0081455_10222099 | Ga0081455_102220993 | 251 |
| 434 | 3300006175 | Ga0070712_100414713 | Ga0070712_1004147132 | 251 |
| 435 | 3300006186 | Ga0075369_10015806 | Ga0075369_100158063 | 251 |
| 436 | 3300006237 | Ga0097621_100059618 | Ga0097621_1000596184 | 251 |
| 437 | 3300006358 | Ga0068871_100068577 | Ga0068871_1000685772 | 251 |
| 438 | 3300006358 | Ga0068871_100118007 | Ga0068871_1001180072 | 251 |
| 439 | 3300006881 | Ga0068865_100020670 | Ga0068865_1000206705 | 251 |
| 440 | 3300006881 | Ga0068865_100026562 | Ga0068865_1000265624 | 251 |
| 441 | 3300006881 | Ga0068865_100056814 | Ga0068865_1000568142 | 251 |
| 442 | 3300006881 | Ga0068865_100291414 | Ga0068865_1002914141 | 251 |
| 443 | 3300006881 | Ga0068865_100428952 | Ga0068865_1004289523 | 251 |
| 444 | 3300006931 | Ga0097620_100012737 | Ga0097620_1000127373 | 251 |
| 445 | 3300006931 | Ga0097620_100608063 | Ga0097620_1006080633 | 251 |
| 446 | 3300009093 | Ga0105240_10001717 | Ga0105240_1000171729 | 251 |
| 447 | 3300009093 | Ga0105240_10013812 | Ga0105240_100138126 | 251 |
| 448 | 3300009093 | Ga0105240_10014038 | Ga0105240_100140385 | 251 |
| 449 | 3300009093 | Ga0105240_10068714 | Ga0105240_100687145 | 251 |
| 450 | 3300009098 | Ga0105245_10123332 | Ga0105245_101233324 | 251 |
| 451 | 3300009174 | Ga0105241_10065438 | Ga0105241_100654381 | 251 |
| 452 | 3300009176 | Ga0105242_10014282 | Ga0105242_100142827 | 251 |
| 453 | 3300009177 | Ga0105248_10121135 | Ga0105248_101211353 | 251 |
| 454 | 3300009177 | Ga0105248_10187894 | Ga0105248_101878943 | 251 |
| 455 | 3300009177 | Ga0105248_10471252 | Ga0105248_104712523 | 251 |
| 456 | 3300009177 | Ga0105248_10566420 | Ga0105248_105664202 | 251 |
| 457 | 3300009545 | Ga0105237_10011644 | Ga0105237_100116449 | 251 |
| 458 | 3300009545 | Ga0105237_10059162 | Ga0105237_100591623 | 251 |
| 459 | 3300009551 | Ga0105238_10000060 | Ga0105238_10000060110 | 251 |
| 460 | 3300009551 | Ga0105238_10002702 | Ga0105238_100027029 | 251 |
| 461 | 3300009551 | Ga0105238_10010019 | Ga0105238_100100196 | 251 |
| 462 | 3300009551 | Ga0105238_10014943 | Ga0105238_100149434 | 251 |
| 463 | 3300009551 | Ga0105238_10035037 | Ga0105238_100350374 | 251 |
| 464 | 3300009551 | Ga0105238_10075221 | Ga0105238_100752215 | 251 |
| 465 | 3300009551 | Ga0105238_10119806 | Ga0105238_101198062 | 251 |
| 466 | 3300009551 | Ga0105238_10546496 | Ga0105238_105464961 | 251 |
| 467 | 3300009553 | Ga0105249_10002972 | Ga0105249_100029729 | 251 |
| 468 | 3300009553 | Ga0105249_10064839 | Ga0105249_100648394 | 251 |
| 469 | 3300010375 | Ga0105239_10000044 | Ga0105239_1000004485 | 251 |
| 470 | 3300010375 | Ga0105239_10052378 | Ga0105239_100523783 | 251 |
| 471 | 3300013100 | Ga0157373_10027152 | Ga0157373_100271524 | 251 |
| 472 | 3300013100 | Ga0157373_10084842 | Ga0157373_100848421 | 251 |
| 473 | 3300013100 | Ga0157373_10157281 | Ga0157373_101572813 | 251 |
| 474 | 3300013100 | Ga0157373_10238940 | Ga0157373_102389403 | 251 |
| 475 | 3300013102 | Ga0157371_10031728 | Ga0157371_100317282 | 251 |
| 476 | 3300013102 | Ga0157371_10138140 | Ga0157371_101381402 | 251 |
| 477 | 3300013104 | Ga0157370_10001227 | Ga0157370_1000122712 | 251 |
| 478 | 3300013104 | Ga0157370_10005668 | Ga0157370_100056684 | 251 |
| 479 | 3300013104 | Ga0157370_10038481 | Ga0157370_100384814 | 251 |
| 480 | 3300013104 | Ga0157370_10319581 | Ga0157370_103195813 | 251 |
| 481 | 3300013104 | Ga0157370_10450822 | Ga0157370_104508223 | 251 |
| 482 | 3300013105 | Ga0157369_10000097 | Ga0157369_1000009710 | 251 |
| 483 | 3300013297 | Ga0157378_10867206 | Ga0157378_108672061 | 251 |
| 484 | 3300013306 | Ga0163162_10000016 | Ga0163162_10000016183 | 251 |
| 485 | 3300013306 | Ga0163162_10020407 | Ga0163162_100204076 | 251 |
| 486 | 3300013306 | Ga0163162_10040638 | Ga0163162_100406385 | 251 |
| 487 | 3300013306 | Ga0163162_10124268 | Ga0163162_101242684 | 251 |
| 488 | 3300013307 | Ga0157372_10005441 | Ga0157372_100054414 | 251 |
| 489 | 3300013307 | Ga0157372_10027676 | Ga0157372_100276767 | 251 |
| 490 | 3300013307 | Ga0157372_10156970 | Ga0157372_101569704 | 251 |
| 491 | 3300013307 | Ga0157372_10290687 | Ga0157372_102906873 | 251 |
| 492 | 3300013308 | Ga0157375_10000867 | Ga0157375_1000086719 | 251 |
| 493 | 3300013308 | Ga0157375_10380330 | Ga0157375_103803303 | 251 |
| 494 | 3300014325 | Ga0163163_10234627 | Ga0163163_102346273 | 251 |
| 495 | 3300014968 | Ga0157379_10143915 | Ga0157379_101439152 | 251 |
| 496 | 3300014969 | Ga0157376_10008311 | Ga0157376_100083115 | 251 |
| 497 | 3300014969 | Ga0157376_10015545 | Ga0157376_100155454 | 251 |
| 498 | 3300014969 | Ga0157376_10076148 | Ga0157376_100761483 | 251 |
| 499 | 3300015261 | Ga0182006_1096392 | Ga0182006_10963921 | 251 |
| 500 | 3300015687 | Ga0183368_1003 | Ga0183368_1003987 | 251 |
| 501 | 3300017792 | Ga0163161_10328668 | Ga0163161_103286683 | 251 |
| 502 | 3300020082 | Ga0206353_10652245 | Ga0206353_106522453 | 251 |
| 503 | 3300025206 | Ga0209435_113829 | Ga0209435_1138291 | 251 |
| 504 | 3300025207 | Ga0209760_100462 | Ga0209760_1004627 | 251 |
| 505 | 3300025224 | Ga0209784_100016 | Ga0209784_100016377 | 251 |
| 506 | 3300025226 | Ga0209674_100012 | Ga0209674_100012733 | 251 |
| 507 | 3300025226 | Ga0209674_100244 | Ga0209674_10024413 | 251 |
| 508 | 3300025226 | Ga0209674_100318 | Ga0209674_10031812 | 251 |
| 509 | 3300025226 | Ga0209674_102989 | Ga0209674_1029894 | 251 |
| 510 | 3300025228 | Ga0209672_100007 | Ga0209672_100007129 | 251 |
| 511 | 3300025228 | Ga0209672_100016 | Ga0209672_100016444 | 251 |
| 512 | 3300025228 | Ga0209672_100078 | Ga0209672_100078121 | 251 |
| 513 | 3300025228 | Ga0209672_100673 | Ga0209672_10067320 | 251 |
| 514 | 3300025228 | Ga0209672_100845 | Ga0209672_1008452 | 251 |
| 515 | 3300025230 | Ga0209563_100169 | Ga0209563_1001695 | 251 |
| 516 | 3300025231 | Ga0207427_100019 | Ga0207427_10001937 | 251 |
| 517 | 3300025231 | Ga0207427_100033 | Ga0207427_100033177 | 251 |
| 518 | 3300025231 | Ga0207427_100123 | Ga0207427_10012340 | 251 |
| 519 | 3300025233 | Ga0209437_100012 | Ga0209437_100012206 | 251 |
| 520 | 3300025233 | Ga0209437_100105 | Ga0209437_10010575 | 251 |
| 521 | 3300025233 | Ga0209437_100192 | Ga0209437_100192108 | 251 |
| 522 | 3300025233 | Ga0209437_100227 | Ga0209437_10022756 | 251 |
| 523 | 3300025242 | Ga0209258_100012 | Ga0209258_100012581 | 251 |
| 524 | 3300025242 | Ga0209258_100039 | Ga0209258_100039383 | 251 |
| 525 | 3300025242 | Ga0209258_100046 | Ga0209258_100046208 | 251 |
| 526 | 3300025242 | Ga0209258_100095 | Ga0209258_100095123 | 251 |
| 527 | 3300025242 | Ga0209258_100308 | Ga0209258_10030844 | 251 |
| 528 | 3300025242 | Ga0209258_101017 | Ga0209258_1010177 | 251 |
| 529 | 3300025246 | Ga0209646_1000307 | Ga0209646_100030742 | 251 |
| 530 | 3300025246 | Ga0209646_1000581 | Ga0209646_100058113 | 251 |
| 531 | 3300025250 | Ga0209026_1000012 | Ga0209026_1000012109 | 251 |
| 532 | 3300025250 | Ga0209026_1000140 | Ga0209026_100014072 | 251 |
| 533 | 3300025250 | Ga0209026_1000249 | Ga0209026_100024943 | 251 |
| 534 | 3300025250 | Ga0209026_1000623 | Ga0209026_100062320 | 251 |
| 535 | 3300025250 | Ga0209026_1005476 | Ga0209026_10054763 | 251 |
| 536 | 3300025253 | Ga0209677_105627 | Ga0209677_1056274 | 251 |
| 537 | 3300025254 | Ga0209148_1000001 | Ga0209148_10000011648 | 251 |
| 538 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005711 | 251 |
| 539 | 3300025254 | Ga0209148_1000014 | Ga0209148_100001475 | 251 |
| 540 | 3300025254 | Ga0209148_1000039 | Ga0209148_1000039335 | 251 |
| 541 | 3300025254 | Ga0209148_1000087 | Ga0209148_1000087138 | 251 |
| 542 | 3300025254 | Ga0209148_1000098 | Ga0209148_100009879 | 251 |
| 543 | 3300025256 | Ga0209759_1000750 | Ga0209759_10007507 | 251 |
| 544 | 3300025256 | Ga0209759_1000852 | Ga0209759_100085213 | 251 |
| 545 | 3300025256 | Ga0209759_1000957 | Ga0209759_10009573 | 251 |
| 546 | 3300025256 | Ga0209759_1005344 | Ga0209759_10053443 | 251 |
| 547 | 3300025261 | Ga0209233_1000002 | Ga0209233_1000002584 | 251 |
| 548 | 3300025261 | Ga0209233_1000080 | Ga0209233_1000080177 | 251 |
| 549 | 3300025261 | Ga0209233_1000283 | Ga0209233_100028340 | 251 |
| 550 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010129 | 251 |
| 551 | 3300025272 | Ga0209455_1000034 | Ga0209455_1000034336 | 251 |
| 552 | 3300025272 | Ga0209455_1000039 | Ga0209455_1000039383 | 251 |
| 553 | 3300025272 | Ga0209455_1000126 | Ga0209455_100012639 | 251 |
| 554 | 3300025272 | Ga0209455_1012247 | Ga0209455_10122472 | 251 |
