F484191
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 336 | 869 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300033179|Ga0307507_10102682|Ga0307507_101026822 |
| Length | 393 |
| Sequence | MVRPRLVSQVGPIARSRYEQNNGQVTGFAEERVPERTEITALNGSQPGRTAKNMSTVITRNWRDLIRPRGIQIESETLTDFYGKFSCEPLERGYGITIGNSLRRVLLSSLQGAAITAIRIDGALHEFTTISDVVEDVTXXXLNLKEVVLKAATPKTYTVRLDKEGPGPVYARDIQLVDGLQVLNPDHLIATLDKKGPLSMELTVNVGRGYVPAEKNKTATMPIGTIPIDALFSPTRKVNYTVTNARVGQATDYDKLALEVWTNGSVKPQDAVAYAAKILKEQLSIFINFEETEETAYQAPGGEDEPLNENLFRSVDELELSVRSANCLQNANITLIGELVQRTEQDMLKTKNFGRKSLKEIKEILANMGLSLGMKIDNWPQMLERWKAQQAQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 3 | 3300002865 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003504 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM | Metagenome | Rhizosphere |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 140 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 147 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 156 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 160 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 170 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 172 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 192 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 199 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 200 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 201 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 202 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 203 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 204 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 207 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 208 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 210 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 211 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 212 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 213 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 305 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 306 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 320 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 336 | 8015556637 | Bdellovibrio reynosensis LBG001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.77 |
| Metatranscriptomes | 7 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.61 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 94.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1759361 | 2162886007 | Bacteria | 232727 |
| 2 | Ga0006761J43178_107884 | 3300002865 | Bacteria | 1623 |
| 3 | Ga0006758J48902_1011730 | 3300003300 | Bacteria | 2534 |
| 4 | Ga0006758J48902_1013914 | 3300003300 | Bacteria | 1154 |
| 5 | JGI26138J51218_100829 | 3300003504 | Bacteria | 1162 |
| 6 | Ga0058863_10079010 | 3300004799 | Bacteria | 4423 |
| 7 | Ga0058863_11799350 | 3300004799 | Bacteria | 1957 |
| 8 | Ga0058863_11878586 | 3300004799 | Bacteria | 1602 |
| 9 | Ga0058861_11958900 | 3300004800 | Bacteria | 1611 |
| 10 | Ga0058861_11963644 | 3300004800 | Bacteria | 2959 |
| 11 | Ga0058860_12161439 | 3300004801 | Bacteria | 5444 |
| 12 | Ga0058862_12711381 | 3300004803 | Bacteria | 2101 |
| 13 | Ga0065714_10014037 | 3300005288 | Bacteria | 2186 |
| 14 | Ga0065704_10070132 | 3300005289 | Bacteria | 1955461 |
| 15 | Ga0065715_10104520 | 3300005293 | Bacteria | 2956 |
| 16 | Ga0065715_10122190 | 3300005293 | Bacteria | 2211 |
| 17 | Ga0065715_10226073 | 3300005293 | Bacteria | 1252 |
| 18 | Ga0065707_10082720 | 3300005295 | Bacteria | 12520 |
| 19 | Ga0070683_100107294 | 3300005329 | Bacteria | 2633 |
| 20 | Ga0070690_100000832 | 3300005330 | Bacteria | 15648 |
| 21 | Ga0070690_100107616 | 3300005330 | Bacteria | 1856 |
| 22 | Ga0070670_100001731 | 3300005331 | Bacteria | 17782 |
| 23 | Ga0070670_100014297 | 3300005331 | Bacteria | 6810 |
| 24 | Ga0070666_10004312 | 3300005335 | Bacteria | 8656 |
| 25 | Ga0070666_10010358 | 3300005335 | Bacteria | 5830 |
| 26 | Ga0070682_100012980 | 3300005337 | Bacteria | 4782 |
| 27 | Ga0070682_100042827 | 3300005337 | Bacteria | 2797 |
| 28 | Ga0068868_100003470 | 3300005338 | Bacteria | 10983 |
| 29 | Ga0068868_100023242 | 3300005338 | Bacteria | 4690 |
| 30 | Ga0068868_100334682 | 3300005338 | Bacteria | 1293 |
| 31 | Ga0070689_100074153 | 3300005340 | Bacteria | 2662 |
| 32 | Ga0070689_100075687 | 3300005340 | Bacteria | 2636 |
| 33 | Ga0070661_100059685 | 3300005344 | Unclassified | 2798 |
| 34 | Ga0070675_100000102 | 3300005354 | Bacteria | 50103 |
| 35 | Ga0070675_100002074 | 3300005354 | Bacteria | 14841 |
| 36 | Ga0070675_100008285 | 3300005354 | Bacteria | 8064 |
| 37 | Ga0070675_100102461 | 3300005354 | Unclassified | 2412 |
| 38 | Ga0070675_100112715 | 3300005354 | Bacteria | 2303 |
| 39 | Ga0070675_100143314 | 3300005354 | Bacteria | 2044 |
| 40 | Ga0070671_100001915 | 3300005355 | Bacteria | 15937 |
| 41 | Ga0070671_100016587 | 3300005355 | Bacteria | 5955 |
| 42 | Ga0070671_100031304 | 3300005355 | Bacteria | 4394 |
| 43 | Ga0070671_100098834 | 3300005355 | Bacteria | 2448 |
| 44 | Ga0070674_100064977 | 3300005356 | Bacteria | 2559 |
| 45 | Ga0070674_100091897 | 3300005356 | Bacteria | 2193 |
| 46 | Ga0070673_100002597 | 3300005364 | Bacteria | 11037 |
| 47 | Ga0070673_100007622 | 3300005364 | Bacteria | 7162 |
| 48 | Ga0070673_100160255 | 3300005364 | Bacteria | 1913 |
| 49 | Ga0070688_100038207 | 3300005365 | Bacteria | 2930 |
| 50 | Ga0070688_100051462 | 3300005365 | Bacteria | 2570 |
| 51 | Ga0070688_100133628 | 3300005365 | Bacteria | 1677 |
| 52 | Ga0070688_100174410 | 3300005365 | Bacteria | 1486 |
| 53 | Ga0070659_100224456 | 3300005366 | Bacteria | 1551 |
| 54 | Ga0070667_100002116 | 3300005367 | Bacteria | 17503 |
| 55 | Ga0070667_100020021 | 3300005367 | Bacteria | 5554 |
| 56 | Ga0070667_100022644 | 3300005367 | Bacteria | 5210 |
| 57 | Ga0070667_100264636 | 3300005367 | Bacteria | 1540 |
| 58 | Ga0070701_10022405 | 3300005438 | Bacteria | 3028 |
| 59 | Ga0070701_10057367 | 3300005438 | Bacteria | 2041 |
| 60 | Ga0070705_100123889 | 3300005440 | Bacteria | 1674 |
| 61 | Ga0070694_100001928 | 3300005444 | Bacteria | 12291 |
| 62 | Ga0070694_100109789 | 3300005444 | Bacteria | 1964 |
| 63 | Ga0070694_100173158 | 3300005444 | Bacteria | 1591 |
| 64 | Ga0070694_100264950 | 3300005444 | Bacteria | 1305 |
| 65 | Ga0070708_100090460 | 3300005445 | Bacteria | 2786 |
| 66 | Ga0070708_100221635 | 3300005445 | Bacteria | 1774 |
| 67 | Ga0070662_100139019 | 3300005457 | Bacteria | 1880 |
| 68 | Ga0070681_10046903 | 3300005458 | Bacteria | 4319 |
| 69 | Ga0070681_10401337 | 3300005458 | Bacteria | 1282 |
| 70 | Ga0068867_100134454 | 3300005459 | Bacteria | 1926 |
| 71 | Ga0070685_10011829 | 3300005466 | Bacteria | 4576 |
| 72 | Ga0070685_10029887 | 3300005466 | Bacteria | 3031 |
| 73 | Ga0070685_10221497 | 3300005466 | Bacteria | 1240 |
| 74 | Ga0070706_100004471 | 3300005467 | Bacteria | 13486 |
| 75 | Ga0070706_100306085 | 3300005467 | Bacteria | 1482 |
| 76 | Ga0070707_100031674 | 3300005468 | Bacteria | 5038 |
| 77 | Ga0070698_100043375 | 3300005471 | Bacteria | 4611 |
| 78 | Ga0070699_100000533 | 3300005518 | Bacteria | 36015 |
| 79 | Ga0070699_100028609 | 3300005518 | Bacteria | 4805 |
| 80 | Ga0070684_100096952 | 3300005535 | Bacteria | 2629 |
| 81 | Ga0070697_100001607 | 3300005536 | Bacteria | 17220 |
| 82 | Ga0070697_100030323 | 3300005536 | Bacteria | 4344 |
| 83 | Ga0070697_100102678 | 3300005536 | Bacteria | 2376 |
| 84 | Ga0070697_100230798 | 3300005536 | Bacteria | 1579 |
| 85 | Ga0070697_100365964 | 3300005536 | Bacteria | 1247 |
| 86 | Ga0070672_100006620 | 3300005543 | Bacteria | 7802 |
| 87 | Ga0070672_100008647 | 3300005543 | Bacteria | 6977 |
| 88 | Ga0070672_100213444 | 3300005543 | Bacteria | 1617 |
| 89 | Ga0070686_100086509 | 3300005544 | Bacteria | 2087 |
| 90 | Ga0070686_100156464 | 3300005544 | Bacteria | 1601 |
| 91 | Ga0070695_100054427 | 3300005545 | Bacteria | 2575 |
| 92 | Ga0070696_100062684 | 3300005546 | Bacteria | 2603 |
| 93 | Ga0070696_100064748 | 3300005546 | Bacteria | 2562 |
| 94 | Ga0070704_100006043 | 3300005549 | Bacteria | 7100 |
| 95 | Ga0070704_100033596 | 3300005549 | Bacteria | 3470 |
| 96 | Ga0070704_100093915 | 3300005549 | Bacteria | 2243 |
| 97 | Ga0070704_100170614 | 3300005549 | Bacteria | 1730 |
| 98 | Ga0068855_100000266 | 3300005563 | Bacteria | 65127 |
| 99 | Ga0068855_100002209 | 3300005563 | Bacteria | 24080 |
| 100 | Ga0068855_100125423 | 3300005563 | Bacteria | 2936 |
| 101 | Ga0070664_100002539 | 3300005564 | Bacteria | 14721 |
| 102 | Ga0070664_100005021 | 3300005564 | Bacteria | 10602 |
| 103 | Ga0068857_100236856 | 3300005577 | Bacteria | 1670 |
| 104 | Ga0068856_100014349 | 3300005614 | Bacteria | 7659 |
| 105 | Ga0068856_100042559 | 3300005614 | Bacteria | 4468 |
| 106 | Ga0068856_100072572 | 3300005614 | Bacteria | 3408 |
| 107 | Ga0068856_100323434 | 3300005614 | Bacteria | 1560 |
| 108 | Ga0068856_100390801 | 3300005614 | Bacteria | 1411 |
| 109 | Ga0068859_100000703 | 3300005617 | Bacteria | 33591 |
| 110 | Ga0068859_100006716 | 3300005617 | Bacteria | 11688 |
| 111 | Ga0068859_100051052 | 3300005617 | Bacteria | 4156 |
| 112 | Ga0068859_100064970 | 3300005617 | Bacteria | 3683 |
| 113 | Ga0068859_100151351 | 3300005617 | Bacteria | 2396 |
| 114 | Ga0068859_100219325 | 3300005617 | Bacteria | 1989 |
| 115 | Ga0068864_100006004 | 3300005618 | Bacteria | 9969 |
| 116 | Ga0068864_100133292 | 3300005618 | Bacteria | 2234 |
| 117 | Ga0068864_100335858 | 3300005618 | Bacteria | 1423 |
| 118 | Ga0068864_100469165 | 3300005618 | Bacteria | 1206 |
| 119 | Ga0068861_100031668 | 3300005719 | Bacteria | 3887 |
| 120 | Ga0068863_100000422 | 3300005841 | Bacteria | 42939 |
| 121 | Ga0068863_100129008 | 3300005841 | Bacteria | 2413 |
| 122 | Ga0068863_100391856 | 3300005841 | Bacteria | 1357 |
| 123 | Ga0068858_100062457 | 3300005842 | Bacteria | 3444 |
| 124 | Ga0068858_100125149 | 3300005842 | Bacteria | 2406 |
| 125 | Ga0068858_100125452 | 3300005842 | Bacteria | 2403 |
| 126 | Ga0068858_100499190 | 3300005842 | Bacteria | 1175 |
| 127 | Ga0068858_100563358 | 3300005842 | Bacteria | 1103 |
| 128 | Ga0068860_100012322 | 3300005843 | Bacteria | 8424 |
| 129 | Ga0068860_100025069 | 3300005843 | Bacteria | 5756 |
| 130 | Ga0081455_10003850 | 3300005937 | Bacteria | 17117 |
| 131 | Ga0081538_10001299 | 3300005981 | Bacteria | 25836 |
| 132 | Ga0081538_10019881 | 3300005981 | Unclassified | 4967 |
| 133 | Ga0075366_10036607 | 3300006195 | Bacteria | 2894 |
| 134 | Ga0075366_10042994 | 3300006195 | Bacteria | 2676 |
| 135 | Ga0075366_10135357 | 3300006195 | Bacteria | 1488 |
| 136 | Ga0075366_10152131 | 3300006195 | Bacteria | 1401 |
| 137 | Ga0097621_100015996 | 3300006237 | Bacteria | 5657 |
| 138 | Ga0097621_100025188 | 3300006237 | Bacteria | 4652 |
| 139 | Ga0097621_100133656 | 3300006237 | Bacteria | 2114 |
| 140 | Ga0097621_100202538 | 3300006237 | Bacteria | 1724 |
| 141 | Ga0097621_100361951 | 3300006237 | Bacteria | 1292 |
| 142 | Ga0068871_100066595 | 3300006358 | Bacteria | 2953 |
| 143 | Ga0068871_100092633 | 3300006358 | Bacteria | 2520 |
| 144 | Ga0068871_100123853 | 3300006358 | Bacteria | 2186 |
| 145 | Ga0068871_100241985 | 3300006358 | Bacteria | 1569 |
| 146 | Ga0068871_100276296 | 3300006358 | Bacteria | 1468 |
| 147 | Ga0068871_100308677 | 3300006358 | Bacteria | 1390 |
| 148 | Ga0075428_100000542 | 3300006844 | Bacteria | 38572 |
| 149 | Ga0075428_100003062 | 3300006844 | Bacteria | 18244 |
| 150 | Ga0075428_100032985 | 3300006844 | Bacteria | 5717 |
| 151 | Ga0075428_100041729 | 3300006844 | Bacteria | 5043 |
| 152 | Ga0075428_100072820 | 3300006844 | Bacteria | 3752 |
| 153 | Ga0075428_100236114 | 3300006844 | Unclassified | 1973 |
| 154 | Ga0075428_100456962 | 3300006844 | Bacteria | 1368 |
| 155 | Ga0075430_100005705 | 3300006846 | Bacteria | 10502 |
| 156 | Ga0075430_100019248 | 3300006846 | Bacteria | 5804 |
| 157 | Ga0075430_100042805 | 3300006846 | Bacteria | 3829 |
| 158 | Ga0075430_100075246 | 3300006846 | Bacteria | 2831 |
| 159 | Ga0075430_100080488 | 3300006846 | Bacteria | 2729 |
| 160 | Ga0075431_100042817 | 3300006847 | Bacteria | 4670 |
| 161 | Ga0075431_100042954 | 3300006847 | Bacteria | 4664 |
| 162 | Ga0075431_100139791 | 3300006847 | Bacteria | 2496 |
| 163 | Ga0075431_100306563 | 3300006847 | Bacteria | 1603 |
| 164 | Ga0075433_10008964 | 3300006852 | Bacteria | 7988 |
| 165 | Ga0075433_10132392 | 3300006852 | Bacteria | 2215 |
| 166 | Ga0075433_10371159 | 3300006852 | Bacteria | 1263 |
| 167 | Ga0075434_100005032 | 3300006871 | Bacteria | 12002 |
| 168 | Ga0075434_100029963 | 3300006871 | Bacteria | 5357 |
| 169 | Ga0075434_100049382 | 3300006871 | Bacteria | 4178 |
| 170 | Ga0075434_100158771 | 3300006871 | Bacteria | 2281 |
| 171 | Ga0075434_100184395 | 3300006871 | Bacteria | 2107 |
| 172 | Ga0075434_100582823 | 3300006871 | Bacteria | 1138 |
| 173 | Ga0075429_100107344 | 3300006880 | Bacteria | 2440 |
| 174 | Ga0075436_100015587 | 3300006914 | Bacteria | 5204 |
| 175 | Ga0097620_100000703 | 3300006931 | Bacteria | 33591 |
| 176 | Ga0097620_100006716 | 3300006931 | Bacteria | 11688 |
| 177 | Ga0097620_100051049 | 3300006931 | Bacteria | 4156 |
| 178 | Ga0097620_100064970 | 3300006931 | Bacteria | 3683 |
| 179 | Ga0097620_100151350 | 3300006931 | Bacteria | 2396 |
| 180 | Ga0097620_100219325 | 3300006931 | Bacteria | 1989 |
| 181 | Ga0075435_100017305 | 3300007076 | Bacteria | 5454 |
| 182 | Ga0075435_100046934 | 3300007076 | Bacteria | 3467 |
| 183 | Ga0075435_100151668 | 3300007076 | Bacteria | 1949 |
| 184 | Ga0075435_100182241 | 3300007076 | Bacteria | 1775 |
| 185 | Ga0099794_10007466 | 3300007265 | Bacteria | 4495 |
| 186 | Ga0099795_10094504 | 3300007788 | Bacteria | 1164 |
| 187 | Ga0111539_10001407 | 3300009094 | Bacteria | 32019 |
| 188 | Ga0111539_10011546 | 3300009094 | Bacteria | 11084 |
| 189 | Ga0111539_10011746 | 3300009094 | Bacteria | 10987 |
| 190 | Ga0111539_10014963 | 3300009094 | Bacteria | 9671 |
| 191 | Ga0111539_10019680 | 3300009094 | Bacteria | 8326 |
| 192 | Ga0111539_10052091 | 3300009094 | Bacteria | 4873 |
| 193 | Ga0111539_10055434 | 3300009094 | Bacteria | 4712 |
| 194 | Ga0111539_10121685 | 3300009094 | Bacteria | 3058 |
| 195 | Ga0111539_10183957 | 3300009094 | Bacteria | 2440 |
| 196 | Ga0111539_10199637 | 3300009094 | Bacteria | 2332 |
| 197 | Ga0111539_10335845 | 3300009094 | Archaea | 1759 |
| 198 | Ga0105245_10002954 | 3300009098 | Bacteria | 15251 |
| 199 | Ga0105245_10097109 | 3300009098 | Bacteria | 2720 |
| 200 | Ga0105247_10001485 | 3300009101 | Bacteria | 16868 |
| 201 | Ga0114129_10000092 | 3300009147 | Bacteria | 86019 |
| 202 | Ga0114129_10000897 | 3300009147 | Bacteria | 38727 |
| 203 | Ga0114129_10028222 | 3300009147 | Bacteria | 7951 |
| 204 | Ga0114129_10050581 | 3300009147 | Bacteria | 5837 |
| 205 | Ga0114129_10196820 | 3300009147 | Bacteria | 2732 |
| 206 | Ga0114129_10214328 | 3300009147 | Bacteria | 2601 |
| 207 | Ga0114129_10322078 | 3300009147 | Bacteria | 2055 |
| 208 | Ga0114129_10563868 | 3300009147 | Bacteria | 1479 |
| 209 | Ga0105241_10003328 | 3300009174 | Bacteria | 11959 |
| 210 | Ga0105242_10035707 | 3300009176 | Bacteria | 3986 |
| 211 | Ga0105242_10248563 | 3300009176 | Bacteria | 1602 |
| 212 | Ga0105242_10279018 | 3300009176 | Bacteria | 1517 |
| 213 | Ga0105248_10000244 | 3300009177 | Bacteria | 62961 |
| 214 | Ga0105248_10053602 | 3300009177 | Bacteria | 4525 |
| 215 | Ga0105248_10116700 | 3300009177 | Bacteria | 3010 |
| 216 | Ga0105249_10014983 | 3300009553 | Bacteria | 6857 |
| 217 | Ga0105249_10053243 | 3300009553 | Unclassified | 3699 |
| 218 | Ga0105239_10010781 | 3300010375 | Bacteria | 10211 |
| 219 | Ga0105246_10066760 | 3300011119 | Unclassified | 2519 |
| 220 | Ga0157373_10006194 | 3300013100 | Bacteria | 8939 |
| 221 | Ga0157373_10091870 | 3300013100 | Bacteria | 2137 |
| 222 | Ga0157373_10159379 | 3300013100 | Bacteria | 1588 |
| 223 | Ga0157371_10009169 | 3300013102 | Bacteria | 7813 |
| 224 | Ga0157370_10509273 | 3300013104 | Bacteria | 1105 |
| 225 | Ga0157374_10208026 | 3300013296 | Bacteria | 1918 |
| 226 | Ga0157374_10345580 | 3300013296 | Unclassified | 1477 |
| 227 | Ga0157378_10050923 | 3300013297 | Unclassified | 3685 |
| 228 | Ga0157378_10177282 | 3300013297 | Bacteria | 2003 |
| 229 | Ga0163162_10000450 | 3300013306 | Bacteria | 38095 |
| 230 | Ga0163162_10007110 | 3300013306 | Bacteria | 10860 |
| 231 | Ga0163162_10175321 | 3300013306 | Bacteria | 2269 |
| 232 | Ga0163162_10177705 | 3300013306 | Bacteria | 2254 |
| 233 | Ga0163162_10436298 | 3300013306 | Bacteria | 1442 |
| 234 | Ga0163162_10747883 | 3300013306 | Bacteria | 1097 |
| 235 | Ga0157372_10243242 | 3300013307 | Bacteria | 2088 |
| 236 | Ga0157375_10000216 | 3300013308 | Bacteria | 53883 |
| 237 | Ga0157375_10000704 | 3300013308 | Bacteria | 29517 |
| 238 | Ga0157375_10713343 | 3300013308 | Bacteria | 1156 |
| 239 | Ga0163163_10021966 | 3300014325 | Bacteria | 6032 |
| 240 | Ga0163163_10037938 | 3300014325 | Bacteria | 4691 |
| 241 | Ga0157380_10063989 | 3300014326 | Bacteria | 2951 |
| 242 | Ga0157380_10137181 | 3300014326 | Bacteria | 2096 |
| 243 | Ga0157380_10140719 | 3300014326 | Bacteria | 2073 |
| 244 | Ga0157380_10218877 | 3300014326 | Bacteria | 1702 |
| 245 | Ga0157377_10054382 | 3300014745 | Bacteria | 2266 |
| 246 | Ga0157379_10000091 | 3300014968 | Bacteria | 61113 |
| 247 | Ga0157379_10000101 | 3300014968 | Bacteria | 58702 |
| 248 | Ga0157379_10232120 | 3300014968 | Bacteria | 1672 |
| 249 | Ga0157376_10085566 | 3300014969 | Bacteria | 2717 |
| 250 | Ga0157376_10216257 | 3300014969 | Bacteria | 1772 |
| 251 | Ga0157376_10242049 | 3300014969 | Bacteria | 1681 |
| 252 | Ga0163161_10022185 | 3300017792 | Bacteria | 4468 |
| 253 | Ga0207710_10001280 | 3300025900 | Bacteria | 12698 |
| 254 | Ga0207680_10002543 | 3300025903 | Bacteria | 8506 |
| 255 | Ga0207645_10234951 | 3300025907 | Bacteria | 1210 |
| 256 | Ga0207654_10006799 | 3300025911 | Bacteria | 5752 |
| 257 | Ga0207707_10204286 | 3300025912 | Bacteria | 1722 |
| 258 | Ga0207660_10250821 | 3300025917 | Bacteria | 1397 |
| 259 | Ga0207649_10055401 | 3300025920 | Bacteria | 2471 |
| 260 | Ga0207652_10082558 | 3300025921 | Bacteria | 2812 |
| 261 | Ga0207652_10198513 | 3300025921 | Bacteria | 1805 |
| 262 | Ga0207646_10022559 | 3300025922 | Bacteria | 5797 |
| 263 | Ga0207646_10453122 | 3300025922 | Bacteria | 1157 |
| 264 | Ga0207681_10069050 | 3300025923 | Bacteria | 2457 |
| 265 | Ga0207650_10005011 | 3300025925 | Bacteria | 9047 |
| 266 | Ga0207650_10101995 | 3300025925 | Bacteria | 2210 |
| 267 | Ga0207650_10280551 | 3300025925 | Bacteria | 1356 |
| 268 | Ga0207650_10390255 | 3300025925 | Bacteria | 1151 |
| 269 | Ga0207659_10002514 | 3300025926 | Bacteria | 10926 |
| 270 | Ga0207659_10005064 | 3300025926 | Bacteria | 7995 |
| 271 | Ga0207659_10013347 | 3300025926 | Bacteria | 5258 |
| 272 | Ga0207659_10140234 | 3300025926 | Bacteria | 1876 |
| 273 | Ga0207659_10155545 | 3300025926 | Bacteria | 1790 |
| 274 | Ga0207687_10083793 | 3300025927 | Bacteria | 2309 |
| 275 | Ga0207644_10000319 | 3300025931 | Bacteria | 31445 |
| 276 | Ga0207644_10173842 | 3300025931 | Bacteria | 1683 |
| 277 | Ga0207644_10397472 | 3300025931 | Bacteria | 1126 |
| 278 | Ga0207706_10085842 | 3300025933 | Bacteria | 2767 |
| 279 | Ga0207706_10161671 | 3300025933 | Bacteria | 1968 |
| 280 | Ga0207706_10201852 | 3300025933 | Bacteria | 1744 |
| 281 | Ga0207686_10012174 | 3300025934 | Bacteria | 4725 |
| 282 | Ga0207670_10021806 | 3300025936 | Bacteria | 3958 |
| 283 | Ga0207670_10053084 | 3300025936 | Bacteria | 2729 |
| 284 | Ga0207670_10077018 | 3300025936 | Bacteria | 2322 |
| 285 | Ga0207670_10359030 | 3300025936 | Bacteria | 1156 |
| 286 | Ga0207669_10151660 | 3300025937 | Bacteria | 1624 |
| 287 | Ga0207665_10142439 | 3300025939 | Bacteria | 1711 |
| 288 | Ga0207691_10006989 | 3300025940 | Bacteria | 10889 |
| 289 | Ga0207691_10025137 | 3300025940 | Bacteria | 5595 |
| 290 | Ga0207691_10134892 | 3300025940 | Bacteria | 2178 |
| 291 | Ga0207711_10003595 | 3300025941 | Bacteria | 13410 |
| 292 | Ga0207711_10228394 | 3300025941 | Bacteria | 1704 |
| 293 | Ga0207689_10098611 | 3300025942 | Bacteria | 2401 |
| 294 | Ga0207689_10266807 | 3300025942 | Bacteria | 1417 |
| 295 | Ga0207661_10037496 | 3300025944 | Bacteria | 3792 |
| 296 | Ga0207661_10169715 | 3300025944 | Bacteria | 1899 |
| 297 | Ga0207679_10003650 | 3300025945 | Bacteria | 9538 |
| 298 | Ga0207679_10018240 | 3300025945 | Bacteria | 4699 |
| 299 | Ga0207679_10384177 | 3300025945 | Unclassified | 1232 |
| 300 | Ga0207667_10000612 | 3300025949 | Bacteria | 46149 |
| 301 | Ga0207667_10002028 | 3300025949 | Bacteria | 25387 |
| 302 | Ga0207667_10072220 | 3300025949 | Bacteria | 3588 |
| 303 | Ga0207651_10004211 | 3300025960 | Bacteria | 7208 |
| 304 | Ga0207651_10109090 | 3300025960 | Bacteria | 2073 |
| 305 | Ga0207651_10160927 | 3300025960 | Bacteria | 1760 |
| 306 | Ga0207712_10010203 | 3300025961 | Bacteria | 5955 |
| 307 | Ga0207712_10146734 | 3300025961 | Bacteria | 1817 |
| 308 | Ga0207658_10001060 | 3300025986 | Bacteria | 22265 |
| 309 | Ga0207658_10039755 | 3300025986 | Bacteria | 3395 |
| 310 | Ga0207658_10047025 | 3300025986 | Bacteria | 3155 |
| 311 | Ga0207658_10322887 | 3300025986 | Bacteria | 1337 |
| 312 | Ga0207677_10002394 | 3300026023 | Bacteria | 9828 |
| 313 | Ga0207677_10015860 | 3300026023 | Bacteria | 4446 |
| 314 | Ga0207677_10047983 | 3300026023 | Bacteria | 2872 |
| 315 | Ga0207677_10367173 | 3300026023 | Bacteria | 1211 |
| 316 | Ga0207703_10007843 | 3300026035 | Bacteria | 8446 |
| 317 | Ga0207703_10272600 | 3300026035 | Bacteria | 1534 |
| 318 | Ga0207678_10045328 | 3300026067 | Bacteria | 3803 |
| 319 | Ga0207702_10001471 | 3300026078 | Bacteria | 23360 |
| 320 | Ga0207702_10161792 | 3300026078 | Bacteria | 2045 |
| 321 | Ga0207641_10000293 | 3300026088 | Bacteria | 62674 |
| 322 | Ga0207641_10012614 | 3300026088 | Bacteria | 6930 |
| 323 | Ga0207641_10037995 | 3300026088 | Bacteria | 4024 |
| 324 | Ga0207641_10043328 | 3300026088 | Bacteria | 3779 |
| 325 | Ga0207641_10064915 | 3300026088 | Bacteria | 3121 |
| 326 | Ga0207641_10538184 | 3300026088 | Bacteria | 1138 |
| 327 | Ga0207648_10146903 | 3300026089 | Bacteria | 2080 |
| 328 | Ga0207648_10490999 | 3300026089 | Bacteria | 1122 |
| 329 | Ga0207676_10000787 | 3300026095 | Bacteria | 24758 |
| 330 | Ga0207676_10527294 | 3300026095 | Bacteria | 1125 |
| 331 | Ga0207675_100009284 | 3300026118 | Bacteria | 9223 |
| 332 | Ga0207675_100025528 | 3300026118 | Bacteria | 5499 |
| 333 | Ga0207675_100481361 | 3300026118 | Bacteria | 1234 |
| 334 | Ga0207683_10036828 | 3300026121 | Bacteria | 4260 |
| 335 | Ga0207683_10208672 | 3300026121 | Bacteria | 1777 |
| 336 | Ga0209974_10076904 | 3300027876 | Bacteria | 1144 |
| 337 | Ga0207428_10003685 | 3300027907 | Bacteria | 14735 |
| 338 | Ga0207428_10042349 | 3300027907 | Bacteria | 3682 |
| 339 | Ga0207428_10044112 | 3300027907 | Bacteria | 3598 |
| 340 | Ga0207428_10092837 | 3300027907 | Bacteria | 2342 |
| 341 | Ga0207428_10126514 | 3300027907 | Bacteria | 1957 |
| 342 | Ga0268265_10199953 | 3300028380 | Bacteria | 1733 |
| 343 | Ga0268265_10308471 | 3300028380 | Bacteria | 1428 |
| 344 | Ga0268264_10008889 | 3300028381 | Bacteria | 8330 |
| 345 | Ga0268264_10011525 | 3300028381 | Bacteria | 7304 |
| 346 | Ga0268264_10051818 | 3300028381 | Bacteria | 3421 |
| 347 | Ga0268264_10573584 | 3300028381 | Bacteria | 1109 |
| 348 | Ga0265326_10015554 | 3300028558 | Unclassified | 2205 |
| 349 | Ga0265318_10000273 | 3300028577 | Bacteria | 43832 |
| 350 | Ga0265318_10001387 | 3300028577 | Bacteria | 14390 |
| 351 | Ga0265318_10017893 | 3300028577 | Bacteria | 2901 |
| 352 | Ga0265338_10000401 | 3300028800 | Bacteria | 77602 |
| 353 | Ga0265338_10071588 | 3300028800 | Bacteria | 2965 |
| 354 | Ga0265338_10122313 | 3300028800 | Bacteria | 2071 |
| 355 | Ga0265338_10190681 | 3300028800 | Bacteria | 1554 |
| 356 | Ga0265330_10000095 | 3300031235 | Bacteria | 74593 |
| 357 | Ga0265330_10000998 | 3300031235 | Bacteria | 17255 |
| 358 | Ga0265332_10000222 | 3300031238 | Bacteria | 45648 |
| 359 | Ga0265332_10000280 | 3300031238 | Bacteria | 40175 |
| 360 | Ga0265328_10034512 | 3300031239 | Bacteria | 1873 |
| 361 | Ga0265320_10000485 | 3300031240 | Bacteria | 31127 |
| 362 | Ga0265320_10039072 | 3300031240 | Bacteria | 2375 |
| 363 | Ga0265325_10000502 | 3300031241 | Bacteria | 28249 |
| 364 | Ga0265325_10001575 | 3300031241 | Bacteria | 15904 |
| 365 | Ga0265325_10042041 | 3300031241 | Bacteria | 2392 |
| 366 | Ga0265329_10000013 | 3300031242 | Bacteria | 70645 |
| 367 | Ga0265329_10005084 | 3300031242 | Bacteria | 5366 |
| 368 | Ga0265340_10000189 | 3300031247 | Bacteria | 31156 |
| 369 | Ga0265340_10001205 | 3300031247 | Bacteria | 14789 |
| 370 | Ga0265340_10019984 | 3300031247 | Bacteria | 3445 |
| 371 | Ga0265339_10000299 | 3300031249 | Bacteria | 40398 |
| 372 | Ga0265339_10008732 | 3300031249 | Bacteria | 6424 |
| 373 | Ga0265339_10008773 | 3300031249 | Bacteria | 6404 |
| 374 | Ga0265331_10000134 | 3300031250 | Bacteria | 96927 |
| 375 | Ga0265331_10002207 | 3300031250 | Bacteria | 13369 |
| 376 | Ga0265331_10025138 | 3300031250 | Bacteria | 3008 |
| 377 | Ga0265316_10000450 | 3300031344 | Bacteria | 46576 |
| 378 | Ga0265316_10001048 | 3300031344 | Bacteria | 29962 |
| 379 | Ga0265316_10002957 | 3300031344 | Bacteria | 17386 |
| 380 | Ga0307408_100218385 | 3300031548 | Bacteria | 1554 |
| 381 | Ga0265313_10000316 | 3300031595 | Bacteria | 52476 |
| 382 | Ga0265313_10000463 | 3300031595 | Bacteria | 42820 |
| 383 | Ga0265313_10001355 | 3300031595 | Bacteria | 23078 |
| 384 | Ga0307508_10136221 | 3300031616 | Bacteria | 2059 |
| 385 | Ga0316575_10001284 | 3300031665 | Bacteria | 8000 |
| 386 | Ga0316575_10056631 | 3300031665 | Bacteria | 1562 |
| 387 | Ga0316579_10039180 | 3300031691 | Bacteria | 2194 |
| 388 | Ga0316579_10052802 | 3300031691 | Bacteria | 1903 |
| 389 | Ga0265314_10000003 | 3300031711 | Bacteria | 1653386 |
| 390 | Ga0265314_10000076 | 3300031711 | Bacteria | 146266 |
| 391 | Ga0265314_10000413 | 3300031711 | Bacteria | 57497 |
| 392 | Ga0265314_10002804 | 3300031711 | Bacteria | 17395 |
| 393 | Ga0265314_10008394 | 3300031711 | Bacteria | 8853 |
| 394 | Ga0265342_10000471 | 3300031712 | Bacteria | 43707 |
| 395 | Ga0265342_10000759 | 3300031712 | Bacteria | 32969 |
| 396 | Ga0265342_10010844 | 3300031712 | Bacteria | 6273 |
| 397 | Ga0316576_10000992 | 3300031727 | Bacteria | 14602 |
| 398 | Ga0316576_10004459 | 3300031727 | Bacteria | 8400 |
| 399 | Ga0316576_10007134 | 3300031727 | Bacteria | 7007 |
| 400 | Ga0316576_10009047 | 3300031727 | Bacteria | 6406 |
| 401 | Ga0316576_10013503 | 3300031727 | Bacteria | 5432 |
| 402 | Ga0316576_10015660 | 3300031727 | Bacteria | 5095 |
| 403 | Ga0316576_10048108 | 3300031727 | Bacteria | 3092 |
| 404 | Ga0316576_10096795 | 3300031727 | Bacteria | 2203 |
| 405 | Ga0316578_10018044 | 3300031728 | Bacteria | 3856 |
| 406 | Ga0316578_10025877 | 3300031728 | Bacteria | 3304 |
| 407 | Ga0307516_10009446 | 3300031730 | Bacteria | 10868 |
| 408 | Ga0316577_10020932 | 3300031733 | Bacteria | 3625 |
| 409 | Ga0316577_10025885 | 3300031733 | Bacteria | 3263 |
| 410 | Ga0316577_10044815 | 3300031733 | Bacteria | 2474 |
| 411 | Ga0316577_10057497 | 3300031733 | Bacteria | 2172 |
| 412 | Ga0307406_10001312 | 3300031901 | Bacteria | 13960 |
| 413 | Ga0307407_10007128 | 3300031903 | Bacteria | 5039 |
| 414 | Ga0307409_100329229 | 3300031995 | Bacteria | 1433 |
| 415 | Ga0307416_100012158 | 3300032002 | Bacteria | 5782 |
| 416 | Ga0307411_10010242 | 3300032005 | Bacteria | 4985 |
| 417 | Ga0307411_10081107 | 3300032005 | Bacteria | 2233 |
| 418 | Ga0307415_100085523 | 3300032126 | Bacteria | 2266 |
| 419 | Ga0316583_10002585 | 3300032133 | Bacteria | 6309 |
| 420 | Ga0316593_10000033 | 3300032168 | Bacteria | 14603 |
| 421 | Ga0316593_10000043 | 3300032168 | Bacteria | 13880 |
| 422 | Ga0316593_10000581 | 3300032168 | Bacteria | 6919 |
| 423 | Ga0316593_10004875 | 3300032168 | Bacteria | 3488 |
| 424 | Ga0316593_10013698 | 3300032168 | Bacteria | 2407 |
| 425 | Ga0316593_10016904 | 3300032168 | Bacteria | 2219 |
| 426 | Ga0316593_10030235 | 3300032168 | Bacteria | 1757 |
| 427 | Ga0316593_10058520 | 3300032168 | Bacteria | 1314 |
| 428 | Ga0307507_10102682 | 3300033179 | Bacteria | 2383 |
| 429 | Ga0316592_1000397 | 3300033524 | Bacteria | 5838 |
| 430 | Ga0316592_1002103 | 3300033524 | Bacteria | 3380 |
| 431 | Ga0316592_1002468 | 3300033524 | Bacteria | 3201 |
| 432 | Ga0316592_1024207 | 3300033524 | Bacteria | 1305 |
| 433 | Ga0316588_1000005 | 3300033528 | Bacteria | 13840 |
| 434 | Ga0316588_1000859 | 3300033528 | Bacteria | 4615 |
| 435 | Ga0316588_1009457 | 3300033528 | Unclassified | 2034 |
| 436 | Ga0316588_1013472 | 3300033528 | Bacteria | 1775 |
| 437 | Ga0316587_1008755 | 3300033529 | Bacteria | 1596 |
| 438 | Ga0316596_1000006 | 3300033541 | Bacteria | 19978 |
| 439 | Ga0316596_1000192 | 3300033541 | Bacteria | 8874 |
| 440 | Ga0316596_1001245 | 3300033541 | Bacteria | 5036 |
| 441 | Ga0316596_1002498 | 3300033541 | Bacteria | 3934 |
| 442 | Ga0316596_1002889 | 3300033541 | Bacteria | 3719 |
| 443 | Ga0316596_1003232 | 3300033541 | Bacteria | 3549 |
| 444 | Ga0316596_1007624 | 3300033541 | Bacteria | 2562 |
| 445 | Ga0316596_1028802 | 3300033541 | Bacteria | 1436 |
| 446 | Ga0373928_0001523 | 3300035084 | Bacteria | 4500 |
| 447 | Ga0373923_0027981 | 3300035111 | Bacteria | 2252 |
| 448 | Ga0373945_0061054 | 3300035116 | Bacteria | 1407 |
| 449 | Ga0373953_0009969 | 3300035117 | Bacteria | 3293 |
| 450 | Ga0373953_0038745 | 3300035117 | Bacteria | 1887 |
| 451 | Ga0373957_0026847 | 3300035120 | Bacteria | 2087 |
| 452 | Ga0373943_0007539 | 3300035170 | Bacteria | 4887 |
| 453 | Ga0373955_0044848 | 3300035172 | Bacteria | 2384 |
| 454 | Ga0373955_0086650 | 3300035172 | Bacteria | 1779 |
| 455 | Ga0316574_0009048 | 3300035398 | Bacteria | 5565 |
| 456 | Ga0316574_0039406 | 3300035398 | Bacteria | 2905 |
| 457 | Ga0316574_0048969 | 3300035398 | Bacteria | 2626 |
| 458 | Ga0316574_0126871 | 3300035398 | Bacteria | 1640 |
| 459 | Ga0316574_0140894 | 3300035398 | Bacteria | 1553 |
| 460 | Ga0373924_0014264 | 3300035410 | Bacteria | 3001 |
| 461 | Ga0373924_0028155 | 3300035410 | Bacteria | 2238 |
| 462 | Ga0373931_0042588 | 3300035691 | Bacteria | 2388 |
| 463 | Ga0373935_0018318 | 3300035692 | Bacteria | 4257 |
| 464 | Ga0373927_0009335 | 3300035695 | Bacteria | 6581 |
| 465 | Ga0373927_0013572 | 3300035695 | Bacteria | 5411 |
| 466 | Ga0373927_0037681 | 3300035695 | Bacteria | 3141 |
| 467 | Ga0373927_0041314 | 3300035695 | Bacteria | 2991 |
| 468 | Ga0373933_0003225 | 3300035724 | Bacteria | 9108 |
| 469 | Ga0373933_0033257 | 3300035724 | Bacteria | 2998 |
| 470 | Ga0373947_0063275 | 3300035725 | Bacteria | 2253 |
| 471 | Ga0373937_0003223 | 3300036401 | Bacteria | 13669 |
| 472 | Ga0373937_0017617 | 3300036401 | Bacteria | 6370 |
| 473 | Ga0373937_0045525 | 3300036401 | Bacteria | 4010 |
| 474 | Ga0373937_0220335 | 3300036401 | Bacteria | 1786 |
| 475 | Ga0373937_0335299 | 3300036401 | Bacteria | 1432 |
| 476 | Ga0373937_0401628 | 3300036401 | Bacteria | 1300 |
| 477 | Ga0316582_0003012 | 3300036647 | Bacteria | 8121 |
| 478 | Ga0316582_0026784 | 3300036647 | Bacteria | 3474 |
| 479 | Ga0316584_0009321 | 3300036712 | Bacteria | 6809 |
| 480 | Ga0373925_0002179 | 3300037068 | Bacteria | 15930 |
| 481 | Ga0373925_0019406 | 3300037068 | Bacteria | 4944 |
| 482 | Ga0395900_0030792 | 3300037418 | Bacteria | 5510 |
| 483 | Ga0395905_0000127 | 3300037471 | Bacteria | 124627 |
| 484 | Ga0395905_0000275 | 3300037471 | Bacteria | 76114 |
| 485 | Ga0395905_0025893 | 3300037471 | Bacteria | 5529 |
| 486 | Ga0395905_0091046 | 3300037471 | Bacteria | 2860 |
| 487 | Ga0395905_0123004 | 3300037471 | Bacteria | 2440 |
| 488 | Ga0316581_0007370 | 3300037588 | Bacteria | 2948 |
| 489 | Ga0436364_1158423 | 3300037853 | Bacteria | 6574 |
| 490 | Ga0400490_17491 | 3300038726 | Bacteria | 28094 |
| 491 | Ga0400490_30744 | 3300038726 | Bacteria | 133210 |
| 492 | Ga0400485_08047 | 3300038735 | Bacteria | 20055 |
| 493 | Ga0400485_08672 | 3300038735 | Bacteria | 18258 |
| 494 | Ga0400486_03968 | 3300038742 | Bacteria | 8030 |
| 495 | Ga0400486_05152 | 3300038742 | Bacteria | 15610 |
| 496 | Ga0400486_17114 | 3300038742 | Bacteria | 18189 |
| 497 | Ga0400483_053606 | 3300039062 | Bacteria | 1285 |
| 498 | Ga0400483_110311 | 3300039062 | Bacteria | 6007 |
| 499 | Ga0400483_206886 | 3300039062 | Bacteria | 2236 |
| 500 | Ga0400483_224663 | 3300039062 | Unclassified | 2009 |
| 501 | Ga0400483_235488 | 3300039062 | Bacteria | 2044 |
| 502 | Ga0400483_282171 | 3300039062 | Bacteria | 1647 |
| 503 | Ga0400489_12624 | 3300039093 | Bacteria | 13561 |
| 504 | Ga0400489_68201 | 3300039093 | Bacteria | 28552 |
| 505 | Ga0400489_87362 | 3300039093 | Unclassified | 1920 |
| 506 | Ga0400489_92265 | 3300039093 | Bacteria | 2620 |
| 507 | Ga0400487_03008 | 3300039110 | Bacteria | 21586 |
| 508 | Ga0400487_21995 | 3300039110 | Bacteria | 1271 |
| 509 | Ga0436361_0045516 | 3300039447 | Bacteria | 2540 |
| 510 | Ga0436361_1081198 | 3300039447 | Bacteria | 1210 |
| 511 | Ga0436363_0759301 | 3300039450 | Bacteria | 1163 |
| 512 | Ga0439453_0002595 | 3300041408 | Bacteria | 2511 |
| 513 | Ga0439465_0002430 | 3300041413 | Bacteria | 6098 |
| 514 | Ga0451807_0596507 | 3300041486 | Bacteria | 1156 |
| 515 | Ga0439431_0032614 | 3300041997 | Bacteria | 1299 |
| 516 | Ga0439449_0052713 | 3300042007 | Bacteria | 1504 |
| 517 | Ga0439435_0017337 | 3300042436 | Bacteria | 1819 |
| 518 | Ga0451577_0000328 | 3300042876 | Bacteria | 88518 |
| 519 | Ga0451577_0000673 | 3300042876 | Bacteria | 53786 |
| 520 | Ga0451577_0000828 | 3300042876 | Bacteria | 46284 |
| 521 | Ga0451577_0008521 | 3300042876 | Bacteria | 9973 |
| 522 | Ga0451577_0030969 | 3300042876 | Bacteria | 4830 |
| 523 | Ga0451577_0042342 | 3300042876 | Bacteria | 4085 |
| 524 | Ga0451577_0149506 | 3300042876 | Unclassified | 2101 |
| 525 | Ga0451577_0234273 | 3300042876 | Bacteria | 1660 |
| 526 | Ga0451577_0318977 | 3300042876 | Bacteria | 1409 |
| 527 | Ga0453683_0000219 | 3300044673 | Bacteria | 76281 |
| 528 | Ga0453683_0001684 | 3300044673 | Bacteria | 18427 |
| 529 | Ga0453683_0003224 | 3300044673 | Bacteria | 12130 |
| 530 | Ga0453683_0004812 | 3300044673 | Bacteria | 9503 |
| 531 | Ga0453683_0016045 | 3300044673 | Bacteria | 4840 |
| 532 | Ga0453683_0022862 | 3300044673 | Bacteria | 3986 |
| 533 | Ga0453683_0026024 | 3300044673 | Bacteria | 3715 |
| 534 | Ga0453683_0030485 | 3300044673 | Bacteria | 3409 |
| 535 | Ga0453683_0062905 | 3300044673 | Bacteria | 2320 |
| 536 | Ga0453683_0065404 | 3300044673 | Bacteria | 2273 |
| 537 | Ga0453683_0069681 | 3300044673 | Bacteria | 2199 |
| 538 | Ga0453683_0073074 | 3300044673 | Bacteria | 2147 |
| 539 | Ga0453683_0234490 | 3300044673 | Bacteria | 1168 |
| 540 | Ga0453684_0000258 | 3300044712 | Bacteria | 228312 |
| 541 | Ga0453684_0000950 | 3300044712 | Bacteria | 95538 |
| 542 | Ga0453684_0001155 | 3300044712 | Bacteria | 82444 |
| 543 | Ga0453684_0001648 | 3300044712 | Bacteria | 60626 |
| 544 | Ga0453684_0003637 | 3300044712 | Bacteria | 34273 |
| 545 | Ga0453684_0004724 | 3300044712 | Bacteria | 28171 |
| 546 | Ga0453684_0005988 | 3300044712 | Bacteria | 23557 |
| 547 | Ga0453684_0007136 | 3300044712 | Bacteria | 20809 |
| 548 | Ga0453684_0008030 | 3300044712 | Bacteria | 19098 |
| 549 | Ga0453684_0010045 | 3300044712 | Bacteria | 16285 |
| 550 | Ga0453684_0010350 | 3300044712 | Bacteria | 15963 |
| 551 | Ga0453684_0012911 | 3300044712 | Bacteria | 13683 |
| 552 | Ga0453684_0015940 | 3300044712 | Bacteria | 11817 |
| 553 | Ga0453684_0019047 | 3300044712 | Bacteria | 10481 |
| 554 | Ga0453684_0024212 | 3300044712 | Bacteria | 8887 |
| 555 | Ga0453684_0032059 | 3300044712 | Bacteria | 7367 |
| 556 | Ga0453684_0032203 | 3300044712 | Bacteria | 7346 |
| 557 | Ga0453684_0037215 | 3300044712 | Bacteria | 6682 |
| 558 | Ga0453684_0056552 | 3300044712 | Bacteria | 5088 |
| 559 | Ga0453684_0099498 | 3300044712 | Bacteria | 3562 |
| 560 | Ga0453684_0100989 | 3300044712 | Bacteria | 3530 |
| 561 | Ga0453684_0111569 | 3300044712 | Bacteria | 3321 |
| 562 | Ga0453684_0124618 | 3300044712 | Bacteria | 3103 |
| 563 | Ga0453684_0163203 | 3300044712 | Bacteria | 2633 |
| 564 | Ga0453684_0222798 | 3300044712 | Bacteria | 2183 |
| 565 | Ga0453684_0224980 | 3300044712 | Bacteria | 2170 |
| 566 | Ga0453684_0345203 | 3300044712 | Bacteria | 1680 |
| 567 | Ga0453684_0559552 | 3300044712 | Bacteria | 1258 |
| 568 | Ga0453684_0576068 | 3300044712 | Bacteria | 1237 |
| 569 | Ga0453684_0608741 | 3300044712 | Bacteria | 1196 |
| 570 | Ga0451576_0000857 | 3300045051 | Bacteria | 58872 |
| 571 | Ga0451576_0001406 | 3300045051 | Bacteria | 41324 |
| 572 | Ga0451576_0003523 | 3300045051 | Bacteria | 21376 |
| 573 | Ga0451576_0004083 | 3300045051 | Bacteria | 19291 |
| 574 | Ga0451576_0017930 | 3300045051 | Bacteria | 7771 |
| 575 | Ga0451576_0057309 | 3300045051 | Bacteria | 4073 |
| 576 | Ga0451576_0093423 | 3300045051 | Bacteria | 3128 |
| 577 | Ga0451576_0121722 | 3300045051 | Bacteria | 2717 |
| 578 | Ga0451576_0128597 | 3300045051 | Bacteria | 2640 |
| 579 | Ga0451576_0158623 | 3300045051 | Bacteria | 2360 |
| 580 | Ga0451576_0185054 | 3300045051 | Bacteria | 2175 |
| 581 | Ga0451576_0302429 | 3300045051 | Bacteria | 1673 |
| 582 | Ga0451576_0632188 | 3300045051 | Bacteria | 1125 |
| 583 | Ga0495592_0096167 | 3300046454 | Bacteria | 2117 |
| 584 | Ga0495603_0058712 | 3300046455 | Bacteria | 2274 |
| 585 | Ga0495629_0000007 | 3300046459 | Bacteria | 358693 |
| 586 | Ga0495629_0000126 | 3300046459 | Bacteria | 66833 |
| 587 | Ga0495629_0053214 | 3300046459 | Bacteria | 2833 |
| 588 | Ga0495641_0016753 | 3300046461 | Bacteria | 3849 |
| 589 | Ga0495641_0092003 | 3300046461 | Bacteria | 1355 |
| 590 | Ga0495651_0080256 | 3300046462 | Bacteria | 2465 |
| 591 | Ga0495580_0002023 | 3300046472 | Bacteria | 17847 |
| 592 | Ga0495580_0028001 | 3300046472 | Bacteria | 4098 |
| 593 | Ga0495580_0040045 | 3300046472 | Bacteria | 3351 |
| 594 | Ga0495639_0000121 | 3300046475 | Bacteria | 39571 |
| 595 | Ga0495639_0012434 | 3300046475 | Bacteria | 3670 |
| 596 | Ga0495664_0003262 | 3300046477 | Bacteria | 8815 |
| 597 | Ga0495594_0009365 | 3300046499 | Bacteria | 5059 |
| 598 | Ga0495608_0015057 | 3300046511 | Bacteria | 5365 |
| 599 | Ga0495618_0033611 | 3300046514 | Bacteria | 3216 |
| 600 | Ga0495628_0199865 | 3300046516 | Bacteria | 1506 |
| 601 | Ga0495666_0019669 | 3300046526 | Bacteria | 3348 |
| 602 | Ga0495652_0246772 | 3300046529 | Bacteria | 1325 |
| 603 | Ga0495640_0084624 | 3300046533 | Bacteria | 2103 |
| 604 | Ga0495586_0006882 | 3300046535 | Bacteria | 6059 |
| 605 | Ga0495586_0012323 | 3300046535 | Bacteria | 4537 |
| 606 | Ga0495587_0196125 | 3300046536 | Bacteria | 1143 |
| 607 | Ga0495598_0000163 | 3300046537 | Bacteria | 11410 |
| 608 | Ga0495645_0091263 | 3300046543 | Bacteria | 2176 |
| 609 | Ga0495622_0036714 | 3300046557 | Bacteria | 2284 |
| 610 | Ga0495667_0000559 | 3300046559 | Bacteria | 23744 |
| 611 | Ga0495656_0000068 | 3300046615 | Bacteria | 46104 |
| 612 | Ga0495656_0000397 | 3300046615 | Bacteria | 14422 |
| 613 | Ga0495635_0001003 | 3300046663 | Bacteria | 18656 |
| 614 | Ga0495635_0001790 | 3300046663 | Bacteria | 14519 |
| 615 | Ga0495659_0007690 | 3300046664 | Bacteria | 3416 |
| 616 | Ga0495657_0089924 | 3300046675 | Bacteria | 1972 |
| 617 | Ga0495646_0129115 | 3300046680 | Bacteria | 1424 |
| 618 | Ga0495647_0001519 | 3300046681 | Bacteria | 7163 |
| 619 | Ga0495647_0016102 | 3300046681 | Bacteria | 2629 |
| 620 | Ga0495647_0020678 | 3300046681 | Bacteria | 2365 |
| 621 | Ga0495658_0000327 | 3300046683 | Bacteria | 26569 |
| 622 | Ga0495658_0004909 | 3300046683 | Bacteria | 6562 |
| 623 | Ga0495613_0007236 | 3300046689 | Bacteria | 8264 |
| 624 | Ga0495613_0011880 | 3300046689 | Bacteria | 6472 |
| 625 | Ga0495613_0025308 | 3300046689 | Bacteria | 4422 |
| 626 | Ga0495613_0041711 | 3300046689 | Bacteria | 3398 |
| 627 | Ga0495624_0096301 | 3300046690 | Bacteria | 1823 |
| 628 | Ga0495624_0155658 | 3300046690 | Bacteria | 1397 |
| 629 | Ga0495600_0020741 | 3300046809 | Bacteria | 4204 |
| 630 | Ga0495581_0000280 | 3300047315 | Bacteria | 24770 |
| 631 | Ga0495581_0090782 | 3300047315 | Bacteria | 1772 |
| 632 | Ga0495604_0106681 | 3300047317 | Bacteria | 2049 |
| 633 | Ga0495636_0001669 | 3300047318 | Bacteria | 8460 |
| 634 | Ga0495636_0004364 | 3300047318 | Bacteria | 5550 |
| 635 | Ga0495636_0024284 | 3300047318 | Bacteria | 2457 |
| 636 | Ga0495674_0010169 | 3300047319 | Bacteria | 8914 |
| 637 | Ga0495674_0013556 | 3300047319 | Bacteria | 7660 |
| 638 | Ga0495674_0160794 | 3300047319 | Bacteria | 1879 |
| 639 | Ga0495676_0020676 | 3300047321 | Bacteria | 5767 |
| 640 | Ga0495676_0040130 | 3300047321 | Bacteria | 3867 |
| 641 | Ga0495676_0154450 | 3300047321 | Bacteria | 1630 |
| 642 | Ga0495680_0000838 | 3300047322 | Bacteria | 34052 |
| 643 | Ga0495680_0001860 | 3300047322 | Bacteria | 22237 |
| 644 | Ga0495680_0042938 | 3300047322 | Bacteria | 3584 |
| 645 | Ga0495684_0006640 | 3300047471 | Bacteria | 8971 |
| 646 | Ga0495684_0115057 | 3300047471 | Bacteria | 2028 |
| 647 | Ga0495684_0177441 | 3300047471 | Bacteria | 1581 |
| 648 | Ga0495684_0197802 | 3300047471 | Bacteria | 1483 |
| 649 | Ga0495602_0088045 | 3300048088 | Bacteria | 2586 |
| 650 | Ga0495614_0002522 | 3300048089 | Bacteria | 8135 |
| 651 | Ga0495615_0002512 | 3300048090 | Bacteria | 2951 |
| 652 | Ga0496102_0158392 | 3300048905 | Bacteria | 2129 |
| 653 | Ga0496102_0373013 | 3300048905 | Bacteria | 1343 |
| 654 | Ga0496103_0209123 | 3300048906 | Bacteria | 1255 |
| 655 | Ga0496110_0000091 | 3300048913 | Bacteria | 48115 |
| 656 | Ga0496110_0001249 | 3300048913 | Bacteria | 18171 |
| 657 | Ga0496110_0202503 | 3300048913 | Unclassified | 1804 |
| 658 | Ga0496112_0077009 | 3300048915 | Bacteria | 3298 |
| 659 | Ga0496115_0020289 | 3300048918 | Bacteria | 5126 |
| 660 | Ga0496124_0000001 | 3300048927 | Bacteria | 1747840 |
| 661 | Ga0496126_0136628 | 3300048929 | Bacteria | 2114 |
| 662 | Ga0501308_000564 | 3300049128 | Bacteria | 2487 |
| 663 | Ga0501312_000273 | 3300049528 | Bacteria | 3762 |
| 664 | Ga0501318_000746 | 3300049534 | Bacteria | 2236 |
| 665 | Ga0501321_000935 | 3300049537 | Bacteria | 2132 |
| 666 | Ga0501324_000877 | 3300049540 | Bacteria | 1840 |
| 667 | Ga0501325_000595 | 3300049541 | Bacteria | 1827 |
| 668 | Ga0501031_0026897 | 3300049568 | Bacteria | 3749 |
| 669 | Ga0501031_0179052 | 3300049568 | Bacteria | 1385 |
| 670 | Ga0501032_0000374 | 3300049569 | Bacteria | 36951 |
| 671 | Ga0501032_0073350 | 3300049569 | Bacteria | 2280 |
| 672 | Ga0501033_0034683 | 3300049570 | Bacteria | 3783 |
| 673 | Ga0501034_0038041 | 3300049571 | Bacteria | 4874 |
| 674 | Ga0501034_0053308 | 3300049571 | Bacteria | 4073 |
| 675 | Ga0501034_0063128 | 3300049571 | Bacteria | 3718 |
| 676 | Ga0501034_0097139 | 3300049571 | Bacteria | 2942 |
| 677 | Ga0501034_0102596 | 3300049571 | Bacteria | 2854 |
| 678 | Ga0501034_0303293 | 3300049571 | Bacteria | 1533 |
| 679 | Ga0501034_0308716 | 3300049571 | Bacteria | 1517 |
| 680 | Ga0501034_0334346 | 3300049571 | Bacteria | 1446 |
| 681 | Ga0501036_0000942 | 3300049572 | Bacteria | 21869 |
| 682 | Ga0501036_0004738 | 3300049572 | Bacteria | 10978 |
| 683 | Ga0501036_0157822 | 3300049572 | Unclassified | 1913 |
| 684 | Ga0501036_0247227 | 3300049572 | Bacteria | 1495 |
| 685 | Ga0501037_0000862 | 3300049573 | Bacteria | 22616 |
| 686 | Ga0501038_0001392 | 3300049574 | Bacteria | 22120 |
| 687 | Ga0501038_0013339 | 3300049574 | Bacteria | 7494 |
| 688 | Ga0501038_0063475 | 3300049574 | Bacteria | 3152 |
| 689 | Ga0501038_0123879 | 3300049574 | Bacteria | 2129 |
| 690 | Ga0501038_0249217 | 3300049574 | Bacteria | 1407 |
| 691 | Ga0501039_0003138 | 3300049575 | Bacteria | 12363 |
| 692 | Ga0501040_0000070 | 3300049576 | Bacteria | 49605 |
| 693 | Ga0501040_0031360 | 3300049576 | Bacteria | 3592 |
| 694 | Ga0501040_0345965 | 3300049576 | Bacteria | 1065 |
| 695 | Ga0501041_0001162 | 3300049577 | Bacteria | 14408 |
| 696 | Ga0501041_0016024 | 3300049577 | Bacteria | 4454 |
| 697 | Ga0501041_0090288 | 3300049577 | Bacteria | 1891 |
| 698 | Ga0501042_0000926 | 3300049578 | Bacteria | 16510 |
| 699 | Ga0501042_0016640 | 3300049578 | Bacteria | 5053 |
| 700 | Ga0501042_0045205 | 3300049578 | Bacteria | 3138 |
| 701 | Ga0501043_0002448 | 3300049579 | Bacteria | 15703 |
| 702 | Ga0501043_0014038 | 3300049579 | Bacteria | 6269 |
| 703 | Ga0501043_0065707 | 3300049579 | Bacteria | 2848 |
| 704 | Ga0501043_0309289 | 3300049579 | Bacteria | 1206 |
| 705 | Ga0501046_0001500 | 3300049580 | Bacteria | 22313 |
| 706 | Ga0501046_0035201 | 3300049580 | Bacteria | 4036 |
| 707 | Ga0501046_0170225 | 3300049580 | Bacteria | 1635 |
| 708 | Ga0501047_0036151 | 3300049581 | Bacteria | 4772 |
| 709 | Ga0501047_0093046 | 3300049581 | Bacteria | 2894 |
| 710 | Ga0501048_0015102 | 3300049582 | Bacteria | 5706 |
| 711 | Ga0501048_0028158 | 3300049582 | Bacteria | 4080 |
| 712 | Ga0501048_0043787 | 3300049582 | Bacteria | 3203 |
| 713 | Ga0501067_0030612 | 3300049583 | Bacteria | 2984 |
| 714 | Ga0501068_0000765 | 3300049584 | Bacteria | 16541 |
| 715 | Ga0501068_0006986 | 3300049584 | Bacteria | 6244 |
| 716 | Ga0501069_0004501 | 3300049585 | Bacteria | 7201 |
| 717 | Ga0501069_0033407 | 3300049585 | Bacteria | 2834 |
| 718 | Ga0501070_0024404 | 3300049586 | Bacteria | 5073 |
| 719 | Ga0501070_0080026 | 3300049586 | Bacteria | 2704 |
| 720 | Ga0501071_0000007 | 3300049587 | Bacteria | 73318 |
| 721 | Ga0501071_0021718 | 3300049587 | Bacteria | 4474 |
| 722 | Ga0501071_0227418 | 3300049587 | Bacteria | 1405 |
| 723 | Ga0501072_0000620 | 3300049588 | Bacteria | 25510 |
| 724 | Ga0501072_0001242 | 3300049588 | Bacteria | 19028 |
| 725 | Ga0501072_0001660 | 3300049588 | Bacteria | 16588 |
| 726 | Ga0501072_0122457 | 3300049588 | Bacteria | 2072 |
| 727 | Ga0501073_0007779 | 3300049589 | Bacteria | 7959 |
| 728 | Ga0501073_0027134 | 3300049589 | Bacteria | 4099 |
| 729 | Ga0501073_0044048 | 3300049589 | Bacteria | 3145 |
| 730 | Ga0501073_0148375 | 3300049589 | Bacteria | 1625 |
| 731 | Ga0501074_0000626 | 3300049590 | Bacteria | 21937 |
| 732 | Ga0501074_0008028 | 3300049590 | Bacteria | 7643 |
| 733 | Ga0501074_0133352 | 3300049590 | Bacteria | 1777 |
| 734 | Ga0501074_0264731 | 3300049590 | Bacteria | 1222 |
| 735 | Ga0501074_0294187 | 3300049590 | Bacteria | 1154 |
| 736 | Ga0501075_0000031 | 3300049591 | Bacteria | 56103 |
| 737 | Ga0501075_0000645 | 3300049591 | Bacteria | 21346 |
| 738 | Ga0501076_0000733 | 3300049592 | Bacteria | 21215 |
| 739 | Ga0501076_0002119 | 3300049592 | Bacteria | 13613 |
| 740 | Ga0501076_0034427 | 3300049592 | Bacteria | 3959 |
| 741 | Ga0501076_0041428 | 3300049592 | Bacteria | 3623 |
| 742 | Ga0501076_0049426 | 3300049592 | Bacteria | 3326 |
| 743 | Ga0501077_0000055 | 3300049593 | Bacteria | 57590 |
| 744 | Ga0501077_0014291 | 3300049593 | Bacteria | 4987 |
| 745 | Ga0501077_0034412 | 3300049593 | Bacteria | 3225 |
| 746 | Ga0501225_0038760 | 3300049705 | Bacteria | 1313 |
| 747 | Ga0501079_0000858 | 3300049741 | Bacteria | 20794 |
| 748 | Ga0501079_0010492 | 3300049741 | Bacteria | 7043 |
| 749 | Ga0501079_0169864 | 3300049741 | Bacteria | 1700 |
| 750 | Ga0501079_0416695 | 3300049741 | Bacteria | 1054 |
| 751 | Ga0501080_0000823 | 3300049742 | Bacteria | 25350 |
| 752 | Ga0501080_0001538 | 3300049742 | Bacteria | 19472 |
| 753 | Ga0501080_0047083 | 3300049742 | Bacteria | 4014 |
| 754 | Ga0501080_0162657 | 3300049742 | Bacteria | 2061 |
| 755 | Ga0501080_0167550 | 3300049742 | Bacteria | 2027 |
| 756 | Ga0501081_0002273 | 3300049743 | Bacteria | 12095 |
| 757 | Ga0501081_0009031 | 3300049743 | Bacteria | 6482 |
| 758 | Ga0501081_0099477 | 3300049743 | Bacteria | 2055 |
| 759 | Ga0501081_0278368 | 3300049743 | Bacteria | 1224 |
| 760 | Ga0501083_0001752 | 3300049744 | Bacteria | 14807 |
| 761 | Ga0501083_0020876 | 3300049744 | Bacteria | 4553 |
| 762 | Ga0501083_0028562 | 3300049744 | Bacteria | 3843 |
| 763 | Ga0501083_0059220 | 3300049744 | Bacteria | 2562 |
| 764 | Ga0501083_0063107 | 3300049744 | Bacteria | 2471 |
| 765 | Ga0501035_0005591 | 3300049822 | Bacteria | 11871 |
| 766 | Ga0501045_0000303 | 3300049824 | Bacteria | 28934 |
| 767 | Ga0501045_0051760 | 3300049824 | Bacteria | 2997 |
| 768 | Ga0501045_0142647 | 3300049824 | Bacteria | 1781 |
| 769 | Ga0501045_0278171 | 3300049824 | Bacteria | 1246 |
| 770 | nmdc:mga00v17_82695_c1 | 3300050491 | Bacteria | 2007 |
| 771 | nmdc:mga0k408_109309_c1 | 3300050493 | Bacteria | 1634 |
| 772 | nmdc:mga0k408_161589_c1 | 3300050493 | Bacteria | 1335 |
| 773 | nmdc:mga0k408_17468_c1 | 3300050493 | Bacteria | 3997 |
| 774 | nmdc:mga0k408_28046_c1 | 3300050493 | Bacteria | 3200 |
| 775 | nmdc:mga0k408_52152_c1 | 3300050493 | Bacteria | 2370 |
| 776 | nmdc:mga0k408_64134_c1 | 3300050493 | Bacteria | 2138 |
| 777 | nmdc:mga06z11_91683_c1 | 3300050494 | Bacteria | 1651 |
| 778 | nmdc:mga05p37_189485_c1 | 3300050507 | Bacteria | 2498 |
| 779 | nmdc:mga05p37_2129_c1 | 3300050507 | Bacteria | 23128 |
| 780 | nmdc:mga05p37_261673_c1 | 3300050507 | Bacteria | 2070 |
| 781 | nmdc:mga05p37_26696_c1 | 3300050507 | Bacteria | 7023 |
| 782 | nmdc:mga05p37_274730_c1 | 3300050507 | Bacteria | 2012 |
| 783 | nmdc:mga05p37_334466_c1 | 3300050507 | Bacteria | 1788 |
| 784 | nmdc:mga05p37_337191_c1 | 3300050507 | Bacteria | 1779 |
| 785 | nmdc:mga05p37_3608_c1 | 3300050507 | Bacteria | 18082 |
| 786 | nmdc:mga05p37_38747_c1 | 3300050507 | Bacteria | 5848 |
| 787 | nmdc:mga05p37_463780_c1 | 3300050507 | Bacteria | 1463 |
| 788 | nmdc:mga05p37_54976_c1 | 3300050507 | Bacteria | 4897 |
| 789 | nmdc:mga09592_10768_c1 | 3300050508 | Bacteria | 7435 |
| 790 | nmdc:mga09592_21071_c1 | 3300050508 | Bacteria | 5368 |
| 791 | nmdc:mga0qj67_205352_c1 | 3300050509 | Unclassified | 1600 |
| 792 | nmdc:mga0qj67_320652_c1 | 3300050509 | Bacteria | 1254 |
| 793 | nmdc:mga0qj67_4157_c1 | 3300050509 | Bacteria | 10490 |
| 794 | nmdc:mga0qj67_93876_c1 | 3300050509 | Bacteria | 2413 |
| 795 | nmdc:mga06r32_172802_c1 | 3300050510 | Bacteria | 2145 |
| 796 | nmdc:mga06r32_216706_c1 | 3300050510 | Bacteria | 1902 |
| 797 | nmdc:mga06r32_271454_c1 | 3300050510 | Bacteria | 1683 |
| 798 | nmdc:mga06r32_71716_c1 | 3300050510 | Bacteria | 3352 |
| 799 | nmdc:mga06r32_7628_c1 | 3300050510 | Bacteria | 9730 |
| 800 | nmdc:mga08y16_10220_c1 | 3300050511 | Bacteria | 9851 |
| 801 | nmdc:mga08y16_123937_c1 | 3300050511 | Bacteria | 2689 |
| 802 | nmdc:mga08y16_13125_c1 | 3300050511 | Bacteria | 8716 |
| 803 | nmdc:mga08y16_133747_c1 | 3300050511 | Bacteria | 2577 |
| 804 | nmdc:mga08y16_180782_c1 | 3300050511 | Bacteria | 2190 |
| 805 | nmdc:mga08y16_269121_c1 | 3300050511 | Archaea | 1759 |
| 806 | nmdc:mga08y16_5631_c1 | 3300050511 | Bacteria | 13120 |
| 807 | nmdc:mga08y16_6706_c1 | 3300050511 | Bacteria | 12072 |
| 808 | nmdc:mga08y16_78049_c1 | 3300050511 | Bacteria | 3452 |
| 809 | nmdc:mga08y16_80830_c1 | 3300050511 | Bacteria | 3389 |
| 810 | nmdc:mga08y16_8355_c1 | 3300050511 | Bacteria | 10832 |
| 811 | nmdc:mga0n895_11252_c1 | 3300050512 | Bacteria | 7970 |
| 812 | nmdc:mga0n895_1213_c1 | 3300050512 | Bacteria | 19023 |
| 813 | nmdc:mga0n895_18871_c2 | 3300050512 | Bacteria | 3913 |
| 814 | nmdc:mga0n895_282350_c1 | 3300050512 | Unclassified | 1683 |
| 815 | nmdc:mga0n895_363905_c1 | 3300050512 | Bacteria | 1464 |
| 816 | nmdc:mga0n895_47933_c1 | 3300050512 | Bacteria | 4180 |
| 817 | nmdc:mga0n895_71242_c1 | 3300050512 | Bacteria | 3446 |
| 818 | nmdc:mga0rr50_102722_c1 | 3300050513 | Bacteria | 2249 |
| 819 | nmdc:mga0rr50_171119_c1 | 3300050513 | Bacteria | 1770 |
| 820 | nmdc:mga08x19_120635_c1 | 3300050514 | Bacteria | 1757 |
| 821 | nmdc:mga08x19_17284_c1 | 3300050514 | Bacteria | 4412 |
| 822 | nmdc:mga08x19_29031_c1 | 3300050514 | Bacteria | 3468 |
| 823 | nmdc:mga0a205_123282_c1 | 3300050515 | Bacteria | 2491 |
| 824 | nmdc:mga0a205_23805_c1 | 3300050515 | Bacteria | 5811 |
| 825 | nmdc:mga0a205_372751_c1 | 3300050515 | Bacteria | 1293 |
| 826 | nmdc:mga0a205_80328_c1 | 3300050515 | Bacteria | 3151 |
| 827 | nmdc:mga0a205_80572_c1 | 3300050515 | Bacteria | 3145 |
| 828 | Ga0495619_0001327 | 3300053085 | Bacteria | 16220 |
| 829 | Ga0495619_0024118 | 3300053085 | Bacteria | 3901 |
| 830 | Ga0495619_0138280 | 3300053085 | Bacteria | 1676 |
| 831 | Ga0500566_0008539 | 3300053094 | Bacteria | 6056 |
| 832 | Ga0500616_0045845 | 3300053153 | Bacteria | 2327 |
| 833 | Ga0501084_0000461 | 3300054114 | Bacteria | 31395 |
| 834 | Ga0501084_0001929 | 3300054114 | Bacteria | 16542 |
| 835 | Ga0501084_0007682 | 3300054114 | Bacteria | 8883 |
| 836 | Ga0501084_0030515 | 3300054114 | Bacteria | 4507 |
| 837 | Ga0501084_0104041 | 3300054114 | Bacteria | 2384 |
| 838 | Ga0501084_0184882 | 3300054114 | Bacteria | 1759 |
| 839 | Ga0590075_014278 | 3300059424 | Bacteria | 1941 |
| 840 | Ga0587070_013141 | 3300059491 | Bacteria | 1272 |
| 841 | Ga0587077_000591 | 3300059493 | Bacteria | 3252 |
| 842 | Ga0587083_0013582 | 3300059505 | Bacteria | 1389 |
| 843 | Ga0587085_001311 | 3300059506 | Bacteria | 2259 |
| 844 | Ga0587085_001989 | 3300059506 | Bacteria | 2020 |
| 845 | Ga0587091_009936 | 3300059511 | Bacteria | 1445 |
| 846 | Ga0587106_001645 | 3300059605 | Bacteria | 2037 |
| 847 | Ga0587101_002160 | 3300059623 | Bacteria | 1835 |
| 848 | Ga0587109_003978 | 3300059624 | Bacteria | 2013 |
| 849 | Ga0587109_005843 | 3300059624 | Bacteria | 1787 |
| 850 | Ga0587062_000268 | 3300059639 | Bacteria | 3294 |
| 851 | Ga0587062_008936 | 3300059639 | Bacteria | 1208 |
| 852 | Ga0587067_010633 | 3300059640 | Bacteria | 1399 |
| 853 | Ga0587072_000911 | 3300059643 | Bacteria | 3390 |
| 854 | Ga0587079_020187 | 3300059647 | Bacteria | 1186 |
| 855 | Ga0587124_001632 | 3300059660 | Bacteria | 1481 |
| 856 | Ga0587111_0000650 | 3300060346 | Bacteria | 3551 |
| 857 | Ga0587111_0010468 | 3300060346 | Bacteria | 1593 |
| 858 | Ga0587111_0013621 | 3300060346 | Bacteria | 1457 |
| 859 | Ga0587111_0014198 | 3300060346 | Bacteria | 1437 |
| 860 | Ga0501082_0003347 | 3300060353 | Bacteria | 13998 |
| 861 | Ga0501082_0011415 | 3300060353 | Bacteria | 7643 |
| 862 | Ga0501082_0024764 | 3300060353 | Bacteria | 5173 |
| 863 | Ga0501082_0071015 | 3300060353 | Bacteria | 2998 |
| 864 | Ga0530510_0004765 | 3300061734 | Bacteria | 9392 |
| 865 | Ga0530510_0006918 | 3300061734 | Bacteria | 7908 |
| 866 | Ga0530510_0008721 | 3300061734 | Bacteria | 7089 |
| 867 | Ga0530510_0015081 | 3300061734 | Bacteria | 5459 |
| 868 | Ga0530510_0030675 | 3300061734 | Bacteria | 3863 |
| 869 | Ga0530510_0053834 | 3300061734 | Bacteria | 2908 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039110 | Ga0400487_21995 | Ga0400487_21995_125_937 | 253 |
| 2 | 3300044673 | Ga0453683_0234490 | Ga0453683_0234490_313_1140 | 269 |
| 3 | 3300049579 | Ga0501043_0309289 | Ga0501043_0309289_305_1192 | 282 |
| 4 | 3300033541 | Ga0316596_1007624 | Ga0316596_10076243 | 284 |
| 5 | 3300038735 | Ga0400485_08672 | Ga0400485_08672_13023_14042 | 298 |
| 6 | 3300038742 | Ga0400486_17114 | Ga0400486_17114_13044_14063 | 298 |
| 7 | 3300039110 | Ga0400487_03008 | Ga0400487_03008_6483_7502 | 298 |
| 8 | 3300044712 | Ga0453684_0003637 | Ga0453684_0003637_12401_13429 | 310 |
| 9 | 3300046459 | Ga0495629_0000007 | Ga0495629_0000007_294092_295033 | 310 |
| 10 | 3300046689 | Ga0495613_0041711 | Ga0495613_0041711_701_1642 | 310 |
| 11 | 3300053094 | Ga0500566_0008539 | Ga0500566_0008539_170_1111 | 310 |
| 12 | 3300031691 | Ga0316579_10052802 | Ga0316579_100528022 | 311 |
| 13 | 3300031733 | Ga0316577_10020932 | Ga0316577_100209322 | 311 |
| 14 | 3300005618 | Ga0068864_100335858 | Ga0068864_1003358582 | 313 |
| 15 | 3300006844 | Ga0075428_100041729 | Ga0075428_1000417295 | 313 |
| 16 | 3300006847 | Ga0075431_100042817 | Ga0075431_1000428174 | 313 |
| 17 | 3300006847 | Ga0075431_100139791 | Ga0075431_1001397913 | 313 |
| 18 | 3300009147 | Ga0114129_10000092 | Ga0114129_1000009243 | 313 |
| 19 | 3300009553 | Ga0105249_10053243 | Ga0105249_100532432 | 313 |
| 20 | 3300014968 | Ga0157379_10232120 | Ga0157379_102321201 | 313 |
| 21 | 3300025933 | Ga0207706_10201852 | Ga0207706_102018522 | 313 |
| 22 | 3300025986 | Ga0207658_10322887 | Ga0207658_103228872 | 313 |
| 23 | 3300026089 | Ga0207648_10490999 | Ga0207648_104909991 | 313 |
| 24 | 3300027876 | Ga0209974_10076904 | Ga0209974_100769041 | 313 |
| 25 | 3300028381 | Ga0268264_10573584 | Ga0268264_105735841 | 313 |
| 26 | 3300041408 | Ga0439453_0002595 | Ga0439453_0002595_1492_2484 | 313 |
| 27 | 3300042436 | Ga0439435_0017337 | Ga0439435_0017337_489_1481 | 313 |
| 28 | 3300048905 | Ga0496102_0373013 | Ga0496102_0373013_239_1231 | 313 |
| 29 | 3300048906 | Ga0496103_0209123 | Ga0496103_0209123_68_1060 | 313 |
| 30 | 3300049568 | Ga0501031_0026897 | Ga0501031_0026897_424_1416 | 313 |
| 31 | 3300049569 | Ga0501032_0073350 | Ga0501032_0073350_839_1831 | 313 |
| 32 | 3300049570 | Ga0501033_0034683 | Ga0501033_0034683_1251_2243 | 313 |
| 33 | 3300049571 | Ga0501034_0097139 | Ga0501034_0097139_1005_1997 | 313 |
| 34 | 3300049572 | Ga0501036_0000942 | Ga0501036_0000942_7955_8947 | 313 |
| 35 | 3300049572 | Ga0501036_0004738 | Ga0501036_0004738_9818_10810 | 313 |
| 36 | 3300049572 | Ga0501036_0247227 | Ga0501036_0247227_354_1346 | 313 |
| 37 | 3300049574 | Ga0501038_0001392 | Ga0501038_0001392_8861_9853 | 313 |
| 38 | 3300049574 | Ga0501038_0249217 | Ga0501038_0249217_331_1323 | 313 |
| 39 | 3300049575 | Ga0501039_0003138 | Ga0501039_0003138_6101_7093 | 313 |
| 40 | 3300049576 | Ga0501040_0000070 | Ga0501040_0000070_46540_47532 | 313 |
| 41 | 3300049576 | Ga0501040_0031360 | Ga0501040_0031360_663_1655 | 313 |
| 42 | 3300049577 | Ga0501041_0001162 | Ga0501041_0001162_10012_11004 | 313 |
| 43 | 3300049577 | Ga0501041_0016024 | Ga0501041_0016024_3250_4242 | 313 |
| 44 | 3300049577 | Ga0501041_0090288 | Ga0501041_0090288_354_1346 | 313 |
| 45 | 3300049578 | Ga0501042_0000926 | Ga0501042_0000926_4372_5364 | 313 |
| 46 | 3300049578 | Ga0501042_0016640 | Ga0501042_0016640_1372_2364 | 313 |
| 47 | 3300049578 | Ga0501042_0045205 | Ga0501042_0045205_2061_3053 | 313 |
| 48 | 3300049579 | Ga0501043_0014038 | Ga0501043_0014038_3562_4554 | 313 |
| 49 | 3300049580 | Ga0501046_0001500 | Ga0501046_0001500_16738_17730 | 313 |
| 50 | 3300049580 | Ga0501046_0035201 | Ga0501046_0035201_1338_2330 | 313 |
| 51 | 3300049580 | Ga0501046_0170225 | Ga0501046_0170225_412_1404 | 313 |
| 52 | 3300049582 | Ga0501048_0015102 | Ga0501048_0015102_1916_2908 | 313 |
| 53 | 3300049582 | Ga0501048_0028158 | Ga0501048_0028158_588_1580 | 313 |
| 54 | 3300049582 | Ga0501048_0043787 | Ga0501048_0043787_2036_3028 | 313 |
| 55 | 3300049584 | Ga0501068_0006986 | Ga0501068_0006986_1711_2703 | 313 |
| 56 | 3300049585 | Ga0501069_0033407 | Ga0501069_0033407_1184_2176 | 313 |
| 57 | 3300049586 | Ga0501070_0024404 | Ga0501070_0024404_2652_3644 | 313 |
| 58 | 3300049587 | Ga0501071_0000007 | Ga0501071_0000007_10808_11800 | 313 |
| 59 | 3300049587 | Ga0501071_0021718 | Ga0501071_0021718_1933_2925 | 313 |
| 60 | 3300049588 | Ga0501072_0000620 | Ga0501072_0000620_875_1867 | 313 |
| 61 | 3300049588 | Ga0501072_0001242 | Ga0501072_0001242_8948_9940 | 313 |
| 62 | 3300049588 | Ga0501072_0122457 | Ga0501072_0122457_144_1136 | 313 |
| 63 | 3300049589 | Ga0501073_0044048 | Ga0501073_0044048_126_1118 | 313 |
| 64 | 3300049590 | Ga0501074_0000626 | Ga0501074_0000626_10594_11586 | 313 |
| 65 | 3300049590 | Ga0501074_0133352 | Ga0501074_0133352_19_1011 | 313 |
| 66 | 3300049590 | Ga0501074_0264731 | Ga0501074_0264731_35_1027 | 313 |
| 67 | 3300049591 | Ga0501075_0000031 | Ga0501075_0000031_13042_14034 | 313 |
| 68 | 3300049591 | Ga0501075_0000645 | Ga0501075_0000645_6362_7354 | 313 |
| 69 | 3300049592 | Ga0501076_0000733 | Ga0501076_0000733_18214_19206 | 313 |
| 70 | 3300049592 | Ga0501076_0002119 | Ga0501076_0002119_9217_10209 | 313 |
| 71 | 3300049592 | Ga0501076_0049426 | Ga0501076_0049426_35_1027 | 313 |
| 72 | 3300049593 | Ga0501077_0000055 | Ga0501077_0000055_9903_10895 | 313 |
| 73 | 3300049593 | Ga0501077_0034412 | Ga0501077_0034412_1373_2365 | 313 |
| 74 | 3300049741 | Ga0501079_0000858 | Ga0501079_0000858_9032_10024 | 313 |
| 75 | 3300049741 | Ga0501079_0010492 | Ga0501079_0010492_5712_6704 | 313 |
| 76 | 3300049741 | Ga0501079_0169864 | Ga0501079_0169864_265_1257 | 313 |
| 77 | 3300049741 | Ga0501079_0416695 | Ga0501079_0416695_22_972 | 313 |
| 78 | 3300049742 | Ga0501080_0000823 | Ga0501080_0000823_18532_19524 | 313 |
| 79 | 3300049742 | Ga0501080_0162657 | Ga0501080_0162657_668_1660 | 313 |
| 80 | 3300049743 | Ga0501081_0002273 | Ga0501081_0002273_2163_3155 | 313 |
| 81 | 3300049743 | Ga0501081_0278368 | Ga0501081_0278368_30_1022 | 313 |
| 82 | 3300049744 | Ga0501083_0028562 | Ga0501083_0028562_1015_2007 | 313 |
| 83 | 3300049744 | Ga0501083_0059220 | Ga0501083_0059220_1022_2014 | 313 |
| 84 | 3300049822 | Ga0501035_0005591 | Ga0501035_0005591_5101_6093 | 313 |
| 85 | 3300049824 | Ga0501045_0000303 | Ga0501045_0000303_15606_16598 | 313 |
| 86 | 3300049824 | Ga0501045_0051760 | Ga0501045_0051760_352_1344 | 313 |
| 87 | 3300050507 | nmdc:mga05p37_3608_c1 | nmdc:mga05p37_3608_c1_16057_17049 | 313 |
| 88 | 3300050510 | nmdc:mga06r32_216706_c1 | nmdc:mga06r32_216706_c1_641_1633 | 313 |
| 89 | 3300050510 | nmdc:mga06r32_271454_c1 | nmdc:mga06r32_271454_c1_91_1083 | 313 |
| 90 | 3300050515 | nmdc:mga0a205_372751_c1 | nmdc:mga0a205_372751_c1_38_1030 | 313 |
| 91 | 3300054114 | Ga0501084_0007682 | Ga0501084_0007682_2504_3496 | 313 |
| 92 | 3300054114 | Ga0501084_0104041 | Ga0501084_0104041_184_1176 | 313 |
| 93 | 3300060353 | Ga0501082_0011415 | Ga0501082_0011415_863_1855 | 313 |
| 94 | 3300060353 | Ga0501082_0024764 | Ga0501082_0024764_1805_2797 | 313 |
| 95 | 3300061734 | Ga0530510_0004765 | Ga0530510_0004765_7266_8258 | 313 |
| 96 | 3300061734 | Ga0530510_0006918 | Ga0530510_0006918_4479_5471 | 313 |
| 97 | 3300061734 | Ga0530510_0008721 | Ga0530510_0008721_4550_5542 | 313 |
| 98 | 3300061734 | Ga0530510_0053834 | Ga0530510_0053834_312_1304 | 313 |
| 99 | 3300005471 | Ga0070698_100043375 | Ga0070698_1000433756 | 314 |
| 100 | 3300005617 | Ga0068859_100064970 | Ga0068859_1000649702 | 314 |
| 101 | 3300006931 | Ga0097620_100064970 | Ga0097620_1000649702 | 314 |
| 102 | 3300033528 | Ga0316588_1009457 | Ga0316588_10094572 | 314 |
| 103 | 3300050509 | nmdc:mga0qj67_320652_c1 | nmdc:mga0qj67_320652_c1_65_1084 | 314 |
| 104 | 3300050510 | nmdc:mga06r32_172802_c1 | nmdc:mga06r32_172802_c1_237_1256 | 314 |
| 105 | 3300003504 | JGI26138J51218_100829 | JGI26138J51218_1008291 | 315 |
| 106 | 3300033541 | Ga0316596_1003232 | Ga0316596_10032325 | 315 |
| 107 | 3300031733 | Ga0316577_10057497 | Ga0316577_100574972 | 316 |
| 108 | 3300032168 | Ga0316593_10000581 | Ga0316593_1000058111 | 316 |
| 109 | 3300038735 | Ga0400485_08047 | Ga0400485_08047_5885_6886 | 316 |
| 110 | 3300038742 | Ga0400486_03968 | Ga0400486_03968_840_1841 | 316 |
| 111 | 3300039093 | Ga0400489_87362 | Ga0400489_87362_48_1070 | 316 |
| 112 | 3300005546 | Ga0070696_100064748 | Ga0070696_1000647482 | 317 |
| 113 | 3300032133 | Ga0316583_10002585 | Ga0316583_100025854 | 317 |
| 114 | 3300036647 | Ga0316582_0026784 | Ga0316582_0026784_845_1891 | 317 |
| 115 | 3300039093 | Ga0400489_68201 | Ga0400489_68201_355_1374 | 317 |
| 116 | 3300050515 | nmdc:mga0a205_80572_c1 | nmdc:mga0a205_80572_c1_216_1235 | 317 |
| 117 | 3300005618 | Ga0068864_100133292 | Ga0068864_1001332923 | 318 |
| 118 | 3300006358 | Ga0068871_100308677 | Ga0068871_1003086772 | 318 |
| 119 | 3300013306 | Ga0163162_10177705 | Ga0163162_101777052 | 318 |
| 120 | 3300031995 | Ga0307409_100329229 | Ga0307409_1003292292 | 318 |
| 121 | 3300046462 | Ga0495651_0080256 | Ga0495651_0080256_807_1826 | 318 |
| 122 | 3300047317 | Ga0495604_0106681 | Ga0495604_0106681_711_1730 | 318 |
| 123 | 3300048088 | Ga0495602_0088045 | Ga0495602_0088045_547_1566 | 318 |
| 124 | 3300031235 | Ga0265330_10000095 | Ga0265330_1000009518 | 319 |
| 125 | 3300031238 | Ga0265332_10000222 | Ga0265332_1000022230 | 319 |
| 126 | 3300031239 | Ga0265328_10034512 | Ga0265328_100345122 | 319 |
| 127 | 3300031240 | Ga0265320_10039072 | Ga0265320_100390722 | 319 |
| 128 | 3300031242 | Ga0265329_10005084 | Ga0265329_100050847 | 319 |
| 129 | 3300031250 | Ga0265331_10025138 | Ga0265331_100251383 | 319 |
| 130 | 3300031344 | Ga0265316_10000450 | Ga0265316_1000045018 | 319 |
| 131 | 3300031711 | Ga0265314_10000076 | Ga0265314_10000076110 | 319 |
| 132 | 3300031712 | Ga0265342_10000759 | Ga0265342_1000075917 | 319 |
| 133 | 3300031727 | Ga0316576_10007134 | Ga0316576_100071349 | 319 |
| 134 | 3300033524 | Ga0316592_1024207 | Ga0316592_10242072 | 319 |
| 135 | 3300039062 | Ga0400483_282171 | Ga0400483_282171_257_1303 | 319 |
| 136 | 3300005614 | Ga0068856_100323434 | Ga0068856_1003234342 | 320 |
| 137 | 3300009094 | Ga0111539_10199637 | Ga0111539_101996372 | 320 |
| 138 | 3300028577 | Ga0265318_10001387 | Ga0265318_100013876 | 320 |
| 139 | 3300028800 | Ga0265338_10190681 | Ga0265338_101906812 | 320 |
| 140 | 3300031241 | Ga0265325_10001575 | Ga0265325_1000157528 | 320 |
| 141 | 3300031247 | Ga0265340_10019984 | Ga0265340_100199841 | 320 |
| 142 | 3300031344 | Ga0265316_10001048 | Ga0265316_1000104816 | 320 |
| 143 | 3300031595 | Ga0265313_10001355 | Ga0265313_1000135525 | 320 |
| 144 | 3300031727 | Ga0316576_10000992 | Ga0316576_100009928 | 320 |
| 145 | 3300033524 | Ga0316592_1000397 | Ga0316592_10003978 | 320 |
| 146 | 3300033528 | Ga0316588_1000005 | Ga0316588_100000526 | 320 |
| 147 | 3300033541 | Ga0316596_1000006 | Ga0316596_100000629 | 320 |
| 148 | 3300035398 | Ga0316574_0126871 | Ga0316574_0126871_204_1241 | 320 |
| 149 | 3300037588 | Ga0316581_0007370 | Ga0316581_0007370_1045_2076 | 320 |
| 150 | 3300050511 | nmdc:mga08y16_180782_c1 | nmdc:mga08y16_180782_c1_366_1337 | 320 |
| 151 | 3300006237 | Ga0097621_100133656 | Ga0097621_1001336562 | 321 |
| 152 | 3300006358 | Ga0068871_100092633 | Ga0068871_1000926332 | 321 |
| 153 | 3300006846 | Ga0075430_100005705 | Ga0075430_1000057054 | 321 |
| 154 | 3300009177 | Ga0105248_10053602 | Ga0105248_100536022 | 321 |
| 155 | 3300028380 | Ga0268265_10199953 | Ga0268265_101999531 | 321 |
| 156 | 3300042876 | Ga0451577_0000828 | Ga0451577_0000828_40163_41134 | 321 |
| 157 | 3300044712 | Ga0453684_0004724 | Ga0453684_0004724_13215_14186 | 321 |
| 158 | 3300044712 | Ga0453684_0010350 | Ga0453684_0010350_7901_8872 | 321 |
| 159 | 3300045051 | Ga0451576_0302429 | Ga0451576_0302429_31_1014 | 321 |
| 160 | 3300046454 | Ga0495592_0096167 | Ga0495592_0096167_686_1660 | 321 |
| 161 | 3300046477 | Ga0495664_0003262 | Ga0495664_0003262_1768_2769 | 321 |
| 162 | 3300046516 | Ga0495628_0199865 | Ga0495628_0199865_301_1275 | 321 |
| 163 | 3300046680 | Ga0495646_0129115 | Ga0495646_0129115_88_1089 | 321 |
| 164 | 3300046690 | Ga0495624_0096301 | Ga0495624_0096301_400_1401 | 321 |
| 165 | 3300047315 | Ga0495581_0090782 | Ga0495581_0090782_198_1199 | 321 |
| 166 | 3300047319 | Ga0495674_0013556 | Ga0495674_0013556_2723_3724 | 321 |
| 167 | 3300047321 | Ga0495676_0154450 | Ga0495676_0154450_409_1410 | 321 |
| 168 | 3300047471 | Ga0495684_0197802 | Ga0495684_0197802_26_1027 | 321 |
| 169 | 3300048915 | Ga0496112_0077009 | Ga0496112_0077009_26_1021 | 321 |
| 170 | 3300049589 | Ga0501073_0148375 | Ga0501073_0148375_48_1022 | 321 |
| 171 | 3300050508 | nmdc:mga09592_21071_c1 | nmdc:mga09592_21071_c1_2669_3694 | 321 |
| 172 | 3300050509 | nmdc:mga0qj67_4157_c1 | nmdc:mga0qj67_4157_c1_9115_10089 | 321 |
| 173 | 3300004799 | Ga0058863_11799350 | Ga0058863_117993502 | 322 |
| 174 | 3300005293 | Ga0065715_10226073 | Ga0065715_102260731 | 322 |
| 175 | 3300005365 | Ga0070688_100174410 | Ga0070688_1001744102 | 322 |
| 176 | 3300005444 | Ga0070694_100264950 | Ga0070694_1002649501 | 322 |
| 177 | 3300005458 | Ga0070681_10401337 | Ga0070681_104013371 | 322 |
| 178 | 3300005563 | Ga0068855_100125423 | Ga0068855_1001254235 | 322 |
| 179 | 3300005617 | Ga0068859_100219325 | Ga0068859_1002193252 | 322 |
| 180 | 3300006931 | Ga0097620_100219325 | Ga0097620_1002193252 | 322 |
| 181 | 3300009147 | Ga0114129_10028222 | Ga0114129_100282226 | 322 |
| 182 | 3300025912 | Ga0207707_10204286 | Ga0207707_102042862 | 322 |
| 183 | 3300025923 | Ga0207681_10069050 | Ga0207681_100690501 | 322 |
| 184 | 3300025925 | Ga0207650_10390255 | Ga0207650_103902551 | 322 |
| 185 | 3300025926 | Ga0207659_10140234 | Ga0207659_101402342 | 322 |
| 186 | 3300025949 | Ga0207667_10072220 | Ga0207667_100722205 | 322 |
| 187 | 3300025960 | Ga0207651_10160927 | Ga0207651_101609272 | 322 |
| 188 | 3300027907 | Ga0207428_10126514 | Ga0207428_101265142 | 322 |
| 189 | 3300031241 | Ga0265325_10000502 | Ga0265325_1000050212 | 322 |
| 190 | 3300031249 | Ga0265339_10000299 | Ga0265339_100002999 | 322 |
| 191 | 3300031250 | Ga0265331_10000134 | Ga0265331_1000013446 | 322 |
| 192 | 3300031595 | Ga0265313_10000316 | Ga0265313_1000031630 | 322 |
| 193 | 3300031711 | Ga0265314_10000413 | Ga0265314_100004138 | 322 |
| 194 | 3300031712 | Ga0265342_10010844 | Ga0265342_100108447 | 322 |
| 195 | 3300032005 | Ga0307411_10081107 | Ga0307411_100811071 | 322 |
| 196 | 3300049592 | Ga0501076_0041428 | Ga0501076_0041428_1654_2631 | 322 |
| 197 | 3300049743 | Ga0501081_0009031 | Ga0501081_0009031_965_1942 | 322 |
| 198 | 3300049824 | Ga0501045_0278171 | Ga0501045_0278171_144_1121 | 322 |
| 199 | 3300050507 | nmdc:mga05p37_337191_c1 | nmdc:mga05p37_337191_c1_585_1568 | 322 |
| 200 | 3300050511 | nmdc:mga08y16_78049_c1 | nmdc:mga08y16_78049_c1_1988_2962 | 322 |
| 201 | 3300050511 | nmdc:mga08y16_80830_c1 | nmdc:mga08y16_80830_c1_90_1064 | 322 |
| 202 | 3300053153 | Ga0500616_0045845 | Ga0500616_0045845_1298_2311 | 322 |
| 203 | 3300061734 | Ga0530510_0030675 | Ga0530510_0030675_990_1967 | 322 |
| 204 | 3300005330 | Ga0070690_100107616 | Ga0070690_1001076162 | 323 |
| 205 | 3300005355 | Ga0070671_100001915 | Ga0070671_10000191526 | 323 |
| 206 | 3300005440 | Ga0070705_100123889 | Ga0070705_1001238892 | 323 |
| 207 | 3300005444 | Ga0070694_100001928 | Ga0070694_1000019284 | 323 |
| 208 | 3300005445 | Ga0070708_100090460 | Ga0070708_1000904603 | 323 |
| 209 | 3300005536 | Ga0070697_100001607 | Ga0070697_1000016078 | 323 |
| 210 | 3300005545 | Ga0070695_100054427 | Ga0070695_1000544273 | 323 |
| 211 | 3300005549 | Ga0070704_100170614 | Ga0070704_1001706142 | 323 |
| 212 | 3300005617 | Ga0068859_100051052 | Ga0068859_1000510523 | 323 |
| 213 | 3300005617 | Ga0068859_100151351 | Ga0068859_1001513512 | 323 |
| 214 | 3300005719 | Ga0068861_100031668 | Ga0068861_1000316683 | 323 |
| 215 | 3300005842 | Ga0068858_100125149 | Ga0068858_1001251492 | 323 |
| 216 | 3300006844 | Ga0075428_100000542 | Ga0075428_1000005423 | 323 |
| 217 | 3300006844 | Ga0075428_100072820 | Ga0075428_1000728203 | 323 |
| 218 | 3300006844 | Ga0075428_100456962 | Ga0075428_1004569622 | 323 |
| 219 | 3300006846 | Ga0075430_100042805 | Ga0075430_1000428052 | 323 |
| 220 | 3300006847 | Ga0075431_100042954 | Ga0075431_1000429543 | 323 |
| 221 | 3300006931 | Ga0097620_100051049 | Ga0097620_1000510493 | 323 |
| 222 | 3300006931 | Ga0097620_100151350 | Ga0097620_1001513502 | 323 |
| 223 | 3300009094 | Ga0111539_10011746 | Ga0111539_100117468 | 323 |
| 224 | 3300009094 | Ga0111539_10014963 | Ga0111539_1001496316 | 323 |
| 225 | 3300009176 | Ga0105242_10279018 | Ga0105242_102790182 | 323 |
| 226 | 3300014326 | Ga0157380_10063989 | Ga0157380_100639893 | 323 |
| 227 | 3300025931 | Ga0207644_10000319 | Ga0207644_1000031915 | 323 |
| 228 | 3300025933 | Ga0207706_10085842 | Ga0207706_100858423 | 323 |
| 229 | 3300025936 | Ga0207670_10359030 | Ga0207670_103590302 | 323 |
| 230 | 3300025961 | Ga0207712_10146734 | Ga0207712_101467342 | 323 |
| 231 | 3300026035 | Ga0207703_10272600 | Ga0207703_102726002 | 323 |
| 232 | 3300026118 | Ga0207675_100025528 | Ga0207675_1000255282 | 323 |
| 233 | 3300027907 | Ga0207428_10044112 | Ga0207428_100441126 | 323 |
| 234 | 3300032168 | Ga0316593_10004875 | Ga0316593_100048753 | 323 |
| 235 | 3300035116 | Ga0373945_0061054 | Ga0373945_0061054_203_1183 | 323 |
| 236 | 3300037068 | Ga0373925_0002179 | Ga0373925_0002179_10319_11299 | 323 |
| 237 | 3300042876 | Ga0451577_0008521 | Ga0451577_0008521_5281_6261 | 323 |
| 238 | 3300044712 | Ga0453684_0111569 | Ga0453684_0111569_1927_2907 | 323 |
| 239 | 3300046455 | Ga0495603_0058712 | Ga0495603_0058712_756_1736 | 323 |
| 240 | 3300046459 | Ga0495629_0000126 | Ga0495629_0000126_56272_57252 | 323 |
| 241 | 3300046461 | Ga0495641_0016753 | Ga0495641_0016753_215_1195 | 323 |
| 242 | 3300046475 | Ga0495639_0000121 | Ga0495639_0000121_7640_8620 | 323 |
| 243 | 3300046475 | Ga0495639_0012434 | Ga0495639_0012434_2665_3645 | 323 |
| 244 | 3300046499 | Ga0495594_0009365 | Ga0495594_0009365_3971_4951 | 323 |
| 245 | 3300046514 | Ga0495618_0033611 | Ga0495618_0033611_406_1386 | 323 |
| 246 | 3300046526 | Ga0495666_0019669 | Ga0495666_0019669_1582_2562 | 323 |
| 247 | 3300046533 | Ga0495640_0084624 | Ga0495640_0084624_225_1205 | 323 |
| 248 | 3300046535 | Ga0495586_0006882 | Ga0495586_0006882_829_1809 | 323 |
| 249 | 3300046535 | Ga0495586_0012323 | Ga0495586_0012323_1887_2867 | 323 |
| 250 | 3300046557 | Ga0495622_0036714 | Ga0495622_0036714_184_1164 | 323 |
| 251 | 3300046663 | Ga0495635_0001003 | Ga0495635_0001003_2647_3627 | 323 |
| 252 | 3300046663 | Ga0495635_0001790 | Ga0495635_0001790_3990_4970 | 323 |
| 253 | 3300046681 | Ga0495647_0001519 | Ga0495647_0001519_3414_4394 | 323 |
| 254 | 3300046681 | Ga0495647_0016102 | Ga0495647_0016102_720_1700 | 323 |
| 255 | 3300046683 | Ga0495658_0000327 | Ga0495658_0000327_10380_11360 | 323 |
| 256 | 3300046683 | Ga0495658_0004909 | Ga0495658_0004909_1996_2976 | 323 |
| 257 | 3300046689 | Ga0495613_0025308 | Ga0495613_0025308_3366_4346 | 323 |
| 258 | 3300046690 | Ga0495624_0155658 | Ga0495624_0155658_289_1269 | 323 |
| 259 | 3300046809 | Ga0495600_0020741 | Ga0495600_0020741_2565_3545 | 323 |
| 260 | 3300047315 | Ga0495581_0000280 | Ga0495581_0000280_13580_14560 | 323 |
| 261 | 3300047321 | Ga0495676_0020676 | Ga0495676_0020676_485_1465 | 323 |
| 262 | 3300047321 | Ga0495676_0040130 | Ga0495676_0040130_95_1075 | 323 |
| 263 | 3300047322 | Ga0495680_0000838 | Ga0495680_0000838_17165_18145 | 323 |
| 264 | 3300047322 | Ga0495680_0001860 | Ga0495680_0001860_2910_3890 | 323 |
| 265 | 3300047471 | Ga0495684_0006640 | Ga0495684_0006640_5323_6303 | 323 |
| 266 | 3300047471 | Ga0495684_0177441 | Ga0495684_0177441_171_1151 | 323 |
| 267 | 3300048089 | Ga0495614_0002522 | Ga0495614_0002522_5712_6692 | 323 |
| 268 | 3300049571 | Ga0501034_0053308 | Ga0501034_0053308_2894_3874 | 323 |
| 269 | 3300049590 | Ga0501074_0294187 | Ga0501074_0294187_22_1002 | 323 |
| 270 | 3300050507 | nmdc:mga05p37_274730_c1 | nmdc:mga05p37_274730_c1_526_1506 | 323 |
| 271 | 3300050511 | nmdc:mga08y16_123937_c1 | nmdc:mga08y16_123937_c1_1298_2278 | 323 |
| 272 | 3300050511 | nmdc:mga08y16_8355_c1 | nmdc:mga08y16_8355_c1_3809_4789 | 323 |
| 273 | 3300053085 | Ga0495619_0001327 | Ga0495619_0001327_9142_10122 | 323 |
| 274 | 3300053085 | Ga0495619_0138280 | Ga0495619_0138280_81_1061 | 323 |
| 275 | 3300005366 | Ga0070659_100224456 | Ga0070659_1002244561 | 324 |
| 276 | 3300006846 | Ga0075430_100075246 | Ga0075430_1000752461 | 324 |
| 277 | 3300032002 | Ga0307416_100012158 | Ga0307416_1000121585 | 324 |
| 278 | 3300032005 | Ga0307411_10010242 | Ga0307411_100102422 | 324 |
| 279 | 3300032126 | Ga0307415_100085523 | Ga0307415_1000855232 | 324 |
| 280 | 3300042876 | Ga0451577_0234273 | Ga0451577_0234273_541_1560 | 324 |
| 281 | 3300049587 | Ga0501071_0227418 | Ga0501071_0227418_147_1130 | 324 |
| 282 | 3300049742 | Ga0501080_0167550 | Ga0501080_0167550_555_1538 | 324 |
| 283 | 3300049743 | Ga0501081_0099477 | Ga0501081_0099477_461_1444 | 324 |
| 284 | 3300013104 | Ga0157370_10509273 | Ga0157370_105092731 | 325 |
| 285 | 3300025936 | Ga0207670_10077018 | Ga0207670_100770183 | 325 |
| 286 | 3300028577 | Ga0265318_10000273 | Ga0265318_1000027328 | 325 |
| 287 | 3300031235 | Ga0265330_10000998 | Ga0265330_100009985 | 325 |
| 288 | 3300031238 | Ga0265332_10000280 | Ga0265332_1000028028 | 325 |
| 289 | 3300031240 | Ga0265320_10000485 | Ga0265320_1000048515 | 325 |
| 290 | 3300031241 | Ga0265325_10042041 | Ga0265325_100420413 | 325 |
| 291 | 3300031242 | Ga0265329_10000013 | Ga0265329_1000001327 | 325 |
| 292 | 3300031247 | Ga0265340_10000189 | Ga0265340_1000018915 | 325 |
| 293 | 3300031249 | Ga0265339_10008773 | Ga0265339_100087733 | 325 |
| 294 | 3300031250 | Ga0265331_10002207 | Ga0265331_1000220717 | 325 |
| 295 | 3300031344 | Ga0265316_10002957 | Ga0265316_100029575 | 325 |
| 296 | 3300031595 | Ga0265313_10000463 | Ga0265313_1000046328 | 325 |
| 297 | 3300031711 | Ga0265314_10002804 | Ga0265314_1000280428 | 325 |
| 298 | 3300031712 | Ga0265342_10000471 | Ga0265342_1000047127 | 325 |
| 299 | 3300047319 | Ga0495674_0010169 | Ga0495674_0010169_7889_8878 | 325 |
| 300 | 3300048918 | Ga0496115_0020289 | Ga0496115_0020289_2898_3920 | 325 |
| 301 | 3300049571 | Ga0501034_0303293 | Ga0501034_0303293_21_1010 | 325 |
| 302 | 3300049576 | Ga0501040_0345965 | Ga0501040_0345965_44_1030 | 325 |
| 303 | 3300059506 | Ga0587085_001311 | Ga0587085_001311_409_1407 | 325 |
| 304 | 3300006237 | Ga0097621_100202538 | Ga0097621_1002025382 | 326 |
| 305 | 3300013297 | Ga0157378_10050923 | Ga0157378_100509236 | 326 |
| 306 | 3300050507 | nmdc:mga05p37_54976_c1 | nmdc:mga05p37_54976_c1_3726_4715 | 326 |
| 307 | 3300050510 | nmdc:mga06r32_7628_c1 | nmdc:mga06r32_7628_c1_4385_5374 | 326 |
| 308 | 3300004801 | Ga0058860_12161439 | Ga0058860_121614398 | 327 |
| 309 | 3300005293 | Ga0065715_10122190 | Ga0065715_101221903 | 327 |
| 310 | 3300005331 | Ga0070670_100014297 | Ga0070670_1000142976 | 327 |
| 311 | 3300005335 | Ga0070666_10010358 | Ga0070666_100103582 | 327 |
| 312 | 3300005338 | Ga0068868_100334682 | Ga0068868_1003346822 | 327 |
| 313 | 3300005340 | Ga0070689_100075687 | Ga0070689_1000756874 | 327 |
| 314 | 3300005354 | Ga0070675_100000102 | Ga0070675_1000001022 | 327 |
| 315 | 3300005354 | Ga0070675_100002074 | Ga0070675_1000020746 | 327 |
| 316 | 3300005354 | Ga0070675_100008285 | Ga0070675_1000082852 | 327 |
| 317 | 3300005355 | Ga0070671_100016587 | Ga0070671_1000165877 | 327 |
| 318 | 3300005356 | Ga0070674_100091897 | Ga0070674_1000918972 | 327 |
| 319 | 3300005364 | Ga0070673_100007622 | Ga0070673_1000076227 | 327 |
| 320 | 3300005365 | Ga0070688_100038207 | Ga0070688_1000382073 | 327 |
| 321 | 3300005365 | Ga0070688_100051462 | Ga0070688_1000514622 | 327 |
| 322 | 3300005367 | Ga0070667_100020021 | Ga0070667_1000200215 | 327 |
| 323 | 3300005367 | Ga0070667_100022644 | Ga0070667_1000226447 | 327 |
| 324 | 3300005438 | Ga0070701_10057367 | Ga0070701_100573673 | 327 |
| 325 | 3300005466 | Ga0070685_10029887 | Ga0070685_100298873 | 327 |
| 326 | 3300005466 | Ga0070685_10221497 | Ga0070685_102214971 | 327 |
| 327 | 3300005543 | Ga0070672_100213444 | Ga0070672_1002134441 | 327 |
| 328 | 3300005544 | Ga0070686_100086509 | Ga0070686_1000865092 | 327 |
| 329 | 3300005544 | Ga0070686_100156464 | Ga0070686_1001564641 | 327 |
| 330 | 3300005546 | Ga0070696_100062684 | Ga0070696_1000626844 | 327 |
| 331 | 3300005549 | Ga0070704_100033596 | Ga0070704_1000335962 | 327 |
| 332 | 3300005564 | Ga0070664_100005021 | Ga0070664_10000502121 | 327 |
| 333 | 3300005617 | Ga0068859_100000703 | Ga0068859_1000007037 | 327 |
| 334 | 3300005617 | Ga0068859_100006716 | Ga0068859_10000671614 | 327 |
| 335 | 3300005841 | Ga0068863_100000422 | Ga0068863_10000042230 | 327 |
| 336 | 3300005842 | Ga0068858_100062457 | Ga0068858_1000624574 | 327 |
| 337 | 3300005842 | Ga0068858_100125452 | Ga0068858_1001254522 | 327 |
| 338 | 3300005843 | Ga0068860_100012322 | Ga0068860_1000123226 | 327 |
| 339 | 3300005981 | Ga0081538_10001299 | Ga0081538_1000129935 | 327 |
| 340 | 3300005981 | Ga0081538_10019881 | Ga0081538_100198814 | 327 |
| 341 | 3300006237 | Ga0097621_100015996 | Ga0097621_1000159963 | 327 |
| 342 | 3300006358 | Ga0068871_100241985 | Ga0068871_1002419852 | 327 |
| 343 | 3300006844 | Ga0075428_100236114 | Ga0075428_1002361142 | 327 |
| 344 | 3300006852 | Ga0075433_10371159 | Ga0075433_103711591 | 327 |
| 345 | 3300006931 | Ga0097620_100000703 | Ga0097620_1000007037 | 327 |
| 346 | 3300006931 | Ga0097620_100006716 | Ga0097620_10000671614 | 327 |
| 347 | 3300007076 | Ga0075435_100182241 | Ga0075435_1001822411 | 327 |
| 348 | 3300009094 | Ga0111539_10019680 | Ga0111539_100196802 | 327 |
| 349 | 3300009094 | Ga0111539_10055434 | Ga0111539_100554343 | 327 |
| 350 | 3300009176 | Ga0105242_10035707 | Ga0105242_100357075 | 327 |
| 351 | 3300009177 | Ga0105248_10000244 | Ga0105248_1000024425 | 327 |
| 352 | 3300013306 | Ga0163162_10007110 | Ga0163162_100071107 | 327 |
| 353 | 3300013306 | Ga0163162_10747883 | Ga0163162_107478831 | 327 |
| 354 | 3300013308 | Ga0157375_10000216 | Ga0157375_1000021638 | 327 |
| 355 | 3300014325 | Ga0163163_10021966 | Ga0163163_100219669 | 327 |
| 356 | 3300014326 | Ga0157380_10140719 | Ga0157380_101407192 | 327 |
| 357 | 3300014745 | Ga0157377_10054382 | Ga0157377_100543824 | 327 |
| 358 | 3300014968 | Ga0157379_10000091 | Ga0157379_1000009142 | 327 |
| 359 | 3300017792 | Ga0163161_10022185 | Ga0163161_100221857 | 327 |
| 360 | 3300025925 | Ga0207650_10101995 | Ga0207650_101019951 | 327 |
| 361 | 3300025926 | Ga0207659_10002514 | Ga0207659_1000251422 | 327 |
| 362 | 3300025926 | Ga0207659_10005064 | Ga0207659_100050648 | 327 |
| 363 | 3300025926 | Ga0207659_10013347 | Ga0207659_100133473 | 327 |
| 364 | 3300025933 | Ga0207706_10161671 | Ga0207706_101616712 | 327 |
| 365 | 3300025934 | Ga0207686_10012174 | Ga0207686_100121746 | 327 |
| 366 | 3300025936 | Ga0207670_10021806 | Ga0207670_100218062 | 327 |
| 367 | 3300025937 | Ga0207669_10151660 | Ga0207669_101516602 | 327 |
| 368 | 3300025939 | Ga0207665_10142439 | Ga0207665_101424392 | 327 |
| 369 | 3300025940 | Ga0207691_10134892 | Ga0207691_101348922 | 327 |
| 370 | 3300025941 | Ga0207711_10003595 | Ga0207711_100035954 | 327 |
| 371 | 3300025942 | Ga0207689_10098611 | Ga0207689_100986114 | 327 |
| 372 | 3300025945 | Ga0207679_10018240 | Ga0207679_100182402 | 327 |
| 373 | 3300025945 | Ga0207679_10384177 | Ga0207679_103841772 | 327 |
| 374 | 3300025960 | Ga0207651_10004211 | Ga0207651_100042117 | 327 |
| 375 | 3300025986 | Ga0207658_10039755 | Ga0207658_100397555 | 327 |
| 376 | 3300025986 | Ga0207658_10047025 | Ga0207658_100470253 | 327 |
| 377 | 3300026023 | Ga0207677_10367173 | Ga0207677_103671732 | 327 |
| 378 | 3300026035 | Ga0207703_10007843 | Ga0207703_100078433 | 327 |
| 379 | 3300026088 | Ga0207641_10000293 | Ga0207641_1000029352 | 327 |
| 380 | 3300028380 | Ga0268265_10308471 | Ga0268265_103084712 | 327 |
| 381 | 3300028381 | Ga0268264_10008889 | Ga0268264_100088897 | 327 |
| 382 | 3300028381 | Ga0268264_10051818 | Ga0268264_100518182 | 327 |
| 383 | 3300031727 | Ga0316576_10048108 | Ga0316576_100481082 | 327 |
| 384 | 3300031733 | Ga0316577_10044815 | Ga0316577_100448153 | 327 |
| 385 | 3300033524 | Ga0316592_1002468 | Ga0316592_10024686 | 327 |
| 386 | 3300033541 | Ga0316596_1001245 | Ga0316596_10012453 | 327 |
| 387 | 3300039062 | Ga0400483_206886 | Ga0400483_206886_1075_2076 | 327 |
| 388 | 3300047318 | Ga0495636_0004364 | Ga0495636_0004364_4037_5029 | 327 |
| 389 | 3300049571 | Ga0501034_0102596 | Ga0501034_0102596_1677_2684 | 327 |
| 390 | 3300050511 | nmdc:mga08y16_10220_c1 | nmdc:mga08y16_10220_c1_7941_8933 | 327 |
| 391 | 3300050513 | nmdc:mga0rr50_171119_c1 | nmdc:mga0rr50_171119_c1_91_1092 | 327 |
| 392 | 3300059511 | Ga0587091_009936 | Ga0587091_009936_283_1290 | 327 |
| 393 | 3300005293 | Ga0065715_10104520 | Ga0065715_101045202 | 328 |
| 394 | 3300005330 | Ga0070690_100000832 | Ga0070690_1000008322 | 328 |
| 395 | 3300005331 | Ga0070670_100001731 | Ga0070670_10000173110 | 328 |
| 396 | 3300005335 | Ga0070666_10004312 | Ga0070666_100043125 | 328 |
| 397 | 3300005338 | Ga0068868_100023242 | Ga0068868_1000232425 | 328 |
| 398 | 3300005340 | Ga0070689_100074153 | Ga0070689_1000741531 | 328 |
| 399 | 3300005344 | Ga0070661_100059685 | Ga0070661_1000596853 | 328 |
| 400 | 3300005354 | Ga0070675_100102461 | Ga0070675_1001024613 | 328 |
| 401 | 3300005354 | Ga0070675_100112715 | Ga0070675_1001127152 | 328 |
| 402 | 3300005355 | Ga0070671_100031304 | Ga0070671_1000313046 | 328 |
| 403 | 3300005364 | Ga0070673_100002597 | Ga0070673_10000259711 | 328 |
| 404 | 3300005365 | Ga0070688_100133628 | Ga0070688_1001336281 | 328 |
| 405 | 3300005367 | Ga0070667_100002116 | Ga0070667_1000021165 | 328 |
| 406 | 3300005543 | Ga0070672_100006620 | Ga0070672_1000066208 | 328 |
| 407 | 3300005564 | Ga0070664_100002539 | Ga0070664_10000253917 | 328 |
| 408 | 3300005577 | Ga0068857_100236856 | Ga0068857_1002368562 | 328 |
| 409 | 3300005618 | Ga0068864_100006004 | Ga0068864_1000060042 | 328 |
| 410 | 3300005618 | Ga0068864_100469165 | Ga0068864_1004691652 | 328 |
| 411 | 3300005841 | Ga0068863_100391856 | Ga0068863_1003918561 | 328 |
| 412 | 3300005842 | Ga0068858_100499190 | Ga0068858_1004991902 | 328 |
| 413 | 3300005842 | Ga0068858_100563358 | Ga0068858_1005633581 | 328 |
| 414 | 3300006237 | Ga0097621_100025188 | Ga0097621_1000251881 | 328 |
| 415 | 3300006237 | Ga0097621_100361951 | Ga0097621_1003619512 | 328 |
| 416 | 3300006358 | Ga0068871_100123853 | Ga0068871_1001238533 | 328 |
| 417 | 3300006358 | Ga0068871_100276296 | Ga0068871_1002762961 | 328 |
| 418 | 3300006847 | Ga0075431_100306563 | Ga0075431_1003065632 | 328 |
| 419 | 3300009176 | Ga0105242_10248563 | Ga0105242_102485632 | 328 |
| 420 | 3300009177 | Ga0105248_10116700 | Ga0105248_101167006 | 328 |
| 421 | 3300011119 | Ga0105246_10066760 | Ga0105246_100667603 | 328 |
| 422 | 3300013296 | Ga0157374_10345580 | Ga0157374_103455801 | 328 |
| 423 | 3300013306 | Ga0163162_10000450 | Ga0163162_1000045011 | 328 |
| 424 | 3300013306 | Ga0163162_10175321 | Ga0163162_101753213 | 328 |
| 425 | 3300013308 | Ga0157375_10000704 | Ga0157375_100007041 | 328 |
| 426 | 3300013308 | Ga0157375_10713343 | Ga0157375_107133431 | 328 |
| 427 | 3300014325 | Ga0163163_10037938 | Ga0163163_100379381 | 328 |
| 428 | 3300025903 | Ga0207680_10002543 | Ga0207680_100025438 | 328 |
| 429 | 3300025907 | Ga0207645_10234951 | Ga0207645_102349511 | 328 |
| 430 | 3300025920 | Ga0207649_10055401 | Ga0207649_100554012 | 328 |
| 431 | 3300025925 | Ga0207650_10005011 | Ga0207650_1000501118 | 328 |
| 432 | 3300025925 | Ga0207650_10280551 | Ga0207650_102805511 | 328 |
| 433 | 3300025926 | Ga0207659_10155545 | Ga0207659_101555452 | 328 |
| 434 | 3300025931 | Ga0207644_10173842 | Ga0207644_101738421 | 328 |
| 435 | 3300025940 | Ga0207691_10025137 | Ga0207691_100251377 | 328 |
| 436 | 3300025941 | Ga0207711_10228394 | Ga0207711_102283942 | 328 |
| 437 | 3300025945 | Ga0207679_10003650 | Ga0207679_100036502 | 328 |
| 438 | 3300025986 | Ga0207658_10001060 | Ga0207658_100010606 | 328 |
| 439 | 3300026023 | Ga0207677_10015860 | Ga0207677_100158602 | 328 |
| 440 | 3300026088 | Ga0207641_10043328 | Ga0207641_100433282 | 328 |
| 441 | 3300026088 | Ga0207641_10064915 | Ga0207641_100649151 | 328 |
| 442 | 3300026095 | Ga0207676_10000787 | Ga0207676_1000078714 | 328 |
| 443 | 3300026095 | Ga0207676_10527294 | Ga0207676_105272941 | 328 |
| 444 | 3300027907 | Ga0207428_10042349 | Ga0207428_100423491 | 328 |
| 445 | 3300031665 | Ga0316575_10001284 | Ga0316575_100012848 | 328 |
| 446 | 3300031691 | Ga0316579_10039180 | Ga0316579_100391802 | 328 |
| 447 | 3300031727 | Ga0316576_10013503 | Ga0316576_100135032 | 328 |
| 448 | 3300031728 | Ga0316578_10025877 | Ga0316578_100258774 | 328 |
| 449 | 3300031733 | Ga0316577_10025885 | Ga0316577_100258851 | 328 |
| 450 | 3300035117 | Ga0373953_0009969 | Ga0373953_0009969_549_1547 | 328 |
| 451 | 3300035120 | Ga0373957_0026847 | Ga0373957_0026847_691_1689 | 328 |
| 452 | 3300035398 | Ga0316574_0039406 | Ga0316574_0039406_1237_2259 | 328 |
| 453 | 3300035398 | Ga0316574_0048969 | Ga0316574_0048969_840_1853 | 328 |
| 454 | 3300035398 | Ga0316574_0140894 | Ga0316574_0140894_412_1413 | 328 |
| 455 | 3300035410 | Ga0373924_0028155 | Ga0373924_0028155_781_1779 | 328 |
| 456 | 3300036401 | Ga0373937_0017617 | Ga0373937_0017617_2768_3766 | 328 |
| 457 | 3300036401 | Ga0373937_0045525 | Ga0373937_0045525_32_1030 | 328 |
| 458 | 3300036647 | Ga0316582_0003012 | Ga0316582_0003012_1167_2180 | 328 |
| 459 | 3300036712 | Ga0316584_0009321 | Ga0316584_0009321_1701_2702 | 328 |
| 460 | 3300046459 | Ga0495629_0053214 | Ga0495629_0053214_1116_2114 | 328 |
| 461 | 3300046472 | Ga0495580_0040045 | Ga0495580_0040045_1922_2920 | 328 |
| 462 | 3300046511 | Ga0495608_0015057 | Ga0495608_0015057_3197_4195 | 328 |
| 463 | 3300046529 | Ga0495652_0246772 | Ga0495652_0246772_154_1152 | 328 |
| 464 | 3300046536 | Ga0495587_0196125 | Ga0495587_0196125_74_1072 | 328 |
| 465 | 3300046559 | Ga0495667_0000559 | Ga0495667_0000559_5555_6553 | 328 |
| 466 | 3300046681 | Ga0495647_0020678 | Ga0495647_0020678_352_1350 | 328 |
| 467 | 3300046689 | Ga0495613_0007236 | Ga0495613_0007236_1253_2251 | 328 |
| 468 | 3300046689 | Ga0495613_0011880 | Ga0495613_0011880_2406_3404 | 328 |
| 469 | 3300047319 | Ga0495674_0160794 | Ga0495674_0160794_841_1839 | 328 |
| 470 | 3300047471 | Ga0495684_0115057 | Ga0495684_0115057_500_1498 | 328 |
| 471 | 3300050508 | nmdc:mga09592_10768_c1 | nmdc:mga09592_10768_c1_6077_7072 | 328 |
| 472 | 3300050509 | nmdc:mga0qj67_205352_c1 | nmdc:mga0qj67_205352_c1_59_1060 | 328 |
| 473 | 3300050511 | nmdc:mga08y16_13125_c1 | nmdc:mga08y16_13125_c1_5028_6023 | 328 |
| 474 | 3300004799 | Ga0058863_10079010 | Ga0058863_100790107 | 329 |
| 475 | 3300004800 | Ga0058861_11963644 | Ga0058861_119636442 | 329 |
| 476 | 3300004803 | Ga0058862_12711381 | Ga0058862_127113812 | 329 |
| 477 | 3300005329 | Ga0070683_100107294 | Ga0070683_1001072944 | 329 |
| 478 | 3300005468 | Ga0070707_100031674 | Ga0070707_1000316746 | 329 |
| 479 | 3300006844 | Ga0075428_100032985 | Ga0075428_1000329856 | 329 |
| 480 | 3300006852 | Ga0075433_10008964 | Ga0075433_100089646 | 329 |
| 481 | 3300006852 | Ga0075433_10132392 | Ga0075433_101323921 | 329 |
| 482 | 3300006871 | Ga0075434_100005032 | Ga0075434_10000503212 | 329 |
| 483 | 3300006871 | Ga0075434_100029963 | Ga0075434_1000299632 | 329 |
| 484 | 3300006871 | Ga0075434_100049382 | Ga0075434_1000493825 | 329 |
| 485 | 3300006871 | Ga0075434_100184395 | Ga0075434_1001843952 | 329 |
| 486 | 3300006871 | Ga0075434_100582823 | Ga0075434_1005828231 | 329 |
| 487 | 3300007076 | Ga0075435_100017305 | Ga0075435_1000173054 | 329 |
| 488 | 3300009094 | Ga0111539_10121685 | Ga0111539_101216853 | 329 |
| 489 | 3300009094 | Ga0111539_10183957 | Ga0111539_101839573 | 329 |
| 490 | 3300009147 | Ga0114129_10000897 | Ga0114129_1000089728 | 329 |
| 491 | 3300009147 | Ga0114129_10050581 | Ga0114129_100505814 | 329 |
| 492 | 3300009147 | Ga0114129_10196820 | Ga0114129_101968201 | 329 |
| 493 | 3300009147 | Ga0114129_10322078 | Ga0114129_103220782 | 329 |
| 494 | 3300009147 | Ga0114129_10563868 | Ga0114129_105638682 | 329 |
| 495 | 3300025917 | Ga0207660_10250821 | Ga0207660_102508211 | 329 |
| 496 | 3300025921 | Ga0207652_10082558 | Ga0207652_100825581 | 329 |
| 497 | 3300025922 | Ga0207646_10022559 | Ga0207646_100225597 | 329 |
| 498 | 3300025944 | Ga0207661_10037496 | Ga0207661_100374964 | 329 |
| 499 | 3300031548 | Ga0307408_100218385 | Ga0307408_1002183851 | 329 |
| 500 | 3300031727 | Ga0316576_10004459 | Ga0316576_100044598 | 329 |
| 501 | 3300031727 | Ga0316576_10015660 | Ga0316576_100156602 | 329 |
| 502 | 3300031728 | Ga0316578_10018044 | Ga0316578_100180442 | 329 |
| 503 | 3300033541 | Ga0316596_1000192 | Ga0316596_10001924 | 329 |
| 504 | 3300035691 | Ga0373931_0042588 | Ga0373931_0042588_1132_2136 | 329 |
| 505 | 3300036401 | Ga0373937_0335299 | Ga0373937_0335299_345_1349 | 329 |
| 506 | 3300039062 | Ga0400483_110311 | Ga0400483_110311_117_1124 | 329 |
| 507 | 3300039062 | Ga0400483_224663 | Ga0400483_224663_533_1537 | 329 |
| 508 | 3300039062 | Ga0400483_235488 | Ga0400483_235488_443_1450 | 329 |
| 509 | 3300039447 | Ga0436361_0045516 | Ga0436361_0045516_1284_2294 | 329 |
| 510 | 3300046537 | Ga0495598_0000163 | Ga0495598_0000163_7496_8509 | 329 |
| 511 | 3300048913 | Ga0496110_0202503 | Ga0496110_0202503_576_1589 | 329 |
| 512 | 3300049541 | Ga0501325_000595 | Ga0501325_000595_621_1655 | 329 |
| 513 | 3300050507 | nmdc:mga05p37_2129_c1 | nmdc:mga05p37_2129_c1_8786_9790 | 329 |
| 514 | 3300050507 | nmdc:mga05p37_261673_c1 | nmdc:mga05p37_261673_c1_872_1876 | 329 |
| 515 | 3300050507 | nmdc:mga05p37_26696_c1 | nmdc:mga05p37_26696_c1_1462_2463 | 329 |
| 516 | 3300050507 | nmdc:mga05p37_334466_c1 | nmdc:mga05p37_334466_c1_48_1052 | 329 |
| 517 | 3300050507 | nmdc:mga05p37_38747_c1 | nmdc:mga05p37_38747_c1_4173_5177 | 329 |
| 518 | 3300050507 | nmdc:mga05p37_463780_c1 | nmdc:mga05p37_463780_c1_272_1276 | 329 |
| 519 | 3300050510 | nmdc:mga06r32_71716_c1 | nmdc:mga06r32_71716_c1_1241_2245 | 329 |
| 520 | 3300050511 | nmdc:mga08y16_133747_c1 | nmdc:mga08y16_133747_c1_519_1523 | 329 |
| 521 | 3300050512 | nmdc:mga0n895_11252_c1 | nmdc:mga0n895_11252_c1_6773_7774 | 329 |
| 522 | 3300050512 | nmdc:mga0n895_1213_c1 | nmdc:mga0n895_1213_c1_6920_7924 | 329 |
| 523 | 3300050512 | nmdc:mga0n895_282350_c1 | nmdc:mga0n895_282350_c1_608_1612 | 329 |
| 524 | 3300050512 | nmdc:mga0n895_47933_c1 | nmdc:mga0n895_47933_c1_1478_2482 | 329 |
| 525 | 3300050512 | nmdc:mga0n895_71242_c1 | nmdc:mga0n895_71242_c1_2246_3250 | 329 |
| 526 | 3300050515 | nmdc:mga0a205_123282_c1 | nmdc:mga0a205_123282_c1_551_1552 | 329 |
| 527 | 3300050515 | nmdc:mga0a205_23805_c1 | nmdc:mga0a205_23805_c1_2215_3219 | 329 |
| 528 | 3300059647 | Ga0587079_020187 | Ga0587079_020187_19_1032 | 329 |
| 529 | 3300060346 | Ga0587111_0014198 | Ga0587111_0014198_183_1187 | 329 |
| 530 | iso_pu_bacteria | 2740891818 | 2740990488 | 329 |
| 531 | 3300005295 | Ga0065707_10082720 | Ga0065707_1008272015 | 330 |
| 532 | 3300005444 | Ga0070694_100173158 | Ga0070694_1001731581 | 330 |
| 533 | 3300005549 | Ga0070704_100006043 | Ga0070704_1000060435 | 330 |
| 534 | 3300013297 | Ga0157378_10177282 | Ga0157378_101772822 | 330 |
| 535 | 3300014969 | Ga0157376_10216257 | Ga0157376_102162572 | 330 |
| 536 | 3300025961 | Ga0207712_10010203 | Ga0207712_100102034 | 330 |
| 537 | 3300031665 | Ga0316575_10056631 | Ga0316575_100566312 | 330 |
| 538 | 3300032168 | Ga0316593_10000043 | Ga0316593_100000433 | 330 |
| 539 | 3300032168 | Ga0316593_10030235 | Ga0316593_100302351 | 330 |
| 540 | 3300033528 | Ga0316588_1000859 | Ga0316588_10008593 | 330 |
| 541 | 3300033529 | Ga0316587_1008755 | Ga0316587_10087551 | 330 |
| 542 | 3300033541 | Ga0316596_1028802 | Ga0316596_10288022 | 330 |
| 543 | 3300046543 | Ga0495645_0091263 | Ga0495645_0091263_533_1570 | 330 |
| 544 | 3300047318 | Ga0495636_0001669 | Ga0495636_0001669_2983_4002 | 330 |
| 545 | 3300050494 | nmdc:mga06z11_91683_c1 | nmdc:mga06z11_91683_c1_210_1295 | 330 |
| 546 | 3300004799 | Ga0058863_11878586 | Ga0058863_118785861 | 331 |
| 547 | 3300005356 | Ga0070674_100064977 | Ga0070674_1000649773 | 331 |
| 548 | 3300005458 | Ga0070681_10046903 | Ga0070681_100469032 | 331 |
| 549 | 3300005467 | Ga0070706_100004471 | Ga0070706_10000447114 | 331 |
| 550 | 3300005467 | Ga0070706_100306085 | Ga0070706_1003060851 | 331 |
| 551 | 3300005518 | Ga0070699_100028609 | Ga0070699_1000286097 | 331 |
| 552 | 3300005536 | Ga0070697_100030323 | Ga0070697_1000303236 | 331 |
| 553 | 3300007788 | Ga0099795_10094504 | Ga0099795_100945041 | 331 |
| 554 | 3300013100 | Ga0157373_10006194 | Ga0157373_100061942 | 331 |
| 555 | 3300013100 | Ga0157373_10159379 | Ga0157373_101593791 | 331 |
| 556 | 3300026118 | Ga0207675_100481361 | Ga0207675_1004813611 | 331 |
| 557 | 3300028800 | Ga0265338_10122313 | Ga0265338_101223131 | 331 |
| 558 | 3300032168 | Ga0316593_10016904 | Ga0316593_100169042 | 331 |
| 559 | 3300037853 | Ga0436364_1158423 | Ga0436364_1158423_4074_5117 | 331 |
| 560 | 3300038726 | Ga0400490_17491 | Ga0400490_17491_14243_15271 | 331 |
| 561 | 3300044673 | Ga0453683_0001684 | Ga0453683_0001684_13896_14912 | 331 |
| 562 | 3300044673 | Ga0453683_0022862 | Ga0453683_0022862_2373_3392 | 331 |
| 563 | 3300044712 | Ga0453684_0000258 | Ga0453684_0000258_213401_214417 | 331 |
| 564 | 3300044712 | Ga0453684_0032203 | Ga0453684_0032203_4663_5679 | 331 |
| 565 | 3300044712 | Ga0453684_0559552 | Ga0453684_0559552_226_1245 | 331 |
| 566 | 3300045051 | Ga0451576_0003523 | Ga0451576_0003523_11378_12394 | 331 |
| 567 | 3300045051 | Ga0451576_0017930 | Ga0451576_0017930_3802_4818 | 331 |
| 568 | 3300049568 | Ga0501031_0179052 | Ga0501031_0179052_262_1281 | 331 |
| 569 | 3300049824 | Ga0501045_0142647 | Ga0501045_0142647_352_1371 | 331 |
| 570 | 3300050512 | nmdc:mga0n895_363905_c1 | nmdc:mga0n895_363905_c1_24_1079 | 331 |
| 571 | 3300061734 | Ga0530510_0015081 | Ga0530510_0015081_3229_4248 | 331 |
| 572 | 3300005288 | Ga0065714_10014037 | Ga0065714_100140372 | 332 |
| 573 | 3300005843 | Ga0068860_100025069 | Ga0068860_1000250697 | 332 |
| 574 | 3300025922 | Ga0207646_10453122 | Ga0207646_104531222 | 332 |
| 575 | 3300028381 | Ga0268264_10011525 | Ga0268264_100115254 | 332 |
| 576 | 3300036401 | Ga0373937_0401628 | Ga0373937_0401628_218_1237 | 332 |
| 577 | 3300042876 | Ga0451577_0000673 | Ga0451577_0000673_47016_48023 | 332 |
| 578 | 3300042876 | Ga0451577_0318977 | Ga0451577_0318977_372_1379 | 332 |
| 579 | 3300044673 | Ga0453683_0069681 | Ga0453683_0069681_732_1739 | 332 |
| 580 | 3300044712 | Ga0453684_0001155 | Ga0453684_0001155_79730_80737 | 332 |
| 581 | 3300044712 | Ga0453684_0001648 | Ga0453684_0001648_45697_46704 | 332 |
| 582 | 3300044712 | Ga0453684_0008030 | Ga0453684_0008030_13901_14908 | 332 |
| 583 | 3300044712 | Ga0453684_0576068 | Ga0453684_0576068_37_1044 | 332 |
| 584 | 3300045051 | Ga0451576_0001406 | Ga0451576_0001406_13923_14930 | 332 |
| 585 | 3300045051 | Ga0451576_0121722 | Ga0451576_0121722_755_1762 | 332 |
| 586 | 3300045051 | Ga0451576_0158623 | Ga0451576_0158623_813_1820 | 332 |
| 587 | 3300046615 | Ga0495656_0000068 | Ga0495656_0000068_32455_33483 | 332 |
| 588 | 3300046664 | Ga0495659_0007690 | Ga0495659_0007690_1777_2805 | 332 |
| 589 | 3300049537 | Ga0501321_000935 | Ga0501321_000935_428_1441 | 332 |
| 590 | 3300049540 | Ga0501324_000877 | Ga0501324_000877_508_1521 | 332 |
| 591 | 3300049744 | Ga0501083_0001752 | Ga0501083_0001752_2860_3879 | 332 |
| 592 | 3300049744 | Ga0501083_0063107 | Ga0501083_0063107_420_1430 | 332 |
| 593 | 3300054114 | Ga0501084_0030515 | Ga0501084_0030515_1467_2486 | 332 |
| 594 | 3300054114 | Ga0501084_0184882 | Ga0501084_0184882_23_1033 | 332 |
| 595 | 3300059605 | Ga0587106_001645 | Ga0587106_001645_656_1669 | 332 |
| 596 | 3300060353 | Ga0501082_0071015 | Ga0501082_0071015_420_1439 | 332 |
| 597 | 3300002865 | Ga0006761J43178_107884 | Ga0006761J43178_1078842 | 333 |
| 598 | 3300003300 | Ga0006758J48902_1011730 | Ga0006758J48902_10117303 | 333 |
| 599 | 3300005355 | Ga0070671_100098834 | Ga0070671_1000988342 | 333 |
| 600 | 3300005367 | Ga0070667_100264636 | Ga0070667_1002646362 | 333 |
| 601 | 3300009094 | Ga0111539_10011546 | Ga0111539_1001154612 | 333 |
| 602 | 3300009101 | Ga0105247_10001485 | Ga0105247_1000148529 | 333 |
| 603 | 3300009553 | Ga0105249_10014983 | Ga0105249_1001498310 | 333 |
| 604 | 3300014968 | Ga0157379_10000101 | Ga0157379_1000010131 | 333 |
| 605 | 3300014969 | Ga0157376_10242049 | Ga0157376_102420491 | 333 |
| 606 | 3300025900 | Ga0207710_10001280 | Ga0207710_1000128021 | 333 |
| 607 | 3300025927 | Ga0207687_10083793 | Ga0207687_100837932 | 333 |
| 608 | 3300025931 | Ga0207644_10397472 | Ga0207644_103974721 | 333 |
| 609 | 3300035695 | Ga0373927_0013572 | Ga0373927_0013572_3039_4061 | 333 |
| 610 | 3300037068 | Ga0373925_0019406 | Ga0373925_0019406_3504_4526 | 333 |
| 611 | 3300038742 | Ga0400486_05152 | Ga0400486_05152_5130_6227 | 333 |
| 612 | 3300039450 | Ga0436363_0759301 | Ga0436363_0759301_100_1113 | 333 |
| 613 | 3300044673 | Ga0453683_0030485 | Ga0453683_0030485_291_1304 | 333 |
| 614 | 3300046472 | Ga0495580_0002023 | Ga0495580_0002023_2798_3820 | 333 |
| 615 | 3300049528 | Ga0501312_000273 | Ga0501312_000273_232_1251 | 333 |
| 616 | 3300049534 | Ga0501318_000746 | Ga0501318_000746_13_1026 | 333 |
| 617 | 3300049589 | Ga0501073_0027134 | Ga0501073_0027134_1739_2752 | 333 |
| 618 | 3300050493 | nmdc:mga0k408_109309_c1 | nmdc:mga0k408_109309_c1_111_1124 | 333 |
| 619 | 3300050493 | nmdc:mga0k408_64134_c1 | nmdc:mga0k408_64134_c1_337_1350 | 333 |
| 620 | 3300050511 | nmdc:mga08y16_5631_c1 | nmdc:mga08y16_5631_c1_3338_4351 | 333 |
| 621 | 3300059491 | Ga0587070_013141 | Ga0587070_013141_49_1086 | 333 |
| 622 | 3300059493 | Ga0587077_000591 | Ga0587077_000591_49_1086 | 333 |
| 623 | 3300059506 | Ga0587085_001989 | Ga0587085_001989_596_1633 | 333 |
| 624 | 3300059624 | Ga0587109_005843 | Ga0587109_005843_516_1553 | 333 |
| 625 | 3300059639 | Ga0587062_000268 | Ga0587062_000268_523_1560 | 333 |
| 626 | 3300059643 | Ga0587072_000911 | Ga0587072_000911_2305_3342 | 333 |
| 627 | 3300059660 | Ga0587124_001632 | Ga0587124_001632_169_1206 | 333 |
| 628 | 3300060346 | Ga0587111_0010468 | Ga0587111_0010468_370_1407 | 333 |
| 629 | 3300005289 | Ga0065704_10070132 | Ga0065704_100701321317 | 334 |
| 630 | 3300006846 | Ga0075430_100019248 | Ga0075430_1000192484 | 334 |
| 631 | 3300009094 | Ga0111539_10335845 | Ga0111539_103358452 | 334 |
| 632 | 3300028577 | Ga0265318_10017893 | Ga0265318_100178933 | 334 |
| 633 | 3300032168 | Ga0316593_10000033 | Ga0316593_1000003328 | 334 |
| 634 | 3300032168 | Ga0316593_10013698 | Ga0316593_100136983 | 334 |
| 635 | 3300035084 | Ga0373928_0001523 | Ga0373928_0001523_3156_4178 | 334 |
| 636 | 3300035398 | Ga0316574_0009048 | Ga0316574_0009048_2063_3085 | 334 |
| 637 | 3300038726 | Ga0400490_30744 | Ga0400490_30744_26247_27290 | 334 |
| 638 | 3300039093 | Ga0400489_12624 | Ga0400489_12624_8033_9046 | 334 |
| 639 | 3300039093 | Ga0400489_92265 | Ga0400489_92265_87_1130 | 334 |
| 640 | 3300042876 | Ga0451577_0000328 | Ga0451577_0000328_6940_7962 | 334 |
| 641 | 3300042876 | Ga0451577_0042342 | Ga0451577_0042342_1145_2167 | 334 |
| 642 | 3300042876 | Ga0451577_0149506 | Ga0451577_0149506_106_1128 | 334 |
| 643 | 3300044673 | Ga0453683_0000219 | Ga0453683_0000219_12146_13168 | 334 |
| 644 | 3300044673 | Ga0453683_0003224 | Ga0453683_0003224_62_1084 | 334 |
| 645 | 3300044673 | Ga0453683_0004812 | Ga0453683_0004812_1428_2450 | 334 |
| 646 | 3300044673 | Ga0453683_0026024 | Ga0453683_0026024_1948_2970 | 334 |
| 647 | 3300044673 | Ga0453683_0062905 | Ga0453683_0062905_606_1628 | 334 |
| 648 | 3300044673 | Ga0453683_0065404 | Ga0453683_0065404_139_1161 | 334 |
| 649 | 3300044712 | Ga0453684_0000950 | Ga0453684_0000950_13852_14874 | 334 |
| 650 | 3300044712 | Ga0453684_0005988 | Ga0453684_0005988_9166_10188 | 334 |
| 651 | 3300044712 | Ga0453684_0007136 | Ga0453684_0007136_13981_15021 | 334 |
| 652 | 3300044712 | Ga0453684_0010045 | Ga0453684_0010045_13238_14260 | 334 |
| 653 | 3300044712 | Ga0453684_0015940 | Ga0453684_0015940_1379_2401 | 334 |
| 654 | 3300044712 | Ga0453684_0019047 | Ga0453684_0019047_4912_5955 | 334 |
| 655 | 3300044712 | Ga0453684_0024212 | Ga0453684_0024212_5237_6259 | 334 |
| 656 | 3300044712 | Ga0453684_0032059 | Ga0453684_0032059_1665_2687 | 334 |
| 657 | 3300044712 | Ga0453684_0037215 | Ga0453684_0037215_2766_3788 | 334 |
| 658 | 3300044712 | Ga0453684_0056552 | Ga0453684_0056552_1822_2844 | 334 |
| 659 | 3300044712 | Ga0453684_0099498 | Ga0453684_0099498_864_1889 | 334 |
| 660 | 3300044712 | Ga0453684_0100989 | Ga0453684_0100989_165_1187 | 334 |
| 661 | 3300044712 | Ga0453684_0124618 | Ga0453684_0124618_702_1724 | 334 |
| 662 | 3300044712 | Ga0453684_0222798 | Ga0453684_0222798_1141_2163 | 334 |
| 663 | 3300044712 | Ga0453684_0224980 | Ga0453684_0224980_1059_2081 | 334 |
| 664 | 3300044712 | Ga0453684_0608741 | Ga0453684_0608741_101_1123 | 334 |
| 665 | 3300045051 | Ga0451576_0000857 | Ga0451576_0000857_45578_46600 | 334 |
| 666 | 3300045051 | Ga0451576_0057309 | Ga0451576_0057309_2921_3970 | 334 |
| 667 | 3300045051 | Ga0451576_0093423 | Ga0451576_0093423_1409_2431 | 334 |
| 668 | 3300045051 | Ga0451576_0128597 | Ga0451576_0128597_873_1895 | 334 |
| 669 | 3300050511 | nmdc:mga08y16_269121_c1 | nmdc:mga08y16_269121_c1_336_1346 | 334 |
| 670 | 3300059640 | Ga0587067_010633 | Ga0587067_010633_47_1072 | 334 |
| 671 | 3300003300 | Ga0006758J48902_1013914 | Ga0006758J48902_10139141 | 335 |
| 672 | 3300004800 | Ga0058861_11958900 | Ga0058861_119589002 | 335 |
| 673 | 3300005337 | Ga0070682_100012980 | Ga0070682_1000129803 | 335 |
| 674 | 3300005337 | Ga0070682_100042827 | Ga0070682_1000428271 | 335 |
| 675 | 3300005338 | Ga0068868_100003470 | Ga0068868_1000034708 | 335 |
| 676 | 3300005354 | Ga0070675_100143314 | Ga0070675_1001433142 | 335 |
| 677 | 3300005438 | Ga0070701_10022405 | Ga0070701_100224052 | 335 |
| 678 | 3300005444 | Ga0070694_100109789 | Ga0070694_1001097892 | 335 |
| 679 | 3300005459 | Ga0068867_100134454 | Ga0068867_1001344542 | 335 |
| 680 | 3300005466 | Ga0070685_10011829 | Ga0070685_100118292 | 335 |
| 681 | 3300005535 | Ga0070684_100096952 | Ga0070684_1000969521 | 335 |
| 682 | 3300005536 | Ga0070697_100102678 | Ga0070697_1001026783 | 335 |
| 683 | 3300005543 | Ga0070672_100008647 | Ga0070672_1000086471 | 335 |
| 684 | 3300005563 | Ga0068855_100000266 | Ga0068855_10000026622 | 335 |
| 685 | 3300005563 | Ga0068855_100002209 | Ga0068855_1000022098 | 335 |
| 686 | 3300005614 | Ga0068856_100042559 | Ga0068856_1000425595 | 335 |
| 687 | 3300005614 | Ga0068856_100072572 | Ga0068856_1000725723 | 335 |
| 688 | 3300005614 | Ga0068856_100390801 | Ga0068856_1003908012 | 335 |
| 689 | 3300005841 | Ga0068863_100129008 | Ga0068863_1001290083 | 335 |
| 690 | 3300005937 | Ga0081455_10003850 | Ga0081455_1000385034 | 335 |
| 691 | 3300006195 | Ga0075366_10036607 | Ga0075366_100366073 | 335 |
| 692 | 3300006195 | Ga0075366_10042994 | Ga0075366_100429944 | 335 |
| 693 | 3300006195 | Ga0075366_10135357 | Ga0075366_101353571 | 335 |
| 694 | 3300006195 | Ga0075366_10152131 | Ga0075366_101521311 | 335 |
| 695 | 3300006358 | Ga0068871_100066595 | Ga0068871_1000665953 | 335 |
| 696 | 3300006844 | Ga0075428_100003062 | Ga0075428_1000030623 | 335 |
| 697 | 3300006846 | Ga0075430_100080488 | Ga0075430_1000804883 | 335 |
| 698 | 3300006880 | Ga0075429_100107344 | Ga0075429_1001073442 | 335 |
| 699 | 3300007076 | Ga0075435_100046934 | Ga0075435_1000469342 | 335 |
| 700 | 3300007076 | Ga0075435_100151668 | Ga0075435_1001516682 | 335 |
| 701 | 3300009094 | Ga0111539_10052091 | Ga0111539_100520917 | 335 |
| 702 | 3300009098 | Ga0105245_10002954 | Ga0105245_100029545 | 335 |
| 703 | 3300009098 | Ga0105245_10097109 | Ga0105245_100971093 | 335 |
| 704 | 3300009174 | Ga0105241_10003328 | Ga0105241_1000332822 | 335 |
| 705 | 3300013296 | Ga0157374_10208026 | Ga0157374_102080262 | 335 |
| 706 | 3300013306 | Ga0163162_10436298 | Ga0163162_104362981 | 335 |
| 707 | 3300014326 | Ga0157380_10137181 | Ga0157380_101371812 | 335 |
| 708 | 3300014326 | Ga0157380_10218877 | Ga0157380_102188772 | 335 |
| 709 | 3300014969 | Ga0157376_10085566 | Ga0157376_100855661 | 335 |
| 710 | 3300025911 | Ga0207654_10006799 | Ga0207654_100067997 | 335 |
| 711 | 3300025921 | Ga0207652_10198513 | Ga0207652_101985132 | 335 |
| 712 | 3300025936 | Ga0207670_10053084 | Ga0207670_100530843 | 335 |
| 713 | 3300025940 | Ga0207691_10006989 | Ga0207691_100069898 | 335 |
| 714 | 3300025942 | Ga0207689_10266807 | Ga0207689_102668072 | 335 |
| 715 | 3300025944 | Ga0207661_10169715 | Ga0207661_101697152 | 335 |
| 716 | 3300025949 | Ga0207667_10000612 | Ga0207667_1000061223 | 335 |
| 717 | 3300025949 | Ga0207667_10002028 | Ga0207667_1000202821 | 335 |
| 718 | 3300026023 | Ga0207677_10002394 | Ga0207677_100023944 | 335 |
| 719 | 3300026023 | Ga0207677_10047983 | Ga0207677_100479833 | 335 |
| 720 | 3300026067 | Ga0207678_10045328 | Ga0207678_100453283 | 335 |
| 721 | 3300026078 | Ga0207702_10161792 | Ga0207702_101617921 | 335 |
| 722 | 3300026088 | Ga0207641_10012614 | Ga0207641_100126145 | 335 |
| 723 | 3300026088 | Ga0207641_10037995 | Ga0207641_100379953 | 335 |
| 724 | 3300026089 | Ga0207648_10146903 | Ga0207648_101469032 | 335 |
| 725 | 3300026118 | Ga0207675_100009284 | Ga0207675_1000092841 | 335 |
| 726 | 3300026121 | Ga0207683_10036828 | Ga0207683_100368283 | 335 |
| 727 | 3300026121 | Ga0207683_10208672 | Ga0207683_102086722 | 335 |
| 728 | 3300027907 | Ga0207428_10092837 | Ga0207428_100928372 | 335 |
| 729 | 3300028558 | Ga0265326_10015554 | Ga0265326_100155542 | 335 |
| 730 | 3300031247 | Ga0265340_10001205 | Ga0265340_100012056 | 335 |
| 731 | 3300031249 | Ga0265339_10008732 | Ga0265339_100087321 | 335 |
| 732 | 3300031616 | Ga0307508_10136221 | Ga0307508_101362213 | 335 |
| 733 | 3300031711 | Ga0265314_10000003 | Ga0265314_100000031199 | 335 |
| 734 | 3300031711 | Ga0265314_10008394 | Ga0265314_100083945 | 335 |
| 735 | 3300031727 | Ga0316576_10009047 | Ga0316576_100090476 | 335 |
| 736 | 3300031727 | Ga0316576_10096795 | Ga0316576_100967952 | 335 |
| 737 | 3300031730 | Ga0307516_10009446 | Ga0307516_100094468 | 335 |
| 738 | 3300031901 | Ga0307406_10001312 | Ga0307406_1000131224 | 335 |
| 739 | 3300031903 | Ga0307407_10007128 | Ga0307407_100071283 | 335 |
| 740 | 3300033179 | Ga0307507_10102682 | Ga0307507_101026822 | 335 |
| 741 | 3300035695 | Ga0373927_0009335 | Ga0373927_0009335_606_1646 | 335 |
| 742 | 3300035724 | Ga0373933_0033257 | Ga0373933_0033257_329_1354 | 335 |
| 743 | 3300036401 | Ga0373937_0220335 | Ga0373937_0220335_76_1101 | 335 |
| 744 | 3300037471 | Ga0395905_0025893 | Ga0395905_0025893_847_1869 | 335 |
| 745 | 3300039062 | Ga0400483_053606 | Ga0400483_053606_118_1155 | 335 |
| 746 | 3300041413 | Ga0439465_0002430 | Ga0439465_0002430_157_1212 | 335 |
| 747 | 3300041486 | Ga0451807_0596507 | Ga0451807_0596507_81_1106 | 335 |
| 748 | 3300041997 | Ga0439431_0032614 | Ga0439431_0032614_183_1238 | 335 |
| 749 | 3300042007 | Ga0439449_0052713 | Ga0439449_0052713_107_1147 | 335 |
| 750 | 3300044673 | Ga0453683_0016045 | Ga0453683_0016045_2025_3050 | 335 |
| 751 | 3300045051 | Ga0451576_0185054 | Ga0451576_0185054_12_1052 | 335 |
| 752 | 3300046461 | Ga0495641_0092003 | Ga0495641_0092003_118_1143 | 335 |
| 753 | 3300046675 | Ga0495657_0089924 | Ga0495657_0089924_906_1931 | 335 |
| 754 | 3300047322 | Ga0495680_0042938 | Ga0495680_0042938_2069_3094 | 335 |
| 755 | 3300049128 | Ga0501308_000564 | Ga0501308_000564_904_1968 | 335 |
| 756 | 3300049571 | Ga0501034_0308716 | Ga0501034_0308716_62_1084 | 335 |
| 757 | 3300049574 | Ga0501038_0013339 | Ga0501038_0013339_5509_6540 | 335 |
| 758 | 3300049579 | Ga0501043_0065707 | Ga0501043_0065707_1434_2465 | 335 |
| 759 | 3300049581 | Ga0501047_0036151 | Ga0501047_0036151_2125_3156 | 335 |
| 760 | 3300049581 | Ga0501047_0093046 | Ga0501047_0093046_82_1110 | 335 |
| 761 | 3300049583 | Ga0501067_0030612 | Ga0501067_0030612_908_1939 | 335 |
| 762 | 3300049584 | Ga0501068_0000765 | Ga0501068_0000765_12723_13754 | 335 |
| 763 | 3300049585 | Ga0501069_0004501 | Ga0501069_0004501_663_1694 | 335 |
| 764 | 3300049586 | Ga0501070_0080026 | Ga0501070_0080026_536_1567 | 335 |
| 765 | 3300049588 | Ga0501072_0001660 | Ga0501072_0001660_2848_3879 | 335 |
| 766 | 3300049589 | Ga0501073_0007779 | Ga0501073_0007779_1793_2818 | 335 |
| 767 | 3300049590 | Ga0501074_0008028 | Ga0501074_0008028_3788_4819 | 335 |
| 768 | 3300049592 | Ga0501076_0034427 | Ga0501076_0034427_59_1090 | 335 |
| 769 | 3300049593 | Ga0501077_0014291 | Ga0501077_0014291_1094_2125 | 335 |
| 770 | 3300049705 | Ga0501225_0038760 | Ga0501225_0038760_36_1076 | 335 |
| 771 | 3300049742 | Ga0501080_0001538 | Ga0501080_0001538_12839_13864 | 335 |
| 772 | 3300049742 | Ga0501080_0047083 | Ga0501080_0047083_2121_3149 | 335 |
| 773 | 3300049744 | Ga0501083_0020876 | Ga0501083_0020876_572_1597 | 335 |
| 774 | 3300050491 | nmdc:mga00v17_82695_c1 | nmdc:mga00v17_82695_c1_686_1711 | 335 |
| 775 | 3300050493 | nmdc:mga0k408_161589_c1 | nmdc:mga0k408_161589_c1_42_1067 | 335 |
| 776 | 3300050493 | nmdc:mga0k408_17468_c1 | nmdc:mga0k408_17468_c1_2203_3228 | 335 |
| 777 | 3300050493 | nmdc:mga0k408_28046_c1 | nmdc:mga0k408_28046_c1_915_1943 | 335 |
| 778 | 3300050493 | nmdc:mga0k408_52152_c1 | nmdc:mga0k408_52152_c1_32_1057 | 335 |
| 779 | 3300050509 | nmdc:mga0qj67_93876_c1 | nmdc:mga0qj67_93876_c1_677_1699 | 335 |
| 780 | 3300050513 | nmdc:mga0rr50_102722_c1 | nmdc:mga0rr50_102722_c1_1133_2230 | 335 |
| 781 | 3300050514 | nmdc:mga08x19_17284_c1 | nmdc:mga08x19_17284_c1_2450_3511 | 335 |
| 782 | 3300054114 | Ga0501084_0000461 | Ga0501084_0000461_6827_7852 | 335 |
| 783 | 3300054114 | Ga0501084_0001929 | Ga0501084_0001929_12724_13755 | 335 |
| 784 | 3300059424 | Ga0590075_014278 | Ga0590075_014278_642_1667 | 335 |
| 785 | 3300059505 | Ga0587083_0013582 | Ga0587083_0013582_221_1261 | 335 |
| 786 | 3300059624 | Ga0587109_003978 | Ga0587109_003978_654_1679 | 335 |
| 787 | 3300059639 | Ga0587062_008936 | Ga0587062_008936_146_1168 | 335 |
| 788 | 3300060346 | Ga0587111_0000650 | Ga0587111_0000650_2118_3143 | 335 |
| 789 | 3300060346 | Ga0587111_0013621 | Ga0587111_0013621_146_1168 | 335 |
| 790 | 3300060353 | Ga0501082_0003347 | Ga0501082_0003347_4793_5824 | 335 |
| 791 | 3300005364 | Ga0070673_100160255 | Ga0070673_1001602552 | 336 |
| 792 | 3300005445 | Ga0070708_100221635 | Ga0070708_1002216352 | 336 |
| 793 | 3300005518 | Ga0070699_100000533 | Ga0070699_1000005338 | 336 |
| 794 | 3300005536 | Ga0070697_100230798 | Ga0070697_1002307981 | 336 |
| 795 | 3300005536 | Ga0070697_100365964 | Ga0070697_1003659641 | 336 |
| 796 | 3300005549 | Ga0070704_100093915 | Ga0070704_1000939153 | 336 |
| 797 | 3300006871 | Ga0075434_100158771 | Ga0075434_1001587713 | 336 |
| 798 | 3300006914 | Ga0075436_100015587 | Ga0075436_1000155873 | 336 |
| 799 | 3300009094 | Ga0111539_10001407 | Ga0111539_1000140734 | 336 |
| 800 | 3300009147 | Ga0114129_10214328 | Ga0114129_102143283 | 336 |
| 801 | 3300025960 | Ga0207651_10109090 | Ga0207651_101090902 | 336 |
| 802 | 3300026088 | Ga0207641_10538184 | Ga0207641_105381841 | 336 |
| 803 | 3300027907 | Ga0207428_10003685 | Ga0207428_100036856 | 336 |
| 804 | 3300028800 | Ga0265338_10071588 | Ga0265338_100715881 | 336 |
| 805 | 3300032168 | Ga0316593_10058520 | Ga0316593_100585202 | 336 |
| 806 | 3300033541 | Ga0316596_1002498 | Ga0316596_10024983 | 336 |
| 807 | 3300033541 | Ga0316596_1002889 | Ga0316596_10028895 | 336 |
| 808 | 3300035111 | Ga0373923_0027981 | Ga0373923_0027981_443_1507 | 336 |
| 809 | 3300035117 | Ga0373953_0038745 | Ga0373953_0038745_454_1518 | 336 |
| 810 | 3300035170 | Ga0373943_0007539 | Ga0373943_0007539_3155_4219 | 336 |
| 811 | 3300035172 | Ga0373955_0044848 | Ga0373955_0044848_559_1623 | 336 |
| 812 | 3300035172 | Ga0373955_0086650 | Ga0373955_0086650_394_1458 | 336 |
| 813 | 3300035410 | Ga0373924_0014264 | Ga0373924_0014264_652_1716 | 336 |
| 814 | 3300035692 | Ga0373935_0018318 | Ga0373935_0018318_2508_3572 | 336 |
| 815 | 3300035695 | Ga0373927_0037681 | Ga0373927_0037681_131_1195 | 336 |
| 816 | 3300035695 | Ga0373927_0041314 | Ga0373927_0041314_491_1555 | 336 |
| 817 | 3300035724 | Ga0373933_0003225 | Ga0373933_0003225_7065_8129 | 336 |
| 818 | 3300035725 | Ga0373947_0063275 | Ga0373947_0063275_1018_2082 | 336 |
| 819 | 3300036401 | Ga0373937_0003223 | Ga0373937_0003223_7820_8884 | 336 |
| 820 | 3300042876 | Ga0451577_0030969 | Ga0451577_0030969_535_1575 | 336 |
| 821 | 3300044673 | Ga0453683_0073074 | Ga0453683_0073074_1063_2100 | 336 |
| 822 | 3300044712 | Ga0453684_0012911 | Ga0453684_0012911_8190_9236 | 336 |
| 823 | 3300044712 | Ga0453684_0345203 | Ga0453684_0345203_540_1565 | 336 |
| 824 | 3300045051 | Ga0451576_0004083 | Ga0451576_0004083_7647_8672 | 336 |
| 825 | 3300045051 | Ga0451576_0632188 | Ga0451576_0632188_16_1080 | 336 |
| 826 | 3300046472 | Ga0495580_0028001 | Ga0495580_0028001_2602_3666 | 336 |
| 827 | 3300050507 | nmdc:mga05p37_189485_c1 | nmdc:mga05p37_189485_c1_793_1857 | 336 |
| 828 | 3300050511 | nmdc:mga08y16_6706_c1 | nmdc:mga08y16_6706_c1_6748_7812 | 336 |
| 829 | 3300050512 | nmdc:mga0n895_18871_c2 | nmdc:mga0n895_18871_c2_2157_3221 | 336 |
| 830 | 3300050514 | nmdc:mga08x19_120635_c1 | nmdc:mga08x19_120635_c1_366_1430 | 336 |
| 831 | 3300050514 | nmdc:mga08x19_29031_c1 | nmdc:mga08x19_29031_c1_1226_2290 | 336 |
| 832 | 3300050515 | nmdc:mga0a205_80328_c1 | nmdc:mga0a205_80328_c1_1921_2985 | 336 |
| 833 | 3300053085 | Ga0495619_0024118 | Ga0495619_0024118_1537_2601 | 336 |
| 834 | 3300059623 | Ga0587101_002160 | Ga0587101_002160_199_1245 | 336 |
| 835 | 3300007265 | Ga0099794_10007466 | Ga0099794_100074662 | 337 |
| 836 | 3300044712 | Ga0453684_0163203 | Ga0453684_0163203_1482_2579 | 337 |
| 837 | 3300028800 | Ga0265338_10000401 | Ga0265338_1000040167 | 338 |
| 838 | 3300033524 | Ga0316592_1002103 | Ga0316592_10021032 | 338 |
| 839 | 3300033528 | Ga0316588_1013472 | Ga0316588_10134722 | 338 |
| 840 | 3300037471 | Ga0395905_0000127 | Ga0395905_0000127_42581_43675 | 338 |
| 841 | iso_pu_bacteria | 8015556637 | 8015559925 | 339 |
| 842 | 3300013100 | Ga0157373_10091870 | Ga0157373_100918702 | 342 |
| 843 | 3300013307 | Ga0157372_10243242 | Ga0157372_102432422 | 342 |
| 844 | 3300037418 | Ga0395900_0030792 | Ga0395900_0030792_973_2001 | 342 |
| 845 | 3300037471 | Ga0395905_0000275 | Ga0395905_0000275_41832_42860 | 342 |
| 846 | 3300037471 | Ga0395905_0123004 | Ga0395905_0123004_869_1897 | 342 |
| 847 | 3300039447 | Ga0436361_1081198 | Ga0436361_1081198_169_1197 | 342 |
| 848 | 3300048905 | Ga0496102_0158392 | Ga0496102_0158392_506_1534 | 342 |
| 849 | 3300049571 | Ga0501034_0334346 | Ga0501034_0334346_310_1338 | 342 |
| 850 | 3300005614 | Ga0068856_100014349 | Ga0068856_1000143495 | 343 |
| 851 | 3300026078 | Ga0207702_10001471 | Ga0207702_100014715 | 343 |
| 852 | 3300037471 | Ga0395905_0091046 | Ga0395905_0091046_93_1130 | 343 |
| 853 | 3300046615 | Ga0495656_0000397 | Ga0495656_0000397_13316_14347 | 343 |
| 854 | 3300047318 | Ga0495636_0024284 | Ga0495636_0024284_443_1474 | 343 |
| 855 | 3300048090 | Ga0495615_0002512 | Ga0495615_0002512_1439_2470 | 343 |
| 856 | 3300048913 | Ga0496110_0000091 | Ga0496110_0000091_23525_24556 | 343 |
| 857 | 3300048913 | Ga0496110_0001249 | Ga0496110_0001249_6480_7511 | 343 |
| 858 | 3300048927 | Ga0496124_0000001 | Ga0496124_0000001_90714_91745 | 343 |
| 859 | 3300048929 | Ga0496126_0136628 | Ga0496126_0136628_88_1119 | 343 |
| 860 | 3300005457 | Ga0070662_100139019 | Ga0070662_1001390191 | 344 |
| 861 | 3300013102 | Ga0157371_10009169 | Ga0157371_100091698 | 344 |
| 862 | 2162886007 | SwRhRL2b_contig_1759361 | SwRhRL2b_0440.00005890 | 345 |
| 863 | 3300010375 | Ga0105239_10010781 | Ga0105239_100107815 | 345 |
| 864 | 3300049569 | Ga0501032_0000374 | Ga0501032_0000374_33441_34517 | 345 |
| 865 | 3300049571 | Ga0501034_0038041 | Ga0501034_0038041_480_1634 | 345 |
| 866 | 3300049571 | Ga0501034_0063128 | Ga0501034_0063128_344_1420 | 345 |
| 867 | 3300049572 | Ga0501036_0157822 | Ga0501036_0157822_457_1533 | 345 |
| 868 | 3300049573 | Ga0501037_0000862 | Ga0501037_0000862_20075_21151 | 345 |
| 869 | 3300049574 | Ga0501038_0063475 | Ga0501038_0063475_1549_2625 | 345 |
| 870 | 3300049574 | Ga0501038_0123879 | Ga0501038_0123879_24_1100 | 345 |
| 871 | 3300049579 | Ga0501043_0002448 | Ga0501043_0002448_2229_3305 | 345 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7x76-assembly1.cif.gz_S | cryo-em structure of streptomyces coelicolor rnap-promoter open complex with two zur dimers | 0.9868 | 260 | 313 |
| 1z3e-assembly1.cif.gz_B | crystal structure of spx in complex with the c-terminal domain of the rna polymerase alpha subunit | 0.9757 | 256 | 318 |
| 1lb2-assembly1.cif.gz_E-2 | structure of the e. coli alpha c-terminal domain of rna polymerase in complex with cap and dna | 0.9681 | 256 | 319 |
| 3ihq-assembly1.cif.gz_B | crystal structure of reduced c10s spx in complex with the alpha c-terminal domain of rna polymeras | 0.9596 | 256 | 318 |
| 1lb2-assembly1.cif.gz_B-2 | structure of the e. coli alpha c-terminal domain of rna polymerase in complex with cap and dna | 0.955 | 255 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1z3eB00 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9757 | 256 | 318 | 1.10.150.20 |
| 1lb2E00 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9681 | 256 | 319 | 1.10.150.20 |
| 3n4mC00 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9626 | 256 | 326 | 1.10.150.20 |
| 3ihqB00 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9596 | 256 | 318 | 1.10.150.20 |
| 3n97C00 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9528 | 255 | 327 | 1.10.150.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1R3B3-F1-model_v4 | DNA-directed RNA polymerase insert domain-containing protein | 0.9936 | 82 | 152 |
GO:0003899
GO:0006351 GO:0046983 |
| AF-A0A645H4F2-F1-model_v4 | DNA-directed RNA polymerase subunit alpha (EC 2.7.7.6) | 0.9798 | 254 | 321 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001065 GO:0001066 GO:0003677 |
| AF-S5REI7-F1-model_v4 | DNA-dependent RNA polymerase alpha subunit | 0.9655 | 50 | 162 |
GO:0003899
GO:0006351 GO:0046983 |
| AF-A0A1B6E1Z9-F1-model_v4 | DNA-directed RNA polymerase RpoA/D/Rpb3-type domain-containing protein | 0.9655 | 35 | 154 |
GO:0000428
GO:0003899 GO:0006351 GO:0046983 |
| AF-A0A2S6W9P1-F1-model_v4 | DNA-directed RNA polymerase subunit alpha | 0.9637 | 29 | 232 |
GO:0000428
GO:0003677 GO:0003899 GO:0006351 GO:0046983 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar