F484191

General Info

Members Datasets Scaffolds Average Seq Length
871 336 869 335

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10102682|Ga0307507_101026822
Length 393
Sequence MVRPRLVSQVGPIARSRYEQNNGQVTGFAEERVPERTEITALNGSQPGRTAKNMSTVITRNWRDLIRPRGIQIESETLTDFYGKFSCEPLERGYGITIGNSLRRVLLSSLQGAAITAIRIDGALHEFTTISDVVEDVTXXXLNLKEVVLKAATPKTYTVRLDKEGPGPVYARDIQLVDGLQVLNPDHLIATLDKKGPLSMELTVNVGRGYVPAEKNKTATMPIGTIPIDALFSPTRKVNYTVTNARVGQATDYDKLALEVWTNGSVKPQDAVAYAAKILKEQLSIFINFEETEETAYQAPGGEDEPLNENLFRSVDELELSVRSANCLQNANITLIGELVQRTEQDMLKTKNFGRKSLKEIKEILANMGLSLGMKIDNWPQMLERWKAQQAQA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
3 3300002865 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
160 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
170 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
172 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
199 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
200 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
201 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
202 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
203 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
305 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
336 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 7
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 1.03
Rhizosphere 94.14
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1759361 2162886007 Bacteria 232727
2 Ga0006761J43178_107884 3300002865 Bacteria 1623
3 Ga0006758J48902_1011730 3300003300 Bacteria 2534
4 Ga0006758J48902_1013914 3300003300 Bacteria 1154
5 JGI26138J51218_100829 3300003504 Bacteria 1162
6 Ga0058863_10079010 3300004799 Bacteria 4423
7 Ga0058863_11799350 3300004799 Bacteria 1957
8 Ga0058863_11878586 3300004799 Bacteria 1602
9 Ga0058861_11958900 3300004800 Bacteria 1611
10 Ga0058861_11963644 3300004800 Bacteria 2959
11 Ga0058860_12161439 3300004801 Bacteria 5444
12 Ga0058862_12711381 3300004803 Bacteria 2101
13 Ga0065714_10014037 3300005288 Bacteria 2186
14 Ga0065704_10070132 3300005289 Bacteria 1955461
15 Ga0065715_10104520 3300005293 Bacteria 2956
16 Ga0065715_10122190 3300005293 Bacteria 2211
17 Ga0065715_10226073 3300005293 Bacteria 1252
18 Ga0065707_10082720 3300005295 Bacteria 12520
19 Ga0070683_100107294 3300005329 Bacteria 2633
20 Ga0070690_100000832 3300005330 Bacteria 15648
21 Ga0070690_100107616 3300005330 Bacteria 1856
22 Ga0070670_100001731 3300005331 Bacteria 17782
23 Ga0070670_100014297 3300005331 Bacteria 6810
24 Ga0070666_10004312 3300005335 Bacteria 8656
25 Ga0070666_10010358 3300005335 Bacteria 5830
26 Ga0070682_100012980 3300005337 Bacteria 4782
27 Ga0070682_100042827 3300005337 Bacteria 2797
28 Ga0068868_100003470 3300005338 Bacteria 10983
29 Ga0068868_100023242 3300005338 Bacteria 4690
30 Ga0068868_100334682 3300005338 Bacteria 1293
31 Ga0070689_100074153 3300005340 Bacteria 2662
32 Ga0070689_100075687 3300005340 Bacteria 2636
33 Ga0070661_100059685 3300005344 Unclassified 2798
34 Ga0070675_100000102 3300005354 Bacteria 50103
35 Ga0070675_100002074 3300005354 Bacteria 14841
36 Ga0070675_100008285 3300005354 Bacteria 8064
37 Ga0070675_100102461 3300005354 Unclassified 2412
38 Ga0070675_100112715 3300005354 Bacteria 2303
39 Ga0070675_100143314 3300005354 Bacteria 2044
40 Ga0070671_100001915 3300005355 Bacteria 15937
41 Ga0070671_100016587 3300005355 Bacteria 5955
42 Ga0070671_100031304 3300005355 Bacteria 4394
43 Ga0070671_100098834 3300005355 Bacteria 2448
44 Ga0070674_100064977 3300005356 Bacteria 2559
45 Ga0070674_100091897 3300005356 Bacteria 2193
46 Ga0070673_100002597 3300005364 Bacteria 11037
47 Ga0070673_100007622 3300005364 Bacteria 7162
48 Ga0070673_100160255 3300005364 Bacteria 1913
49 Ga0070688_100038207 3300005365 Bacteria 2930
50 Ga0070688_100051462 3300005365 Bacteria 2570
51 Ga0070688_100133628 3300005365 Bacteria 1677
52 Ga0070688_100174410 3300005365 Bacteria 1486
53 Ga0070659_100224456 3300005366 Bacteria 1551
54 Ga0070667_100002116 3300005367 Bacteria 17503
55 Ga0070667_100020021 3300005367 Bacteria 5554
56 Ga0070667_100022644 3300005367 Bacteria 5210
57 Ga0070667_100264636 3300005367 Bacteria 1540
58 Ga0070701_10022405 3300005438 Bacteria 3028
59 Ga0070701_10057367 3300005438 Bacteria 2041
60 Ga0070705_100123889 3300005440 Bacteria 1674
61 Ga0070694_100001928 3300005444 Bacteria 12291
62 Ga0070694_100109789 3300005444 Bacteria 1964
63 Ga0070694_100173158 3300005444 Bacteria 1591
64 Ga0070694_100264950 3300005444 Bacteria 1305
65 Ga0070708_100090460 3300005445 Bacteria 2786
66 Ga0070708_100221635 3300005445 Bacteria 1774
67 Ga0070662_100139019 3300005457 Bacteria 1880
68 Ga0070681_10046903 3300005458 Bacteria 4319
69 Ga0070681_10401337 3300005458 Bacteria 1282
70 Ga0068867_100134454 3300005459 Bacteria 1926
71 Ga0070685_10011829 3300005466 Bacteria 4576
72 Ga0070685_10029887 3300005466 Bacteria 3031
73 Ga0070685_10221497 3300005466 Bacteria 1240
74 Ga0070706_100004471 3300005467 Bacteria 13486
75 Ga0070706_100306085 3300005467 Bacteria 1482
76 Ga0070707_100031674 3300005468 Bacteria 5038
77 Ga0070698_100043375 3300005471 Bacteria 4611
78 Ga0070699_100000533 3300005518 Bacteria 36015
79 Ga0070699_100028609 3300005518 Bacteria 4805
80 Ga0070684_100096952 3300005535 Bacteria 2629
81 Ga0070697_100001607 3300005536 Bacteria 17220
82 Ga0070697_100030323 3300005536 Bacteria 4344
83 Ga0070697_100102678 3300005536 Bacteria 2376
84 Ga0070697_100230798 3300005536 Bacteria 1579
85 Ga0070697_100365964 3300005536 Bacteria 1247
86 Ga0070672_100006620 3300005543 Bacteria 7802
87 Ga0070672_100008647 3300005543 Bacteria 6977
88 Ga0070672_100213444 3300005543 Bacteria 1617
89 Ga0070686_100086509 3300005544 Bacteria 2087
90 Ga0070686_100156464 3300005544 Bacteria 1601
91 Ga0070695_100054427 3300005545 Bacteria 2575
92 Ga0070696_100062684 3300005546 Bacteria 2603
93 Ga0070696_100064748 3300005546 Bacteria 2562
94 Ga0070704_100006043 3300005549 Bacteria 7100
95 Ga0070704_100033596 3300005549 Bacteria 3470
96 Ga0070704_100093915 3300005549 Bacteria 2243
97 Ga0070704_100170614 3300005549 Bacteria 1730
98 Ga0068855_100000266 3300005563 Bacteria 65127
99 Ga0068855_100002209 3300005563 Bacteria 24080
100 Ga0068855_100125423 3300005563 Bacteria 2936
101 Ga0070664_100002539 3300005564 Bacteria 14721
102 Ga0070664_100005021 3300005564 Bacteria 10602
103 Ga0068857_100236856 3300005577 Bacteria 1670
104 Ga0068856_100014349 3300005614 Bacteria 7659
105 Ga0068856_100042559 3300005614 Bacteria 4468
106 Ga0068856_100072572 3300005614 Bacteria 3408
107 Ga0068856_100323434 3300005614 Bacteria 1560
108 Ga0068856_100390801 3300005614 Bacteria 1411
109 Ga0068859_100000703 3300005617 Bacteria 33591
110 Ga0068859_100006716 3300005617 Bacteria 11688
111 Ga0068859_100051052 3300005617 Bacteria 4156
112 Ga0068859_100064970 3300005617 Bacteria 3683
113 Ga0068859_100151351 3300005617 Bacteria 2396
114 Ga0068859_100219325 3300005617 Bacteria 1989
115 Ga0068864_100006004 3300005618 Bacteria 9969
116 Ga0068864_100133292 3300005618 Bacteria 2234
117 Ga0068864_100335858 3300005618 Bacteria 1423
118 Ga0068864_100469165 3300005618 Bacteria 1206
119 Ga0068861_100031668 3300005719 Bacteria 3887
120 Ga0068863_100000422 3300005841 Bacteria 42939
121 Ga0068863_100129008 3300005841 Bacteria 2413
122 Ga0068863_100391856 3300005841 Bacteria 1357
123 Ga0068858_100062457 3300005842 Bacteria 3444
124 Ga0068858_100125149 3300005842 Bacteria 2406
125 Ga0068858_100125452 3300005842 Bacteria 2403
126 Ga0068858_100499190 3300005842 Bacteria 1175
127 Ga0068858_100563358 3300005842 Bacteria 1103
128 Ga0068860_100012322 3300005843 Bacteria 8424
129 Ga0068860_100025069 3300005843 Bacteria 5756
130 Ga0081455_10003850 3300005937 Bacteria 17117
131 Ga0081538_10001299 3300005981 Bacteria 25836
132 Ga0081538_10019881 3300005981 Unclassified 4967
133 Ga0075366_10036607 3300006195 Bacteria 2894
134 Ga0075366_10042994 3300006195 Bacteria 2676
135 Ga0075366_10135357 3300006195 Bacteria 1488
136 Ga0075366_10152131 3300006195 Bacteria 1401
137 Ga0097621_100015996 3300006237 Bacteria 5657
138 Ga0097621_100025188 3300006237 Bacteria 4652
139 Ga0097621_100133656 3300006237 Bacteria 2114
140 Ga0097621_100202538 3300006237 Bacteria 1724
141 Ga0097621_100361951 3300006237 Bacteria 1292
142 Ga0068871_100066595 3300006358 Bacteria 2953
143 Ga0068871_100092633 3300006358 Bacteria 2520
144 Ga0068871_100123853 3300006358 Bacteria 2186
145 Ga0068871_100241985 3300006358 Bacteria 1569
146 Ga0068871_100276296 3300006358 Bacteria 1468
147 Ga0068871_100308677 3300006358 Bacteria 1390
148 Ga0075428_100000542 3300006844 Bacteria 38572
149 Ga0075428_100003062 3300006844 Bacteria 18244
150 Ga0075428_100032985 3300006844 Bacteria 5717
151 Ga0075428_100041729 3300006844 Bacteria 5043
152 Ga0075428_100072820 3300006844 Bacteria 3752
153 Ga0075428_100236114 3300006844 Unclassified 1973
154 Ga0075428_100456962 3300006844 Bacteria 1368
155 Ga0075430_100005705 3300006846 Bacteria 10502
156 Ga0075430_100019248 3300006846 Bacteria 5804
157 Ga0075430_100042805 3300006846 Bacteria 3829
158 Ga0075430_100075246 3300006846 Bacteria 2831
159 Ga0075430_100080488 3300006846 Bacteria 2729
160 Ga0075431_100042817 3300006847 Bacteria 4670
161 Ga0075431_100042954 3300006847 Bacteria 4664
162 Ga0075431_100139791 3300006847 Bacteria 2496
163 Ga0075431_100306563 3300006847 Bacteria 1603
164 Ga0075433_10008964 3300006852 Bacteria 7988
165 Ga0075433_10132392 3300006852 Bacteria 2215
166 Ga0075433_10371159 3300006852 Bacteria 1263
167 Ga0075434_100005032 3300006871 Bacteria 12002
168 Ga0075434_100029963 3300006871 Bacteria 5357
169 Ga0075434_100049382 3300006871 Bacteria 4178
170 Ga0075434_100158771 3300006871 Bacteria 2281
171 Ga0075434_100184395 3300006871 Bacteria 2107
172 Ga0075434_100582823 3300006871 Bacteria 1138
173 Ga0075429_100107344 3300006880 Bacteria 2440
174 Ga0075436_100015587 3300006914 Bacteria 5204
175 Ga0097620_100000703 3300006931 Bacteria 33591
176 Ga0097620_100006716 3300006931 Bacteria 11688
177 Ga0097620_100051049 3300006931 Bacteria 4156
178 Ga0097620_100064970 3300006931 Bacteria 3683
179 Ga0097620_100151350 3300006931 Bacteria 2396
180 Ga0097620_100219325 3300006931 Bacteria 1989
181 Ga0075435_100017305 3300007076 Bacteria 5454
182 Ga0075435_100046934 3300007076 Bacteria 3467
183 Ga0075435_100151668 3300007076 Bacteria 1949
184 Ga0075435_100182241 3300007076 Bacteria 1775
185 Ga0099794_10007466 3300007265 Bacteria 4495
186 Ga0099795_10094504 3300007788 Bacteria 1164
187 Ga0111539_10001407 3300009094 Bacteria 32019
188 Ga0111539_10011546 3300009094 Bacteria 11084
189 Ga0111539_10011746 3300009094 Bacteria 10987
190 Ga0111539_10014963 3300009094 Bacteria 9671
191 Ga0111539_10019680 3300009094 Bacteria 8326
192 Ga0111539_10052091 3300009094 Bacteria 4873
193 Ga0111539_10055434 3300009094 Bacteria 4712
194 Ga0111539_10121685 3300009094 Bacteria 3058
195 Ga0111539_10183957 3300009094 Bacteria 2440
196 Ga0111539_10199637 3300009094 Bacteria 2332
197 Ga0111539_10335845 3300009094 Archaea 1759
198 Ga0105245_10002954 3300009098 Bacteria 15251
199 Ga0105245_10097109 3300009098 Bacteria 2720
200 Ga0105247_10001485 3300009101 Bacteria 16868
201 Ga0114129_10000092 3300009147 Bacteria 86019
202 Ga0114129_10000897 3300009147 Bacteria 38727
203 Ga0114129_10028222 3300009147 Bacteria 7951
204 Ga0114129_10050581 3300009147 Bacteria 5837
205 Ga0114129_10196820 3300009147 Bacteria 2732
206 Ga0114129_10214328 3300009147 Bacteria 2601
207 Ga0114129_10322078 3300009147 Bacteria 2055
208 Ga0114129_10563868 3300009147 Bacteria 1479
209 Ga0105241_10003328 3300009174 Bacteria 11959
210 Ga0105242_10035707 3300009176 Bacteria 3986
211 Ga0105242_10248563 3300009176 Bacteria 1602
212 Ga0105242_10279018 3300009176 Bacteria 1517
213 Ga0105248_10000244 3300009177 Bacteria 62961
214 Ga0105248_10053602 3300009177 Bacteria 4525
215 Ga0105248_10116700 3300009177 Bacteria 3010
216 Ga0105249_10014983 3300009553 Bacteria 6857
217 Ga0105249_10053243 3300009553 Unclassified 3699
218 Ga0105239_10010781 3300010375 Bacteria 10211
219 Ga0105246_10066760 3300011119 Unclassified 2519
220 Ga0157373_10006194 3300013100 Bacteria 8939
221 Ga0157373_10091870 3300013100 Bacteria 2137
222 Ga0157373_10159379 3300013100 Bacteria 1588
223 Ga0157371_10009169 3300013102 Bacteria 7813
224 Ga0157370_10509273 3300013104 Bacteria 1105
225 Ga0157374_10208026 3300013296 Bacteria 1918
226 Ga0157374_10345580 3300013296 Unclassified 1477
227 Ga0157378_10050923 3300013297 Unclassified 3685
228 Ga0157378_10177282 3300013297 Bacteria 2003
229 Ga0163162_10000450 3300013306 Bacteria 38095
230 Ga0163162_10007110 3300013306 Bacteria 10860
231 Ga0163162_10175321 3300013306 Bacteria 2269
232 Ga0163162_10177705 3300013306 Bacteria 2254
233 Ga0163162_10436298 3300013306 Bacteria 1442
234 Ga0163162_10747883 3300013306 Bacteria 1097
235 Ga0157372_10243242 3300013307 Bacteria 2088
236 Ga0157375_10000216 3300013308 Bacteria 53883
237 Ga0157375_10000704 3300013308 Bacteria 29517
238 Ga0157375_10713343 3300013308 Bacteria 1156
239 Ga0163163_10021966 3300014325 Bacteria 6032
240 Ga0163163_10037938 3300014325 Bacteria 4691
241 Ga0157380_10063989 3300014326 Bacteria 2951
242 Ga0157380_10137181 3300014326 Bacteria 2096
243 Ga0157380_10140719 3300014326 Bacteria 2073
244 Ga0157380_10218877 3300014326 Bacteria 1702
245 Ga0157377_10054382 3300014745 Bacteria 2266
246 Ga0157379_10000091 3300014968 Bacteria 61113
247 Ga0157379_10000101 3300014968 Bacteria 58702
248 Ga0157379_10232120 3300014968 Bacteria 1672
249 Ga0157376_10085566 3300014969 Bacteria 2717
250 Ga0157376_10216257 3300014969 Bacteria 1772
251 Ga0157376_10242049 3300014969 Bacteria 1681
252 Ga0163161_10022185 3300017792 Bacteria 4468
253 Ga0207710_10001280 3300025900 Bacteria 12698
254 Ga0207680_10002543 3300025903 Bacteria 8506
255 Ga0207645_10234951 3300025907 Bacteria 1210
256 Ga0207654_10006799 3300025911 Bacteria 5752
257 Ga0207707_10204286 3300025912 Bacteria 1722
258 Ga0207660_10250821 3300025917 Bacteria 1397
259 Ga0207649_10055401 3300025920 Bacteria 2471
260 Ga0207652_10082558 3300025921 Bacteria 2812
261 Ga0207652_10198513 3300025921 Bacteria 1805
262 Ga0207646_10022559 3300025922 Bacteria 5797
263 Ga0207646_10453122 3300025922 Bacteria 1157
264 Ga0207681_10069050 3300025923 Bacteria 2457
265 Ga0207650_10005011 3300025925 Bacteria 9047
266 Ga0207650_10101995 3300025925 Bacteria 2210
267 Ga0207650_10280551 3300025925 Bacteria 1356
268 Ga0207650_10390255 3300025925 Bacteria 1151
269 Ga0207659_10002514 3300025926 Bacteria 10926
270 Ga0207659_10005064 3300025926 Bacteria 7995
271 Ga0207659_10013347 3300025926 Bacteria 5258
272 Ga0207659_10140234 3300025926 Bacteria 1876
273 Ga0207659_10155545 3300025926 Bacteria 1790
274 Ga0207687_10083793 3300025927 Bacteria 2309
275 Ga0207644_10000319 3300025931 Bacteria 31445
276 Ga0207644_10173842 3300025931 Bacteria 1683
277 Ga0207644_10397472 3300025931 Bacteria 1126
278 Ga0207706_10085842 3300025933 Bacteria 2767
279 Ga0207706_10161671 3300025933 Bacteria 1968
280 Ga0207706_10201852 3300025933 Bacteria 1744
281 Ga0207686_10012174 3300025934 Bacteria 4725
282 Ga0207670_10021806 3300025936 Bacteria 3958
283 Ga0207670_10053084 3300025936 Bacteria 2729
284 Ga0207670_10077018 3300025936 Bacteria 2322
285 Ga0207670_10359030 3300025936 Bacteria 1156
286 Ga0207669_10151660 3300025937 Bacteria 1624
287 Ga0207665_10142439 3300025939 Bacteria 1711
288 Ga0207691_10006989 3300025940 Bacteria 10889
289 Ga0207691_10025137 3300025940 Bacteria 5595
290 Ga0207691_10134892 3300025940 Bacteria 2178
291 Ga0207711_10003595 3300025941 Bacteria 13410
292 Ga0207711_10228394 3300025941 Bacteria 1704
293 Ga0207689_10098611 3300025942 Bacteria 2401
294 Ga0207689_10266807 3300025942 Bacteria 1417
295 Ga0207661_10037496 3300025944 Bacteria 3792
296 Ga0207661_10169715 3300025944 Bacteria 1899
297 Ga0207679_10003650 3300025945 Bacteria 9538
298 Ga0207679_10018240 3300025945 Bacteria 4699
299 Ga0207679_10384177 3300025945 Unclassified 1232
300 Ga0207667_10000612 3300025949 Bacteria 46149
301 Ga0207667_10002028 3300025949 Bacteria 25387
302 Ga0207667_10072220 3300025949 Bacteria 3588
303 Ga0207651_10004211 3300025960 Bacteria 7208
304 Ga0207651_10109090 3300025960 Bacteria 2073
305 Ga0207651_10160927 3300025960 Bacteria 1760
306 Ga0207712_10010203 3300025961 Bacteria 5955
307 Ga0207712_10146734 3300025961 Bacteria 1817
308 Ga0207658_10001060 3300025986 Bacteria 22265
309 Ga0207658_10039755 3300025986 Bacteria 3395
310 Ga0207658_10047025 3300025986 Bacteria 3155
311 Ga0207658_10322887 3300025986 Bacteria 1337
312 Ga0207677_10002394 3300026023 Bacteria 9828
313 Ga0207677_10015860 3300026023 Bacteria 4446
314 Ga0207677_10047983 3300026023 Bacteria 2872
315 Ga0207677_10367173 3300026023 Bacteria 1211
316 Ga0207703_10007843 3300026035 Bacteria 8446
317 Ga0207703_10272600 3300026035 Bacteria 1534
318 Ga0207678_10045328 3300026067 Bacteria 3803
319 Ga0207702_10001471 3300026078 Bacteria 23360
320 Ga0207702_10161792 3300026078 Bacteria 2045
321 Ga0207641_10000293 3300026088 Bacteria 62674
322 Ga0207641_10012614 3300026088 Bacteria 6930
323 Ga0207641_10037995 3300026088 Bacteria 4024
324 Ga0207641_10043328 3300026088 Bacteria 3779
325 Ga0207641_10064915 3300026088 Bacteria 3121
326 Ga0207641_10538184 3300026088 Bacteria 1138
327 Ga0207648_10146903 3300026089 Bacteria 2080
328 Ga0207648_10490999 3300026089 Bacteria 1122
329 Ga0207676_10000787 3300026095 Bacteria 24758
330 Ga0207676_10527294 3300026095 Bacteria 1125
331 Ga0207675_100009284 3300026118 Bacteria 9223
332 Ga0207675_100025528 3300026118 Bacteria 5499
333 Ga0207675_100481361 3300026118 Bacteria 1234
334 Ga0207683_10036828 3300026121 Bacteria 4260
335 Ga0207683_10208672 3300026121 Bacteria 1777
336 Ga0209974_10076904 3300027876 Bacteria 1144
337 Ga0207428_10003685 3300027907 Bacteria 14735
338 Ga0207428_10042349 3300027907 Bacteria 3682
339 Ga0207428_10044112 3300027907 Bacteria 3598
340 Ga0207428_10092837 3300027907 Bacteria 2342
341 Ga0207428_10126514 3300027907 Bacteria 1957
342 Ga0268265_10199953 3300028380 Bacteria 1733
343 Ga0268265_10308471 3300028380 Bacteria 1428
344 Ga0268264_10008889 3300028381 Bacteria 8330
345 Ga0268264_10011525 3300028381 Bacteria 7304
346 Ga0268264_10051818 3300028381 Bacteria 3421
347 Ga0268264_10573584 3300028381 Bacteria 1109
348 Ga0265326_10015554 3300028558 Unclassified 2205
349 Ga0265318_10000273 3300028577 Bacteria 43832
350 Ga0265318_10001387 3300028577 Bacteria 14390
351 Ga0265318_10017893 3300028577 Bacteria 2901
352 Ga0265338_10000401 3300028800 Bacteria 77602
353 Ga0265338_10071588 3300028800 Bacteria 2965
354 Ga0265338_10122313 3300028800 Bacteria 2071
355 Ga0265338_10190681 3300028800 Bacteria 1554
356 Ga0265330_10000095 3300031235 Bacteria 74593
357 Ga0265330_10000998 3300031235 Bacteria 17255
358 Ga0265332_10000222 3300031238 Bacteria 45648
359 Ga0265332_10000280 3300031238 Bacteria 40175
360 Ga0265328_10034512 3300031239 Bacteria 1873
361 Ga0265320_10000485 3300031240 Bacteria 31127
362 Ga0265320_10039072 3300031240 Bacteria 2375
363 Ga0265325_10000502 3300031241 Bacteria 28249
364 Ga0265325_10001575 3300031241 Bacteria 15904
365 Ga0265325_10042041 3300031241 Bacteria 2392
366 Ga0265329_10000013 3300031242 Bacteria 70645
367 Ga0265329_10005084 3300031242 Bacteria 5366
368 Ga0265340_10000189 3300031247 Bacteria 31156
369 Ga0265340_10001205 3300031247 Bacteria 14789
370 Ga0265340_10019984 3300031247 Bacteria 3445
371 Ga0265339_10000299 3300031249 Bacteria 40398
372 Ga0265339_10008732 3300031249 Bacteria 6424
373 Ga0265339_10008773 3300031249 Bacteria 6404
374 Ga0265331_10000134 3300031250 Bacteria 96927
375 Ga0265331_10002207 3300031250 Bacteria 13369
376 Ga0265331_10025138 3300031250 Bacteria 3008
377 Ga0265316_10000450 3300031344 Bacteria 46576
378 Ga0265316_10001048 3300031344 Bacteria 29962
379 Ga0265316_10002957 3300031344 Bacteria 17386
380 Ga0307408_100218385 3300031548 Bacteria 1554
381 Ga0265313_10000316 3300031595 Bacteria 52476
382 Ga0265313_10000463 3300031595 Bacteria 42820
383 Ga0265313_10001355 3300031595 Bacteria 23078
384 Ga0307508_10136221 3300031616 Bacteria 2059
385 Ga0316575_10001284 3300031665 Bacteria 8000
386 Ga0316575_10056631 3300031665 Bacteria 1562
387 Ga0316579_10039180 3300031691 Bacteria 2194
388 Ga0316579_10052802 3300031691 Bacteria 1903
389 Ga0265314_10000003 3300031711 Bacteria 1653386
390 Ga0265314_10000076 3300031711 Bacteria 146266
391 Ga0265314_10000413 3300031711 Bacteria 57497
392 Ga0265314_10002804 3300031711 Bacteria 17395
393 Ga0265314_10008394 3300031711 Bacteria 8853
394 Ga0265342_10000471 3300031712 Bacteria 43707
395 Ga0265342_10000759 3300031712 Bacteria 32969
396 Ga0265342_10010844 3300031712 Bacteria 6273
397 Ga0316576_10000992 3300031727 Bacteria 14602
398 Ga0316576_10004459 3300031727 Bacteria 8400
399 Ga0316576_10007134 3300031727 Bacteria 7007
400 Ga0316576_10009047 3300031727 Bacteria 6406
401 Ga0316576_10013503 3300031727 Bacteria 5432
402 Ga0316576_10015660 3300031727 Bacteria 5095
403 Ga0316576_10048108 3300031727 Bacteria 3092
404 Ga0316576_10096795 3300031727 Bacteria 2203
405 Ga0316578_10018044 3300031728 Bacteria 3856
406 Ga0316578_10025877 3300031728 Bacteria 3304
407 Ga0307516_10009446 3300031730 Bacteria 10868
408 Ga0316577_10020932 3300031733 Bacteria 3625
409 Ga0316577_10025885 3300031733 Bacteria 3263
410 Ga0316577_10044815 3300031733 Bacteria 2474
411 Ga0316577_10057497 3300031733 Bacteria 2172
412 Ga0307406_10001312 3300031901 Bacteria 13960
413 Ga0307407_10007128 3300031903 Bacteria 5039
414 Ga0307409_100329229 3300031995 Bacteria 1433
415 Ga0307416_100012158 3300032002 Bacteria 5782
416 Ga0307411_10010242 3300032005 Bacteria 4985
417 Ga0307411_10081107 3300032005 Bacteria 2233
418 Ga0307415_100085523 3300032126 Bacteria 2266
419 Ga0316583_10002585 3300032133 Bacteria 6309
420 Ga0316593_10000033 3300032168 Bacteria 14603
421 Ga0316593_10000043 3300032168 Bacteria 13880
422 Ga0316593_10000581 3300032168 Bacteria 6919
423 Ga0316593_10004875 3300032168 Bacteria 3488
424 Ga0316593_10013698 3300032168 Bacteria 2407
425 Ga0316593_10016904 3300032168 Bacteria 2219
426 Ga0316593_10030235 3300032168 Bacteria 1757
427 Ga0316593_10058520 3300032168 Bacteria 1314
428 Ga0307507_10102682 3300033179 Bacteria 2383
429 Ga0316592_1000397 3300033524 Bacteria 5838
430 Ga0316592_1002103 3300033524 Bacteria 3380
431 Ga0316592_1002468 3300033524 Bacteria 3201
432 Ga0316592_1024207 3300033524 Bacteria 1305
433 Ga0316588_1000005 3300033528 Bacteria 13840
434 Ga0316588_1000859 3300033528 Bacteria 4615
435 Ga0316588_1009457 3300033528 Unclassified 2034
436 Ga0316588_1013472 3300033528 Bacteria 1775
437 Ga0316587_1008755 3300033529 Bacteria 1596
438 Ga0316596_1000006 3300033541 Bacteria 19978
439 Ga0316596_1000192 3300033541 Bacteria 8874
440 Ga0316596_1001245 3300033541 Bacteria 5036
441 Ga0316596_1002498 3300033541 Bacteria 3934
442 Ga0316596_1002889 3300033541 Bacteria 3719
443 Ga0316596_1003232 3300033541 Bacteria 3549
444 Ga0316596_1007624 3300033541 Bacteria 2562
445 Ga0316596_1028802 3300033541 Bacteria 1436
446 Ga0373928_0001523 3300035084 Bacteria 4500
447 Ga0373923_0027981 3300035111 Bacteria 2252
448 Ga0373945_0061054 3300035116 Bacteria 1407
449 Ga0373953_0009969 3300035117 Bacteria 3293
450 Ga0373953_0038745 3300035117 Bacteria 1887
451 Ga0373957_0026847 3300035120 Bacteria 2087
452 Ga0373943_0007539 3300035170 Bacteria 4887
453 Ga0373955_0044848 3300035172 Bacteria 2384
454 Ga0373955_0086650 3300035172 Bacteria 1779
455 Ga0316574_0009048 3300035398 Bacteria 5565
456 Ga0316574_0039406 3300035398 Bacteria 2905
457 Ga0316574_0048969 3300035398 Bacteria 2626
458 Ga0316574_0126871 3300035398 Bacteria 1640
459 Ga0316574_0140894 3300035398 Bacteria 1553
460 Ga0373924_0014264 3300035410 Bacteria 3001
461 Ga0373924_0028155 3300035410 Bacteria 2238
462 Ga0373931_0042588 3300035691 Bacteria 2388
463 Ga0373935_0018318 3300035692 Bacteria 4257
464 Ga0373927_0009335 3300035695 Bacteria 6581
465 Ga0373927_0013572 3300035695 Bacteria 5411
466 Ga0373927_0037681 3300035695 Bacteria 3141
467 Ga0373927_0041314 3300035695 Bacteria 2991
468 Ga0373933_0003225 3300035724 Bacteria 9108
469 Ga0373933_0033257 3300035724 Bacteria 2998
470 Ga0373947_0063275 3300035725 Bacteria 2253
471 Ga0373937_0003223 3300036401 Bacteria 13669
472 Ga0373937_0017617 3300036401 Bacteria 6370
473 Ga0373937_0045525 3300036401 Bacteria 4010
474 Ga0373937_0220335 3300036401 Bacteria 1786
475 Ga0373937_0335299 3300036401 Bacteria 1432
476 Ga0373937_0401628 3300036401 Bacteria 1300
477 Ga0316582_0003012 3300036647 Bacteria 8121
478 Ga0316582_0026784 3300036647 Bacteria 3474
479 Ga0316584_0009321 3300036712 Bacteria 6809
480 Ga0373925_0002179 3300037068 Bacteria 15930
481 Ga0373925_0019406 3300037068 Bacteria 4944
482 Ga0395900_0030792 3300037418 Bacteria 5510
483 Ga0395905_0000127 3300037471 Bacteria 124627
484 Ga0395905_0000275 3300037471 Bacteria 76114
485 Ga0395905_0025893 3300037471 Bacteria 5529
486 Ga0395905_0091046 3300037471 Bacteria 2860
487 Ga0395905_0123004 3300037471 Bacteria 2440
488 Ga0316581_0007370 3300037588 Bacteria 2948
489 Ga0436364_1158423 3300037853 Bacteria 6574
490 Ga0400490_17491 3300038726 Bacteria 28094
491 Ga0400490_30744 3300038726 Bacteria 133210
492 Ga0400485_08047 3300038735 Bacteria 20055
493 Ga0400485_08672 3300038735 Bacteria 18258
494 Ga0400486_03968 3300038742 Bacteria 8030
495 Ga0400486_05152 3300038742 Bacteria 15610
496 Ga0400486_17114 3300038742 Bacteria 18189
497 Ga0400483_053606 3300039062 Bacteria 1285
498 Ga0400483_110311 3300039062 Bacteria 6007
499 Ga0400483_206886 3300039062 Bacteria 2236
500 Ga0400483_224663 3300039062 Unclassified 2009
501 Ga0400483_235488 3300039062 Bacteria 2044
502 Ga0400483_282171 3300039062 Bacteria 1647
503 Ga0400489_12624 3300039093 Bacteria 13561
504 Ga0400489_68201 3300039093 Bacteria 28552
505 Ga0400489_87362 3300039093 Unclassified 1920
506 Ga0400489_92265 3300039093 Bacteria 2620
507 Ga0400487_03008 3300039110 Bacteria 21586
508 Ga0400487_21995 3300039110 Bacteria 1271
509 Ga0436361_0045516 3300039447 Bacteria 2540
510 Ga0436361_1081198 3300039447 Bacteria 1210
511 Ga0436363_0759301 3300039450 Bacteria 1163
512 Ga0439453_0002595 3300041408 Bacteria 2511
513 Ga0439465_0002430 3300041413 Bacteria 6098
514 Ga0451807_0596507 3300041486 Bacteria 1156
515 Ga0439431_0032614 3300041997 Bacteria 1299
516 Ga0439449_0052713 3300042007 Bacteria 1504
517 Ga0439435_0017337 3300042436 Bacteria 1819
518 Ga0451577_0000328 3300042876 Bacteria 88518
519 Ga0451577_0000673 3300042876 Bacteria 53786
520 Ga0451577_0000828 3300042876 Bacteria 46284
521 Ga0451577_0008521 3300042876 Bacteria 9973
522 Ga0451577_0030969 3300042876 Bacteria 4830
523 Ga0451577_0042342 3300042876 Bacteria 4085
524 Ga0451577_0149506 3300042876 Unclassified 2101
525 Ga0451577_0234273 3300042876 Bacteria 1660
526 Ga0451577_0318977 3300042876 Bacteria 1409
527 Ga0453683_0000219 3300044673 Bacteria 76281
528 Ga0453683_0001684 3300044673 Bacteria 18427
529 Ga0453683_0003224 3300044673 Bacteria 12130
530 Ga0453683_0004812 3300044673 Bacteria 9503
531 Ga0453683_0016045 3300044673 Bacteria 4840
532 Ga0453683_0022862 3300044673 Bacteria 3986
533 Ga0453683_0026024 3300044673 Bacteria 3715
534 Ga0453683_0030485 3300044673 Bacteria 3409
535 Ga0453683_0062905 3300044673 Bacteria 2320
536 Ga0453683_0065404 3300044673 Bacteria 2273
537 Ga0453683_0069681 3300044673 Bacteria 2199
538 Ga0453683_0073074 3300044673 Bacteria 2147
539 Ga0453683_0234490 3300044673 Bacteria 1168
540 Ga0453684_0000258 3300044712 Bacteria 228312
541 Ga0453684_0000950 3300044712 Bacteria 95538
542 Ga0453684_0001155 3300044712 Bacteria 82444
543 Ga0453684_0001648 3300044712 Bacteria 60626
544 Ga0453684_0003637 3300044712 Bacteria 34273
545 Ga0453684_0004724 3300044712 Bacteria 28171
546 Ga0453684_0005988 3300044712 Bacteria 23557
547 Ga0453684_0007136 3300044712 Bacteria 20809
548 Ga0453684_0008030 3300044712 Bacteria 19098
549 Ga0453684_0010045 3300044712 Bacteria 16285
550 Ga0453684_0010350 3300044712 Bacteria 15963
551 Ga0453684_0012911 3300044712 Bacteria 13683
552 Ga0453684_0015940 3300044712 Bacteria 11817
553 Ga0453684_0019047 3300044712 Bacteria 10481
554 Ga0453684_0024212 3300044712 Bacteria 8887
555 Ga0453684_0032059 3300044712 Bacteria 7367
556 Ga0453684_0032203 3300044712 Bacteria 7346
557 Ga0453684_0037215 3300044712 Bacteria 6682
558 Ga0453684_0056552 3300044712 Bacteria 5088
559 Ga0453684_0099498 3300044712 Bacteria 3562
560 Ga0453684_0100989 3300044712 Bacteria 3530
561 Ga0453684_0111569 3300044712 Bacteria 3321
562 Ga0453684_0124618 3300044712 Bacteria 3103
563 Ga0453684_0163203 3300044712 Bacteria 2633
564 Ga0453684_0222798 3300044712 Bacteria 2183
565 Ga0453684_0224980 3300044712 Bacteria 2170
566 Ga0453684_0345203 3300044712 Bacteria 1680
567 Ga0453684_0559552 3300044712 Bacteria 1258
568 Ga0453684_0576068 3300044712 Bacteria 1237
569 Ga0453684_0608741 3300044712 Bacteria 1196
570 Ga0451576_0000857 3300045051 Bacteria 58872
571 Ga0451576_0001406 3300045051 Bacteria 41324
572 Ga0451576_0003523 3300045051 Bacteria 21376
573 Ga0451576_0004083 3300045051 Bacteria 19291
574 Ga0451576_0017930 3300045051 Bacteria 7771
575 Ga0451576_0057309 3300045051 Bacteria 4073
576 Ga0451576_0093423 3300045051 Bacteria 3128
577 Ga0451576_0121722 3300045051 Bacteria 2717
578 Ga0451576_0128597 3300045051 Bacteria 2640
579 Ga0451576_0158623 3300045051 Bacteria 2360
580 Ga0451576_0185054 3300045051 Bacteria 2175
581 Ga0451576_0302429 3300045051 Bacteria 1673
582 Ga0451576_0632188 3300045051 Bacteria 1125
583 Ga0495592_0096167 3300046454 Bacteria 2117
584 Ga0495603_0058712 3300046455 Bacteria 2274
585 Ga0495629_0000007 3300046459 Bacteria 358693
586 Ga0495629_0000126 3300046459 Bacteria 66833
587 Ga0495629_0053214 3300046459 Bacteria 2833
588 Ga0495641_0016753 3300046461 Bacteria 3849
589 Ga0495641_0092003 3300046461 Bacteria 1355
590 Ga0495651_0080256 3300046462 Bacteria 2465
591 Ga0495580_0002023 3300046472 Bacteria 17847
592 Ga0495580_0028001 3300046472 Bacteria 4098
593 Ga0495580_0040045 3300046472 Bacteria 3351
594 Ga0495639_0000121 3300046475 Bacteria 39571
595 Ga0495639_0012434 3300046475 Bacteria 3670
596 Ga0495664_0003262 3300046477 Bacteria 8815
597 Ga0495594_0009365 3300046499 Bacteria 5059
598 Ga0495608_0015057 3300046511 Bacteria 5365
599 Ga0495618_0033611 3300046514 Bacteria 3216
600 Ga0495628_0199865 3300046516 Bacteria 1506
601 Ga0495666_0019669 3300046526 Bacteria 3348
602 Ga0495652_0246772 3300046529 Bacteria 1325
603 Ga0495640_0084624 3300046533 Bacteria 2103
604 Ga0495586_0006882 3300046535 Bacteria 6059
605 Ga0495586_0012323 3300046535 Bacteria 4537
606 Ga0495587_0196125 3300046536 Bacteria 1143
607 Ga0495598_0000163 3300046537 Bacteria 11410
608 Ga0495645_0091263 3300046543 Bacteria 2176
609 Ga0495622_0036714 3300046557 Bacteria 2284
610 Ga0495667_0000559 3300046559 Bacteria 23744
611 Ga0495656_0000068 3300046615 Bacteria 46104
612 Ga0495656_0000397 3300046615 Bacteria 14422
613 Ga0495635_0001003 3300046663 Bacteria 18656
614 Ga0495635_0001790 3300046663 Bacteria 14519
615 Ga0495659_0007690 3300046664 Bacteria 3416
616 Ga0495657_0089924 3300046675 Bacteria 1972
617 Ga0495646_0129115 3300046680 Bacteria 1424
618 Ga0495647_0001519 3300046681 Bacteria 7163
619 Ga0495647_0016102 3300046681 Bacteria 2629
620 Ga0495647_0020678 3300046681 Bacteria 2365
621 Ga0495658_0000327 3300046683 Bacteria 26569
622 Ga0495658_0004909 3300046683 Bacteria 6562
623 Ga0495613_0007236 3300046689 Bacteria 8264
624 Ga0495613_0011880 3300046689 Bacteria 6472
625 Ga0495613_0025308 3300046689 Bacteria 4422
626 Ga0495613_0041711 3300046689 Bacteria 3398
627 Ga0495624_0096301 3300046690 Bacteria 1823
628 Ga0495624_0155658 3300046690 Bacteria 1397
629 Ga0495600_0020741 3300046809 Bacteria 4204
630 Ga0495581_0000280 3300047315 Bacteria 24770
631 Ga0495581_0090782 3300047315 Bacteria 1772
632 Ga0495604_0106681 3300047317 Bacteria 2049
633 Ga0495636_0001669 3300047318 Bacteria 8460
634 Ga0495636_0004364 3300047318 Bacteria 5550
635 Ga0495636_0024284 3300047318 Bacteria 2457
636 Ga0495674_0010169 3300047319 Bacteria 8914
637 Ga0495674_0013556 3300047319 Bacteria 7660
638 Ga0495674_0160794 3300047319 Bacteria 1879
639 Ga0495676_0020676 3300047321 Bacteria 5767
640 Ga0495676_0040130 3300047321 Bacteria 3867
641 Ga0495676_0154450 3300047321 Bacteria 1630
642 Ga0495680_0000838 3300047322 Bacteria 34052
643 Ga0495680_0001860 3300047322 Bacteria 22237
644 Ga0495680_0042938 3300047322 Bacteria 3584
645 Ga0495684_0006640 3300047471 Bacteria 8971
646 Ga0495684_0115057 3300047471 Bacteria 2028
647 Ga0495684_0177441 3300047471 Bacteria 1581
648 Ga0495684_0197802 3300047471 Bacteria 1483
649 Ga0495602_0088045 3300048088 Bacteria 2586
650 Ga0495614_0002522 3300048089 Bacteria 8135
651 Ga0495615_0002512 3300048090 Bacteria 2951
652 Ga0496102_0158392 3300048905 Bacteria 2129
653 Ga0496102_0373013 3300048905 Bacteria 1343
654 Ga0496103_0209123 3300048906 Bacteria 1255
655 Ga0496110_0000091 3300048913 Bacteria 48115
656 Ga0496110_0001249 3300048913 Bacteria 18171
657 Ga0496110_0202503 3300048913 Unclassified 1804
658 Ga0496112_0077009 3300048915 Bacteria 3298
659 Ga0496115_0020289 3300048918 Bacteria 5126
660 Ga0496124_0000001 3300048927 Bacteria 1747840
661 Ga0496126_0136628 3300048929 Bacteria 2114
662 Ga0501308_000564 3300049128 Bacteria 2487
663 Ga0501312_000273 3300049528 Bacteria 3762
664 Ga0501318_000746 3300049534 Bacteria 2236
665 Ga0501321_000935 3300049537 Bacteria 2132
666 Ga0501324_000877 3300049540 Bacteria 1840
667 Ga0501325_000595 3300049541 Bacteria 1827
668 Ga0501031_0026897 3300049568 Bacteria 3749
669 Ga0501031_0179052 3300049568 Bacteria 1385
670 Ga0501032_0000374 3300049569 Bacteria 36951
671 Ga0501032_0073350 3300049569 Bacteria 2280
672 Ga0501033_0034683 3300049570 Bacteria 3783
673 Ga0501034_0038041 3300049571 Bacteria 4874
674 Ga0501034_0053308 3300049571 Bacteria 4073
675 Ga0501034_0063128 3300049571 Bacteria 3718
676 Ga0501034_0097139 3300049571 Bacteria 2942
677 Ga0501034_0102596 3300049571 Bacteria 2854
678 Ga0501034_0303293 3300049571 Bacteria 1533
679 Ga0501034_0308716 3300049571 Bacteria 1517
680 Ga0501034_0334346 3300049571 Bacteria 1446
681 Ga0501036_0000942 3300049572 Bacteria 21869
682 Ga0501036_0004738 3300049572 Bacteria 10978
683 Ga0501036_0157822 3300049572 Unclassified 1913
684 Ga0501036_0247227 3300049572 Bacteria 1495
685 Ga0501037_0000862 3300049573 Bacteria 22616
686 Ga0501038_0001392 3300049574 Bacteria 22120
687 Ga0501038_0013339 3300049574 Bacteria 7494
688 Ga0501038_0063475 3300049574 Bacteria 3152
689 Ga0501038_0123879 3300049574 Bacteria 2129
690 Ga0501038_0249217 3300049574 Bacteria 1407
691 Ga0501039_0003138 3300049575 Bacteria 12363
692 Ga0501040_0000070 3300049576 Bacteria 49605
693 Ga0501040_0031360 3300049576 Bacteria 3592
694 Ga0501040_0345965 3300049576 Bacteria 1065
695 Ga0501041_0001162 3300049577 Bacteria 14408
696 Ga0501041_0016024 3300049577 Bacteria 4454
697 Ga0501041_0090288 3300049577 Bacteria 1891
698 Ga0501042_0000926 3300049578 Bacteria 16510
699 Ga0501042_0016640 3300049578 Bacteria 5053
700 Ga0501042_0045205 3300049578 Bacteria 3138
701 Ga0501043_0002448 3300049579 Bacteria 15703
702 Ga0501043_0014038 3300049579 Bacteria 6269
703 Ga0501043_0065707 3300049579 Bacteria 2848
704 Ga0501043_0309289 3300049579 Bacteria 1206
705 Ga0501046_0001500 3300049580 Bacteria 22313
706 Ga0501046_0035201 3300049580 Bacteria 4036
707 Ga0501046_0170225 3300049580 Bacteria 1635
708 Ga0501047_0036151 3300049581 Bacteria 4772
709 Ga0501047_0093046 3300049581 Bacteria 2894
710 Ga0501048_0015102 3300049582 Bacteria 5706
711 Ga0501048_0028158 3300049582 Bacteria 4080
712 Ga0501048_0043787 3300049582 Bacteria 3203
713 Ga0501067_0030612 3300049583 Bacteria 2984
714 Ga0501068_0000765 3300049584 Bacteria 16541
715 Ga0501068_0006986 3300049584 Bacteria 6244
716 Ga0501069_0004501 3300049585 Bacteria 7201
717 Ga0501069_0033407 3300049585 Bacteria 2834
718 Ga0501070_0024404 3300049586 Bacteria 5073
719 Ga0501070_0080026 3300049586 Bacteria 2704
720 Ga0501071_0000007 3300049587 Bacteria 73318
721 Ga0501071_0021718 3300049587 Bacteria 4474
722 Ga0501071_0227418 3300049587 Bacteria 1405
723 Ga0501072_0000620 3300049588 Bacteria 25510
724 Ga0501072_0001242 3300049588 Bacteria 19028
725 Ga0501072_0001660 3300049588 Bacteria 16588
726 Ga0501072_0122457 3300049588 Bacteria 2072
727 Ga0501073_0007779 3300049589 Bacteria 7959
728 Ga0501073_0027134 3300049589 Bacteria 4099
729 Ga0501073_0044048 3300049589 Bacteria 3145
730 Ga0501073_0148375 3300049589 Bacteria 1625
731 Ga0501074_0000626 3300049590 Bacteria 21937
732 Ga0501074_0008028 3300049590 Bacteria 7643
733 Ga0501074_0133352 3300049590 Bacteria 1777
734 Ga0501074_0264731 3300049590 Bacteria 1222
735 Ga0501074_0294187 3300049590 Bacteria 1154
736 Ga0501075_0000031 3300049591 Bacteria 56103
737 Ga0501075_0000645 3300049591 Bacteria 21346
738 Ga0501076_0000733 3300049592 Bacteria 21215
739 Ga0501076_0002119 3300049592 Bacteria 13613
740 Ga0501076_0034427 3300049592 Bacteria 3959
741 Ga0501076_0041428 3300049592 Bacteria 3623
742 Ga0501076_0049426 3300049592 Bacteria 3326
743 Ga0501077_0000055 3300049593 Bacteria 57590
744 Ga0501077_0014291 3300049593 Bacteria 4987
745 Ga0501077_0034412 3300049593 Bacteria 3225
746 Ga0501225_0038760 3300049705 Bacteria 1313
747 Ga0501079_0000858 3300049741 Bacteria 20794
748 Ga0501079_0010492 3300049741 Bacteria 7043
749 Ga0501079_0169864 3300049741 Bacteria 1700
750 Ga0501079_0416695 3300049741 Bacteria 1054
751 Ga0501080_0000823 3300049742 Bacteria 25350
752 Ga0501080_0001538 3300049742 Bacteria 19472
753 Ga0501080_0047083 3300049742 Bacteria 4014
754 Ga0501080_0162657 3300049742 Bacteria 2061
755 Ga0501080_0167550 3300049742 Bacteria 2027
756 Ga0501081_0002273 3300049743 Bacteria 12095
757 Ga0501081_0009031 3300049743 Bacteria 6482
758 Ga0501081_0099477 3300049743 Bacteria 2055
759 Ga0501081_0278368 3300049743 Bacteria 1224
760 Ga0501083_0001752 3300049744 Bacteria 14807
761 Ga0501083_0020876 3300049744 Bacteria 4553
762 Ga0501083_0028562 3300049744 Bacteria 3843
763 Ga0501083_0059220 3300049744 Bacteria 2562
764 Ga0501083_0063107 3300049744 Bacteria 2471
765 Ga0501035_0005591 3300049822 Bacteria 11871
766 Ga0501045_0000303 3300049824 Bacteria 28934
767 Ga0501045_0051760 3300049824 Bacteria 2997
768 Ga0501045_0142647 3300049824 Bacteria 1781
769 Ga0501045_0278171 3300049824 Bacteria 1246
770 nmdc:mga00v17_82695_c1 3300050491 Bacteria 2007
771 nmdc:mga0k408_109309_c1 3300050493 Bacteria 1634
772 nmdc:mga0k408_161589_c1 3300050493 Bacteria 1335
773 nmdc:mga0k408_17468_c1 3300050493 Bacteria 3997
774 nmdc:mga0k408_28046_c1 3300050493 Bacteria 3200
775 nmdc:mga0k408_52152_c1 3300050493 Bacteria 2370
776 nmdc:mga0k408_64134_c1 3300050493 Bacteria 2138
777 nmdc:mga06z11_91683_c1 3300050494 Bacteria 1651
778 nmdc:mga05p37_189485_c1 3300050507 Bacteria 2498
779 nmdc:mga05p37_2129_c1 3300050507 Bacteria 23128
780 nmdc:mga05p37_261673_c1 3300050507 Bacteria 2070
781 nmdc:mga05p37_26696_c1 3300050507 Bacteria 7023
782 nmdc:mga05p37_274730_c1 3300050507 Bacteria 2012
783 nmdc:mga05p37_334466_c1 3300050507 Bacteria 1788
784 nmdc:mga05p37_337191_c1 3300050507 Bacteria 1779
785 nmdc:mga05p37_3608_c1 3300050507 Bacteria 18082
786 nmdc:mga05p37_38747_c1 3300050507 Bacteria 5848
787 nmdc:mga05p37_463780_c1 3300050507 Bacteria 1463
788 nmdc:mga05p37_54976_c1 3300050507 Bacteria 4897
789 nmdc:mga09592_10768_c1 3300050508 Bacteria 7435
790 nmdc:mga09592_21071_c1 3300050508 Bacteria 5368
791 nmdc:mga0qj67_205352_c1 3300050509 Unclassified 1600
792 nmdc:mga0qj67_320652_c1 3300050509 Bacteria 1254
793 nmdc:mga0qj67_4157_c1 3300050509 Bacteria 10490
794 nmdc:mga0qj67_93876_c1 3300050509 Bacteria 2413
795 nmdc:mga06r32_172802_c1 3300050510 Bacteria 2145
796 nmdc:mga06r32_216706_c1 3300050510 Bacteria 1902
797 nmdc:mga06r32_271454_c1 3300050510 Bacteria 1683
798 nmdc:mga06r32_71716_c1 3300050510 Bacteria 3352
799 nmdc:mga06r32_7628_c1 3300050510 Bacteria 9730
800 nmdc:mga08y16_10220_c1 3300050511 Bacteria 9851
801 nmdc:mga08y16_123937_c1 3300050511 Bacteria 2689
802 nmdc:mga08y16_13125_c1 3300050511 Bacteria 8716
803 nmdc:mga08y16_133747_c1 3300050511 Bacteria 2577
804 nmdc:mga08y16_180782_c1 3300050511 Bacteria 2190
805 nmdc:mga08y16_269121_c1 3300050511 Archaea 1759
806 nmdc:mga08y16_5631_c1 3300050511 Bacteria 13120
807 nmdc:mga08y16_6706_c1 3300050511 Bacteria 12072
808 nmdc:mga08y16_78049_c1 3300050511 Bacteria 3452
809 nmdc:mga08y16_80830_c1 3300050511 Bacteria 3389
810 nmdc:mga08y16_8355_c1 3300050511 Bacteria 10832
811 nmdc:mga0n895_11252_c1 3300050512 Bacteria 7970
812 nmdc:mga0n895_1213_c1 3300050512 Bacteria 19023
813 nmdc:mga0n895_18871_c2 3300050512 Bacteria 3913
814 nmdc:mga0n895_282350_c1 3300050512 Unclassified 1683
815 nmdc:mga0n895_363905_c1 3300050512 Bacteria 1464
816 nmdc:mga0n895_47933_c1 3300050512 Bacteria 4180
817 nmdc:mga0n895_71242_c1 3300050512 Bacteria 3446
818 nmdc:mga0rr50_102722_c1 3300050513 Bacteria 2249
819 nmdc:mga0rr50_171119_c1 3300050513 Bacteria 1770
820 nmdc:mga08x19_120635_c1 3300050514 Bacteria 1757
821 nmdc:mga08x19_17284_c1 3300050514 Bacteria 4412
822 nmdc:mga08x19_29031_c1 3300050514 Bacteria 3468
823 nmdc:mga0a205_123282_c1 3300050515 Bacteria 2491
824 nmdc:mga0a205_23805_c1 3300050515 Bacteria 5811
825 nmdc:mga0a205_372751_c1 3300050515 Bacteria 1293
826 nmdc:mga0a205_80328_c1 3300050515 Bacteria 3151
827 nmdc:mga0a205_80572_c1 3300050515 Bacteria 3145
828 Ga0495619_0001327 3300053085 Bacteria 16220
829 Ga0495619_0024118 3300053085 Bacteria 3901
830 Ga0495619_0138280 3300053085 Bacteria 1676
831 Ga0500566_0008539 3300053094 Bacteria 6056
832 Ga0500616_0045845 3300053153 Bacteria 2327
833 Ga0501084_0000461 3300054114 Bacteria 31395
834 Ga0501084_0001929 3300054114 Bacteria 16542
835 Ga0501084_0007682 3300054114 Bacteria 8883
836 Ga0501084_0030515 3300054114 Bacteria 4507
837 Ga0501084_0104041 3300054114 Bacteria 2384
838 Ga0501084_0184882 3300054114 Bacteria 1759
839 Ga0590075_014278 3300059424 Bacteria 1941
840 Ga0587070_013141 3300059491 Bacteria 1272
841 Ga0587077_000591 3300059493 Bacteria 3252
842 Ga0587083_0013582 3300059505 Bacteria 1389
843 Ga0587085_001311 3300059506 Bacteria 2259
844 Ga0587085_001989 3300059506 Bacteria 2020
845 Ga0587091_009936 3300059511 Bacteria 1445
846 Ga0587106_001645 3300059605 Bacteria 2037
847 Ga0587101_002160 3300059623 Bacteria 1835
848 Ga0587109_003978 3300059624 Bacteria 2013
849 Ga0587109_005843 3300059624 Bacteria 1787
850 Ga0587062_000268 3300059639 Bacteria 3294
851 Ga0587062_008936 3300059639 Bacteria 1208
852 Ga0587067_010633 3300059640 Bacteria 1399
853 Ga0587072_000911 3300059643 Bacteria 3390
854 Ga0587079_020187 3300059647 Bacteria 1186
855 Ga0587124_001632 3300059660 Bacteria 1481
856 Ga0587111_0000650 3300060346 Bacteria 3551
857 Ga0587111_0010468 3300060346 Bacteria 1593
858 Ga0587111_0013621 3300060346 Bacteria 1457
859 Ga0587111_0014198 3300060346 Bacteria 1437
860 Ga0501082_0003347 3300060353 Bacteria 13998
861 Ga0501082_0011415 3300060353 Bacteria 7643
862 Ga0501082_0024764 3300060353 Bacteria 5173
863 Ga0501082_0071015 3300060353 Bacteria 2998
864 Ga0530510_0004765 3300061734 Bacteria 9392
865 Ga0530510_0006918 3300061734 Bacteria 7908
866 Ga0530510_0008721 3300061734 Bacteria 7089
867 Ga0530510_0015081 3300061734 Bacteria 5459
868 Ga0530510_0030675 3300061734 Bacteria 3863
869 Ga0530510_0053834 3300061734 Bacteria 2908

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039110 Ga0400487_21995 Ga0400487_21995_125_937 253
2 3300044673 Ga0453683_0234490 Ga0453683_0234490_313_1140 269
3 3300049579 Ga0501043_0309289 Ga0501043_0309289_305_1192 282
4 3300033541 Ga0316596_1007624 Ga0316596_10076243 284
5 3300038735 Ga0400485_08672 Ga0400485_08672_13023_14042 298
6 3300038742 Ga0400486_17114 Ga0400486_17114_13044_14063 298
7 3300039110 Ga0400487_03008 Ga0400487_03008_6483_7502 298
8 3300044712 Ga0453684_0003637 Ga0453684_0003637_12401_13429 310
9 3300046459 Ga0495629_0000007 Ga0495629_0000007_294092_295033 310
10 3300046689 Ga0495613_0041711 Ga0495613_0041711_701_1642 310
11 3300053094 Ga0500566_0008539 Ga0500566_0008539_170_1111 310
12 3300031691 Ga0316579_10052802 Ga0316579_100528022 311
13 3300031733 Ga0316577_10020932 Ga0316577_100209322 311
14 3300005618 Ga0068864_100335858 Ga0068864_1003358582 313
15 3300006844 Ga0075428_100041729 Ga0075428_1000417295 313
16 3300006847 Ga0075431_100042817 Ga0075431_1000428174 313
17 3300006847 Ga0075431_100139791 Ga0075431_1001397913 313
18 3300009147 Ga0114129_10000092 Ga0114129_1000009243 313
19 3300009553 Ga0105249_10053243 Ga0105249_100532432 313
20 3300014968 Ga0157379_10232120 Ga0157379_102321201 313
21 3300025933 Ga0207706_10201852 Ga0207706_102018522 313
22 3300025986 Ga0207658_10322887 Ga0207658_103228872 313
23 3300026089 Ga0207648_10490999 Ga0207648_104909991 313
24 3300027876 Ga0209974_10076904 Ga0209974_100769041 313
25 3300028381 Ga0268264_10573584 Ga0268264_105735841 313
26 3300041408 Ga0439453_0002595 Ga0439453_0002595_1492_2484 313
27 3300042436 Ga0439435_0017337 Ga0439435_0017337_489_1481 313
28 3300048905 Ga0496102_0373013 Ga0496102_0373013_239_1231 313
29 3300048906 Ga0496103_0209123 Ga0496103_0209123_68_1060 313
30 3300049568 Ga0501031_0026897 Ga0501031_0026897_424_1416 313
31 3300049569 Ga0501032_0073350 Ga0501032_0073350_839_1831 313
32 3300049570 Ga0501033_0034683 Ga0501033_0034683_1251_2243 313
33 3300049571 Ga0501034_0097139 Ga0501034_0097139_1005_1997 313
34 3300049572 Ga0501036_0000942 Ga0501036_0000942_7955_8947 313
35 3300049572 Ga0501036_0004738 Ga0501036_0004738_9818_10810 313
36 3300049572 Ga0501036_0247227 Ga0501036_0247227_354_1346 313
37 3300049574 Ga0501038_0001392 Ga0501038_0001392_8861_9853 313
38 3300049574 Ga0501038_0249217 Ga0501038_0249217_331_1323 313
39 3300049575 Ga0501039_0003138 Ga0501039_0003138_6101_7093 313
40 3300049576 Ga0501040_0000070 Ga0501040_0000070_46540_47532 313
41 3300049576 Ga0501040_0031360 Ga0501040_0031360_663_1655 313
42 3300049577 Ga0501041_0001162 Ga0501041_0001162_10012_11004 313
43 3300049577 Ga0501041_0016024 Ga0501041_0016024_3250_4242 313
44 3300049577 Ga0501041_0090288 Ga0501041_0090288_354_1346 313
45 3300049578 Ga0501042_0000926 Ga0501042_0000926_4372_5364 313
46 3300049578 Ga0501042_0016640 Ga0501042_0016640_1372_2364 313
47 3300049578 Ga0501042_0045205 Ga0501042_0045205_2061_3053 313
48 3300049579 Ga0501043_0014038 Ga0501043_0014038_3562_4554 313
49 3300049580 Ga0501046_0001500 Ga0501046_0001500_16738_17730 313
50 3300049580 Ga0501046_0035201 Ga0501046_0035201_1338_2330 313
51 3300049580 Ga0501046_0170225 Ga0501046_0170225_412_1404 313
52 3300049582 Ga0501048_0015102 Ga0501048_0015102_1916_2908 313
53 3300049582 Ga0501048_0028158 Ga0501048_0028158_588_1580 313
54 3300049582 Ga0501048_0043787 Ga0501048_0043787_2036_3028 313
55 3300049584 Ga0501068_0006986 Ga0501068_0006986_1711_2703 313
56 3300049585 Ga0501069_0033407 Ga0501069_0033407_1184_2176 313
57 3300049586 Ga0501070_0024404 Ga0501070_0024404_2652_3644 313
58 3300049587 Ga0501071_0000007 Ga0501071_0000007_10808_11800 313
59 3300049587 Ga0501071_0021718 Ga0501071_0021718_1933_2925 313
60 3300049588 Ga0501072_0000620 Ga0501072_0000620_875_1867 313
61 3300049588 Ga0501072_0001242 Ga0501072_0001242_8948_9940 313
62 3300049588 Ga0501072_0122457 Ga0501072_0122457_144_1136 313
63 3300049589 Ga0501073_0044048 Ga0501073_0044048_126_1118 313
64 3300049590 Ga0501074_0000626 Ga0501074_0000626_10594_11586 313
65 3300049590 Ga0501074_0133352 Ga0501074_0133352_19_1011 313
66 3300049590 Ga0501074_0264731 Ga0501074_0264731_35_1027 313
67 3300049591 Ga0501075_0000031 Ga0501075_0000031_13042_14034 313
68 3300049591 Ga0501075_0000645 Ga0501075_0000645_6362_7354 313
69 3300049592 Ga0501076_0000733 Ga0501076_0000733_18214_19206 313
70 3300049592 Ga0501076_0002119 Ga0501076_0002119_9217_10209 313
71 3300049592 Ga0501076_0049426 Ga0501076_0049426_35_1027 313
72 3300049593 Ga0501077_0000055 Ga0501077_0000055_9903_10895 313
73 3300049593 Ga0501077_0034412 Ga0501077_0034412_1373_2365 313
74 3300049741 Ga0501079_0000858 Ga0501079_0000858_9032_10024 313
75 3300049741 Ga0501079_0010492 Ga0501079_0010492_5712_6704 313
76 3300049741 Ga0501079_0169864 Ga0501079_0169864_265_1257 313
77 3300049741 Ga0501079_0416695 Ga0501079_0416695_22_972 313
78 3300049742 Ga0501080_0000823 Ga0501080_0000823_18532_19524 313
79 3300049742 Ga0501080_0162657 Ga0501080_0162657_668_1660 313
80 3300049743 Ga0501081_0002273 Ga0501081_0002273_2163_3155 313
81 3300049743 Ga0501081_0278368 Ga0501081_0278368_30_1022 313
82 3300049744 Ga0501083_0028562 Ga0501083_0028562_1015_2007 313
83 3300049744 Ga0501083_0059220 Ga0501083_0059220_1022_2014 313
84 3300049822 Ga0501035_0005591 Ga0501035_0005591_5101_6093 313
85 3300049824 Ga0501045_0000303 Ga0501045_0000303_15606_16598 313
86 3300049824 Ga0501045_0051760 Ga0501045_0051760_352_1344 313
87 3300050507 nmdc:mga05p37_3608_c1 nmdc:mga05p37_3608_c1_16057_17049 313
88 3300050510 nmdc:mga06r32_216706_c1 nmdc:mga06r32_216706_c1_641_1633 313
89 3300050510 nmdc:mga06r32_271454_c1 nmdc:mga06r32_271454_c1_91_1083 313
90 3300050515 nmdc:mga0a205_372751_c1 nmdc:mga0a205_372751_c1_38_1030 313
91 3300054114 Ga0501084_0007682 Ga0501084_0007682_2504_3496 313
92 3300054114 Ga0501084_0104041 Ga0501084_0104041_184_1176 313
93 3300060353 Ga0501082_0011415 Ga0501082_0011415_863_1855 313
94 3300060353 Ga0501082_0024764 Ga0501082_0024764_1805_2797 313
95 3300061734 Ga0530510_0004765 Ga0530510_0004765_7266_8258 313
96 3300061734 Ga0530510_0006918 Ga0530510_0006918_4479_5471 313
97 3300061734 Ga0530510_0008721 Ga0530510_0008721_4550_5542 313
98 3300061734 Ga0530510_0053834 Ga0530510_0053834_312_1304 313
99 3300005471 Ga0070698_100043375 Ga0070698_1000433756 314
100 3300005617 Ga0068859_100064970 Ga0068859_1000649702 314
101 3300006931 Ga0097620_100064970 Ga0097620_1000649702 314
102 3300033528 Ga0316588_1009457 Ga0316588_10094572 314
103 3300050509 nmdc:mga0qj67_320652_c1 nmdc:mga0qj67_320652_c1_65_1084 314
104 3300050510 nmdc:mga06r32_172802_c1 nmdc:mga06r32_172802_c1_237_1256 314
105 3300003504 JGI26138J51218_100829 JGI26138J51218_1008291 315
106 3300033541 Ga0316596_1003232 Ga0316596_10032325 315
107 3300031733 Ga0316577_10057497 Ga0316577_100574972 316
108 3300032168 Ga0316593_10000581 Ga0316593_1000058111 316
109 3300038735 Ga0400485_08047 Ga0400485_08047_5885_6886 316
110 3300038742 Ga0400486_03968 Ga0400486_03968_840_1841 316
111 3300039093 Ga0400489_87362 Ga0400489_87362_48_1070 316
112 3300005546 Ga0070696_100064748 Ga0070696_1000647482 317
113 3300032133 Ga0316583_10002585 Ga0316583_100025854 317
114 3300036647 Ga0316582_0026784 Ga0316582_0026784_845_1891 317
115 3300039093 Ga0400489_68201 Ga0400489_68201_355_1374 317
116 3300050515 nmdc:mga0a205_80572_c1 nmdc:mga0a205_80572_c1_216_1235 317
117 3300005618 Ga0068864_100133292 Ga0068864_1001332923 318
118 3300006358 Ga0068871_100308677 Ga0068871_1003086772 318
119 3300013306 Ga0163162_10177705 Ga0163162_101777052 318
120 3300031995 Ga0307409_100329229 Ga0307409_1003292292 318
121 3300046462 Ga0495651_0080256 Ga0495651_0080256_807_1826 318
122 3300047317 Ga0495604_0106681 Ga0495604_0106681_711_1730 318
123 3300048088 Ga0495602_0088045 Ga0495602_0088045_547_1566 318
124 3300031235 Ga0265330_10000095 Ga0265330_1000009518 319
125 3300031238 Ga0265332_10000222 Ga0265332_1000022230 319
126 3300031239 Ga0265328_10034512 Ga0265328_100345122 319
127 3300031240 Ga0265320_10039072 Ga0265320_100390722 319
128 3300031242 Ga0265329_10005084 Ga0265329_100050847 319
129 3300031250 Ga0265331_10025138 Ga0265331_100251383 319
130 3300031344 Ga0265316_10000450 Ga0265316_1000045018 319
131 3300031711 Ga0265314_10000076 Ga0265314_10000076110 319
132 3300031712 Ga0265342_10000759 Ga0265342_1000075917 319
133 3300031727 Ga0316576_10007134 Ga0316576_100071349 319
134 3300033524 Ga0316592_1024207 Ga0316592_10242072 319
135 3300039062 Ga0400483_282171 Ga0400483_282171_257_1303 319
136 3300005614 Ga0068856_100323434 Ga0068856_1003234342 320
137 3300009094 Ga0111539_10199637 Ga0111539_101996372 320
138 3300028577 Ga0265318_10001387 Ga0265318_100013876 320
139 3300028800 Ga0265338_10190681 Ga0265338_101906812 320
140 3300031241 Ga0265325_10001575 Ga0265325_1000157528 320
141 3300031247 Ga0265340_10019984 Ga0265340_100199841 320
142 3300031344 Ga0265316_10001048 Ga0265316_1000104816 320
143 3300031595 Ga0265313_10001355 Ga0265313_1000135525 320
144 3300031727 Ga0316576_10000992 Ga0316576_100009928 320
145 3300033524 Ga0316592_1000397 Ga0316592_10003978 320
146 3300033528 Ga0316588_1000005 Ga0316588_100000526 320
147 3300033541 Ga0316596_1000006 Ga0316596_100000629 320
148 3300035398 Ga0316574_0126871 Ga0316574_0126871_204_1241 320
149 3300037588 Ga0316581_0007370 Ga0316581_0007370_1045_2076 320
150 3300050511 nmdc:mga08y16_180782_c1 nmdc:mga08y16_180782_c1_366_1337 320
151 3300006237 Ga0097621_100133656 Ga0097621_1001336562 321
152 3300006358 Ga0068871_100092633 Ga0068871_1000926332 321
153 3300006846 Ga0075430_100005705 Ga0075430_1000057054 321
154 3300009177 Ga0105248_10053602 Ga0105248_100536022 321
155 3300028380 Ga0268265_10199953 Ga0268265_101999531 321
156 3300042876 Ga0451577_0000828 Ga0451577_0000828_40163_41134 321
157 3300044712 Ga0453684_0004724 Ga0453684_0004724_13215_14186 321
158 3300044712 Ga0453684_0010350 Ga0453684_0010350_7901_8872 321
159 3300045051 Ga0451576_0302429 Ga0451576_0302429_31_1014 321
160 3300046454 Ga0495592_0096167 Ga0495592_0096167_686_1660 321
161 3300046477 Ga0495664_0003262 Ga0495664_0003262_1768_2769 321
162 3300046516 Ga0495628_0199865 Ga0495628_0199865_301_1275 321
163 3300046680 Ga0495646_0129115 Ga0495646_0129115_88_1089 321
164 3300046690 Ga0495624_0096301 Ga0495624_0096301_400_1401 321
165 3300047315 Ga0495581_0090782 Ga0495581_0090782_198_1199 321
166 3300047319 Ga0495674_0013556 Ga0495674_0013556_2723_3724 321
167 3300047321 Ga0495676_0154450 Ga0495676_0154450_409_1410 321
168 3300047471 Ga0495684_0197802 Ga0495684_0197802_26_1027 321
169 3300048915 Ga0496112_0077009 Ga0496112_0077009_26_1021 321
170 3300049589 Ga0501073_0148375 Ga0501073_0148375_48_1022 321
171 3300050508 nmdc:mga09592_21071_c1 nmdc:mga09592_21071_c1_2669_3694 321
172 3300050509 nmdc:mga0qj67_4157_c1 nmdc:mga0qj67_4157_c1_9115_10089 321
173 3300004799 Ga0058863_11799350 Ga0058863_117993502 322
174 3300005293 Ga0065715_10226073 Ga0065715_102260731 322
175 3300005365 Ga0070688_100174410 Ga0070688_1001744102 322
176 3300005444 Ga0070694_100264950 Ga0070694_1002649501 322
177 3300005458 Ga0070681_10401337 Ga0070681_104013371 322
178 3300005563 Ga0068855_100125423 Ga0068855_1001254235 322
179 3300005617 Ga0068859_100219325 Ga0068859_1002193252 322
180 3300006931 Ga0097620_100219325 Ga0097620_1002193252 322
181 3300009147 Ga0114129_10028222 Ga0114129_100282226 322
182 3300025912 Ga0207707_10204286 Ga0207707_102042862 322
183 3300025923 Ga0207681_10069050 Ga0207681_100690501 322
184 3300025925 Ga0207650_10390255 Ga0207650_103902551 322
185 3300025926 Ga0207659_10140234 Ga0207659_101402342 322
186 3300025949 Ga0207667_10072220 Ga0207667_100722205 322
187 3300025960 Ga0207651_10160927 Ga0207651_101609272 322
188 3300027907 Ga0207428_10126514 Ga0207428_101265142 322
189 3300031241 Ga0265325_10000502 Ga0265325_1000050212 322
190 3300031249 Ga0265339_10000299 Ga0265339_100002999 322
191 3300031250 Ga0265331_10000134 Ga0265331_1000013446 322
192 3300031595 Ga0265313_10000316 Ga0265313_1000031630 322
193 3300031711 Ga0265314_10000413 Ga0265314_100004138 322
194 3300031712 Ga0265342_10010844 Ga0265342_100108447 322
195 3300032005 Ga0307411_10081107 Ga0307411_100811071 322
196 3300049592 Ga0501076_0041428 Ga0501076_0041428_1654_2631 322
197 3300049743 Ga0501081_0009031 Ga0501081_0009031_965_1942 322
198 3300049824 Ga0501045_0278171 Ga0501045_0278171_144_1121 322
199 3300050507 nmdc:mga05p37_337191_c1 nmdc:mga05p37_337191_c1_585_1568 322
200 3300050511 nmdc:mga08y16_78049_c1 nmdc:mga08y16_78049_c1_1988_2962 322
201 3300050511 nmdc:mga08y16_80830_c1 nmdc:mga08y16_80830_c1_90_1064 322
202 3300053153 Ga0500616_0045845 Ga0500616_0045845_1298_2311 322
203 3300061734 Ga0530510_0030675 Ga0530510_0030675_990_1967 322
204 3300005330 Ga0070690_100107616 Ga0070690_1001076162 323
205 3300005355 Ga0070671_100001915 Ga0070671_10000191526 323
206 3300005440 Ga0070705_100123889 Ga0070705_1001238892 323
207 3300005444 Ga0070694_100001928 Ga0070694_1000019284 323
208 3300005445 Ga0070708_100090460 Ga0070708_1000904603 323
209 3300005536 Ga0070697_100001607 Ga0070697_1000016078 323
210 3300005545 Ga0070695_100054427 Ga0070695_1000544273 323
211 3300005549 Ga0070704_100170614 Ga0070704_1001706142 323
212 3300005617 Ga0068859_100051052 Ga0068859_1000510523 323
213 3300005617 Ga0068859_100151351 Ga0068859_1001513512 323
214 3300005719 Ga0068861_100031668 Ga0068861_1000316683 323
215 3300005842 Ga0068858_100125149 Ga0068858_1001251492 323
216 3300006844 Ga0075428_100000542 Ga0075428_1000005423 323
217 3300006844 Ga0075428_100072820 Ga0075428_1000728203 323
218 3300006844 Ga0075428_100456962 Ga0075428_1004569622 323
219 3300006846 Ga0075430_100042805 Ga0075430_1000428052 323
220 3300006847 Ga0075431_100042954 Ga0075431_1000429543 323
221 3300006931 Ga0097620_100051049 Ga0097620_1000510493 323
222 3300006931 Ga0097620_100151350 Ga0097620_1001513502 323
223 3300009094 Ga0111539_10011746 Ga0111539_100117468 323
224 3300009094 Ga0111539_10014963 Ga0111539_1001496316 323
225 3300009176 Ga0105242_10279018 Ga0105242_102790182 323
226 3300014326 Ga0157380_10063989 Ga0157380_100639893 323
227 3300025931 Ga0207644_10000319 Ga0207644_1000031915 323
228 3300025933 Ga0207706_10085842 Ga0207706_100858423 323
229 3300025936 Ga0207670_10359030 Ga0207670_103590302 323
230 3300025961 Ga0207712_10146734 Ga0207712_101467342 323
231 3300026035 Ga0207703_10272600 Ga0207703_102726002 323
232 3300026118 Ga0207675_100025528 Ga0207675_1000255282 323
233 3300027907 Ga0207428_10044112 Ga0207428_100441126 323
234 3300032168 Ga0316593_10004875 Ga0316593_100048753 323
235 3300035116 Ga0373945_0061054 Ga0373945_0061054_203_1183 323
236 3300037068 Ga0373925_0002179 Ga0373925_0002179_10319_11299 323
237 3300042876 Ga0451577_0008521 Ga0451577_0008521_5281_6261 323
238 3300044712 Ga0453684_0111569 Ga0453684_0111569_1927_2907 323
239 3300046455 Ga0495603_0058712 Ga0495603_0058712_756_1736 323
240 3300046459 Ga0495629_0000126 Ga0495629_0000126_56272_57252 323
241 3300046461 Ga0495641_0016753 Ga0495641_0016753_215_1195 323
242 3300046475 Ga0495639_0000121 Ga0495639_0000121_7640_8620 323
243 3300046475 Ga0495639_0012434 Ga0495639_0012434_2665_3645 323
244 3300046499 Ga0495594_0009365 Ga0495594_0009365_3971_4951 323
245 3300046514 Ga0495618_0033611 Ga0495618_0033611_406_1386 323
246 3300046526 Ga0495666_0019669 Ga0495666_0019669_1582_2562 323
247 3300046533 Ga0495640_0084624 Ga0495640_0084624_225_1205 323
248 3300046535 Ga0495586_0006882 Ga0495586_0006882_829_1809 323
249 3300046535 Ga0495586_0012323 Ga0495586_0012323_1887_2867 323
250 3300046557 Ga0495622_0036714 Ga0495622_0036714_184_1164 323
251 3300046663 Ga0495635_0001003 Ga0495635_0001003_2647_3627 323
252 3300046663 Ga0495635_0001790 Ga0495635_0001790_3990_4970 323
253 3300046681 Ga0495647_0001519 Ga0495647_0001519_3414_4394 323
254 3300046681 Ga0495647_0016102 Ga0495647_0016102_720_1700 323
255 3300046683 Ga0495658_0000327 Ga0495658_0000327_10380_11360 323
256 3300046683 Ga0495658_0004909 Ga0495658_0004909_1996_2976 323
257 3300046689 Ga0495613_0025308 Ga0495613_0025308_3366_4346 323
258 3300046690 Ga0495624_0155658 Ga0495624_0155658_289_1269 323
259 3300046809 Ga0495600_0020741 Ga0495600_0020741_2565_3545 323
260 3300047315 Ga0495581_0000280 Ga0495581_0000280_13580_14560 323
261 3300047321 Ga0495676_0020676 Ga0495676_0020676_485_1465 323
262 3300047321 Ga0495676_0040130 Ga0495676_0040130_95_1075 323
263 3300047322 Ga0495680_0000838 Ga0495680_0000838_17165_18145 323
264 3300047322 Ga0495680_0001860 Ga0495680_0001860_2910_3890 323
265 3300047471 Ga0495684_0006640 Ga0495684_0006640_5323_6303 323
266 3300047471 Ga0495684_0177441 Ga0495684_0177441_171_1151 323
267 3300048089 Ga0495614_0002522 Ga0495614_0002522_5712_6692 323
268 3300049571 Ga0501034_0053308 Ga0501034_0053308_2894_3874 323
269 3300049590 Ga0501074_0294187 Ga0501074_0294187_22_1002 323
270 3300050507 nmdc:mga05p37_274730_c1 nmdc:mga05p37_274730_c1_526_1506 323
271 3300050511 nmdc:mga08y16_123937_c1 nmdc:mga08y16_123937_c1_1298_2278 323
272 3300050511 nmdc:mga08y16_8355_c1 nmdc:mga08y16_8355_c1_3809_4789 323
273 3300053085 Ga0495619_0001327 Ga0495619_0001327_9142_10122 323
274 3300053085 Ga0495619_0138280 Ga0495619_0138280_81_1061 323
275 3300005366 Ga0070659_100224456 Ga0070659_1002244561 324
276 3300006846 Ga0075430_100075246 Ga0075430_1000752461 324
277 3300032002 Ga0307416_100012158 Ga0307416_1000121585 324
278 3300032005 Ga0307411_10010242 Ga0307411_100102422 324
279 3300032126 Ga0307415_100085523 Ga0307415_1000855232 324
280 3300042876 Ga0451577_0234273 Ga0451577_0234273_541_1560 324
281 3300049587 Ga0501071_0227418 Ga0501071_0227418_147_1130 324
282 3300049742 Ga0501080_0167550 Ga0501080_0167550_555_1538 324
283 3300049743 Ga0501081_0099477 Ga0501081_0099477_461_1444 324
284 3300013104 Ga0157370_10509273 Ga0157370_105092731 325
285 3300025936 Ga0207670_10077018 Ga0207670_100770183 325
286 3300028577 Ga0265318_10000273 Ga0265318_1000027328 325
287 3300031235 Ga0265330_10000998 Ga0265330_100009985 325
288 3300031238 Ga0265332_10000280 Ga0265332_1000028028 325
289 3300031240 Ga0265320_10000485 Ga0265320_1000048515 325
290 3300031241 Ga0265325_10042041 Ga0265325_100420413 325
291 3300031242 Ga0265329_10000013 Ga0265329_1000001327 325
292 3300031247 Ga0265340_10000189 Ga0265340_1000018915 325
293 3300031249 Ga0265339_10008773 Ga0265339_100087733 325
294 3300031250 Ga0265331_10002207 Ga0265331_1000220717 325
295 3300031344 Ga0265316_10002957 Ga0265316_100029575 325
296 3300031595 Ga0265313_10000463 Ga0265313_1000046328 325
297 3300031711 Ga0265314_10002804 Ga0265314_1000280428 325
298 3300031712 Ga0265342_10000471 Ga0265342_1000047127 325
299 3300047319 Ga0495674_0010169 Ga0495674_0010169_7889_8878 325
300 3300048918 Ga0496115_0020289 Ga0496115_0020289_2898_3920 325
301 3300049571 Ga0501034_0303293 Ga0501034_0303293_21_1010 325
302 3300049576 Ga0501040_0345965 Ga0501040_0345965_44_1030 325
303 3300059506 Ga0587085_001311 Ga0587085_001311_409_1407 325
304 3300006237 Ga0097621_100202538 Ga0097621_1002025382 326
305 3300013297 Ga0157378_10050923 Ga0157378_100509236 326
306 3300050507 nmdc:mga05p37_54976_c1 nmdc:mga05p37_54976_c1_3726_4715 326
307 3300050510 nmdc:mga06r32_7628_c1 nmdc:mga06r32_7628_c1_4385_5374 326
308 3300004801 Ga0058860_12161439 Ga0058860_121614398 327
309 3300005293 Ga0065715_10122190 Ga0065715_101221903 327
310 3300005331 Ga0070670_100014297 Ga0070670_1000142976 327
311 3300005335 Ga0070666_10010358 Ga0070666_100103582 327
312 3300005338 Ga0068868_100334682 Ga0068868_1003346822 327
313 3300005340 Ga0070689_100075687 Ga0070689_1000756874 327
314 3300005354 Ga0070675_100000102 Ga0070675_1000001022 327
315 3300005354 Ga0070675_100002074 Ga0070675_1000020746 327
316 3300005354 Ga0070675_100008285 Ga0070675_1000082852 327
317 3300005355 Ga0070671_100016587 Ga0070671_1000165877 327
318 3300005356 Ga0070674_100091897 Ga0070674_1000918972 327
319 3300005364 Ga0070673_100007622 Ga0070673_1000076227 327
320 3300005365 Ga0070688_100038207 Ga0070688_1000382073 327
321 3300005365 Ga0070688_100051462 Ga0070688_1000514622 327
322 3300005367 Ga0070667_100020021 Ga0070667_1000200215 327
323 3300005367 Ga0070667_100022644 Ga0070667_1000226447 327
324 3300005438 Ga0070701_10057367 Ga0070701_100573673 327
325 3300005466 Ga0070685_10029887 Ga0070685_100298873 327
326 3300005466 Ga0070685_10221497 Ga0070685_102214971 327
327 3300005543 Ga0070672_100213444 Ga0070672_1002134441 327
328 3300005544 Ga0070686_100086509 Ga0070686_1000865092 327
329 3300005544 Ga0070686_100156464 Ga0070686_1001564641 327
330 3300005546 Ga0070696_100062684 Ga0070696_1000626844 327
331 3300005549 Ga0070704_100033596 Ga0070704_1000335962 327
332 3300005564 Ga0070664_100005021 Ga0070664_10000502121 327
333 3300005617 Ga0068859_100000703 Ga0068859_1000007037 327
334 3300005617 Ga0068859_100006716 Ga0068859_10000671614 327
335 3300005841 Ga0068863_100000422 Ga0068863_10000042230 327
336 3300005842 Ga0068858_100062457 Ga0068858_1000624574 327
337 3300005842 Ga0068858_100125452 Ga0068858_1001254522 327
338 3300005843 Ga0068860_100012322 Ga0068860_1000123226 327
339 3300005981 Ga0081538_10001299 Ga0081538_1000129935 327
340 3300005981 Ga0081538_10019881 Ga0081538_100198814 327
341 3300006237 Ga0097621_100015996 Ga0097621_1000159963 327
342 3300006358 Ga0068871_100241985 Ga0068871_1002419852 327
343 3300006844 Ga0075428_100236114 Ga0075428_1002361142 327
344 3300006852 Ga0075433_10371159 Ga0075433_103711591 327
345 3300006931 Ga0097620_100000703 Ga0097620_1000007037 327
346 3300006931 Ga0097620_100006716 Ga0097620_10000671614 327
347 3300007076 Ga0075435_100182241 Ga0075435_1001822411 327
348 3300009094 Ga0111539_10019680 Ga0111539_100196802 327
349 3300009094 Ga0111539_10055434 Ga0111539_100554343 327
350 3300009176 Ga0105242_10035707 Ga0105242_100357075 327
351 3300009177 Ga0105248_10000244 Ga0105248_1000024425 327
352 3300013306 Ga0163162_10007110 Ga0163162_100071107 327
353 3300013306 Ga0163162_10747883 Ga0163162_107478831 327
354 3300013308 Ga0157375_10000216 Ga0157375_1000021638 327
355 3300014325 Ga0163163_10021966 Ga0163163_100219669 327
356 3300014326 Ga0157380_10140719 Ga0157380_101407192 327
357 3300014745 Ga0157377_10054382 Ga0157377_100543824 327
358 3300014968 Ga0157379_10000091 Ga0157379_1000009142 327
359 3300017792 Ga0163161_10022185 Ga0163161_100221857 327
360 3300025925 Ga0207650_10101995 Ga0207650_101019951 327
361 3300025926 Ga0207659_10002514 Ga0207659_1000251422 327
362 3300025926 Ga0207659_10005064 Ga0207659_100050648 327
363 3300025926 Ga0207659_10013347 Ga0207659_100133473 327
364 3300025933 Ga0207706_10161671 Ga0207706_101616712 327
365 3300025934 Ga0207686_10012174 Ga0207686_100121746 327
366 3300025936 Ga0207670_10021806 Ga0207670_100218062 327
367 3300025937 Ga0207669_10151660 Ga0207669_101516602 327
368 3300025939 Ga0207665_10142439 Ga0207665_101424392 327
369 3300025940 Ga0207691_10134892 Ga0207691_101348922 327
370 3300025941 Ga0207711_10003595 Ga0207711_100035954 327
371 3300025942 Ga0207689_10098611 Ga0207689_100986114 327
372 3300025945 Ga0207679_10018240 Ga0207679_100182402 327
373 3300025945 Ga0207679_10384177 Ga0207679_103841772 327
374 3300025960 Ga0207651_10004211 Ga0207651_100042117 327
375 3300025986 Ga0207658_10039755 Ga0207658_100397555 327
376 3300025986 Ga0207658_10047025 Ga0207658_100470253 327
377 3300026023 Ga0207677_10367173 Ga0207677_103671732 327
378 3300026035 Ga0207703_10007843 Ga0207703_100078433 327
379 3300026088 Ga0207641_10000293 Ga0207641_1000029352 327
380 3300028380 Ga0268265_10308471 Ga0268265_103084712 327
381 3300028381 Ga0268264_10008889 Ga0268264_100088897 327
382 3300028381 Ga0268264_10051818 Ga0268264_100518182 327
383 3300031727 Ga0316576_10048108 Ga0316576_100481082 327
384 3300031733 Ga0316577_10044815 Ga0316577_100448153 327
385 3300033524 Ga0316592_1002468 Ga0316592_10024686 327
386 3300033541 Ga0316596_1001245 Ga0316596_10012453 327
387 3300039062 Ga0400483_206886 Ga0400483_206886_1075_2076 327
388 3300047318 Ga0495636_0004364 Ga0495636_0004364_4037_5029 327
389 3300049571 Ga0501034_0102596 Ga0501034_0102596_1677_2684 327
390 3300050511 nmdc:mga08y16_10220_c1 nmdc:mga08y16_10220_c1_7941_8933 327
391 3300050513 nmdc:mga0rr50_171119_c1 nmdc:mga0rr50_171119_c1_91_1092 327
392 3300059511 Ga0587091_009936 Ga0587091_009936_283_1290 327
393 3300005293 Ga0065715_10104520 Ga0065715_101045202 328
394 3300005330 Ga0070690_100000832 Ga0070690_1000008322 328
395 3300005331 Ga0070670_100001731 Ga0070670_10000173110 328
396 3300005335 Ga0070666_10004312 Ga0070666_100043125 328
397 3300005338 Ga0068868_100023242 Ga0068868_1000232425 328
398 3300005340 Ga0070689_100074153 Ga0070689_1000741531 328
399 3300005344 Ga0070661_100059685 Ga0070661_1000596853 328
400 3300005354 Ga0070675_100102461 Ga0070675_1001024613 328
401 3300005354 Ga0070675_100112715 Ga0070675_1001127152 328
402 3300005355 Ga0070671_100031304 Ga0070671_1000313046 328
403 3300005364 Ga0070673_100002597 Ga0070673_10000259711 328
404 3300005365 Ga0070688_100133628 Ga0070688_1001336281 328
405 3300005367 Ga0070667_100002116 Ga0070667_1000021165 328
406 3300005543 Ga0070672_100006620 Ga0070672_1000066208 328
407 3300005564 Ga0070664_100002539 Ga0070664_10000253917 328
408 3300005577 Ga0068857_100236856 Ga0068857_1002368562 328
409 3300005618 Ga0068864_100006004 Ga0068864_1000060042 328
410 3300005618 Ga0068864_100469165 Ga0068864_1004691652 328
411 3300005841 Ga0068863_100391856 Ga0068863_1003918561 328
412 3300005842 Ga0068858_100499190 Ga0068858_1004991902 328
413 3300005842 Ga0068858_100563358 Ga0068858_1005633581 328
414 3300006237 Ga0097621_100025188 Ga0097621_1000251881 328
415 3300006237 Ga0097621_100361951 Ga0097621_1003619512 328
416 3300006358 Ga0068871_100123853 Ga0068871_1001238533 328
417 3300006358 Ga0068871_100276296 Ga0068871_1002762961 328
418 3300006847 Ga0075431_100306563 Ga0075431_1003065632 328
419 3300009176 Ga0105242_10248563 Ga0105242_102485632 328
420 3300009177 Ga0105248_10116700 Ga0105248_101167006 328
421 3300011119 Ga0105246_10066760 Ga0105246_100667603 328
422 3300013296 Ga0157374_10345580 Ga0157374_103455801 328
423 3300013306 Ga0163162_10000450 Ga0163162_1000045011 328
424 3300013306 Ga0163162_10175321 Ga0163162_101753213 328
425 3300013308 Ga0157375_10000704 Ga0157375_100007041 328
426 3300013308 Ga0157375_10713343 Ga0157375_107133431 328
427 3300014325 Ga0163163_10037938 Ga0163163_100379381 328
428 3300025903 Ga0207680_10002543 Ga0207680_100025438 328
429 3300025907 Ga0207645_10234951 Ga0207645_102349511 328
430 3300025920 Ga0207649_10055401 Ga0207649_100554012 328
431 3300025925 Ga0207650_10005011 Ga0207650_1000501118 328
432 3300025925 Ga0207650_10280551 Ga0207650_102805511 328
433 3300025926 Ga0207659_10155545 Ga0207659_101555452 328
434 3300025931 Ga0207644_10173842 Ga0207644_101738421 328
435 3300025940 Ga0207691_10025137 Ga0207691_100251377 328
436 3300025941 Ga0207711_10228394 Ga0207711_102283942 328
437 3300025945 Ga0207679_10003650 Ga0207679_100036502 328
438 3300025986 Ga0207658_10001060 Ga0207658_100010606 328
439 3300026023 Ga0207677_10015860 Ga0207677_100158602 328
440 3300026088 Ga0207641_10043328 Ga0207641_100433282 328
441 3300026088 Ga0207641_10064915 Ga0207641_100649151 328
442 3300026095 Ga0207676_10000787 Ga0207676_1000078714 328
443 3300026095 Ga0207676_10527294 Ga0207676_105272941 328
444 3300027907 Ga0207428_10042349 Ga0207428_100423491 328
445 3300031665 Ga0316575_10001284 Ga0316575_100012848 328
446 3300031691 Ga0316579_10039180 Ga0316579_100391802 328
447 3300031727 Ga0316576_10013503 Ga0316576_100135032 328
448 3300031728 Ga0316578_10025877 Ga0316578_100258774 328
449 3300031733 Ga0316577_10025885 Ga0316577_100258851 328
450 3300035117 Ga0373953_0009969 Ga0373953_0009969_549_1547 328
451 3300035120 Ga0373957_0026847 Ga0373957_0026847_691_1689 328
452 3300035398 Ga0316574_0039406 Ga0316574_0039406_1237_2259 328
453 3300035398 Ga0316574_0048969 Ga0316574_0048969_840_1853 328
454 3300035398 Ga0316574_0140894 Ga0316574_0140894_412_1413 328
455 3300035410 Ga0373924_0028155 Ga0373924_0028155_781_1779 328
456 3300036401 Ga0373937_0017617 Ga0373937_0017617_2768_3766 328
457 3300036401 Ga0373937_0045525 Ga0373937_0045525_32_1030 328
458 3300036647 Ga0316582_0003012 Ga0316582_0003012_1167_2180 328
459 3300036712 Ga0316584_0009321 Ga0316584_0009321_1701_2702 328
460 3300046459 Ga0495629_0053214 Ga0495629_0053214_1116_2114 328
461 3300046472 Ga0495580_0040045 Ga0495580_0040045_1922_2920 328
462 3300046511 Ga0495608_0015057 Ga0495608_0015057_3197_4195 328
463 3300046529 Ga0495652_0246772 Ga0495652_0246772_154_1152 328
464 3300046536 Ga0495587_0196125 Ga0495587_0196125_74_1072 328
465 3300046559 Ga0495667_0000559 Ga0495667_0000559_5555_6553 328
466 3300046681 Ga0495647_0020678 Ga0495647_0020678_352_1350 328
467 3300046689 Ga0495613_0007236 Ga0495613_0007236_1253_2251 328
468 3300046689 Ga0495613_0011880 Ga0495613_0011880_2406_3404 328
469 3300047319 Ga0495674_0160794 Ga0495674_0160794_841_1839 328
470 3300047471 Ga0495684_0115057 Ga0495684_0115057_500_1498 328
471 3300050508 nmdc:mga09592_10768_c1 nmdc:mga09592_10768_c1_6077_7072 328
472 3300050509 nmdc:mga0qj67_205352_c1 nmdc:mga0qj67_205352_c1_59_1060 328
473 3300050511 nmdc:mga08y16_13125_c1 nmdc:mga08y16_13125_c1_5028_6023 328
474 3300004799 Ga0058863_10079010 Ga0058863_100790107 329
475 3300004800 Ga0058861_11963644 Ga0058861_119636442 329
476 3300004803 Ga0058862_12711381 Ga0058862_127113812 329
477 3300005329 Ga0070683_100107294 Ga0070683_1001072944 329
478 3300005468 Ga0070707_100031674 Ga0070707_1000316746 329
479 3300006844 Ga0075428_100032985 Ga0075428_1000329856 329
480 3300006852 Ga0075433_10008964 Ga0075433_100089646 329
481 3300006852 Ga0075433_10132392 Ga0075433_101323921 329
482 3300006871 Ga0075434_100005032 Ga0075434_10000503212 329
483 3300006871 Ga0075434_100029963 Ga0075434_1000299632 329
484 3300006871 Ga0075434_100049382 Ga0075434_1000493825 329
485 3300006871 Ga0075434_100184395 Ga0075434_1001843952 329
486 3300006871 Ga0075434_100582823 Ga0075434_1005828231 329
487 3300007076 Ga0075435_100017305 Ga0075435_1000173054 329
488 3300009094 Ga0111539_10121685 Ga0111539_101216853 329
489 3300009094 Ga0111539_10183957 Ga0111539_101839573 329
490 3300009147 Ga0114129_10000897 Ga0114129_1000089728 329
491 3300009147 Ga0114129_10050581 Ga0114129_100505814 329
492 3300009147 Ga0114129_10196820 Ga0114129_101968201 329
493 3300009147 Ga0114129_10322078 Ga0114129_103220782 329
494 3300009147 Ga0114129_10563868 Ga0114129_105638682 329
495 3300025917 Ga0207660_10250821 Ga0207660_102508211 329
496 3300025921 Ga0207652_10082558 Ga0207652_100825581 329
497 3300025922 Ga0207646_10022559 Ga0207646_100225597 329
498 3300025944 Ga0207661_10037496 Ga0207661_100374964 329
499 3300031548 Ga0307408_100218385 Ga0307408_1002183851 329
500 3300031727 Ga0316576_10004459 Ga0316576_100044598 329
501 3300031727 Ga0316576_10015660 Ga0316576_100156602 329
502 3300031728 Ga0316578_10018044 Ga0316578_100180442 329
503 3300033541 Ga0316596_1000192 Ga0316596_10001924 329
504 3300035691 Ga0373931_0042588 Ga0373931_0042588_1132_2136 329
505 3300036401 Ga0373937_0335299 Ga0373937_0335299_345_1349 329
506 3300039062 Ga0400483_110311 Ga0400483_110311_117_1124 329
507 3300039062 Ga0400483_224663 Ga0400483_224663_533_1537 329
508 3300039062 Ga0400483_235488 Ga0400483_235488_443_1450 329
509 3300039447 Ga0436361_0045516 Ga0436361_0045516_1284_2294 329
510 3300046537 Ga0495598_0000163 Ga0495598_0000163_7496_8509 329
511 3300048913 Ga0496110_0202503 Ga0496110_0202503_576_1589 329
512 3300049541 Ga0501325_000595 Ga0501325_000595_621_1655 329
513 3300050507 nmdc:mga05p37_2129_c1 nmdc:mga05p37_2129_c1_8786_9790 329
514 3300050507 nmdc:mga05p37_261673_c1 nmdc:mga05p37_261673_c1_872_1876 329
515 3300050507 nmdc:mga05p37_26696_c1 nmdc:mga05p37_26696_c1_1462_2463 329
516 3300050507 nmdc:mga05p37_334466_c1 nmdc:mga05p37_334466_c1_48_1052 329
517 3300050507 nmdc:mga05p37_38747_c1 nmdc:mga05p37_38747_c1_4173_5177 329
518 3300050507 nmdc:mga05p37_463780_c1 nmdc:mga05p37_463780_c1_272_1276 329
519 3300050510 nmdc:mga06r32_71716_c1 nmdc:mga06r32_71716_c1_1241_2245 329
520 3300050511 nmdc:mga08y16_133747_c1 nmdc:mga08y16_133747_c1_519_1523 329
521 3300050512 nmdc:mga0n895_11252_c1 nmdc:mga0n895_11252_c1_6773_7774 329
522 3300050512 nmdc:mga0n895_1213_c1 nmdc:mga0n895_1213_c1_6920_7924 329
523 3300050512 nmdc:mga0n895_282350_c1 nmdc:mga0n895_282350_c1_608_1612 329
524 3300050512 nmdc:mga0n895_47933_c1 nmdc:mga0n895_47933_c1_1478_2482 329
525 3300050512 nmdc:mga0n895_71242_c1 nmdc:mga0n895_71242_c1_2246_3250 329
526 3300050515 nmdc:mga0a205_123282_c1 nmdc:mga0a205_123282_c1_551_1552 329
527 3300050515 nmdc:mga0a205_23805_c1 nmdc:mga0a205_23805_c1_2215_3219 329
528 3300059647 Ga0587079_020187 Ga0587079_020187_19_1032 329
529 3300060346 Ga0587111_0014198 Ga0587111_0014198_183_1187 329
530 iso_pu_bacteria 2740891818 2740990488 329
531 3300005295 Ga0065707_10082720 Ga0065707_1008272015 330
532 3300005444 Ga0070694_100173158 Ga0070694_1001731581 330
533 3300005549 Ga0070704_100006043 Ga0070704_1000060435 330
534 3300013297 Ga0157378_10177282 Ga0157378_101772822 330
535 3300014969 Ga0157376_10216257 Ga0157376_102162572 330
536 3300025961 Ga0207712_10010203 Ga0207712_100102034 330
537 3300031665 Ga0316575_10056631 Ga0316575_100566312 330
538 3300032168 Ga0316593_10000043 Ga0316593_100000433 330
539 3300032168 Ga0316593_10030235 Ga0316593_100302351 330
540 3300033528 Ga0316588_1000859 Ga0316588_10008593 330
541 3300033529 Ga0316587_1008755 Ga0316587_10087551 330
542 3300033541 Ga0316596_1028802 Ga0316596_10288022 330
543 3300046543 Ga0495645_0091263 Ga0495645_0091263_533_1570 330
544 3300047318 Ga0495636_0001669 Ga0495636_0001669_2983_4002 330
545 3300050494 nmdc:mga06z11_91683_c1 nmdc:mga06z11_91683_c1_210_1295 330
546 3300004799 Ga0058863_11878586 Ga0058863_118785861 331
547 3300005356 Ga0070674_100064977 Ga0070674_1000649773 331
548 3300005458 Ga0070681_10046903 Ga0070681_100469032 331
549 3300005467 Ga0070706_100004471 Ga0070706_10000447114 331
550 3300005467 Ga0070706_100306085 Ga0070706_1003060851 331
551 3300005518 Ga0070699_100028609 Ga0070699_1000286097 331
552 3300005536 Ga0070697_100030323 Ga0070697_1000303236 331
553 3300007788 Ga0099795_10094504 Ga0099795_100945041 331
554 3300013100 Ga0157373_10006194 Ga0157373_100061942 331
555 3300013100 Ga0157373_10159379 Ga0157373_101593791 331
556 3300026118 Ga0207675_100481361 Ga0207675_1004813611 331
557 3300028800 Ga0265338_10122313 Ga0265338_101223131 331
558 3300032168 Ga0316593_10016904 Ga0316593_100169042 331
559 3300037853 Ga0436364_1158423 Ga0436364_1158423_4074_5117 331
560 3300038726 Ga0400490_17491 Ga0400490_17491_14243_15271 331
561 3300044673 Ga0453683_0001684 Ga0453683_0001684_13896_14912 331
562 3300044673 Ga0453683_0022862 Ga0453683_0022862_2373_3392 331
563 3300044712 Ga0453684_0000258 Ga0453684_0000258_213401_214417 331
564 3300044712 Ga0453684_0032203 Ga0453684_0032203_4663_5679 331
565 3300044712 Ga0453684_0559552 Ga0453684_0559552_226_1245 331
566 3300045051 Ga0451576_0003523 Ga0451576_0003523_11378_12394 331
567 3300045051 Ga0451576_0017930 Ga0451576_0017930_3802_4818 331
568 3300049568 Ga0501031_0179052 Ga0501031_0179052_262_1281 331
569 3300049824 Ga0501045_0142647 Ga0501045_0142647_352_1371 331
570 3300050512 nmdc:mga0n895_363905_c1 nmdc:mga0n895_363905_c1_24_1079 331
571 3300061734 Ga0530510_0015081 Ga0530510_0015081_3229_4248 331
572 3300005288 Ga0065714_10014037 Ga0065714_100140372 332
573 3300005843 Ga0068860_100025069 Ga0068860_1000250697 332
574 3300025922 Ga0207646_10453122 Ga0207646_104531222 332
575 3300028381 Ga0268264_10011525 Ga0268264_100115254 332
576 3300036401 Ga0373937_0401628 Ga0373937_0401628_218_1237 332
577 3300042876 Ga0451577_0000673 Ga0451577_0000673_47016_48023 332
578 3300042876 Ga0451577_0318977 Ga0451577_0318977_372_1379 332
579 3300044673 Ga0453683_0069681 Ga0453683_0069681_732_1739 332
580 3300044712 Ga0453684_0001155 Ga0453684_0001155_79730_80737 332
581 3300044712 Ga0453684_0001648 Ga0453684_0001648_45697_46704 332
582 3300044712 Ga0453684_0008030 Ga0453684_0008030_13901_14908 332
583 3300044712 Ga0453684_0576068 Ga0453684_0576068_37_1044 332
584 3300045051 Ga0451576_0001406 Ga0451576_0001406_13923_14930 332
585 3300045051 Ga0451576_0121722 Ga0451576_0121722_755_1762 332
586 3300045051 Ga0451576_0158623 Ga0451576_0158623_813_1820 332
587 3300046615 Ga0495656_0000068 Ga0495656_0000068_32455_33483 332
588 3300046664 Ga0495659_0007690 Ga0495659_0007690_1777_2805 332
589 3300049537 Ga0501321_000935 Ga0501321_000935_428_1441 332
590 3300049540 Ga0501324_000877 Ga0501324_000877_508_1521 332
591 3300049744 Ga0501083_0001752 Ga0501083_0001752_2860_3879 332
592 3300049744 Ga0501083_0063107 Ga0501083_0063107_420_1430 332
593 3300054114 Ga0501084_0030515 Ga0501084_0030515_1467_2486 332
594 3300054114 Ga0501084_0184882 Ga0501084_0184882_23_1033 332
595 3300059605 Ga0587106_001645 Ga0587106_001645_656_1669 332
596 3300060353 Ga0501082_0071015 Ga0501082_0071015_420_1439 332
597 3300002865 Ga0006761J43178_107884 Ga0006761J43178_1078842 333
598 3300003300 Ga0006758J48902_1011730 Ga0006758J48902_10117303 333
599 3300005355 Ga0070671_100098834 Ga0070671_1000988342 333
600 3300005367 Ga0070667_100264636 Ga0070667_1002646362 333
601 3300009094 Ga0111539_10011546 Ga0111539_1001154612 333
602 3300009101 Ga0105247_10001485 Ga0105247_1000148529 333
603 3300009553 Ga0105249_10014983 Ga0105249_1001498310 333
604 3300014968 Ga0157379_10000101 Ga0157379_1000010131 333
605 3300014969 Ga0157376_10242049 Ga0157376_102420491 333
606 3300025900 Ga0207710_10001280 Ga0207710_1000128021 333
607 3300025927 Ga0207687_10083793 Ga0207687_100837932 333
608 3300025931 Ga0207644_10397472 Ga0207644_103974721 333
609 3300035695 Ga0373927_0013572 Ga0373927_0013572_3039_4061 333
610 3300037068 Ga0373925_0019406 Ga0373925_0019406_3504_4526 333
611 3300038742 Ga0400486_05152 Ga0400486_05152_5130_6227 333
612 3300039450 Ga0436363_0759301 Ga0436363_0759301_100_1113 333
613 3300044673 Ga0453683_0030485 Ga0453683_0030485_291_1304 333
614 3300046472 Ga0495580_0002023 Ga0495580_0002023_2798_3820 333
615 3300049528 Ga0501312_000273 Ga0501312_000273_232_1251 333
616 3300049534 Ga0501318_000746 Ga0501318_000746_13_1026 333
617 3300049589 Ga0501073_0027134 Ga0501073_0027134_1739_2752 333
618 3300050493 nmdc:mga0k408_109309_c1 nmdc:mga0k408_109309_c1_111_1124 333
619 3300050493 nmdc:mga0k408_64134_c1 nmdc:mga0k408_64134_c1_337_1350 333
620 3300050511 nmdc:mga08y16_5631_c1 nmdc:mga08y16_5631_c1_3338_4351 333
621 3300059491 Ga0587070_013141 Ga0587070_013141_49_1086 333
622 3300059493 Ga0587077_000591 Ga0587077_000591_49_1086 333
623 3300059506 Ga0587085_001989 Ga0587085_001989_596_1633 333
624 3300059624 Ga0587109_005843 Ga0587109_005843_516_1553 333
625 3300059639 Ga0587062_000268 Ga0587062_000268_523_1560 333
626 3300059643 Ga0587072_000911 Ga0587072_000911_2305_3342 333
627 3300059660 Ga0587124_001632 Ga0587124_001632_169_1206 333
628 3300060346 Ga0587111_0010468 Ga0587111_0010468_370_1407 333
629 3300005289 Ga0065704_10070132 Ga0065704_100701321317 334
630 3300006846 Ga0075430_100019248 Ga0075430_1000192484 334
631 3300009094 Ga0111539_10335845 Ga0111539_103358452 334
632 3300028577 Ga0265318_10017893 Ga0265318_100178933 334
633 3300032168 Ga0316593_10000033 Ga0316593_1000003328 334
634 3300032168 Ga0316593_10013698 Ga0316593_100136983 334
635 3300035084 Ga0373928_0001523 Ga0373928_0001523_3156_4178 334
636 3300035398 Ga0316574_0009048 Ga0316574_0009048_2063_3085 334
637 3300038726 Ga0400490_30744 Ga0400490_30744_26247_27290 334
638 3300039093 Ga0400489_12624 Ga0400489_12624_8033_9046 334
639 3300039093 Ga0400489_92265 Ga0400489_92265_87_1130 334
640 3300042876 Ga0451577_0000328 Ga0451577_0000328_6940_7962 334
641 3300042876 Ga0451577_0042342 Ga0451577_0042342_1145_2167 334
642 3300042876 Ga0451577_0149506 Ga0451577_0149506_106_1128 334
643 3300044673 Ga0453683_0000219 Ga0453683_0000219_12146_13168 334
644 3300044673 Ga0453683_0003224 Ga0453683_0003224_62_1084 334
645 3300044673 Ga0453683_0004812 Ga0453683_0004812_1428_2450 334
646 3300044673 Ga0453683_0026024 Ga0453683_0026024_1948_2970 334
647 3300044673 Ga0453683_0062905 Ga0453683_0062905_606_1628 334
648 3300044673 Ga0453683_0065404 Ga0453683_0065404_139_1161 334
649 3300044712 Ga0453684_0000950 Ga0453684_0000950_13852_14874 334
650 3300044712 Ga0453684_0005988 Ga0453684_0005988_9166_10188 334
651 3300044712 Ga0453684_0007136 Ga0453684_0007136_13981_15021 334
652 3300044712 Ga0453684_0010045 Ga0453684_0010045_13238_14260 334
653 3300044712 Ga0453684_0015940 Ga0453684_0015940_1379_2401 334
654 3300044712 Ga0453684_0019047 Ga0453684_0019047_4912_5955 334
655 3300044712 Ga0453684_0024212 Ga0453684_0024212_5237_6259 334
656 3300044712 Ga0453684_0032059 Ga0453684_0032059_1665_2687 334
657 3300044712 Ga0453684_0037215 Ga0453684_0037215_2766_3788 334
658 3300044712 Ga0453684_0056552 Ga0453684_0056552_1822_2844 334
659 3300044712 Ga0453684_0099498 Ga0453684_0099498_864_1889 334
660 3300044712 Ga0453684_0100989 Ga0453684_0100989_165_1187 334
661 3300044712 Ga0453684_0124618 Ga0453684_0124618_702_1724 334
662 3300044712 Ga0453684_0222798 Ga0453684_0222798_1141_2163 334
663 3300044712 Ga0453684_0224980 Ga0453684_0224980_1059_2081 334
664 3300044712 Ga0453684_0608741 Ga0453684_0608741_101_1123 334
665 3300045051 Ga0451576_0000857 Ga0451576_0000857_45578_46600 334
666 3300045051 Ga0451576_0057309 Ga0451576_0057309_2921_3970 334
667 3300045051 Ga0451576_0093423 Ga0451576_0093423_1409_2431 334
668 3300045051 Ga0451576_0128597 Ga0451576_0128597_873_1895 334
669 3300050511 nmdc:mga08y16_269121_c1 nmdc:mga08y16_269121_c1_336_1346 334
670 3300059640 Ga0587067_010633 Ga0587067_010633_47_1072 334
671 3300003300 Ga0006758J48902_1013914 Ga0006758J48902_10139141 335
672 3300004800 Ga0058861_11958900 Ga0058861_119589002 335
673 3300005337 Ga0070682_100012980 Ga0070682_1000129803 335
674 3300005337 Ga0070682_100042827 Ga0070682_1000428271 335
675 3300005338 Ga0068868_100003470 Ga0068868_1000034708 335
676 3300005354 Ga0070675_100143314 Ga0070675_1001433142 335
677 3300005438 Ga0070701_10022405 Ga0070701_100224052 335
678 3300005444 Ga0070694_100109789 Ga0070694_1001097892 335
679 3300005459 Ga0068867_100134454 Ga0068867_1001344542 335
680 3300005466 Ga0070685_10011829 Ga0070685_100118292 335
681 3300005535 Ga0070684_100096952 Ga0070684_1000969521 335
682 3300005536 Ga0070697_100102678 Ga0070697_1001026783 335
683 3300005543 Ga0070672_100008647 Ga0070672_1000086471 335
684 3300005563 Ga0068855_100000266 Ga0068855_10000026622 335
685 3300005563 Ga0068855_100002209 Ga0068855_1000022098 335
686 3300005614 Ga0068856_100042559 Ga0068856_1000425595 335
687 3300005614 Ga0068856_100072572 Ga0068856_1000725723 335
688 3300005614 Ga0068856_100390801 Ga0068856_1003908012 335
689 3300005841 Ga0068863_100129008 Ga0068863_1001290083 335
690 3300005937 Ga0081455_10003850 Ga0081455_1000385034 335
691 3300006195 Ga0075366_10036607 Ga0075366_100366073 335
692 3300006195 Ga0075366_10042994 Ga0075366_100429944 335
693 3300006195 Ga0075366_10135357 Ga0075366_101353571 335
694 3300006195 Ga0075366_10152131 Ga0075366_101521311 335
695 3300006358 Ga0068871_100066595 Ga0068871_1000665953 335
696 3300006844 Ga0075428_100003062 Ga0075428_1000030623 335
697 3300006846 Ga0075430_100080488 Ga0075430_1000804883 335
698 3300006880 Ga0075429_100107344 Ga0075429_1001073442 335
699 3300007076 Ga0075435_100046934 Ga0075435_1000469342 335
700 3300007076 Ga0075435_100151668 Ga0075435_1001516682 335
701 3300009094 Ga0111539_10052091 Ga0111539_100520917 335
702 3300009098 Ga0105245_10002954 Ga0105245_100029545 335
703 3300009098 Ga0105245_10097109 Ga0105245_100971093 335
704 3300009174 Ga0105241_10003328 Ga0105241_1000332822 335
705 3300013296 Ga0157374_10208026 Ga0157374_102080262 335
706 3300013306 Ga0163162_10436298 Ga0163162_104362981 335
707 3300014326 Ga0157380_10137181 Ga0157380_101371812 335
708 3300014326 Ga0157380_10218877 Ga0157380_102188772 335
709 3300014969 Ga0157376_10085566 Ga0157376_100855661 335
710 3300025911 Ga0207654_10006799 Ga0207654_100067997 335
711 3300025921 Ga0207652_10198513 Ga0207652_101985132 335
712 3300025936 Ga0207670_10053084 Ga0207670_100530843 335
713 3300025940 Ga0207691_10006989 Ga0207691_100069898 335
714 3300025942 Ga0207689_10266807 Ga0207689_102668072 335
715 3300025944 Ga0207661_10169715 Ga0207661_101697152 335
716 3300025949 Ga0207667_10000612 Ga0207667_1000061223 335
717 3300025949 Ga0207667_10002028 Ga0207667_1000202821 335
718 3300026023 Ga0207677_10002394 Ga0207677_100023944 335
719 3300026023 Ga0207677_10047983 Ga0207677_100479833 335
720 3300026067 Ga0207678_10045328 Ga0207678_100453283 335
721 3300026078 Ga0207702_10161792 Ga0207702_101617921 335
722 3300026088 Ga0207641_10012614 Ga0207641_100126145 335
723 3300026088 Ga0207641_10037995 Ga0207641_100379953 335
724 3300026089 Ga0207648_10146903 Ga0207648_101469032 335
725 3300026118 Ga0207675_100009284 Ga0207675_1000092841 335
726 3300026121 Ga0207683_10036828 Ga0207683_100368283 335
727 3300026121 Ga0207683_10208672 Ga0207683_102086722 335
728 3300027907 Ga0207428_10092837 Ga0207428_100928372 335
729 3300028558 Ga0265326_10015554 Ga0265326_100155542 335
730 3300031247 Ga0265340_10001205 Ga0265340_100012056 335
731 3300031249 Ga0265339_10008732 Ga0265339_100087321 335
732 3300031616 Ga0307508_10136221 Ga0307508_101362213 335
733 3300031711 Ga0265314_10000003 Ga0265314_100000031199 335
734 3300031711 Ga0265314_10008394 Ga0265314_100083945 335
735 3300031727 Ga0316576_10009047 Ga0316576_100090476 335
736 3300031727 Ga0316576_10096795 Ga0316576_100967952 335
737 3300031730 Ga0307516_10009446 Ga0307516_100094468 335
738 3300031901 Ga0307406_10001312 Ga0307406_1000131224 335
739 3300031903 Ga0307407_10007128 Ga0307407_100071283 335
740 3300033179 Ga0307507_10102682 Ga0307507_101026822 335
741 3300035695 Ga0373927_0009335 Ga0373927_0009335_606_1646 335
742 3300035724 Ga0373933_0033257 Ga0373933_0033257_329_1354 335
743 3300036401 Ga0373937_0220335 Ga0373937_0220335_76_1101 335
744 3300037471 Ga0395905_0025893 Ga0395905_0025893_847_1869 335
745 3300039062 Ga0400483_053606 Ga0400483_053606_118_1155 335
746 3300041413 Ga0439465_0002430 Ga0439465_0002430_157_1212 335
747 3300041486 Ga0451807_0596507 Ga0451807_0596507_81_1106 335
748 3300041997 Ga0439431_0032614 Ga0439431_0032614_183_1238 335
749 3300042007 Ga0439449_0052713 Ga0439449_0052713_107_1147 335
750 3300044673 Ga0453683_0016045 Ga0453683_0016045_2025_3050 335
751 3300045051 Ga0451576_0185054 Ga0451576_0185054_12_1052 335
752 3300046461 Ga0495641_0092003 Ga0495641_0092003_118_1143 335
753 3300046675 Ga0495657_0089924 Ga0495657_0089924_906_1931 335
754 3300047322 Ga0495680_0042938 Ga0495680_0042938_2069_3094 335
755 3300049128 Ga0501308_000564 Ga0501308_000564_904_1968 335
756 3300049571 Ga0501034_0308716 Ga0501034_0308716_62_1084 335
757 3300049574 Ga0501038_0013339 Ga0501038_0013339_5509_6540 335
758 3300049579 Ga0501043_0065707 Ga0501043_0065707_1434_2465 335
759 3300049581 Ga0501047_0036151 Ga0501047_0036151_2125_3156 335
760 3300049581 Ga0501047_0093046 Ga0501047_0093046_82_1110 335
761 3300049583 Ga0501067_0030612 Ga0501067_0030612_908_1939 335
762 3300049584 Ga0501068_0000765 Ga0501068_0000765_12723_13754 335
763 3300049585 Ga0501069_0004501 Ga0501069_0004501_663_1694 335
764 3300049586 Ga0501070_0080026 Ga0501070_0080026_536_1567 335
765 3300049588 Ga0501072_0001660 Ga0501072_0001660_2848_3879 335
766 3300049589 Ga0501073_0007779 Ga0501073_0007779_1793_2818 335
767 3300049590 Ga0501074_0008028 Ga0501074_0008028_3788_4819 335
768 3300049592 Ga0501076_0034427 Ga0501076_0034427_59_1090 335
769 3300049593 Ga0501077_0014291 Ga0501077_0014291_1094_2125 335
770 3300049705 Ga0501225_0038760 Ga0501225_0038760_36_1076 335
771 3300049742 Ga0501080_0001538 Ga0501080_0001538_12839_13864 335
772 3300049742 Ga0501080_0047083 Ga0501080_0047083_2121_3149 335
773 3300049744 Ga0501083_0020876 Ga0501083_0020876_572_1597 335
774 3300050491 nmdc:mga00v17_82695_c1 nmdc:mga00v17_82695_c1_686_1711 335
775 3300050493 nmdc:mga0k408_161589_c1 nmdc:mga0k408_161589_c1_42_1067 335
776 3300050493 nmdc:mga0k408_17468_c1 nmdc:mga0k408_17468_c1_2203_3228 335
777 3300050493 nmdc:mga0k408_28046_c1 nmdc:mga0k408_28046_c1_915_1943 335
778 3300050493 nmdc:mga0k408_52152_c1 nmdc:mga0k408_52152_c1_32_1057 335
779 3300050509 nmdc:mga0qj67_93876_c1 nmdc:mga0qj67_93876_c1_677_1699 335
780 3300050513 nmdc:mga0rr50_102722_c1 nmdc:mga0rr50_102722_c1_1133_2230 335
781 3300050514 nmdc:mga08x19_17284_c1 nmdc:mga08x19_17284_c1_2450_3511 335
782 3300054114 Ga0501084_0000461 Ga0501084_0000461_6827_7852 335
783 3300054114 Ga0501084_0001929 Ga0501084_0001929_12724_13755 335
784 3300059424 Ga0590075_014278 Ga0590075_014278_642_1667 335
785 3300059505 Ga0587083_0013582 Ga0587083_0013582_221_1261 335
786 3300059624 Ga0587109_003978 Ga0587109_003978_654_1679 335
787 3300059639 Ga0587062_008936 Ga0587062_008936_146_1168 335
788 3300060346 Ga0587111_0000650 Ga0587111_0000650_2118_3143 335
789 3300060346 Ga0587111_0013621 Ga0587111_0013621_146_1168 335
790 3300060353 Ga0501082_0003347 Ga0501082_0003347_4793_5824 335
791 3300005364 Ga0070673_100160255 Ga0070673_1001602552 336
792 3300005445 Ga0070708_100221635 Ga0070708_1002216352 336
793 3300005518 Ga0070699_100000533 Ga0070699_1000005338 336
794 3300005536 Ga0070697_100230798 Ga0070697_1002307981 336
795 3300005536 Ga0070697_100365964 Ga0070697_1003659641 336
796 3300005549 Ga0070704_100093915 Ga0070704_1000939153 336
797 3300006871 Ga0075434_100158771 Ga0075434_1001587713 336
798 3300006914 Ga0075436_100015587 Ga0075436_1000155873 336
799 3300009094 Ga0111539_10001407 Ga0111539_1000140734 336
800 3300009147 Ga0114129_10214328 Ga0114129_102143283 336
801 3300025960 Ga0207651_10109090 Ga0207651_101090902 336
802 3300026088 Ga0207641_10538184 Ga0207641_105381841 336
803 3300027907 Ga0207428_10003685 Ga0207428_100036856 336
804 3300028800 Ga0265338_10071588 Ga0265338_100715881 336
805 3300032168 Ga0316593_10058520 Ga0316593_100585202 336
806 3300033541 Ga0316596_1002498 Ga0316596_10024983 336
807 3300033541 Ga0316596_1002889 Ga0316596_10028895 336
808 3300035111 Ga0373923_0027981 Ga0373923_0027981_443_1507 336
809 3300035117 Ga0373953_0038745 Ga0373953_0038745_454_1518 336
810 3300035170 Ga0373943_0007539 Ga0373943_0007539_3155_4219 336
811 3300035172 Ga0373955_0044848 Ga0373955_0044848_559_1623 336
812 3300035172 Ga0373955_0086650 Ga0373955_0086650_394_1458 336
813 3300035410 Ga0373924_0014264 Ga0373924_0014264_652_1716 336
814 3300035692 Ga0373935_0018318 Ga0373935_0018318_2508_3572 336
815 3300035695 Ga0373927_0037681 Ga0373927_0037681_131_1195 336
816 3300035695 Ga0373927_0041314 Ga0373927_0041314_491_1555 336
817 3300035724 Ga0373933_0003225 Ga0373933_0003225_7065_8129 336
818 3300035725 Ga0373947_0063275 Ga0373947_0063275_1018_2082 336
819 3300036401 Ga0373937_0003223 Ga0373937_0003223_7820_8884 336
820 3300042876 Ga0451577_0030969 Ga0451577_0030969_535_1575 336
821 3300044673 Ga0453683_0073074 Ga0453683_0073074_1063_2100 336
822 3300044712 Ga0453684_0012911 Ga0453684_0012911_8190_9236 336
823 3300044712 Ga0453684_0345203 Ga0453684_0345203_540_1565 336
824 3300045051 Ga0451576_0004083 Ga0451576_0004083_7647_8672 336
825 3300045051 Ga0451576_0632188 Ga0451576_0632188_16_1080 336
826 3300046472 Ga0495580_0028001 Ga0495580_0028001_2602_3666 336
827 3300050507 nmdc:mga05p37_189485_c1 nmdc:mga05p37_189485_c1_793_1857 336
828 3300050511 nmdc:mga08y16_6706_c1 nmdc:mga08y16_6706_c1_6748_7812 336
829 3300050512 nmdc:mga0n895_18871_c2 nmdc:mga0n895_18871_c2_2157_3221 336
830 3300050514 nmdc:mga08x19_120635_c1 nmdc:mga08x19_120635_c1_366_1430 336
831 3300050514 nmdc:mga08x19_29031_c1 nmdc:mga08x19_29031_c1_1226_2290 336
832 3300050515 nmdc:mga0a205_80328_c1 nmdc:mga0a205_80328_c1_1921_2985 336
833 3300053085 Ga0495619_0024118 Ga0495619_0024118_1537_2601 336
834 3300059623 Ga0587101_002160 Ga0587101_002160_199_1245 336
835 3300007265 Ga0099794_10007466 Ga0099794_100074662 337
836 3300044712 Ga0453684_0163203 Ga0453684_0163203_1482_2579 337
837 3300028800 Ga0265338_10000401 Ga0265338_1000040167 338
838 3300033524 Ga0316592_1002103 Ga0316592_10021032 338
839 3300033528 Ga0316588_1013472 Ga0316588_10134722 338
840 3300037471 Ga0395905_0000127 Ga0395905_0000127_42581_43675 338
841 iso_pu_bacteria 8015556637 8015559925 339
842 3300013100 Ga0157373_10091870 Ga0157373_100918702 342
843 3300013307 Ga0157372_10243242 Ga0157372_102432422 342
844 3300037418 Ga0395900_0030792 Ga0395900_0030792_973_2001 342
845 3300037471 Ga0395905_0000275 Ga0395905_0000275_41832_42860 342
846 3300037471 Ga0395905_0123004 Ga0395905_0123004_869_1897 342
847 3300039447 Ga0436361_1081198 Ga0436361_1081198_169_1197 342
848 3300048905 Ga0496102_0158392 Ga0496102_0158392_506_1534 342
849 3300049571 Ga0501034_0334346 Ga0501034_0334346_310_1338 342
850 3300005614 Ga0068856_100014349 Ga0068856_1000143495 343
851 3300026078 Ga0207702_10001471 Ga0207702_100014715 343
852 3300037471 Ga0395905_0091046 Ga0395905_0091046_93_1130 343
853 3300046615 Ga0495656_0000397 Ga0495656_0000397_13316_14347 343
854 3300047318 Ga0495636_0024284 Ga0495636_0024284_443_1474 343
855 3300048090 Ga0495615_0002512 Ga0495615_0002512_1439_2470 343
856 3300048913 Ga0496110_0000091 Ga0496110_0000091_23525_24556 343
857 3300048913 Ga0496110_0001249 Ga0496110_0001249_6480_7511 343
858 3300048927 Ga0496124_0000001 Ga0496124_0000001_90714_91745 343
859 3300048929 Ga0496126_0136628 Ga0496126_0136628_88_1119 343
860 3300005457 Ga0070662_100139019 Ga0070662_1001390191 344
861 3300013102 Ga0157371_10009169 Ga0157371_100091698 344
862 2162886007 SwRhRL2b_contig_1759361 SwRhRL2b_0440.00005890 345
863 3300010375 Ga0105239_10010781 Ga0105239_100107815 345
864 3300049569 Ga0501032_0000374 Ga0501032_0000374_33441_34517 345
865 3300049571 Ga0501034_0038041 Ga0501034_0038041_480_1634 345
866 3300049571 Ga0501034_0063128 Ga0501034_0063128_344_1420 345
867 3300049572 Ga0501036_0157822 Ga0501036_0157822_457_1533 345
868 3300049573 Ga0501037_0000862 Ga0501037_0000862_20075_21151 345
869 3300049574 Ga0501038_0063475 Ga0501038_0063475_1549_2625 345
870 3300049574 Ga0501038_0123879 Ga0501038_0123879_24_1100 345
871 3300049579 Ga0501043_0002448 Ga0501043_0002448_2229_3305 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01193

RNA_pol_L

RNA polymerase Rpb3/Rpb11 dimerisation domain

88

283

0.99

PF01000

RNA_pol_A_bac

RNA polymerase Rpb3/RpoA insert domain

118

233

0.96

PF03118

RNA_pol_A_CTD

Bacterial RNA polymerase, alpha chain C terminal domain

302

367

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x76-assembly1.cif.gz_S cryo-em structure of streptomyces coelicolor rnap-promoter open complex with two zur dimers 0.9868 260 313
1z3e-assembly1.cif.gz_B crystal structure of spx in complex with the c-terminal domain of the rna polymerase alpha subunit 0.9757 256 318
1lb2-assembly1.cif.gz_E-2 structure of the e. coli alpha c-terminal domain of rna polymerase in complex with cap and dna 0.9681 256 319
3ihq-assembly1.cif.gz_B crystal structure of reduced c10s spx in complex with the alpha c-terminal domain of rna polymeras 0.9596 256 318
1lb2-assembly1.cif.gz_B-2 structure of the e. coli alpha c-terminal domain of rna polymerase in complex with cap and dna 0.955 255 325
ID Description Score Start End Superfamily
1z3eB00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9757 256 318 1.10.150.20
1lb2E00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9681 256 319 1.10.150.20
3n4mC00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9626 256 326 1.10.150.20
3ihqB00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9596 256 318 1.10.150.20
3n97C00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9528 255 327 1.10.150.20
ID Description Score Start End GO Terms
AF-X1R3B3-F1-model_v4 DNA-directed RNA polymerase insert domain-containing protein 0.9936 82 152 GO:0003899
GO:0006351
GO:0046983
AF-A0A645H4F2-F1-model_v4 DNA-directed RNA polymerase subunit alpha (EC 2.7.7.6) 0.9798 254 321 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001065
GO:0001066
GO:0003677
AF-S5REI7-F1-model_v4 DNA-dependent RNA polymerase alpha subunit 0.9655 50 162 GO:0003899
GO:0006351
GO:0046983
AF-A0A1B6E1Z9-F1-model_v4 DNA-directed RNA polymerase RpoA/D/Rpb3-type domain-containing protein 0.9655 35 154 GO:0000428
GO:0003899
GO:0006351
GO:0046983
AF-A0A2S6W9P1-F1-model_v4 DNA-directed RNA polymerase subunit alpha 0.9637 29 232 GO:0000428
GO:0003677
GO:0003899
GO:0006351
GO:0046983

Feature Viewer

pLDDT pTM Quality
86.9 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map