F484241

General Info

Members Datasets Scaffolds Average Seq Length
872 478 1742 248

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_000832|Ga0500595_000832_9349_10197
Length 282
Sequence MFAVKSEHRYGVMPMQARIAVPFLHAPEPPMKIADVRANAFAMPLNDPAYPKPPYKFYNREFVVINYRSDPDALRAVVPEPLEVIGDTVSYEFIRMPDSTGFGDYTETGQVIPVRFKTPSGEVQEGGYVHAMYLDDNSPIAGGREIWGFPKKLATPKLSHEQETLVGTLHYGSVLCVTATMGYKHREIDLAPLAKAMAKPAFMIKIIPHVDCTPRICELVRYYLQDVTLKGAWTGPAALQLFEHAMCDVARLPVREVISASHYIADLTLGLGEVVFDYLKKE

Samples

Sample ID Description Type Environment
1 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
178 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
183 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
184 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
216 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
217 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
218 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
219 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
220 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
221 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
222 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
223 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
224 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
225 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
226 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
331 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
338 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
351 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
352 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
353 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
354 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
355 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
362 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
365 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
366 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
367 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
368 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
369 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
374 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
375 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
376 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
377 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
383 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
384 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
385 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
386 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
387 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
388 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
389 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
390 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
391 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
392 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
393 2519103095 Burkholderia sp. KJ006 Isolate Nodule
394 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
395 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
396 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
397 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
398 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
399 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
400 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
401 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
402 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
403 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
404 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
405 2643221733 Bosea sp. Root381 Isolate Unclassified
406 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
407 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
408 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
409 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
410 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
411 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
412 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
413 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
414 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
415 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
416 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
417 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
418 2818991452 Burkholderia cepacia 561 Isolate Unclassified
419 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
420 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
421 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
422 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
423 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
424 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
425 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
426 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
427 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
428 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
429 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
430 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
431 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
432 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
433 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
434 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
435 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
436 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
437 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
438 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
439 2885266251 Ralstonia sp. SET104 Isolate Nodule
440 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
441 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
442 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
443 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
444 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
445 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
446 2904564687 Burkholderia sp. 571 Isolate Unclassified
447 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
448 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
449 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
450 2928058823 Ralstonia sp. 1138 Isolate Unclassified
451 2928163908 Burkholderia sp. 567 Isolate Unclassified
452 2928170801 Burkholderia sp. 572 Isolate Unclassified
453 2928536128 Burkholderia sola 565 Isolate Unclassified
454 2928963466 Dyella japonica 1073 Isolate Unclassified
455 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
456 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
457 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
458 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
459 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
460 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
461 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
462 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
463 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
464 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
465 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
466 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
467 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
468 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
469 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
470 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
471 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
472 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
473 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
474 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
475 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
476 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
477 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
478 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.84
Metatranscriptomes 0.92
Isolates 11.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.23
Nodule 4.47
Rhizoplane 4.59
Rhizosphere 59.17
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500595_000832 3300053119 Bacteria 17650
2 JGI24740J21852_10000077 3300001979 Bacteria 33090
3 JGI24740J21852_10005393 3300001979 Bacteria 5415
4 JGI24739J22299_10037163 3300001989 Bacteria 1642
5 JGI24739J22299_10045445 3300001989 Bacteria 1441
6 JGI25156J39149_1000501 3300002705 Bacteria 23243
7 JGI25156J39149_1002797 3300002705 Bacteria 6035
8 JGI25156J39149_1006188 3300002705 Bacteria 3310
9 JGI25162J39368_1001067 3300002737 Bacteria 16763
10 JGI25154J39366_1001249 3300002738 Bacteria 9572
11 JGI25151J46595_10003556 3300003187 Bacteria 8554
12 rootH2_10004477 3300003320 Bacteria 3266
13 rootL2_10036769 3300003322 Bacteria 17194
14 rootL2_10163942 3300003322 Bacteria 1097
15 rootH1_10149736 3300003323 Bacteria 2638
16 JGI25160J50197_1000161 3300003354 Bacteria 57627
17 Ga0006560J51390_1027746 3300003565 Bacteria 2019
18 JGI25404J52841_10005879 3300003659 Bacteria 2545
19 Ga0055538_1002016 3300003751 Bacteria 3290
20 Ga0055539_1000190 3300003752 Bacteria 50661
21 Ga0055539_1001774 3300003752 Bacteria 3725
22 Ga0055533_1001324 3300003756 Bacteria 6706
23 Ga0055533_1002299 3300003756 Bacteria 4419
24 Ga0055533_1003303 3300003756 Bacteria 3290
25 Ga0055533_1003789 3300003756 Bacteria 2915
26 Ga0055532_1000075 3300003758 Bacteria 124604
27 Ga0055532_1011975 3300003758 Bacteria 1011
28 Ga0055532_1012787 3300003758 Bacteria 966
29 Ga0055532_1013422 3300003758 Bacteria 933
30 Ga0055525_1000031 3300003759 Bacteria 314909
31 Ga0055525_1000686 3300003759 Bacteria 12650
32 Ga0055527_1000258 3300003760 Bacteria 32350
33 Ga0055527_1000567 3300003760 Bacteria 12206
34 Ga0055527_1000633 3300003760 Bacteria 10902
35 Ga0055527_1001561 3300003760 Bacteria 4651
36 Ga0055535_1000013 3300003761 Bacteria 299614
37 Ga0055535_1000523 3300003761 Bacteria 33415
38 Ga0055535_1000910 3300003761 Bacteria 20012
39 Ga0055535_1001427 3300003761 Bacteria 12206
40 Ga0055542_1000220 3300003762 Bacteria 69389
41 Ga0055542_1000541 3300003762 Bacteria 33561
42 Ga0055542_1000571 3300003762 Bacteria 32350
43 Ga0055542_1001873 3300003762 Bacteria 8425
44 Ga0055542_1004549 3300003762 Bacteria 3335
45 Ga0055529_1000085 3300003763 Bacteria 140832
46 Ga0055529_1000521 3300003763 Bacteria 33561
47 Ga0055529_1000774 3300003763 Bacteria 20025
48 Ga0055529_1001253 3300003763 Bacteria 9385
49 Ga0055529_1005201 3300003763 Bacteria 1904
50 Ga0055529_1006748 3300003763 Bacteria 1589
51 Ga0055526_1003815 3300003771 Bacteria 9365
52 Ga0055524_1002528 3300003775 Bacteria 9365
53 Ga0055528_1007308 3300003790 Bacteria 4901
54 Ga0055541_1000539 3300003841 Bacteria 10347
55 Ga0055541_1002933 3300003841 Bacteria 3290
56 Ga0055541_1002945 3300003841 Bacteria 3287
57 Ga0058692_1011998 3300003856 Bacteria 2070
58 Ga0065165_1000074 3300005262 Bacteria 164454
59 Ga0065165_1001055 3300005262 Bacteria 33046
60 Ga0065707_10045106 3300005295 Bacteria 929
61 Ga0070658_10052600 3300005327 Bacteria 3303
62 Ga0070690_100400277 3300005330 Bacteria 1008
63 Ga0070666_10119367 3300005335 Bacteria 1828
64 Ga0070680_100161624 3300005336 Bacteria 1882
65 Ga0070689_100309547 3300005340 Bacteria 1317
66 Ga0070661_100000007 3300005344 Bacteria 202433
67 Ga0070661_100154495 3300005344 Bacteria 1736
68 Ga0070668_100303834 3300005347 Bacteria 1339
69 Ga0070671_100003946 3300005355 Bacteria 11674
70 Ga0070671_100052310 3300005355 Bacteria 3396
71 Ga0070674_100307466 3300005356 Bacteria 1266
72 Ga0070659_100000223 3300005366 Bacteria 44089
73 Ga0070703_10134683 3300005406 Bacteria 911
74 Ga0070713_100037308 3300005436 Bacteria 3928
75 Ga0070713_100344431 3300005436 Bacteria 1382
76 Ga0070700_100442828 3300005441 Bacteria 987
77 Ga0070663_100000002 3300005455 Bacteria 298075
78 Ga0070663_100001618 3300005455 Bacteria 12429
79 Ga0070663_100393277 3300005455 Bacteria 1131
80 Ga0070678_100110506 3300005456 Bacteria 2150
81 Ga0070706_100078042 3300005467 Bacteria 3066
82 Ga0070706_100281965 3300005467 Bacteria 1551
83 Ga0070707_100028200 3300005468 Bacteria 5341
84 Ga0070707_100204038 3300005468 Bacteria 1927
85 Ga0070707_100774247 3300005468 Bacteria 923
86 Ga0070698_100000636 3300005471 Bacteria 37845
87 Ga0070698_100001471 3300005471 Bacteria 26153
88 Ga0070697_100035530 3300005536 Bacteria 4019
89 Ga0070697_100059440 3300005536 Bacteria 3113
90 Ga0070697_100353724 3300005536 Bacteria 1269
91 Ga0070695_100556789 3300005545 Bacteria 894
92 Ga0070665_100040919 3300005548 Bacteria 4657
93 Ga0070665_100047558 3300005548 Bacteria 4305
94 Ga0070665_100254268 3300005548 Bacteria 1758
95 Ga0068855_100119216 3300005563 Bacteria 3021
96 Ga0068855_100718129 3300005563 Bacteria 1068
97 Ga0070664_100000004 3300005564 Bacteria 298075
98 Ga0070664_100515796 3300005564 Bacteria 1103
99 Ga0068857_100045920 3300005577 Bacteria 3876
100 Ga0068854_100000034 3300005578 Bacteria 102389
101 Ga0068856_100000530 3300005614 Bacteria 42035
102 Ga0068856_100003227 3300005614 Bacteria 16601
103 Ga0068852_100033918 3300005616 Bacteria 4244
104 Ga0068864_100031205 3300005618 Bacteria 4521
105 Ga0068870_10238168 3300005840 Bacteria 1122
106 Ga0068858_100194462 3300005842 Bacteria 1917
107 Ga0068858_100690452 3300005842 Bacteria 993
108 Ga0068860_100014779 3300005843 Bacteria 7635
109 Ga0068862_100279451 3300005844 Bacteria 1530
110 Ga0081455_10000299 3300005937 Bacteria 65486
111 Ga0081455_10057901 3300005937 Bacteria 3282
112 Ga0081538_10005351 3300005981 Bacteria 11535
113 Ga0081538_10068446 3300005981 Bacteria 1974
114 Ga0081538_10073852 3300005981 Bacteria 1860
115 Ga0081540_1005016 3300005983 Bacteria 9944
116 Ga0081540_1021097 3300005983 Bacteria 3894
117 Ga0081540_1026233 3300005983 Bacteria 3331
118 Ga0081540_1060168 3300005983 Bacteria 1819
119 Ga0070717_10000603 3300006028 Bacteria 23074
120 Ga0070717_10067436 3300006028 Bacteria 2977
121 Ga0075365_10057613 3300006038 Bacteria 2585
122 Ga0075365_10171300 3300006038 Bacteria 1515
123 Ga0075363_100005221 3300006048 Bacteria 5754
124 Ga0075363_100044506 3300006048 Bacteria 2352
125 Ga0075362_10000561 3300006177 Bacteria 10840
126 Ga0075362_10004021 3300006177 Bacteria 5235
127 Ga0075362_10135158 3300006177 Bacteria 1175
128 Ga0075367_10036466 3300006178 Bacteria 2852
129 Ga0075367_10053593 3300006178 Bacteria 2390
130 Ga0075367_10089101 3300006178 Bacteria 1875
131 Ga0075367_10166249 3300006178 Bacteria 1373
132 Ga0075369_10052570 3300006186 Bacteria 1766
133 Ga0075366_10040998 3300006195 Bacteria 2740
134 Ga0097621_100364592 3300006237 Bacteria 1288
135 Ga0075370_10064528 3300006353 Bacteria 2089
136 Ga0075370_10080572 3300006353 Bacteria 1871
137 Ga0075431_100004584 3300006847 Bacteria 13561
138 Ga0075429_100056627 3300006880 Bacteria 3413
139 Ga0075436_100127586 3300006914 Bacteria 1782
140 Ga0099794_10008555 3300007265 Bacteria 4258
141 Ga0099795_10004394 3300007788 Bacteria 3632
142 Ga0105251_10069370 3300009011 Bacteria 1643
143 Ga0105250_10003901 3300009092 Bacteria 6977
144 Ga0105250_10096823 3300009092 Bacteria 1203
145 Ga0105240_10000244 3300009093 Bacteria 107739
146 Ga0105240_10000333 3300009093 Bacteria 88420
147 Ga0105240_10005198 3300009093 Bacteria 19476
148 Ga0105240_10029128 3300009093 Bacteria 7200
149 Ga0105240_10052005 3300009093 Bacteria 5151
150 Ga0105240_10126308 3300009093 Bacteria 3073
151 Ga0105240_10162644 3300009093 Bacteria 2650
152 Ga0105240_10652990 3300009093 Bacteria 1153
153 Ga0105245_10290452 3300009098 Bacteria 1601
154 Ga0105243_10173304 3300009148 Bacteria 1870
155 Ga0105248_10010721 3300009177 Bacteria 10116
156 Ga0105248_10307367 3300009177 Bacteria 1786
157 Ga0105248_10595286 3300009177 Bacteria 1248
158 Ga0105237_10172681 3300009545 Bacteria 2162
159 Ga0105238_10000031 3300009551 Bacteria 179497
160 Ga0105238_10537670 3300009551 Bacteria 1172
161 Ga0105249_10356129 3300009553 Bacteria 1484
162 Ga0105239_10000043 3300010375 Bacteria 196600
163 Ga0105239_10000539 3300010375 Bacteria 54773
164 Ga0105239_10077993 3300010375 Bacteria 3646
165 Ga0105239_10219991 3300010375 Bacteria 2129
166 Ga0157373_10012704 3300013100 Bacteria 6189
167 Ga0157371_10000270 3300013102 Bacteria 70773
168 Ga0157370_10000014 3300013104 Bacteria 194894
169 Ga0157370_10069565 3300013104 Bacteria 3324
170 Ga0157369_10011725 3300013105 Bacteria 9952
171 Ga0157369_10137442 3300013105 Bacteria 2587
172 Ga0157369_10937319 3300013105 Bacteria 887
173 Ga0157374_10419939 3300013296 Bacteria 1336
174 Ga0157378_10018792 3300013297 Bacteria 6077
175 Ga0157378_10092708 3300013297 Bacteria 2748
176 Ga0163162_10940136 3300013306 Bacteria 976
177 Ga0157372_10001912 3300013307 Bacteria 22608
178 Ga0163163_10135200 3300014325 Bacteria 2507
179 Ga0163163_10155272 3300014325 Bacteria 2333
180 Ga0157380_10023585 3300014326 Bacteria 4643
181 Ga0182008_10026497 3300014497 Bacteria 2940
182 Ga0157379_10279836 3300014968 Bacteria 1518
183 Ga0157379_10863097 3300014968 Bacteria 857
184 Ga0157376_10040894 3300014969 Bacteria 3792
185 Ga0157376_10507709 3300014969 Bacteria 1186
186 Ga0182006_1034815 3300015261 Bacteria 2012
187 Ga0182007_10008595 3300015262 Bacteria 4181
188 Ga0182005_1005314 3300015265 Bacteria 4040
189 Ga0183361_10003 3300016635 Bacteria 577277
190 Ga0183361_10016 3300016635 Bacteria 163785
191 Ga0197907_11324568 3300020069 Bacteria 1375
192 Ga0206351_10413566 3300020077 Bacteria 11749
193 Ga0154015_1491382 3300020610 Bacteria 6814
194 Ga0213872_10000058 3300021361 Bacteria 100531
195 Ga0213872_10001133 3300021361 Bacteria 18215
196 Ga0213872_10004642 3300021361 Bacteria 7234
197 Ga0213872_10011227 3300021361 Bacteria 4242
198 Ga0213872_10024014 3300021361 Unclassified 2804
199 Ga0213872_10076520 3300021361 Bacteria 1505
200 Ga0213872_10172895 3300021361 Bacteria 936
201 Ga0213871_10017531 3300021441 Bacteria 1741
202 Ga0209784_100297 3300025224 Bacteria 26818
203 Ga0209784_100367 3300025224 Bacteria 21366
204 Ga0209784_100840 3300025224 Bacteria 6841
205 Ga0209566_100567 3300025225 Bacteria 24190
206 Ga0209566_100620 3300025225 Bacteria 21926
207 Ga0209566_100998 3300025225 Bacteria 12262
208 Ga0209674_100083 3300025226 Bacteria 197744
209 Ga0209674_100224 3300025226 Bacteria 52381
210 Ga0209674_100249 3300025226 Bacteria 45253
211 Ga0209674_101969 3300025226 Bacteria 4782
212 Ga0209674_106784 3300025226 Bacteria 1513
213 Ga0209672_100012 3300025228 Bacteria 795742
214 Ga0209672_100063 3300025228 Bacteria 204903
215 Ga0209672_100074 3300025228 Bacteria 159792
216 Ga0209672_101023 3300025228 Bacteria 12111
217 Ga0209672_102666 3300025228 Bacteria 4175
218 Ga0209147_100005 3300025229 Bacteria 1036530
219 Ga0209147_100007 3300025229 Bacteria 795684
220 Ga0209147_100077 3300025229 Bacteria 205964
221 Ga0209147_100119 3300025229 Bacteria 142860
222 Ga0209563_100016 3300025230 Bacteria 802091
223 Ga0209563_100044 3300025230 Bacteria 396812
224 Ga0209563_103098 3300025230 Bacteria 3524
225 Ga0209563_109140 3300025230 Bacteria 1519
226 Ga0207427_104022 3300025231 Bacteria 2683
227 Ga0209437_100338 3300025233 Bacteria 56554
228 Ga0209258_100007 3300025242 Bacteria 1036530
229 Ga0209258_100014 3300025242 Bacteria 720132
230 Ga0209258_100105 3300025242 Bacteria 207862
231 Ga0209258_100546 3300025242 Bacteria 34094
232 Ga0209258_103401 3300025242 Bacteria 3445
233 Ga0209258_105860 3300025242 Bacteria 2005
234 Ga0209646_1000016 3300025246 Bacteria 501688
235 Ga0209677_100008 3300025253 Bacteria 802091
236 Ga0209677_102084 3300025253 Bacteria 7893
237 Ga0209677_103548 3300025253 Bacteria 4973
238 Ga0209148_1000002 3300025254 Bacteria 2399500
239 Ga0209148_1000041 3300025254 Bacteria 469323
240 Ga0209148_1000051 3300025254 Bacteria 401000
241 Ga0209148_1000107 3300025254 Bacteria 207862
242 Ga0209148_1003274 3300025254 Bacteria 4587
243 Ga0209148_1004110 3300025254 Bacteria 3680
244 Ga0209759_1000341 3300025256 Bacteria 61595
245 Ga0209759_1002154 3300025256 Bacteria 9042
246 Ga0209759_1002447 3300025256 Bacteria 8141
247 Ga0209759_1003942 3300025256 Bacteria 5713
248 Ga0209759_1004691 3300025256 Bacteria 5008
249 Ga0209233_1008898 3300025261 Bacteria 3077
250 Ga0209455_1000007 3300025272 Bacteria 1157983
251 Ga0209455_1000011 3300025272 Bacteria 947242
252 Ga0209455_1000100 3300025272 Bacteria 207862
253 Ga0209455_1000220 3300025272 Bacteria 79809
254 Ga0209455_1000528 3300025272 Bacteria 26777
255 Ga0209455_1006798 3300025272 Bacteria 3328
256 Ga0209673_1000101 3300025273 Bacteria 190230
257 Ga0209130_1003511 3300025284 Bacteria 6589
258 Ga0209675_1010312 3300025291 Bacteria 3203
259 Ga0209025_1039087 3300025294 Bacteria 2076
260 Ga0209025_1102776 3300025294 Bacteria 899
261 Ga0209564_1000003 3300025295 Bacteria 1585848
262 Ga0209564_1006036 3300025295 Bacteria 6679
263 Ga0209564_1041552 3300025295 Bacteria 1232
264 Ga0209758_1003394 3300025297 Bacteria 14551
265 Ga0209256_1000176 3300025299 Bacteria 126545
266 Ga0207426_1000180 3300025302 Bacteria 158321
267 Ga0207426_1030923 3300025302 Bacteria 1751
268 Ga0209051_1037272 3300025303 Bacteria 1786
269 Ga0209257_1031562 3300025304 Bacteria 1692
270 Ga0207696_1056357 3300025711 Bacteria 1113
271 Ga0207713_1068608 3300025735 Bacteria 1317
272 Ga0207647_10011575 3300025904 Bacteria 6180
273 Ga0207699_10172032 3300025906 Bacteria 1450
274 Ga0207643_10133851 3300025908 Bacteria 1477
275 Ga0207705_10055272 3300025909 Bacteria 2862
276 Ga0207684_10283191 3300025910 Bacteria 1429
277 Ga0207684_10477043 3300025910 Bacteria 1070
278 Ga0207695_10000262 3300025913 Bacteria 133005
279 Ga0207695_10000623 3300025913 Bacteria 71205
280 Ga0207695_10002240 3300025913 Bacteria 28991
281 Ga0207695_10002319 3300025913 Bacteria 28385
282 Ga0207695_10047750 3300025913 Bacteria 4527
283 Ga0207695_10090184 3300025913 Bacteria 3081
284 Ga0207695_10102493 3300025913 Bacteria 2855
285 Ga0207695_10187713 3300025913 Bacteria 1986
286 Ga0207695_10591851 3300025913 Bacteria 990
287 Ga0207671_10097610 3300025914 Bacteria 2222
288 Ga0207671_10099223 3300025914 Bacteria 2204
289 Ga0207693_10003527 3300025915 Bacteria 13355
290 Ga0207693_10029593 3300025915 Bacteria 4324
291 Ga0207663_10034041 3300025916 Bacteria 3042
292 Ga0207657_10000442 3300025919 Bacteria 43937
293 Ga0207649_10000205 3300025920 Bacteria 49427
294 Ga0207652_10178619 3300025921 Bacteria 1907
295 Ga0207646_10035949 3300025922 Bacteria 4471
296 Ga0207646_10318394 3300025922 Bacteria 1406
297 Ga0207646_10543632 3300025922 Unclassified 1045
298 Ga0207646_10632401 3300025922 Bacteria 959
299 Ga0207694_10000062 3300025924 Bacteria 140156
300 Ga0207650_10384398 3300025925 Bacteria 1160
301 Ga0207659_10496633 3300025926 Bacteria 1032
302 Ga0207687_10499496 3300025927 Bacteria 1015
303 Ga0207700_10086016 3300025928 Bacteria 2469
304 Ga0207700_10147789 3300025928 Bacteria 1939
305 Ga0207644_10012046 3300025931 Bacteria 5734
306 Ga0207644_10015307 3300025931 Bacteria 5145
307 Ga0207644_10023149 3300025931 Bacteria 4251
308 Ga0207690_10000037 3300025932 Bacteria 142658
309 Ga0207690_10111541 3300025932 Bacteria 1971
310 Ga0207670_10036273 3300025936 Bacteria 3205
311 Ga0207704_10460788 3300025938 Bacteria 1016
312 Ga0207665_10369130 3300025939 Bacteria 1087
313 Ga0207711_10067936 3300025941 Bacteria 3086
314 Ga0207711_10412620 3300025941 Bacteria 1255
315 Ga0207711_10564700 3300025941 Bacteria 1061
316 Ga0207689_10409582 3300025942 Bacteria 1131
317 Ga0207679_10000002 3300025945 Bacteria 634491
318 Ga0207679_10287648 3300025945 Bacteria 1412
319 Ga0207667_10029566 3300025949 Bacteria 5940
320 Ga0207640_10000257 3300025981 Bacteria 36110
321 Ga0207703_10057979 3300026035 Bacteria 3159
322 Ga0207703_10368351 3300026035 Bacteria 1326
323 Ga0207678_10000003 3300026067 Bacteria 282716
324 Ga0207678_10000317 3300026067 Bacteria 43506
325 Ga0207702_10000282 3300026078 Bacteria 58756
326 Ga0207702_10002185 3300026078 Bacteria 18737
327 Ga0207676_10028791 3300026095 Bacteria 4154
328 Ga0207674_10013124 3300026116 Bacteria 9220
329 Ga0207674_10059557 3300026116 Bacteria 3864
330 Ga0207683_10162880 3300026121 Bacteria 2017
331 Ga0207698_10303566 3300026142 Bacteria 1487
332 Ga0209371_1000080 3300027312 Bacteria 185771
333 Ga0209588_1004182 3300027671 Bacteria 4052
334 Ga0209588_1042691 3300027671 Bacteria 1465
335 Ga0209998_10036829 3300027717 Bacteria 1100
336 Ga0268266_10013898 3300028379 Bacteria 6932
337 Ga0268266_10048395 3300028379 Bacteria 3644
338 Ga0265319_1011004 3300028563 Bacteria 3740
339 Ga0265334_10012147 3300028573 Bacteria 3620
340 Ga0307517_10010987 3300028786 Bacteria 12591
341 Ga0307515_10004677 3300028794 Bacteria 28083
342 Ga0307515_10006880 3300028794 Bacteria 22609
343 Ga0307515_10036958 3300028794 Bacteria 7876
344 Ga0307515_10187944 3300028794 Bacteria 1988
345 Ga0265338_10028317 3300028800 Bacteria 5590
346 Ga0265324_10031483 3300029957 Bacteria 1858
347 Ga0268256_1000263 3300030500 Bacteria 55690
348 Ga0307512_10024522 3300030522 Bacteria 5365
349 Ga0307512_10127864 3300030522 Bacteria 1606
350 Ga0265328_10000601 3300031239 Bacteria 16722
351 Ga0265320_10001290 3300031240 Bacteria 18290
352 Ga0265331_10066011 3300031250 Bacteria 1700
353 Ga0265327_10001382 3300031251 Bacteria 31023
354 Ga0265316_10104778 3300031344 Bacteria 2147
355 Ga0307513_10105123 3300031456 Bacteria 2834
356 Ga0307509_10001286 3300031507 Bacteria 42598
357 Ga0307509_10013769 3300031507 Bacteria 9545
358 Ga0307509_10102717 3300031507 Bacteria 2889
359 Ga0307509_10217359 3300031507 Bacteria 1728
360 Ga0307508_10000088 3300031616 Bacteria 107883
361 Ga0307508_10000159 3300031616 Bacteria 81150
362 Ga0307508_10285536 3300031616 Bacteria 1243
363 Ga0307514_10003621 3300031649 Bacteria 14673
364 Ga0307514_10185313 3300031649 Bacteria 1335
365 Ga0265314_10003925 3300031711 Bacteria 14129
366 Ga0307405_10107509 3300031731 Bacteria 1883
367 Ga0307405_10647306 3300031731 Bacteria 869
368 Ga0307518_10079505 3300031838 Bacteria 2368
369 Ga0307510_10001739 3300033180 Bacteria 24244
370 Ga0307510_10002924 3300033180 Bacteria 19645
371 Ga0307510_10194911 3300033180 Bacteria 1569
372 Ga0373932_0137298 3300035112 Bacteria 829
373 Ga0373939_0051346 3300035114 Bacteria 1282
374 Ga0373957_0036911 3300035120 Bacteria 1823
375 Ga0373960_0068885 3300035121 Bacteria 1090
376 Ga0373955_0006391 3300035172 Bacteria 5371
377 Ga0373955_0313822 3300035172 Bacteria 947
378 Ga0373931_0059425 3300035691 Bacteria 2056
379 Ga0373937_0199126 3300036401 Bacteria 1883
380 Ga0395899_0001096 3300037312 Bacteria 24291
381 Ga0395899_0007777 3300037312 Bacteria 8266
382 Ga0395900_0003519 3300037418 Bacteria 16891
383 Ga0395900_0019699 3300037418 Bacteria 6877
384 Ga0395898_0051377 3300037466 Bacteria 4031
385 Ga0395905_0000004 3300037471 Bacteria 674991
386 Ga0395905_0016259 3300037471 Bacteria 7069
387 Ga0395905_0031719 3300037471 Bacteria 4972
388 Ga0395905_0791554 3300037471 Bacteria 851
389 Ga0436364_1010474 3300037853 Bacteria 1206
390 Ga0436364_1048249 3300037853 Bacteria 866
391 Ga0395901_0007491 3300038443 Bacteria 11024
392 Ga0436365_1186277 3300039437 Bacteria 2196
393 Ga0436360_0055769 3300039438 Bacteria 1051
394 Ga0436360_0077353 3300039438 Bacteria 1003
395 Ga0436360_0151145 3300039438 Bacteria 1494
396 Ga0436360_0473946 3300039438 Bacteria 923
397 Ga0436360_1244250 3300039438 Bacteria 2769
398 Ga0436361_0009072 3300039447 Bacteria 69000
399 Ga0436361_0015246 3300039447 Bacteria 2794
400 Ga0436361_0068556 3300039447 Bacteria 100895
401 Ga0436361_0072645 3300039447 Bacteria 2253
402 Ga0436361_0154893 3300039447 Bacteria 9187
403 Ga0436361_0285974 3300039447 Bacteria 1379
404 Ga0436361_0327497 3300039447 Bacteria 2325
405 Ga0436361_0396047 3300039447 Bacteria 2950
406 Ga0436361_0691909 3300039447 Bacteria 2061
407 Ga0436361_0854298 3300039447 Bacteria 36657
408 Ga0436361_0898793 3300039447 Bacteria 17943
409 Ga0436361_0927296 3300039447 Bacteria 36814
410 Ga0436361_0991922 3300039447 Bacteria 1068
411 Ga0436361_1032389 3300039447 Bacteria 1707
412 Ga0436361_1076629 3300039447 Bacteria 996
413 Ga0436361_1103177 3300039447 Bacteria 1630
414 Ga0439465_0038100 3300041413 Bacteria 1547
415 Ga0451793_0099842 3300041452 Bacteria 1869
416 Ga0451833_0521900 3300041491 Bacteria 2304
417 Ga0451835_0089958 3300041492 Bacteria 2791
418 Ga0451837_0949555 3300041494 Bacteria 1184
419 Ga0451839_0148025 3300041496 Bacteria 5334
420 Ga0451841_0180740 3300041498 Bacteria 1794
421 Ga0451845_0404377 3300041501 Bacteria 12256
422 Ga0451847_0356391 3300041503 Bacteria 1508
423 Ga0451849_0652222 3300041505 Bacteria 14513
424 Ga0451851_0196131 3300041507 Bacteria 5818
425 Ga0451843_0644706 3300041509 Bacteria 1712
426 Ga0451855_0100114 3300041511 Bacteria 1373
427 Ga0451853_1334978 3300041512 Bacteria 14917
428 Ga0439432_069026 3300042006 Bacteria 1080
429 Ga0439459_0075758 3300042438 Bacteria 786
430 Ga0466969_0028584 3300044656 Bacteria 2849
431 Ga0466966_0006790 3300044684 Bacteria 7579
432 Ga0466968_0139680 3300044735 Bacteria 1107
433 Ga0466970_0049603 3300044765 Bacteria 2239
434 Ga0466959_0029570 3300045049 Bacteria 4059
435 Ga0495617_053260 3300046452 Bacteria 1344
436 Ga0495592_0000205 3300046454 Bacteria 50544
437 Ga0495592_0007838 3300046454 Bacteria 8000
438 Ga0495592_0016393 3300046454 Bacteria 5621
439 Ga0495592_0021883 3300046454 Bacteria 4865
440 Ga0495603_0006100 3300046455 Bacteria 7207
441 Ga0495603_0048169 3300046455 Bacteria 2538
442 Ga0495590_0008396 3300046457 Bacteria 3944
443 Ga0495591_001698 3300046458 Bacteria 13148
444 Ga0495629_0001193 3300046459 Bacteria 20485
445 Ga0495629_0002100 3300046459 Bacteria 15458
446 Ga0495629_0014979 3300046459 Bacteria 5571
447 Ga0495629_0054326 3300046459 Bacteria 2801
448 Ga0495629_0095264 3300046459 Bacteria 2077
449 Ga0495638_0001744 3300046460 Bacteria 19061
450 Ga0495638_0006787 3300046460 Bacteria 8274
451 Ga0495638_0131736 3300046460 Bacteria 1468
452 Ga0495638_0347317 3300046460 Bacteria 784
453 Ga0495641_0013804 3300046461 Bacteria 4410
454 Ga0495651_0007051 3300046462 Bacteria 8591
455 Ga0495651_0019238 3300046462 Bacteria 5292
456 Ga0495653_0001764 3300046463 Bacteria 17048
457 Ga0495653_0017662 3300046463 Bacteria 5800
458 Ga0495653_0035612 3300046463 Bacteria 3925
459 Ga0495650_0000812 3300046471 Bacteria 38006
460 Ga0495650_0006038 3300046471 Bacteria 7655
461 Ga0495650_0021725 3300046471 Bacteria 3091
462 Ga0495580_0000864 3300046472 Bacteria 26138
463 Ga0495580_0000945 3300046472 Bacteria 25397
464 Ga0495580_0003406 3300046472 Bacteria 13552
465 Ga0495580_0007092 3300046472 Bacteria 9030
466 Ga0495580_0007981 3300046472 Bacteria 8459
467 Ga0495580_0008113 3300046472 Bacteria 8375
468 Ga0495580_0259852 3300046472 Bacteria 1187
469 Ga0495582_0003431 3300046473 Bacteria 8926
470 Ga0495605_0018467 3300046474 Bacteria 3738
471 Ga0495662_0024784 3300046476 Bacteria 2895
472 Ga0495664_0000493 3300046477 Bacteria 19671
473 Ga0495664_0032858 3300046477 Bacteria 3047
474 Ga0495664_0051850 3300046477 Bacteria 2436
475 Ga0495594_0120038 3300046499 Bacteria 1486
476 Ga0495596_0026168 3300046500 Bacteria 2352
477 Ga0495583_0009087 3300046506 Bacteria 5976
478 Ga0495583_0024701 3300046506 Bacteria 3014
479 Ga0495606_0040944 3300046507 Bacteria 3109
480 Ga0495606_0052066 3300046507 Bacteria 2665
481 Ga0495608_0004706 3300046511 Bacteria 9764
482 Ga0495608_0027649 3300046511 Bacteria 3858
483 Ga0495610_0044297 3300046512 Bacteria 2209
484 Ga0495616_0215908 3300046513 Bacteria 837
485 Ga0495618_0009128 3300046514 Bacteria 5983
486 Ga0495618_0015754 3300046514 Bacteria 4615
487 Ga0495618_0112207 3300046514 Bacteria 1745
488 Ga0495618_0333007 3300046514 Bacteria 938
489 Ga0495620_0009098 3300046515 Bacteria 5300
490 Ga0495620_0101830 3300046515 Bacteria 1144
491 Ga0495628_0004908 3300046516 Bacteria 11770
492 Ga0495628_0007273 3300046516 Bacteria 9592
493 Ga0495628_0014868 3300046516 Bacteria 6509
494 Ga0495628_0033954 3300046516 Bacteria 4106
495 Ga0495628_0104445 3300046516 Bacteria 2183
496 Ga0495630_0006497 3300046517 Bacteria 8324
497 Ga0495630_0019627 3300046517 Bacteria 4971
498 Ga0495630_0041883 3300046517 Bacteria 3420
499 Ga0495630_0180254 3300046517 Bacteria 1610
500 Ga0495632_0142961 3300046519 Bacteria 1109
501 Ga0495632_0281328 3300046519 Bacteria 741
502 Ga0495643_0018152 3300046522 Bacteria 4096
503 Ga0495643_0179837 3300046522 Bacteria 1028
504 Ga0495648_0010371 3300046524 Bacteria 7099
505 Ga0495648_0108887 3300046524 Bacteria 1512
506 Ga0495648_0116894 3300046524 Bacteria 1440
507 Ga0495648_0251194 3300046524 Bacteria 853
508 Ga0495666_0001397 3300046526 Bacteria 11712
509 Ga0495666_0001421 3300046526 Bacteria 11618
510 Ga0495666_0092024 3300046526 Bacteria 1431
511 Ga0495666_0185228 3300046526 Bacteria 960
512 Ga0495642_0046906 3300046528 Bacteria 1768
513 Ga0495652_0031032 3300046529 Bacteria 4682
514 Ga0495652_0108025 3300046529 Bacteria 2243
515 Ga0495654_0097519 3300046530 Bacteria 1357
516 Ga0495665_0003557 3300046531 Bacteria 8463
517 Ga0495665_0004099 3300046531 Bacteria 7852
518 Ga0495665_0162042 3300046531 Bacteria 1165
519 Ga0495640_0010699 3300046533 Bacteria 7077
520 Ga0495640_0019714 3300046533 Bacteria 4974
521 Ga0495640_0022510 3300046533 Bacteria 4603
522 Ga0495640_0311495 3300046533 Bacteria 976
523 Ga0495586_0006311 3300046535 Bacteria 6332
524 Ga0495586_0150536 3300046535 Bacteria 1309
525 Ga0495587_0003286 3300046536 Bacteria 10794
526 Ga0495587_0005534 3300046536 Bacteria 8240
527 Ga0495587_0011186 3300046536 Bacteria 5690
528 Ga0495597_0084556 3300046542 Bacteria 1353
529 Ga0495597_0087233 3300046542 Bacteria 1328
530 Ga0495645_0001429 3300046543 Bacteria 16087
531 Ga0495645_0062924 3300046543 Bacteria 2687
532 Ga0495622_0000112 3300046557 Bacteria 71013
533 Ga0495622_0050115 3300046557 Bacteria 1938
534 Ga0495633_0008420 3300046558 Bacteria 5811
535 Ga0495667_0009714 3300046559 Bacteria 6518
536 Ga0495667_0037388 3300046559 Bacteria 3236
537 Ga0495668_0110625 3300046616 Bacteria 1502
538 Ga0495668_0266876 3300046616 Bacteria 937
539 Ga0495634_0003385 3300046642 Bacteria 12795
540 Ga0495634_0015660 3300046642 Bacteria 5440
541 Ga0495634_0035741 3300046642 Bacteria 3400
542 Ga0495611_0009536 3300046648 Bacteria 4102
543 Ga0495625_0215465 3300046660 Bacteria 1260
544 Ga0495635_0003125 3300046663 Bacteria 11395
545 Ga0495635_0003436 3300046663 Bacteria 10958
546 Ga0495635_0443714 3300046663 Bacteria 858
547 Ga0495661_0002648 3300046665 Bacteria 13700
548 Ga0495661_0008884 3300046665 Bacteria 6923
549 Ga0495661_0025258 3300046665 Bacteria 3839
550 Ga0495657_0026208 3300046675 Bacteria 4129
551 Ga0495657_0032857 3300046675 Bacteria 3617
552 Ga0495599_0002693 3300046678 Bacteria 10368
553 Ga0495599_0008887 3300046678 Bacteria 6118
554 Ga0495599_0014101 3300046678 Bacteria 4948
555 Ga0495599_0028914 3300046678 Bacteria 3473
556 Ga0495623_0002567 3300046679 Bacteria 11999
557 Ga0495623_0008883 3300046679 Bacteria 6523
558 Ga0495623_0118188 3300046679 Bacteria 1599
559 Ga0495646_0003486 3300046680 Bacteria 9790
560 Ga0495646_0003639 3300046680 Bacteria 9616
561 Ga0495646_0008768 3300046680 Bacteria 6425
562 Ga0495646_0035564 3300046680 Bacteria 3089
563 Ga0495646_0053859 3300046680 Bacteria 2423
564 Ga0495613_0001812 3300046689 Bacteria 16228
565 Ga0495613_0002978 3300046689 Bacteria 12683
566 Ga0495613_0093555 3300046689 Bacteria 2176
567 Ga0495624_0001002 3300046690 Bacteria 22345
568 Ga0495624_0003869 3300046690 Bacteria 11054
569 Ga0495670_0271258 3300046691 Bacteria 906
570 Ga0495671_0017727 3300046692 Bacteria 3787
571 Ga0495671_0039564 3300046692 Bacteria 2380
572 Ga0495589_0007499 3300046794 Bacteria 5715
573 Ga0495589_0113164 3300046794 Bacteria 1309
574 Ga0495600_0009704 3300046809 Bacteria 5948
575 Ga0495600_0023950 3300046809 Bacteria 3929
576 Ga0495600_0068857 3300046809 Bacteria 2313
577 Ga0495600_0147658 3300046809 Bacteria 1523
578 Ga0495660_0137330 3300046810 Bacteria 1220
579 Ga0495581_0004373 3300047315 Bacteria 8162
580 Ga0495581_0044158 3300047315 Bacteria 2577
581 Ga0495604_0013274 3300047317 Bacteria 6560
582 Ga0495604_0019571 3300047317 Bacteria 5418
583 Ga0495604_0040252 3300047317 Bacteria 3670
584 Ga0495604_0042400 3300047317 Bacteria 3566
585 Ga0495604_0044330 3300047317 Bacteria 3476
586 Ga0495604_0086227 3300047317 Bacteria 2341
587 Ga0495604_0206873 3300047317 Bacteria 1358
588 Ga0495674_0019285 3300047319 Bacteria 6332
589 Ga0495674_0034503 3300047319 Bacteria 4575
590 Ga0495674_0039568 3300047319 Bacteria 4225
591 Ga0495674_0045329 3300047319 Bacteria 3904
592 Ga0495674_0052958 3300047319 Bacteria 3569
593 Ga0495674_0073184 3300047319 Bacteria 2954
594 Ga0495674_0113100 3300047319 Bacteria 2299
595 Ga0495672_0061033 3300047320 Bacteria 2174
596 Ga0495676_0002356 3300047321 Bacteria 16746
597 Ga0495676_0028046 3300047321 Bacteria 4818
598 Ga0495676_0297812 3300047321 Bacteria 1088
599 Ga0495680_0007573 3300047322 Bacteria 9929
600 Ga0495680_0033222 3300047322 Bacteria 4178
601 Ga0495680_0133766 3300047322 Bacteria 1819
602 Ga0495683_0001469 3300047323 Bacteria 15412
603 Ga0495683_0017733 3300047323 Bacteria 3686
604 Ga0495683_0118879 3300047323 Bacteria 1256
605 Ga0495687_115867 3300047443 Bacteria 976
606 Ga0495675_0002316 3300047444 Bacteria 11378
607 Ga0495675_0011045 3300047444 Bacteria 5661
608 Ga0495675_0016691 3300047444 Bacteria 4642
609 Ga0495679_000110 3300047446 Bacteria 74091
610 Ga0495679_000439 3300047446 Bacteria 30769
611 Ga0495679_002707 3300047446 Bacteria 8844
612 Ga0495673_0022150 3300047469 Bacteria 3119
613 Ga0495673_0030433 3300047469 Bacteria 2534
614 Ga0495684_0020082 3300047471 Bacteria 5146
615 Ga0495684_0557075 3300047471 Bacteria 780
616 Ga0495686_0045315 3300047472 Bacteria 2783
617 Ga0495686_0115387 3300047472 Bacteria 1606
618 Ga0495593_0001604 3300047673 Bacteria 13357
619 Ga0495593_0003043 3300047673 Bacteria 10105
620 Ga0495602_0003762 3300048088 Bacteria 15757
621 Ga0495602_0008295 3300048088 Bacteria 10857
622 Ga0495602_0041556 3300048088 Bacteria 4198
623 Ga0495602_0073285 3300048088 Bacteria 2915
624 Ga0495602_0200284 3300048088 Bacteria 1524
625 Ga0495614_0001047 3300048089 Bacteria 11804
626 Ga0495615_0002493 3300048090 Bacteria 2959
627 Ga0495626_0011202 3300048091 Bacteria 4750
628 Ga0496100_0000251 3300048903 Bacteria 27742
629 Ga0496101_0000346 3300048904 Bacteria 31341
630 Ga0496102_0004434 3300048905 Bacteria 11857
631 Ga0496102_0013495 3300048905 Bacteria 7077
632 Ga0496102_0287253 3300048905 Bacteria 1550
633 Ga0496102_0563028 3300048905 Bacteria 1062
634 Ga0496103_0000314 3300048906 Bacteria 44738
635 Ga0496103_0001908 3300048906 Bacteria 13547
636 Ga0496103_0118726 3300048906 Bacteria 1684
637 Ga0496104_0002191 3300048907 Bacteria 16912
638 Ga0496104_0108967 3300048907 Bacteria 2655
639 Ga0496104_0114535 3300048907 Bacteria 2586
640 Ga0496104_0239571 3300048907 Bacteria 1726
641 Ga0496104_0258692 3300048907 Bacteria 1653
642 Ga0496105_0005523 3300048908 Bacteria 9596
643 Ga0496105_0154890 3300048908 Bacteria 1882
644 Ga0496105_0178472 3300048908 Bacteria 1739
645 Ga0496105_0234254 3300048908 Bacteria 1491
646 Ga0496106_0000712 3300048909 Bacteria 23955
647 Ga0496106_0074025 3300048909 Bacteria 2607
648 Ga0496106_0082246 3300048909 Bacteria 2475
649 Ga0496107_0322053 3300048910 Bacteria 1150
650 Ga0496108_0003220 3300048911 Bacteria 13129
651 Ga0496108_0019773 3300048911 Bacteria 5532
652 Ga0496109_0036962 3300048912 Bacteria 4410
653 Ga0496109_0044895 3300048912 Bacteria 4010
654 Ga0496110_0026001 3300048913 Bacteria 5005
655 Ga0496110_0366345 3300048913 Bacteria 1313
656 Ga0496112_0046866 3300048915 Bacteria 4240
657 Ga0496112_0304031 3300048915 Bacteria 1540
658 Ga0496113_0075457 3300048916 Bacteria 2573
659 Ga0496113_0079936 3300048916 Bacteria 2503
660 Ga0496113_0651839 3300048916 Bacteria 842
661 Ga0496115_0062505 3300048918 Bacteria 3004
662 Ga0496116_0058619 3300048919 Bacteria 2509
663 Ga0496116_0062663 3300048919 Bacteria 2400
664 Ga0496116_0100849 3300048919 Bacteria 1725
665 Ga0496117_0000665 3300048920 Bacteria 55054
666 Ga0496117_0009849 3300048920 Bacteria 8803
667 Ga0496117_0031023 3300048920 Bacteria 4089
668 Ga0496117_0042962 3300048920 Bacteria 3293
669 Ga0496117_0261695 3300048920 Bacteria 937
670 Ga0496118_0000619 3300048921 Bacteria 58357
671 Ga0496118_0002376 3300048921 Bacteria 25430
672 Ga0496118_0004494 3300048921 Bacteria 16508
673 Ga0496118_0010955 3300048921 Bacteria 8911
674 Ga0496118_0029528 3300048921 Bacteria 4596
675 Ga0496118_0043606 3300048921 Bacteria 3523
676 Ga0496118_0044138 3300048921 Bacteria 3494
677 Ga0496118_0048445 3300048921 Bacteria 3282
678 Ga0496118_0110523 3300048921 Bacteria 1825
679 Ga0496119_0000131 3300048922 Bacteria 105813
680 Ga0496119_0048977 3300048922 Bacteria 2616
681 Ga0496119_0153177 3300048922 Bacteria 1233
682 Ga0496119_0208833 3300048922 Bacteria 1006
683 Ga0496120_0000182 3300048923 Bacteria 107094
684 Ga0496121_0000341 3300048924 Bacteria 97289
685 Ga0496121_0002720 3300048924 Bacteria 26392
686 Ga0496121_0002837 3300048924 Bacteria 25561
687 Ga0496121_0042999 3300048924 Bacteria 3919
688 Ga0496121_0094361 3300048924 Bacteria 2328
689 Ga0496121_0339426 3300048924 Bacteria 1005
690 Ga0496121_0419176 3300048924 Bacteria 872
691 Ga0496122_0027576 3300048925 Bacteria 4851
692 Ga0496124_0077147 3300048927 Bacteria 2749
693 Ga0496124_0108613 3300048927 Bacteria 2237
694 Ga0496125_0345380 3300048928 Bacteria 891
695 Ga0496126_0000996 3300048929 Bacteria 48318
696 Ga0496126_0001358 3300048929 Bacteria 38769
697 Ga0496126_0037504 3300048929 Bacteria 4522
698 Ga0496126_0080130 3300048929 Bacteria 2890
699 Ga0496126_0132583 3300048929 Bacteria 2152
700 Ga0496126_0242373 3300048929 Bacteria 1505
701 Ga0496126_0306704 3300048929 Bacteria 1308
702 Ga0496126_0636313 3300048929 Bacteria 836
703 Ga0495678_046170 3300049459 Bacteria 1714
704 Ga0495682_0024475 3300049460 Bacteria 2250
705 Ga0495682_0059576 3300049460 Bacteria 1379
706 Ga0501034_0000708 3300049571 Bacteria 50605
707 Ga0501034_0003790 3300049571 Bacteria 17063
708 Ga0501034_0090019 3300049571 Bacteria 3067
709 Ga0501034_0244885 3300049571 Bacteria 1738
710 Ga0501040_0229945 3300049576 Bacteria 1320
711 Ga0501046_0138631 3300049580 Bacteria 1842
712 Ga0501068_0083153 3300049584 Bacteria 1967
713 Ga0501068_0432791 3300049584 Bacteria 850
714 Ga0501071_0044713 3300049587 Bacteria 3177
715 Ga0501071_0446297 3300049587 Bacteria 990
716 Ga0501072_0031625 3300049588 Bacteria 4145
717 Ga0501075_0046472 3300049591 Bacteria 3261
718 Ga0501077_0264754 3300049593 Bacteria 1093
719 Ga0501079_0012162 3300049741 Bacteria 6571
720 Ga0501081_0022187 3300049743 Bacteria 4247
721 Ga0501044_0093314 3300049823 Bacteria 3035
722 nmdc:mga03683_19017_c1 3300050489 Bacteria 2618
723 nmdc:mga03683_31879_c1 3300050489 Bacteria 2117
724 nmdc:mga03683_56895_c1 3300050489 Bacteria 1645
725 nmdc:mga03n38_3156_c1 3300050490 Bacteria 5249
726 nmdc:mga03n38_58102_c1 3300050490 Bacteria 1751
727 nmdc:mga0yw44_137794_c1 3300050492 Bacteria 1584
728 nmdc:mga0yw44_17259_c1 3300050492 Bacteria 3924
729 nmdc:mga0yw44_19935_c1 3300050492 Bacteria 3710
730 nmdc:mga0yw44_51999_c1 3300050492 Bacteria 2483
731 nmdc:mga0k408_101347_c1 3300050493 Bacteria 1698
732 nmdc:mga06z11_12830_c1 3300050494 Bacteria 3656
733 nmdc:mga06z11_19805_c1 3300050494 Bacteria 3101
734 nmdc:mga06z11_34549_c1 3300050494 Bacteria 2483
735 nmdc:mga07m45_50233_c1 3300050496 Bacteria 2349
736 nmdc:mga09592_11604_c1 3300050508 Bacteria 7165
737 nmdc:mga0n895_771319_c1 3300050512 Bacteria 953
738 nmdc:mga0sz30_117398_c1 3300050516 Bacteria 1168
739 nmdc:mga0sz30_35933_c1 3300050516 Bacteria 2070
740 nmdc:mga0sz30_4490_c1 3300050516 Bacteria 5048
741 Ga0495601_0080021 3300053077 Bacteria 2096
742 Ga0495601_0205962 3300053077 Bacteria 1285
743 Ga0495612_0015008 3300053078 Bacteria 3107
744 Ga0500610_0061769 3300053079 Bacteria 1956
745 Ga0495595_0004318 3300053084 Bacteria 5718
746 Ga0495619_0012591 3300053085 Bacteria 5325
747 Ga0495619_0140950 3300053085 Bacteria 1660
748 Ga0500578_0057251 3300053086 Bacteria 2492
749 Ga0500583_0016504 3300053092 Bacteria 2949
750 Ga0500651_0035507 3300053093 Bacteria 3142
751 Ga0500651_0049601 3300053093 Bacteria 2636
752 Ga0500641_0013313 3300053096 Bacteria 3020
753 Ga0500594_0006514 3300053118 Bacteria 2627
754 Ga0500595_007335 3300053119 Bacteria 4579
755 Ga0500595_013314 3300053119 Bacteria 3154
756 Ga0500564_093273 3300053138 Bacteria 1338
757 Ga0500568_0077573 3300053139 Bacteria 1264
758 Ga0500590_004048 3300053148 Bacteria 6864
759 Ga0500616_0001521 3300053153 Bacteria 21858
760 Ga0500616_0032502 3300053153 Bacteria 2852
761 Ga0500616_0058764 3300053153 Bacteria 1999
762 Ga0500616_0075102 3300053153 Bacteria 1712
763 Ga0500616_0203107 3300053153 Bacteria 876
764 Ga0500620_144375 3300053155 Bacteria 831
765 Ga0500622_0002271 3300053156 Bacteria 14115
766 Ga0500633_0108269 3300053160 Bacteria 1028
767 Ga0500636_0230132 3300053177 Bacteria 960
768 Ga0590071_002746 3300059421 Bacteria 4409
769 Ga0587098_005447 3300059604 Bacteria 1250
770 Ga0587067_000331 3300059640 Bacteria 3901
771 Ga0587068_017021 3300059641 Bacteria 1158
772 Ga0587072_000984 3300059643 Bacteria 3311
773 Ga0530510_0062915 3300061734 Bacteria 2686
774 2510898377 2510461076 Bacteria 8618824
775 2513568887 2513237084 Bacteria 7231967
776 2513579914 2513237085 Bacteria 7695351
777 2513591228 2513237087 Bacteria 5817514
778 2513598225 2513237088 Bacteria 6927906
779 2514047767 2513237166 Bacteria 10373764
780 2514051881 2513237166 Bacteria 10373764
781 2515637713 2515154113 Bacteria 7807172
782 2515646585 2515154114 Bacteria 7848616
783 2515658645 2515154116 Bacteria 7552979
784 2515687687 2515154123 Bacteria 6387382
785 2519460723 2519103095 Bacteria 6629912
786 2585281904 2582581308 Bacteria 7413247
787 2585293175 2582581311 Bacteria 6763856
788 2585403298 2582581867 Bacteria 7184437
789 2585525392 2585427526 Bacteria 7258840
790 2585824102 2585427590 Bacteria 6824633
791 2597031010 2596583598 Bacteria 5251611
792 2599445910 2599185178 Bacteria 5365746
793 2599740280 2599185239 Bacteria 8686614
794 2599748960 2599185240 Bacteria 7968121
795 2600211093 2599185355 Bacteria 7968906
796 2644241304 2643221643 Bacteria 5749658
797 2644731248 2643221733 Bacteria 5690728
798 2676747166 2675903129 Bacteria 7964495
799 2723877141 2721755763 Bacteria 4464185
800 2746089361 2744054900 Bacteria 8399525
801 2746097886 2744054901 Bacteria 8397047
802 2776257208 2775506901 Bacteria 9631051
803 2808968703 2808606384 Bacteria 8474373
804 2809003534 2808606390 Bacteria 8476311
805 2809010811 2808606391 Bacteria 8308166
806 2817257525 2816332253 Bacteria 6764532
807 2817282071 2816332256 Bacteria 6891714
808 2817451468 2816332286 Bacteria 6853759
809 2819617029 2818991449 Bacteria 5518009
810 2819635473 2818991452 Bacteria 8442785
811 2828309410 2828305725 Bacteria 4916900
812 2835319591 2835312727 Bacteria 7413381
813 2838681066 2838680041 Bacteria 6545511
814 2838694901 2838694306 Bacteria 6853137
815 2838708277 2838707686 Bacteria 6619912
816 2841912818 2841911363 Bacteria 6173697
817 2841918565 2841917233 Bacteria 6173500
818 2842080489 2842077413 Bacteria 6508645
819 2842121108 2842118031 Bacteria 7033875
820 2842237689 2842237096 Bacteria 6620661
821 2842294148 2842291075 Bacteria 7076806
822 2842327745 2842324504 Bacteria 9364110
823 2842351647 2842348783 Bacteria 9002918
824 2842371529 2842370503 Bacteria 7038661
825 2842380545 2842377471 Bacteria 7140707
826 2842387616 2842384541 Bacteria 7057858
827 2842460636 2842454564 Bacteria 8730687
828 2852657191 2852653556 Bacteria 4050083
829 2863425224 2863421361 Bacteria 7300805
830 2870074121 2870068957 Bacteria 8925310
831 2885268270 2885266251 Bacteria 4796748
832 2885273901 2885270888 Bacteria 9831543
833 2891093109 2891088606 Bacteria 4762464
834 2894653403 2894652903 Bacteria 4587256
835 2900580750 2900577576 Bacteria 5438534
836 2900635371 2900634093 Bacteria 10263517
837 2904442631 2904439833 Bacteria 5931679
838 2904570248 2904564687 Bacteria 7609577
839 2904577509 2904571731 Bacteria 7608790
840 2917704991 2917699015 Bacteria 7043791
841 2921646577 2921643360 Bacteria 11448031
842 2928059060 2928058823 Bacteria 5520022
843 2928166069 2928163908 Bacteria 7561269
844 2928171148 2928170801 Bacteria 8785406
845 2928536497 2928536128 Bacteria 7657547
846 2928967862 2928963466 Bacteria 5165703
847 2935895423 2935894831 Bacteria 6620579
848 2936368389 2936367885 Bacteria 7324495
849 2936376220 2936375103 Bacteria 6652732
850 2981991348 2981990288 Bacteria 7590678
851 3005416481 3005409236 Bacteria 7188837
852 642420175 641736154 Bacteria 7689995
853 642595685 642555112 Bacteria 8676562
854 642621131 642555113 Bacteria 8214658
855 8005376876 8005376324 Bacteria 6590079
856 8005570171 8005563573 Bacteria 7153261
857 8018849256 8018845410 Bacteria 8933938
858 8020811133 8020807995 Bacteria 6801506
859 8020943763 8020938398 Bacteria 7472757
860 8020950028 8020945358 Bacteria 8467355
861 8020957306 8020953355 Bacteria 7439080
862 8021123284 8021120328 Bacteria 8782274
863 8023687253 8023680758 Bacteria 7729763
864 8024480829 8024479707 Bacteria 6954785
865 8024488840 8024486573 Bacteria 6540512
866 8039102994 8039098773 Bacteria 6602928
867 8040168240 8040167225 Bacteria 6542727
868 8040175974 8040173305 Bacteria 6827067
869 8046768798 8046767195 Bacteria 7547379
870 8046774801 8046767195 Bacteria 7547379
871 8054567933 8054563764 Bacteria 5592885
872 Ga0500595_000832
873 JGI24740J21852_10000077
874 JGI24740J21852_10005393
875 JGI24739J22299_10037163
876 JGI24739J22299_10045445
877 JGI25156J39149_1000501
878 JGI25156J39149_1002797
879 JGI25156J39149_1006188
880 JGI25162J39368_1001067
881 JGI25154J39366_1001249
882 JGI25151J46595_10003556
883 rootH2_10004477
884 rootL2_10036769
885 rootL2_10163942
886 rootH1_10149736
887 JGI25160J50197_1000161
888 Ga0006560J51390_1027746
889 JGI25404J52841_10005879
890 Ga0055538_1002016
891 Ga0055539_1000190
892 Ga0055539_1001774
893 Ga0055533_1001324
894 Ga0055533_1002299
895 Ga0055533_1003303
896 Ga0055533_1003789
897 Ga0055532_1000075
898 Ga0055532_1011975
899 Ga0055532_1012787
900 Ga0055532_1013422
901 Ga0055525_1000031
902 Ga0055525_1000686
903 Ga0055527_1000258
904 Ga0055527_1000567
905 Ga0055527_1000633
906 Ga0055527_1001561
907 Ga0055535_1000013
908 Ga0055535_1000523
909 Ga0055535_1000910
910 Ga0055535_1001427
911 Ga0055542_1000220
912 Ga0055542_1000541
913 Ga0055542_1000571
914 Ga0055542_1001873
915 Ga0055542_1004549
916 Ga0055529_1000085
917 Ga0055529_1000521
918 Ga0055529_1000774
919 Ga0055529_1001253
920 Ga0055529_1005201
921 Ga0055529_1006748
922 Ga0055526_1003815
923 Ga0055524_1002528
924 Ga0055528_1007308
925 Ga0055541_1000539
926 Ga0055541_1002933
927 Ga0055541_1002945
928 Ga0058692_1011998
929 Ga0065165_1000074
930 Ga0065165_1001055
931 Ga0065707_10045106
932 Ga0070658_10052600
933 Ga0070690_100400277
934 Ga0070666_10119367
935 Ga0070680_100161624
936 Ga0070689_100309547
937 Ga0070661_100000007
938 Ga0070661_100154495
939 Ga0070668_100303834
940 Ga0070671_100003946
941 Ga0070671_100052310
942 Ga0070674_100307466
943 Ga0070659_100000223
944 Ga0070703_10134683
945 Ga0070713_100037308
946 Ga0070713_100344431
947 Ga0070700_100442828
948 Ga0070663_100000002
949 Ga0070663_100001618
950 Ga0070663_100393277
951 Ga0070678_100110506
952 Ga0070706_100078042
953 Ga0070706_100281965
954 Ga0070707_100028200
955 Ga0070707_100204038
956 Ga0070707_100774247
957 Ga0070698_100000636
958 Ga0070698_100001471
959 Ga0070697_100035530
960 Ga0070697_100059440
961 Ga0070697_100353724
962 Ga0070695_100556789
963 Ga0070665_100040919
964 Ga0070665_100047558
965 Ga0070665_100254268
966 Ga0068855_100119216
967 Ga0068855_100718129
968 Ga0070664_100000004
969 Ga0070664_100515796
970 Ga0068857_100045920
971 Ga0068854_100000034
972 Ga0068856_100000530
973 Ga0068856_100003227
974 Ga0068852_100033918
975 Ga0068864_100031205
976 Ga0068870_10238168
977 Ga0068858_100194462
978 Ga0068858_100690452
979 Ga0068860_100014779
980 Ga0068862_100279451
981 Ga0081455_10000299
982 Ga0081455_10057901
983 Ga0081538_10005351
984 Ga0081538_10068446
985 Ga0081538_10073852
986 Ga0081540_1005016
987 Ga0081540_1021097
988 Ga0081540_1026233
989 Ga0081540_1060168
990 Ga0070717_10000603
991 Ga0070717_10067436
992 Ga0075365_10057613
993 Ga0075365_10171300
994 Ga0075363_100005221
995 Ga0075363_100044506
996 Ga0075362_10000561
997 Ga0075362_10004021
998 Ga0075362_10135158
999 Ga0075367_10036466
1000 Ga0075367_10053593
1001 Ga0075367_10089101
1002 Ga0075367_10166249
1003 Ga0075369_10052570
1004 Ga0075366_10040998
1005 Ga0097621_100364592
1006 Ga0075370_10064528
1007 Ga0075370_10080572
1008 Ga0075431_100004584
1009 Ga0075429_100056627
1010 Ga0075436_100127586
1011 Ga0099794_10008555
1012 Ga0099795_10004394
1013 Ga0105251_10069370
1014 Ga0105250_10003901
1015 Ga0105250_10096823
1016 Ga0105240_10000244
1017 Ga0105240_10000333
1018 Ga0105240_10005198
1019 Ga0105240_10029128
1020 Ga0105240_10052005
1021 Ga0105240_10126308
1022 Ga0105240_10162644
1023 Ga0105240_10652990
1024 Ga0105245_10290452
1025 Ga0105243_10173304
1026 Ga0105248_10010721
1027 Ga0105248_10307367
1028 Ga0105248_10595286
1029 Ga0105237_10172681
1030 Ga0105238_10000031
1031 Ga0105238_10537670
1032 Ga0105249_10356129
1033 Ga0105239_10000043
1034 Ga0105239_10000539
1035 Ga0105239_10077993
1036 Ga0105239_10219991
1037 Ga0157373_10012704
1038 Ga0157371_10000270
1039 Ga0157370_10000014
1040 Ga0157370_10069565
1041 Ga0157369_10011725
1042 Ga0157369_10137442
1043 Ga0157369_10937319
1044 Ga0157374_10419939
1045 Ga0157378_10018792
1046 Ga0157378_10092708
1047 Ga0163162_10940136
1048 Ga0157372_10001912
1049 Ga0163163_10135200
1050 Ga0163163_10155272
1051 Ga0157380_10023585
1052 Ga0182008_10026497
1053 Ga0157379_10279836
1054 Ga0157379_10863097
1055 Ga0157376_10040894
1056 Ga0157376_10507709
1057 Ga0182006_1034815
1058 Ga0182007_10008595
1059 Ga0182005_1005314
1060 Ga0183361_10003
1061 Ga0183361_10016
1062 Ga0197907_11324568
1063 Ga0206351_10413566
1064 Ga0154015_1491382
1065 Ga0213872_10000058
1066 Ga0213872_10001133
1067 Ga0213872_10004642
1068 Ga0213872_10011227
1069 Ga0213872_10024014
1070 Ga0213872_10076520
1071 Ga0213872_10172895
1072 Ga0213871_10017531
1073 Ga0209784_100297
1074 Ga0209784_100367
1075 Ga0209784_100840
1076 Ga0209566_100567
1077 Ga0209566_100620
1078 Ga0209566_100998
1079 Ga0209674_100083
1080 Ga0209674_100224
1081 Ga0209674_100249
1082 Ga0209674_101969
1083 Ga0209674_106784
1084 Ga0209672_100012
1085 Ga0209672_100063
1086 Ga0209672_100074
1087 Ga0209672_101023
1088 Ga0209672_102666
1089 Ga0209147_100005
1090 Ga0209147_100007
1091 Ga0209147_100077
1092 Ga0209147_100119
1093 Ga0209563_100016
1094 Ga0209563_100044
1095 Ga0209563_103098
1096 Ga0209563_109140
1097 Ga0207427_104022
1098 Ga0209437_100338
1099 Ga0209258_100007
1100 Ga0209258_100014
1101 Ga0209258_100105
1102 Ga0209258_100546
1103 Ga0209258_103401
1104 Ga0209258_105860
1105 Ga0209646_1000016
1106 Ga0209677_100008
1107 Ga0209677_102084
1108 Ga0209677_103548
1109 Ga0209148_1000002
1110 Ga0209148_1000041
1111 Ga0209148_1000051
1112 Ga0209148_1000107
1113 Ga0209148_1003274
1114 Ga0209148_1004110
1115 Ga0209759_1000341
1116 Ga0209759_1002154
1117 Ga0209759_1002447
1118 Ga0209759_1003942
1119 Ga0209759_1004691
1120 Ga0209233_1008898
1121 Ga0209455_1000007
1122 Ga0209455_1000011
1123 Ga0209455_1000100
1124 Ga0209455_1000220
1125 Ga0209455_1000528
1126 Ga0209455_1006798
1127 Ga0209673_1000101
1128 Ga0209130_1003511
1129 Ga0209675_1010312
1130 Ga0209025_1039087
1131 Ga0209025_1102776
1132 Ga0209564_1000003
1133 Ga0209564_1006036
1134 Ga0209564_1041552
1135 Ga0209758_1003394
1136 Ga0209256_1000176
1137 Ga0207426_1000180
1138 Ga0207426_1030923
1139 Ga0209051_1037272
1140 Ga0209257_1031562
1141 Ga0207696_1056357
1142 Ga0207713_1068608
1143 Ga0207647_10011575
1144 Ga0207699_10172032
1145 Ga0207643_10133851
1146 Ga0207705_10055272
1147 Ga0207684_10283191
1148 Ga0207684_10477043
1149 Ga0207695_10000262
1150 Ga0207695_10000623
1151 Ga0207695_10002240
1152 Ga0207695_10002319
1153 Ga0207695_10047750
1154 Ga0207695_10090184
1155 Ga0207695_10102493
1156 Ga0207695_10187713
1157 Ga0207695_10591851
1158 Ga0207671_10097610
1159 Ga0207671_10099223
1160 Ga0207693_10003527
1161 Ga0207693_10029593
1162 Ga0207663_10034041
1163 Ga0207657_10000442
1164 Ga0207649_10000205
1165 Ga0207652_10178619
1166 Ga0207646_10035949
1167 Ga0207646_10318394
1168 Ga0207646_10543632
1169 Ga0207646_10632401
1170 Ga0207694_10000062
1171 Ga0207650_10384398
1172 Ga0207659_10496633
1173 Ga0207687_10499496
1174 Ga0207700_10086016
1175 Ga0207700_10147789
1176 Ga0207644_10012046
1177 Ga0207644_10015307
1178 Ga0207644_10023149
1179 Ga0207690_10000037
1180 Ga0207690_10111541
1181 Ga0207670_10036273
1182 Ga0207704_10460788
1183 Ga0207665_10369130
1184 Ga0207711_10067936
1185 Ga0207711_10412620
1186 Ga0207711_10564700
1187 Ga0207689_10409582
1188 Ga0207679_10000002
1189 Ga0207679_10287648
1190 Ga0207667_10029566
1191 Ga0207640_10000257
1192 Ga0207703_10057979
1193 Ga0207703_10368351
1194 Ga0207678_10000003
1195 Ga0207678_10000317
1196 Ga0207702_10000282
1197 Ga0207702_10002185
1198 Ga0207676_10028791
1199 Ga0207674_10013124
1200 Ga0207674_10059557
1201 Ga0207683_10162880
1202 Ga0207698_10303566
1203 Ga0209371_1000080
1204 Ga0209588_1004182
1205 Ga0209588_1042691
1206 Ga0209998_10036829
1207 Ga0268266_10013898
1208 Ga0268266_10048395
1209 Ga0265319_1011004
1210 Ga0265334_10012147
1211 Ga0307517_10010987
1212 Ga0307515_10004677
1213 Ga0307515_10006880
1214 Ga0307515_10036958
1215 Ga0307515_10187944
1216 Ga0265338_10028317
1217 Ga0265324_10031483
1218 Ga0268256_1000263
1219 Ga0307512_10024522
1220 Ga0307512_10127864
1221 Ga0265328_10000601
1222 Ga0265320_10001290
1223 Ga0265331_10066011
1224 Ga0265327_10001382
1225 Ga0265316_10104778
1226 Ga0307513_10105123
1227 Ga0307509_10001286
1228 Ga0307509_10013769
1229 Ga0307509_10102717
1230 Ga0307509_10217359
1231 Ga0307508_10000088
1232 Ga0307508_10000159
1233 Ga0307508_10285536
1234 Ga0307514_10003621
1235 Ga0307514_10185313
1236 Ga0265314_10003925
1237 Ga0307405_10107509
1238 Ga0307405_10647306
1239 Ga0307518_10079505
1240 Ga0307510_10001739
1241 Ga0307510_10002924
1242 Ga0307510_10194911
1243 Ga0373932_0137298
1244 Ga0373939_0051346
1245 Ga0373957_0036911
1246 Ga0373960_0068885
1247 Ga0373955_0006391
1248 Ga0373955_0313822
1249 Ga0373931_0059425
1250 Ga0373937_0199126
1251 Ga0395899_0001096
1252 Ga0395899_0007777
1253 Ga0395900_0003519
1254 Ga0395900_0019699
1255 Ga0395898_0051377
1256 Ga0395905_0000004
1257 Ga0395905_0016259
1258 Ga0395905_0031719
1259 Ga0395905_0791554
1260 Ga0436364_1010474
1261 Ga0436364_1048249
1262 Ga0395901_0007491
1263 Ga0436365_1186277
1264 Ga0436360_0055769
1265 Ga0436360_0077353
1266 Ga0436360_0151145
1267 Ga0436360_0473946
1268 Ga0436360_1244250
1269 Ga0436361_0009072
1270 Ga0436361_0015246
1271 Ga0436361_0068556
1272 Ga0436361_0072645
1273 Ga0436361_0154893
1274 Ga0436361_0285974
1275 Ga0436361_0327497
1276 Ga0436361_0396047
1277 Ga0436361_0691909
1278 Ga0436361_0854298
1279 Ga0436361_0898793
1280 Ga0436361_0927296
1281 Ga0436361_0991922
1282 Ga0436361_1032389
1283 Ga0436361_1076629
1284 Ga0436361_1103177
1285 Ga0439465_0038100
1286 Ga0451793_0099842
1287 Ga0451833_0521900
1288 Ga0451835_0089958
1289 Ga0451837_0949555
1290 Ga0451839_0148025
1291 Ga0451841_0180740
1292 Ga0451845_0404377
1293 Ga0451847_0356391
1294 Ga0451849_0652222
1295 Ga0451851_0196131
1296 Ga0451843_0644706
1297 Ga0451855_0100114
1298 Ga0451853_1334978
1299 Ga0439432_069026
1300 Ga0439459_0075758
1301 Ga0466969_0028584
1302 Ga0466966_0006790
1303 Ga0466968_0139680
1304 Ga0466970_0049603
1305 Ga0466959_0029570
1306 Ga0495617_053260
1307 Ga0495592_0000205
1308 Ga0495592_0007838
1309 Ga0495592_0016393
1310 Ga0495592_0021883
1311 Ga0495603_0006100
1312 Ga0495603_0048169
1313 Ga0495590_0008396
1314 Ga0495591_001698
1315 Ga0495629_0001193
1316 Ga0495629_0002100
1317 Ga0495629_0014979
1318 Ga0495629_0054326
1319 Ga0495629_0095264
1320 Ga0495638_0001744
1321 Ga0495638_0006787
1322 Ga0495638_0131736
1323 Ga0495638_0347317
1324 Ga0495641_0013804
1325 Ga0495651_0007051
1326 Ga0495651_0019238
1327 Ga0495653_0001764
1328 Ga0495653_0017662
1329 Ga0495653_0035612
1330 Ga0495650_0000812
1331 Ga0495650_0006038
1332 Ga0495650_0021725
1333 Ga0495580_0000864
1334 Ga0495580_0000945
1335 Ga0495580_0003406
1336 Ga0495580_0007092
1337 Ga0495580_0007981
1338 Ga0495580_0008113
1339 Ga0495580_0259852
1340 Ga0495582_0003431
1341 Ga0495605_0018467
1342 Ga0495662_0024784
1343 Ga0495664_0000493
1344 Ga0495664_0032858
1345 Ga0495664_0051850
1346 Ga0495594_0120038
1347 Ga0495596_0026168
1348 Ga0495583_0009087
1349 Ga0495583_0024701
1350 Ga0495606_0040944
1351 Ga0495606_0052066
1352 Ga0495608_0004706
1353 Ga0495608_0027649
1354 Ga0495610_0044297
1355 Ga0495616_0215908
1356 Ga0495618_0009128
1357 Ga0495618_0015754
1358 Ga0495618_0112207
1359 Ga0495618_0333007
1360 Ga0495620_0009098
1361 Ga0495620_0101830
1362 Ga0495628_0004908
1363 Ga0495628_0007273
1364 Ga0495628_0014868
1365 Ga0495628_0033954
1366 Ga0495628_0104445
1367 Ga0495630_0006497
1368 Ga0495630_0019627
1369 Ga0495630_0041883
1370 Ga0495630_0180254
1371 Ga0495632_0142961
1372 Ga0495632_0281328
1373 Ga0495643_0018152
1374 Ga0495643_0179837
1375 Ga0495648_0010371
1376 Ga0495648_0108887
1377 Ga0495648_0116894
1378 Ga0495648_0251194
1379 Ga0495666_0001397
1380 Ga0495666_0001421
1381 Ga0495666_0092024
1382 Ga0495666_0185228
1383 Ga0495642_0046906
1384 Ga0495652_0031032
1385 Ga0495652_0108025
1386 Ga0495654_0097519
1387 Ga0495665_0003557
1388 Ga0495665_0004099
1389 Ga0495665_0162042
1390 Ga0495640_0010699
1391 Ga0495640_0019714
1392 Ga0495640_0022510
1393 Ga0495640_0311495
1394 Ga0495586_0006311
1395 Ga0495586_0150536
1396 Ga0495587_0003286
1397 Ga0495587_0005534
1398 Ga0495587_0011186
1399 Ga0495597_0084556
1400 Ga0495597_0087233
1401 Ga0495645_0001429
1402 Ga0495645_0062924
1403 Ga0495622_0000112
1404 Ga0495622_0050115
1405 Ga0495633_0008420
1406 Ga0495667_0009714
1407 Ga0495667_0037388
1408 Ga0495668_0110625
1409 Ga0495668_0266876
1410 Ga0495634_0003385
1411 Ga0495634_0015660
1412 Ga0495634_0035741
1413 Ga0495611_0009536
1414 Ga0495625_0215465
1415 Ga0495635_0003125
1416 Ga0495635_0003436
1417 Ga0495635_0443714
1418 Ga0495661_0002648
1419 Ga0495661_0008884
1420 Ga0495661_0025258
1421 Ga0495657_0026208
1422 Ga0495657_0032857
1423 Ga0495599_0002693
1424 Ga0495599_0008887
1425 Ga0495599_0014101
1426 Ga0495599_0028914
1427 Ga0495623_0002567
1428 Ga0495623_0008883
1429 Ga0495623_0118188
1430 Ga0495646_0003486
1431 Ga0495646_0003639
1432 Ga0495646_0008768
1433 Ga0495646_0035564
1434 Ga0495646_0053859
1435 Ga0495613_0001812
1436 Ga0495613_0002978
1437 Ga0495613_0093555
1438 Ga0495624_0001002
1439 Ga0495624_0003869
1440 Ga0495670_0271258
1441 Ga0495671_0017727
1442 Ga0495671_0039564
1443 Ga0495589_0007499
1444 Ga0495589_0113164
1445 Ga0495600_0009704
1446 Ga0495600_0023950
1447 Ga0495600_0068857
1448 Ga0495600_0147658
1449 Ga0495660_0137330
1450 Ga0495581_0004373
1451 Ga0495581_0044158
1452 Ga0495604_0013274
1453 Ga0495604_0019571
1454 Ga0495604_0040252
1455 Ga0495604_0042400
1456 Ga0495604_0044330
1457 Ga0495604_0086227
1458 Ga0495604_0206873
1459 Ga0495674_0019285
1460 Ga0495674_0034503
1461 Ga0495674_0039568
1462 Ga0495674_0045329
1463 Ga0495674_0052958
1464 Ga0495674_0073184
1465 Ga0495674_0113100
1466 Ga0495672_0061033
1467 Ga0495676_0002356
1468 Ga0495676_0028046
1469 Ga0495676_0297812
1470 Ga0495680_0007573
1471 Ga0495680_0033222
1472 Ga0495680_0133766
1473 Ga0495683_0001469
1474 Ga0495683_0017733
1475 Ga0495683_0118879
1476 Ga0495687_115867
1477 Ga0495675_0002316
1478 Ga0495675_0011045
1479 Ga0495675_0016691
1480 Ga0495679_000110
1481 Ga0495679_000439
1482 Ga0495679_002707
1483 Ga0495673_0022150
1484 Ga0495673_0030433
1485 Ga0495684_0020082
1486 Ga0495684_0557075
1487 Ga0495686_0045315
1488 Ga0495686_0115387
1489 Ga0495593_0001604
1490 Ga0495593_0003043
1491 Ga0495602_0003762
1492 Ga0495602_0008295
1493 Ga0495602_0041556
1494 Ga0495602_0073285
1495 Ga0495602_0200284
1496 Ga0495614_0001047
1497 Ga0495615_0002493
1498 Ga0495626_0011202
1499 Ga0496100_0000251
1500 Ga0496101_0000346
1501 Ga0496102_0004434
1502 Ga0496102_0013495
1503 Ga0496102_0287253
1504 Ga0496102_0563028
1505 Ga0496103_0000314
1506 Ga0496103_0001908
1507 Ga0496103_0118726
1508 Ga0496104_0002191
1509 Ga0496104_0108967
1510 Ga0496104_0114535
1511 Ga0496104_0239571
1512 Ga0496104_0258692
1513 Ga0496105_0005523
1514 Ga0496105_0154890
1515 Ga0496105_0178472
1516 Ga0496105_0234254
1517 Ga0496106_0000712
1518 Ga0496106_0074025
1519 Ga0496106_0082246
1520 Ga0496107_0322053
1521 Ga0496108_0003220
1522 Ga0496108_0019773
1523 Ga0496109_0036962
1524 Ga0496109_0044895
1525 Ga0496110_0026001
1526 Ga0496110_0366345
1527 Ga0496112_0046866
1528 Ga0496112_0304031
1529 Ga0496113_0075457
1530 Ga0496113_0079936
1531 Ga0496113_0651839
1532 Ga0496115_0062505
1533 Ga0496116_0058619
1534 Ga0496116_0062663
1535 Ga0496116_0100849
1536 Ga0496117_0000665
1537 Ga0496117_0009849
1538 Ga0496117_0031023
1539 Ga0496117_0042962
1540 Ga0496117_0261695
1541 Ga0496118_0000619
1542 Ga0496118_0002376
1543 Ga0496118_0004494
1544 Ga0496118_0010955
1545 Ga0496118_0029528
1546 Ga0496118_0043606
1547 Ga0496118_0044138
1548 Ga0496118_0048445
1549 Ga0496118_0110523
1550 Ga0496119_0000131
1551 Ga0496119_0048977
1552 Ga0496119_0153177
1553 Ga0496119_0208833
1554 Ga0496120_0000182
1555 Ga0496121_0000341
1556 Ga0496121_0002720
1557 Ga0496121_0002837
1558 Ga0496121_0042999
1559 Ga0496121_0094361
1560 Ga0496121_0339426
1561 Ga0496121_0419176
1562 Ga0496122_0027576
1563 Ga0496124_0077147
1564 Ga0496124_0108613
1565 Ga0496125_0345380
1566 Ga0496126_0000996
1567 Ga0496126_0001358
1568 Ga0496126_0037504
1569 Ga0496126_0080130
1570 Ga0496126_0132583
1571 Ga0496126_0242373
1572 Ga0496126_0306704
1573 Ga0496126_0636313
1574 Ga0495678_046170
1575 Ga0495682_0024475
1576 Ga0495682_0059576
1577 Ga0501034_0000708
1578 Ga0501034_0003790
1579 Ga0501034_0090019
1580 Ga0501034_0244885
1581 Ga0501040_0229945
1582 Ga0501046_0138631
1583 Ga0501068_0083153
1584 Ga0501068_0432791
1585 Ga0501071_0044713
1586 Ga0501071_0446297
1587 Ga0501072_0031625
1588 Ga0501075_0046472
1589 Ga0501077_0264754
1590 Ga0501079_0012162
1591 Ga0501081_0022187
1592 Ga0501044_0093314
1593 nmdc:mga03683_19017_c1
1594 nmdc:mga03683_31879_c1
1595 nmdc:mga03683_56895_c1
1596 nmdc:mga03n38_3156_c1
1597 nmdc:mga03n38_58102_c1
1598 nmdc:mga0yw44_137794_c1
1599 nmdc:mga0yw44_17259_c1
1600 nmdc:mga0yw44_19935_c1
1601 nmdc:mga0yw44_51999_c1
1602 nmdc:mga0k408_101347_c1
1603 nmdc:mga06z11_12830_c1
1604 nmdc:mga06z11_19805_c1
1605 nmdc:mga06z11_34549_c1
1606 nmdc:mga07m45_50233_c1
1607 nmdc:mga09592_11604_c1
1608 nmdc:mga0n895_771319_c1
1609 nmdc:mga0sz30_117398_c1
1610 nmdc:mga0sz30_35933_c1
1611 nmdc:mga0sz30_4490_c1
1612 Ga0495601_0080021
1613 Ga0495601_0205962
1614 Ga0495612_0015008
1615 Ga0500610_0061769
1616 Ga0495595_0004318
1617 Ga0495619_0012591
1618 Ga0495619_0140950
1619 Ga0500578_0057251
1620 Ga0500583_0016504
1621 Ga0500651_0035507
1622 Ga0500651_0049601
1623 Ga0500641_0013313
1624 Ga0500594_0006514
1625 Ga0500595_007335
1626 Ga0500595_013314
1627 Ga0500564_093273
1628 Ga0500568_0077573
1629 Ga0500590_004048
1630 Ga0500616_0001521
1631 Ga0500616_0032502
1632 Ga0500616_0058764
1633 Ga0500616_0075102
1634 Ga0500616_0203107
1635 Ga0500620_144375
1636 Ga0500622_0002271
1637 Ga0500633_0108269
1638 Ga0500636_0230132
1639 Ga0590071_002746
1640 Ga0587098_005447
1641 Ga0587067_000331
1642 Ga0587068_017021
1643 Ga0587072_000984
1644 Ga0530510_0062915
1645 2510898377
1646 2513568887
1647 2513579914
1648 2513591228
1649 2513598225
1650 2514047767
1651 2514051881
1652 2515637713
1653 2515646585
1654 2515658645
1655 2515687687
1656 2519460723
1657 2585281904
1658 2585293175
1659 2585403298
1660 2585525392
1661 2585824102
1662 2597031010
1663 2599445910
1664 2599740280
1665 2599748960
1666 2600211093
1667 2644241304
1668 2644731248
1669 2676747166
1670 2723877141
1671 2746089361
1672 2746097886
1673 2776257208
1674 2808968703
1675 2809003534
1676 2809010811
1677 2817257525
1678 2817282071
1679 2817451468
1680 2819617029
1681 2819635473
1682 2828309410
1683 2835319591
1684 2838681066
1685 2838694901
1686 2838708277
1687 2841912818
1688 2841918565
1689 2842080489
1690 2842121108
1691 2842237689
1692 2842294148
1693 2842327745
1694 2842351647
1695 2842371529
1696 2842380545
1697 2842387616
1698 2842460636
1699 2852657191
1700 2863425224
1701 2870074121
1702 2885268270
1703 2885273901
1704 2891093109
1705 2894653403
1706 2900580750
1707 2900635371
1708 2904442631
1709 2904570248
1710 2904577509
1711 2917704991
1712 2921646577
1713 2928059060
1714 2928166069
1715 2928171148
1716 2928536497
1717 2928967862
1718 2935895423
1719 2936368389
1720 2936376220
1721 2981991348
1722 3005416481
1723 642420175
1724 642595685
1725 642621131
1726 8005376876
1727 8005570171
1728 8018849256
1729 8020811133
1730 8020943763
1731 8020950028
1732 8020957306
1733 8021123284
1734 8023687253
1735 8024480829
1736 8024488840
1737 8039102994
1738 8040168240
1739 8040175974
1740 8046768798
1741 8046774801
1742 8054567933

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06314

ADC

Acetoacetate decarboxylase (ADC)

42

279

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.9931 1 246
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.9891 1 246
3bh2-assembly1.cif.gz_A structural studies of acetoacetate decarboxylase 0.9731 1 246
3bh2-assembly1.cif.gz_A structural studies of acetoacetate decarboxylase 0.9692 1 246
3c8w-assembly1.cif.gz_A crystal structure of acetoacetate decarboxylase (adc) (yp_094708.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.60 a resolution 0.9479 6 246
ID Description Score Start End Superfamily
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.9923 14 245 2.40.400.10
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.988 14 245 2.40.400.10
4zbtD00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.9014 11 243 2.40.400.10
3cmbA00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.8554 20 242 2.40.400.10
4zbtD00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.8491 11 243 2.40.400.10
ID Description Score Start End GO Terms
AF-A0A352SAK1-F1-model_v4 Acetoacetate decarboxylase (EC 4.1.1.4) 0.9999 48 247 GO:0047602
AF-A0A535EX24-F1-model_v4 Acetoacetate decarboxylase (EC 4.1.1.4) 0.9998 98 246 GO:0047602
AF-A0A211ZJP5-F1-model_v4 Acetoacetate decarboxylase 0.9984 77 246 GO:0016829
AF-A0A2J6MTL3-F1-model_v4 Acetoacetate decarboxylase (AAD) (ADC) (EC 4.1.1.4) 0.9977 1 246 GO:0047602
AF-A0A554TU78-F1-model_v4 deleted 0.997 7 216

Map