| 555 | 3300025297 | Ga0209758_1054388 | Ga0209758_10543882 | 251 |
| 556 | 3300025315 | Ga0207697_10090836 | Ga0207697_100908362 | 251 |
| 557 | 3300025321 | Ga0207656_10000302 | Ga0207656_100003025 | 251 |
| 558 | 3300025900 | Ga0207710_10104707 | Ga0207710_101047072 | 251 |
| 559 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005588 | 251 |
| 560 | 3300025903 | Ga0207680_10002436 | Ga0207680_100024363 | 251 |
| 561 | 3300025903 | Ga0207680_10331950 | Ga0207680_103319502 | 251 |
| 562 | 3300025904 | Ga0207647_10014022 | Ga0207647_100140223 | 251 |
| 563 | 3300025906 | Ga0207699_10426022 | Ga0207699_104260222 | 251 |
| 564 | 3300025907 | Ga0207645_10019755 | Ga0207645_100197553 | 251 |
| 565 | 3300025908 | Ga0207643_10061333 | Ga0207643_100613333 | 251 |
| 566 | 3300025912 | Ga0207707_10006499 | Ga0207707_100064998 | 251 |
| 567 | 3300025912 | Ga0207707_10028395 | Ga0207707_100283955 | 251 |
| 568 | 3300025912 | Ga0207707_10070210 | Ga0207707_100702103 | 251 |
| 569 | 3300025912 | Ga0207707_10081282 | Ga0207707_100812823 | 251 |
| 570 | 3300025912 | Ga0207707_10418443 | Ga0207707_104184432 | 251 |
| 571 | 3300025913 | Ga0207695_10000033 | Ga0207695_10000033187 | 251 |
| 572 | 3300025913 | Ga0207695_10000294 | Ga0207695_1000029494 | 251 |
| 573 | 3300025913 | Ga0207695_10016454 | Ga0207695_100164545 | 251 |
| 574 | 3300025913 | Ga0207695_10049940 | Ga0207695_100499402 | 251 |
| 575 | 3300025913 | Ga0207695_10160462 | Ga0207695_101604623 | 251 |
| 576 | 3300025913 | Ga0207695_10240770 | Ga0207695_102407704 | 251 |
| 577 | 3300025914 | Ga0207671_10004485 | Ga0207671_1000448510 | 251 |
| 578 | 3300025914 | Ga0207671_10008000 | Ga0207671_100080005 | 251 |
| 579 | 3300025914 | Ga0207671_10099159 | Ga0207671_100991592 | 251 |
| 580 | 3300025917 | Ga0207660_10315276 | Ga0207660_103152762 | 251 |
| 581 | 3300025919 | Ga0207657_10213453 | Ga0207657_102134532 | 251 |
| 582 | 3300025920 | Ga0207649_10044527 | Ga0207649_100445273 | 251 |
| 583 | 3300025921 | Ga0207652_10048611 | Ga0207652_100486115 | 251 |
| 584 | 3300025921 | Ga0207652_10180745 | Ga0207652_101807452 | 251 |
| 585 | 3300025923 | Ga0207681_10067551 | Ga0207681_100675513 | 251 |
| 586 | 3300025924 | Ga0207694_10000332 | Ga0207694_1000033244 | 251 |
| 587 | 3300025924 | Ga0207694_10000487 | Ga0207694_100004879 | 251 |
| 588 | 3300025924 | Ga0207694_10001035 | Ga0207694_100010357 | 251 |
| 589 | 3300025924 | Ga0207694_10007924 | Ga0207694_100079244 | 251 |
| 590 | 3300025924 | Ga0207694_10039531 | Ga0207694_100395314 | 251 |
| 591 | 3300025924 | Ga0207694_10145124 | Ga0207694_101451243 | 251 |
| 592 | 3300025925 | Ga0207650_10055870 | Ga0207650_100558702 | 251 |
| 593 | 3300025925 | Ga0207650_10174958 | Ga0207650_101749582 | 251 |
| 594 | 3300025928 | Ga0207700_10016208 | Ga0207700_100162082 | 251 |
| 595 | 3300025929 | Ga0207664_10000036 | Ga0207664_10000036168 | 251 |
| 596 | 3300025929 | Ga0207664_10000901 | Ga0207664_100009015 | 251 |
| 597 | 3300025931 | Ga0207644_10061871 | Ga0207644_100618713 | 251 |
| 598 | 3300025931 | Ga0207644_10070309 | Ga0207644_100703093 | 251 |
| 599 | 3300025932 | Ga0207690_10001378 | Ga0207690_100013785 | 251 |
| 600 | 3300025932 | Ga0207690_10093964 | Ga0207690_100939641 | 251 |
| 601 | 3300025932 | Ga0207690_10106675 | Ga0207690_101066752 | 251 |
| 602 | 3300025933 | Ga0207706_10008621 | Ga0207706_100086215 | 251 |
| 603 | 3300025934 | Ga0207686_10082136 | Ga0207686_100821363 | 251 |
| 604 | 3300025934 | Ga0207686_10414213 | Ga0207686_104142131 | 251 |
| 605 | 3300025936 | Ga0207670_10002849 | Ga0207670_100028497 | 251 |
| 606 | 3300025936 | Ga0207670_10124769 | Ga0207670_101247692 | 251 |
| 607 | 3300025938 | Ga0207704_10051710 | Ga0207704_100517104 | 251 |
| 608 | 3300025938 | Ga0207704_10058952 | Ga0207704_100589524 | 251 |
| 609 | 3300025938 | Ga0207704_10111132 | Ga0207704_101111321 | 251 |
| 610 | 3300025938 | Ga0207704_10214075 | Ga0207704_102140753 | 251 |
| 611 | 3300025938 | Ga0207704_10228012 | Ga0207704_102280122 | 251 |
| 612 | 3300025940 | Ga0207691_10004047 | Ga0207691_100040477 | 251 |
| 613 | 3300025940 | Ga0207691_10141568 | Ga0207691_101415682 | 251 |
| 614 | 3300025941 | Ga0207711_10193280 | Ga0207711_101932802 | 251 |
| 615 | 3300025942 | Ga0207689_10028306 | Ga0207689_100283064 | 251 |
| 616 | 3300025942 | Ga0207689_10059518 | Ga0207689_100595184 | 251 |
| 617 | 3300025945 | Ga0207679_10233207 | Ga0207679_102332072 | 251 |
| 618 | 3300025949 | Ga0207667_10031186 | Ga0207667_100311866 | 251 |
| 619 | 3300025949 | Ga0207667_10124665 | Ga0207667_101246652 | 251 |
| 620 | 3300025949 | Ga0207667_10249130 | Ga0207667_102491302 | 251 |
| 621 | 3300025949 | Ga0207667_10376233 | Ga0207667_103762332 | 251 |
| 622 | 3300025961 | Ga0207712_10000288 | Ga0207712_1000028836 | 251 |
| 623 | 3300025961 | Ga0207712_10075447 | Ga0207712_100754472 | 251 |
| 624 | 3300025972 | Ga0207668_10165228 | Ga0207668_101652283 | 251 |
| 625 | 3300025972 | Ga0207668_10206568 | Ga0207668_102065683 | 251 |
| 626 | 3300025981 | Ga0207640_10101119 | Ga0207640_101011193 | 251 |
| 627 | 3300025981 | Ga0207640_10117064 | Ga0207640_101170644 | 251 |
| 628 | 3300025986 | Ga0207658_10031575 | Ga0207658_100315753 | 251 |
| 629 | 3300025986 | Ga0207658_10540140 | Ga0207658_105401401 | 251 |
| 630 | 3300026035 | Ga0207703_10001120 | Ga0207703_1000112010 | 251 |
| 631 | 3300026041 | Ga0207639_10002655 | Ga0207639_100026555 | 251 |
| 632 | 3300026041 | Ga0207639_10008066 | Ga0207639_100080668 | 251 |
| 633 | 3300026041 | Ga0207639_10011603 | Ga0207639_100116036 | 251 |
| 634 | 3300026041 | Ga0207639_10094754 | Ga0207639_100947542 | 251 |
| 635 | 3300026041 | Ga0207639_10532087 | Ga0207639_105320871 | 251 |
| 636 | 3300026067 | Ga0207678_10011976 | Ga0207678_100119765 | 251 |
| 637 | 3300026067 | Ga0207678_10131037 | Ga0207678_101310374 | 251 |
| 638 | 3300026067 | Ga0207678_10194393 | Ga0207678_101943933 | 251 |
| 639 | 3300026067 | Ga0207678_10693491 | Ga0207678_106934911 | 251 |
| 640 | 3300026078 | Ga0207702_10000340 | Ga0207702_1000034041 | 251 |
| 641 | 3300026078 | Ga0207702_10107722 | Ga0207702_101077223 | 251 |
| 642 | 3300026078 | Ga0207702_10121622 | Ga0207702_101216222 | 251 |
| 643 | 3300026078 | Ga0207702_10302808 | Ga0207702_103028082 | 251 |
| 644 | 3300026088 | Ga0207641_10120752 | Ga0207641_101207523 | 251 |
| 645 | 3300026088 | Ga0207641_10189016 | Ga0207641_101890162 | 251 |
| 646 | 3300026088 | Ga0207641_10357061 | Ga0207641_103570613 | 251 |
| 647 | 3300026088 | Ga0207641_10436414 | Ga0207641_104364142 | 251 |
| 648 | 3300026089 | Ga0207648_10048514 | Ga0207648_100485141 | 251 |
| 649 | 3300026089 | Ga0207648_10075262 | Ga0207648_100752623 | 251 |
| 650 | 3300026089 | Ga0207648_10148216 | Ga0207648_101482163 | 251 |
| 651 | 3300026116 | Ga0207674_10019334 | Ga0207674_100193343 | 251 |
| 652 | 3300026118 | Ga0207675_100069569 | Ga0207675_1000695693 | 251 |
| 653 | 3300026121 | Ga0207683_10174862 | Ga0207683_101748623 | 251 |
| 654 | 3300026142 | Ga0207698_10073753 | Ga0207698_100737532 | 251 |
| 655 | 3300026142 | Ga0207698_10093018 | Ga0207698_100930183 | 251 |
| 656 | 3300026142 | Ga0207698_10404863 | Ga0207698_104048631 | 251 |
| 657 | 3300027312 | Ga0209371_1000072 | Ga0209371_100007262 | 251 |
| 658 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012844 | 251 |
| 659 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004943 | 251 |
| 660 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006128 | 251 |
| 661 | 3300028379 | Ga0268266_10030884 | Ga0268266_100308844 | 251 |
| 662 | 3300028379 | Ga0268266_10067829 | Ga0268266_100678293 | 251 |
| 663 | 3300028379 | Ga0268266_10134875 | Ga0268266_101348754 | 251 |
| 664 | 3300028380 | Ga0268265_10000775 | Ga0268265_1000077511 | 251 |
| 665 | 3300028380 | Ga0268265_10152847 | Ga0268265_101528472 | 251 |
| 666 | 3300028381 | Ga0268264_10005953 | Ga0268264_100059537 | 251 |
| 667 | 3300028381 | Ga0268264_10083899 | Ga0268264_100838993 | 251 |
| 668 | 3300028381 | Ga0268264_10654758 | Ga0268264_106547582 | 251 |
| 669 | 3300028786 | Ga0307517_10148851 | Ga0307517_101488512 | 251 |
| 670 | 3300030500 | Ga0268256_1000065 | Ga0268256_100006562 | 251 |
| 671 | 3300031616 | Ga0307508_10436776 | Ga0307508_104367761 | 251 |
| 672 | 3300033180 | Ga0307510_10020810 | Ga0307510_100208105 | 251 |
| 673 | 3300037312 | Ga0395899_0000175 | Ga0395899_0000175_91643_92401 | 251 |
| 674 | 3300037312 | Ga0395899_0083556 | Ga0395899_0083556_672_1445 | 251 |
| 675 | 3300037418 | Ga0395900_0000012 | Ga0395900_0000012_356979_357737 | 251 |
| 676 | 3300037418 | Ga0395900_0000590 | Ga0395900_0000590_14598_15353 | 251 |
| 677 | 3300037418 | Ga0395900_0003017 | Ga0395900_0003017_8235_8990 | 251 |
| 678 | 3300037418 | Ga0395900_0113437 | Ga0395900_0113437_384_1142 | 251 |
| 679 | 3300037466 | Ga0395898_0000034 | Ga0395898_0000034_191446_192204 | 251 |
| 680 | 3300037466 | Ga0395898_0000197 | Ga0395898_0000197_8887_9645 | 251 |
| 681 | 3300037466 | Ga0395898_0084511 | Ga0395898_0084511_1184_1957 | 251 |
| 682 | 3300037466 | Ga0395898_0187964 | Ga0395898_0187964_981_1736 | 251 |
| 683 | 3300037466 | Ga0395898_0261181 | Ga0395898_0261181_795_1553 | 251 |
| 684 | 3300037471 | Ga0395905_0530847 | Ga0395905_0530847_20_793 | 251 |
| 685 | 3300038443 | Ga0395901_0002395 | Ga0395901_0002395_8618_9376 | 251 |
| 686 | 3300038443 | Ga0395901_0099480 | Ga0395901_0099480_205_963 | 251 |
| 687 | 3300038443 | Ga0395901_0321976 | Ga0395901_0321976_301_1059 | 251 |
| 688 | 3300038443 | Ga0395901_0527910 | Ga0395901_0527910_28_786 | 251 |
| 689 | 3300041451 | Ga0451791_0120622 | Ga0451791_0120622_514_1320 | 251 |
| 690 | 3300041463 | Ga0451804_0827444 | Ga0451804_0827444_687_1490 | 251 |
| 691 | 3300042006 | Ga0439432_033213 | Ga0439432_033213_711_1469 | 251 |
| 692 | 3300044656 | Ga0466969_0003088 | Ga0466969_0003088_1169_1930 | 251 |
| 693 | 3300044656 | Ga0466969_0006890 | Ga0466969_0006890_598_1356 | 251 |
| 694 | 3300044684 | Ga0466966_0089385 | Ga0466966_0089385_1114_1875 | 251 |
| 695 | 3300044684 | Ga0466966_0182397 | Ga0466966_0182397_210_968 | 251 |
| 696 | 3300044693 | Ga0466961_0009198 | Ga0466961_0009198_4476_5234 | 251 |
| 697 | 3300044693 | Ga0466961_0011333 | Ga0466961_0011333_1683_2441 | 251 |
| 698 | 3300044693 | Ga0466961_0012228 | Ga0466961_0012228_1864_2625 | 251 |
| 699 | 3300044693 | Ga0466961_0033217 | Ga0466961_0033217_548_1306 | 251 |
| 700 | 3300044693 | Ga0466961_0193868 | Ga0466961_0193868_307_1065 | 251 |
| 701 | 3300044706 | Ga0466964_0082481 | Ga0466964_0082481_92_850 | 251 |
| 702 | 3300044719 | Ga0466971_0004168 | Ga0466971_0004168_4371_5129 | 251 |
| 703 | 3300044719 | Ga0466971_0005065 | Ga0466971_0005065_1723_2481 | 251 |
| 704 | 3300044765 | Ga0466970_0001017 | Ga0466970_0001017_6816_7607 | 251 |
| 705 | 3300044765 | Ga0466970_0016399 | Ga0466970_0016399_1241_1999 | 251 |
| 706 | 3300044765 | Ga0466970_0156709 | Ga0466970_0156709_307_1065 | 251 |
| 707 | 3300044842 | Ga0466957_0015342 | Ga0466957_0015342_1476_2234 | 251 |
| 708 | 3300045049 | Ga0466959_0001920 | Ga0466959_0001920_11081_11842 | 251 |
| 709 | 3300045049 | Ga0466959_0019916 | Ga0466959_0019916_1557_2315 | 251 |
| 710 | 3300045049 | Ga0466959_0058121 | Ga0466959_0058121_1639_2397 | 251 |
| 711 | 3300045049 | Ga0466959_0070366 | Ga0466959_0070366_1557_2315 | 251 |
| 712 | 3300045836 | Ga0466958_0005201 | Ga0466958_0005201_783_1541 | 251 |
| 713 | 3300045836 | Ga0466958_0022314 | Ga0466958_0022314_986_1744 | 251 |
| 714 | 3300045976 | Ga0466967_0203723 | Ga0466967_0203723_554_1330 | 251 |
| 715 | 3300046460 | Ga0495638_0000159 | Ga0495638_0000159_13721_14479 | 251 |
| 716 | 3300046460 | Ga0495638_0000161 | Ga0495638_0000161_44094_44852 | 251 |
| 717 | 3300046471 | Ga0495650_0000197 | Ga0495650_0000197_102916_103674 | 251 |
| 718 | 3300046471 | Ga0495650_0000590 | Ga0495650_0000590_10802_11557 | 251 |
| 719 | 3300046501 | Ga0495607_0000508 | Ga0495607_0000508_23410_24177 | 251 |
| 720 | 3300046501 | Ga0495607_0041187 | Ga0495607_0041187_411_1178 | 251 |
| 721 | 3300046507 | Ga0495606_0000940 | Ga0495606_0000940_20850_21608 | 251 |
| 722 | 3300046507 | Ga0495606_0009272 | Ga0495606_0009272_3362_4129 | 251 |
| 723 | 3300046533 | Ga0495640_0224766 | Ga0495640_0224766_247_1023 | 251 |
| 724 | 3300046660 | Ga0495625_0026760 | Ga0495625_0026760_3187_3945 | 251 |
| 725 | 3300046660 | Ga0495625_0113192 | Ga0495625_0113192_40_795 | 251 |
| 726 | 3300046683 | Ga0495658_0116546 | Ga0495658_0116546_691_1470 | 251 |
| 727 | 3300046694 | Ga0495649_0002293 | Ga0495649_0002293_7135_7893 | 251 |
| 728 | 3300047472 | Ga0495686_0000175 | Ga0495686_0000175_106827_107594 | 251 |
| 729 | 3300048904 | Ga0496101_0025554 | Ga0496101_0025554_460_1239 | 251 |
| 730 | 3300048907 | Ga0496104_0000011 | Ga0496104_0000011_215754_216527 | 251 |
| 731 | 3300048907 | Ga0496104_0538061 | Ga0496104_0538061_246_1004 | 251 |
| 732 | 3300048908 | Ga0496105_0000014 | Ga0496105_0000014_215781_216554 | 251 |
| 733 | 3300048908 | Ga0496105_0016340 | Ga0496105_0016340_1533_2291 | 251 |
| 734 | 3300048909 | Ga0496106_0181925 | Ga0496106_0181925_362_1120 | 251 |
| 735 | 3300048917 | Ga0496114_0395867 | Ga0496114_0395867_248_1024 | 251 |
| 736 | 3300048918 | Ga0496115_0000025 | Ga0496115_0000025_389_1147 | 251 |
| 737 | 3300048918 | Ga0496115_0000974 | Ga0496115_0000974_13725_14483 | 251 |
| 738 | 3300048918 | Ga0496115_0022193 | Ga0496115_0022193_3253_4011 | 251 |
| 739 | 3300048920 | Ga0496117_0019447 | Ga0496117_0019447_4795_5553 | 251 |
| 740 | 3300048920 | Ga0496117_0062426 | Ga0496117_0062426_316_1074 | 251 |
| 741 | 3300048921 | Ga0496118_0004230 | Ga0496118_0004230_15893_16651 | 251 |
| 742 | 3300048921 | Ga0496118_0018702 | Ga0496118_0018702_2844_3611 | 251 |
| 743 | 3300048922 | Ga0496119_0001095 | Ga0496119_0001095_14541_15299 | 251 |
| 744 | 3300048922 | Ga0496119_0062380 | Ga0496119_0062380_1406_2164 | 251 |
| 745 | 3300048923 | Ga0496120_0000656 | Ga0496120_0000656_49320_50078 | 251 |
| 746 | 3300048923 | Ga0496120_0013968 | Ga0496120_0013968_3132_3890 | 251 |
| 747 | 3300048924 | Ga0496121_0009617 | Ga0496121_0009617_3689_4447 | 251 |
| 748 | 3300048924 | Ga0496121_0042777 | Ga0496121_0042777_2347_3105 | 251 |
| 749 | 3300048924 | Ga0496121_0087285 | Ga0496121_0087285_545_1303 | 251 |
| 750 | 3300048924 | Ga0496121_0184405 | Ga0496121_0184405_492_1247 | 251 |
| 751 | 3300048929 | Ga0496126_0003518 | Ga0496126_0003518_9134_9892 | 251 |
| 752 | 3300048929 | Ga0496126_0023183 | Ga0496126_0023183_855_1613 | 251 |
| 753 | 3300048929 | Ga0496126_0059039 | Ga0496126_0059039_1261_2016 | 251 |
| 754 | 3300048929 | Ga0496126_0114480 | Ga0496126_0114480_904_1662 | 251 |
| 755 | 3300049568 | Ga0501031_0018033 | Ga0501031_0018033_190_966 | 251 |
| 756 | 3300049568 | Ga0501031_0024897 | Ga0501031_0024897_2300_3076 | 251 |
| 757 | 3300049568 | Ga0501031_0046675 | Ga0501031_0046675_667_1425 | 251 |
| 758 | 3300049569 | Ga0501032_0007509 | Ga0501032_0007509_1688_2464 | 251 |
| 759 | 3300049569 | Ga0501032_0036367 | Ga0501032_0036367_1116_1874 | 251 |
| 760 | 3300049569 | Ga0501032_0151679 | Ga0501032_0151679_210_986 | 251 |
| 761 | 3300049570 | Ga0501033_0000550 | Ga0501033_0000550_1435_2331 | 251 |
| 762 | 3300049570 | Ga0501033_0006764 | Ga0501033_0006764_5379_6155 | 251 |
| 763 | 3300049570 | Ga0501033_0060705 | Ga0501033_0060705_1228_1986 | 251 |
| 764 | 3300049571 | Ga0501034_0002423 | Ga0501034_0002423_7494_8270 | 251 |
| 765 | 3300049571 | Ga0501034_0039328 | Ga0501034_0039328_1037_1807 | 251 |
| 766 | 3300049572 | Ga0501036_0047657 | Ga0501036_0047657_1938_2714 | 251 |
| 767 | 3300049572 | Ga0501036_0117080 | Ga0501036_0117080_454_1230 | 251 |
| 768 | 3300049573 | Ga0501037_0010539 | Ga0501037_0010539_3212_3988 | 251 |
| 769 | 3300049573 | Ga0501037_0069638 | Ga0501037_0069638_1101_1877 | 251 |
| 770 | 3300049573 | Ga0501037_0101647 | Ga0501037_0101647_57_815 | 251 |
| 771 | 3300049574 | Ga0501038_0016661 | Ga0501038_0016661_2280_3056 | 251 |
| 772 | 3300049574 | Ga0501038_0033729 | Ga0501038_0033729_882_1658 | 251 |
| 773 | 3300049574 | Ga0501038_0120395 | Ga0501038_0120395_1210_1986 | 251 |
| 774 | 3300049574 | Ga0501038_0180829 | Ga0501038_0180829_796_1554 | 251 |
| 775 | 3300049574 | Ga0501038_0304105 | Ga0501038_0304105_290_1060 | 251 |
| 776 | 3300049575 | Ga0501039_0003438 | Ga0501039_0003438_5899_6675 | 251 |
| 777 | 3300049575 | Ga0501039_0111912 | Ga0501039_0111912_473_1231 | 251 |
| 778 | 3300049578 | Ga0501042_0032210 | Ga0501042_0032210_2545_3303 | 251 |
| 779 | 3300049578 | Ga0501042_0177115 | Ga0501042_0177115_541_1317 | 251 |
| 780 | 3300049579 | Ga0501043_0022649 | Ga0501043_0022649_1348_2124 | 251 |
| 781 | 3300049579 | Ga0501043_0078288 | Ga0501043_0078288_655_1413 | 251 |
| 782 | 3300049580 | Ga0501046_0026065 | Ga0501046_0026065_2452_3228 | 251 |
| 783 | 3300049580 | Ga0501046_0051077 | Ga0501046_0051077_401_1177 | 251 |
| 784 | 3300049580 | Ga0501046_0104255 | Ga0501046_0104255_989_1747 | 251 |
| 785 | 3300049581 | Ga0501047_0016313 | Ga0501047_0016313_5125_5901 | 251 |
| 786 | 3300049581 | Ga0501047_0046648 | Ga0501047_0046648_1248_2006 | 251 |
| 787 | 3300049581 | Ga0501047_0156480 | Ga0501047_0156480_36_812 | 251 |
| 788 | 3300049581 | Ga0501047_0266593 | Ga0501047_0266593_718_1494 | 251 |
| 789 | 3300049583 | Ga0501067_0027913 | Ga0501067_0027913_1077_1853 | 251 |
| 790 | 3300049584 | Ga0501068_0023128 | Ga0501068_0023128_1315_2091 | 251 |
| 791 | 3300049586 | Ga0501070_0010811 | Ga0501070_0010811_2946_3722 | 251 |
| 792 | 3300049586 | Ga0501070_0081453 | Ga0501070_0081453_1269_2027 | 251 |
| 793 | 3300049587 | Ga0501071_0022609 | Ga0501071_0022609_1071_1847 | 251 |
| 794 | 3300049588 | Ga0501072_0067873 | Ga0501072_0067873_1284_2060 | 251 |
| 795 | 3300049589 | Ga0501073_0003183 | Ga0501073_0003183_5967_6743 | 251 |
| 796 | 3300049589 | Ga0501073_0124857 | Ga0501073_0124857_557_1315 | 251 |
| 797 | 3300049589 | Ga0501073_0240851 | Ga0501073_0240851_229_1005 | 251 |
| 798 | 3300049590 | Ga0501074_0272882 | Ga0501074_0272882_158_934 | 251 |
| 799 | 3300049593 | Ga0501077_0127499 | Ga0501077_0127499_131_892 | 251 |
| 800 | 3300049742 | Ga0501080_0003297 | Ga0501080_0003297_12617_13393 | 251 |
| 801 | 3300049742 | Ga0501080_0062906 | Ga0501080_0062906_1332_2090 | 251 |
| 802 | 3300049742 | Ga0501080_0135246 | Ga0501080_0135246_1468_2244 | 251 |
| 803 | 3300049742 | Ga0501080_0195615 | Ga0501080_0195615_550_1326 | 251 |
| 804 | 3300049744 | Ga0501083_0066365 | Ga0501083_0066365_1148_1924 | 251 |
| 805 | 3300049822 | Ga0501035_0021974 | Ga0501035_0021974_3624_4400 | 251 |
| 806 | 3300049822 | Ga0501035_0039997 | Ga0501035_0039997_2254_3012 | 251 |
| 807 | 3300049822 | Ga0501035_0084771 | Ga0501035_0084771_1015_1911 | 251 |
| 808 | 3300049822 | Ga0501035_0090024 | Ga0501035_0090024_1716_2492 | 251 |
| 809 | 3300049822 | Ga0501035_0142153 | Ga0501035_0142153_347_1120 | 251 |
| 810 | 3300049822 | Ga0501035_0238283 | Ga0501035_0238283_535_1293 | 251 |
| 811 | 3300049823 | Ga0501044_0012392 | Ga0501044_0012392_4847_5623 | 251 |
| 812 | 3300049823 | Ga0501044_0017345 | Ga0501044_0017345_2678_3448 | 251 |
| 813 | 3300049823 | Ga0501044_0096134 | Ga0501044_0096134_1796_2554 | 251 |
| 814 | 3300049823 | Ga0501044_0096304 | Ga0501044_0096304_723_1499 | 251 |
| 815 | 3300049823 | Ga0501044_0156699 | Ga0501044_0156699_24_800 | 251 |
| 816 | 3300049823 | Ga0501044_0242320 | Ga0501044_0242320_849_1625 | 251 |
| 817 | 3300049823 | Ga0501044_0260492 | Ga0501044_0260492_387_1145 | 251 |
| 818 | 3300049824 | Ga0501045_0131719 | Ga0501045_0131719_426_1184 | 251 |
| 819 | 3300050516 | nmdc:mga0sz30_10261_c1 | nmdc:mga0sz30_10261_c1_1776_2543 | 251 |
| 820 | 3300053139 | Ga0500568_0000145 | Ga0500568_0000145_54633_55409 | 251 |
| 821 | 3300053163 | Ga0500639_193770 | Ga0500639_193770_48_824 | 251 |
| 822 | 3300053177 | Ga0500636_0132008 | Ga0500636_0132008_138_914 | 251 |
| 823 | 3300060353 | Ga0501082_0015830 | Ga0501082_0015830_4937_5713 | 251 |
| 824 | 3300060353 | Ga0501082_0095259 | Ga0501082_0095259_1522_2298 | 251 |
| 825 | 3300061719 | Ga0466962_0004731 | Ga0466962_0004731_2693_3451 | 251 |
| 826 | 3300061719 | Ga0466962_0012527 | Ga0466962_0012527_893_1654 | 251 |
| 827 | 3300001979 | JGI24740J21852_10001236 | JGI24740J21852_100012367 | 252 |
| 828 | 3300001989 | JGI24739J22299_10000042 | JGI24739J22299_1000004232 | 252 |
| 829 | 3300001989 | JGI24739J22299_10000993 | JGI24739J22299_100009935 | 252 |
| 830 | 3300001990 | JGI24737J22298_10006310 | JGI24737J22298_100063103 | 252 |
| 831 | 3300002067 | JGI24735J21928_10003420 | JGI24735J21928_100034204 | 252 |
| 832 | 3300002067 | JGI24735J21928_10024489 | JGI24735J21928_100244893 | 252 |
| 833 | 3300002773 | JGI25152J39213_1028829 | JGI25152J39213_10288291 | 252 |
| 834 | 3300003578 | Ga0006562J51391_1073184 | Ga0006562J51391_10731844 | 252 |
| 835 | 3300003578 | Ga0006562J51391_1073185 | Ga0006562J51391_10731854 | 252 |
| 836 | 3300005262 | Ga0065165_1003057 | Ga0065165_10030578 | 252 |
| 837 | 3300005455 | Ga0070663_100019477 | Ga0070663_1000194773 | 252 |
| 838 | 3300005457 | Ga0070662_100267179 | Ga0070662_1002671791 | 252 |
| 839 | 3300005577 | Ga0068857_100025352 | Ga0068857_1000253524 | 252 |
| 840 | 3300005616 | Ga0068852_100134564 | Ga0068852_1001345642 | 252 |
| 841 | 3300005834 | Ga0068851_10033803 | Ga0068851_100338034 | 252 |
| 842 | 3300009093 | Ga0105240_10013498 | Ga0105240_100134988 | 252 |
| 843 | 3300009093 | Ga0105240_10761909 | Ga0105240_107619092 | 252 |
| 844 | 3300009545 | Ga0105237_10000023 | Ga0105237_100000239 | 252 |
| 845 | 3300010375 | Ga0105239_10128629 | Ga0105239_101286294 | 252 |
| 846 | 3300012500 | Ga0157314_1000333 | Ga0157314_10003337 | 252 |
| 847 | 3300025258 | Ga0209129_1007635 | Ga0209129_10076352 | 252 |
| 848 | 3300025297 | Ga0209758_1002406 | Ga0209758_10024069 | 252 |
| 849 | 3300025297 | Ga0209758_1015870 | Ga0209758_10158705 | 252 |
| 850 | 3300025321 | Ga0207656_10001499 | Ga0207656_100014992 | 252 |
| 851 | 3300025913 | Ga0207695_10001068 | Ga0207695_1000106815 | 252 |
| 852 | 3300025913 | Ga0207695_10002599 | Ga0207695_1000259916 | 252 |
| 853 | 3300025913 | Ga0207695_10041406 | Ga0207695_100414063 | 252 |
| 854 | 3300025914 | Ga0207671_10000020 | Ga0207671_10000020226 | 252 |
| 855 | 3300025914 | Ga0207671_10000033 | Ga0207671_1000003329 | 252 |
| 856 | 3300025949 | Ga0207667_10000130 | Ga0207667_10000130114 | 252 |
| 857 | 3300025981 | Ga0207640_10003468 | Ga0207640_100034688 | 252 |
| 858 | 3300026035 | Ga0207703_10036724 | Ga0207703_100367244 | 252 |
| 859 | 3300026067 | Ga0207678_10032619 | Ga0207678_100326193 | 252 |
| 860 | 3300026116 | Ga0207674_10000218 | Ga0207674_1000021873 | 252 |
| 861 | 3300026142 | Ga0207698_10005033 | Ga0207698_100050334 | 252 |
| 862 | 3300037418 | Ga0395900_0020607 | Ga0395900_0020607_1380_2165 | 252 |
| 863 | 3300044656 | Ga0466969_0042668 | Ga0466969_0042668_1134_1892 | 252 |
| 864 | 3300044672 | Ga0466982_0000020 | Ga0466982_0000020_66600_67358 | 252 |
| 865 | 3300044683 | Ga0466965_0054319 | Ga0466965_0054319_304_1062 | 252 |
| 866 | 3300044706 | Ga0466964_0007547 | Ga0466964_0007547_1397_2155 | 252 |
| 867 | 3300044719 | Ga0466971_0019375 | Ga0466971_0019375_1146_1904 | 252 |
| 868 | 3300044735 | Ga0466968_0010922 | Ga0466968_0010922_1399_2163 | 252 |
| 869 | 3300044735 | Ga0466968_0013147 | Ga0466968_0013147_1161_1919 | 252 |
| 870 | 3300044765 | Ga0466970_0040551 | Ga0466970_0040551_221_979 | 252 |
| 871 | 3300044842 | Ga0466957_0230339 | Ga0466957_0230339_127_885 | 252 |
| 872 | 3300044901 | Ga0466960_0006030 | Ga0466960_0006030_1752_2510 | 252 |
| 873 | 3300048928 | Ga0496125_0000344 | Ga0496125_0000344_72204_72962 | 252 |
| 874 | 3300061719 | Ga0466962_0006238 | Ga0466962_0006238_2133_2891 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.8273 | 14 | 243 |
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.8106 | 14 | 243 |
| 1ktm-assembly1.cif.gz_A | solution structure of fat domain of focal adhesion kinase | 0.5615 | 67 | 183 |
| 5oc0-assembly1.cif.gz_A | structure of e. coli superoxide oxidase | 0.5327 | 71 | 194 |
| 6w6x-assembly1.cif.gz_A | crystal structure of able apo-protein | 0.5327 | 63 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q08CE6_110_279_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.8122 | 57 | 145 | 1.20.140.150 |
| af_A0A1D6JN65_108_240_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7233 | 60 | 186 | 1.20.120.1770 |
| af_A0A1D6JN65_108_240_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.692 | 60 | 186 | 1.20.120.1770 |
| af_Q8S8F1_85_256_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.5962 | 6 | 184 | 1.20.120.1770 |
| af_F1LZS9_42_166_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.5868 | 68 | 174 | 1.20.120.350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A558DEJ1-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein) | 0.9606 | 11 | 252 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A522IJA9-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein) | 0.9583 | 1 | 252 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A2V1JTV0-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein) | 0.9573 | 12 | 251 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A254TKK9-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein) | 0.9572 | 27 | 249 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A0J8H019-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein) | 0.9558 | 8 | 246 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar