F484102

General Info

Members Datasets Scaffolds Average Seq Length
868 417 1734 328

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_157079_c1|nmdc:mga08y16_157079_c1_476_1465
Length 315
Sequence MPVLSRILTRILAVGAAGLALAALPAAAQTKLKWAHVYEVAEPYHTEALWAADEIKKRTNGKYEIQVFPASQLGNENQINEGLGLATVDMIYTGVAFAGSIHKPIAITNAPYVLRDFEHWKAYRDSKRFRDIAKYYGQRHVTANKEIKKPEDMKGMKLRVPPAPLFLMFTKSVGANATPIAFAEVYLALQQGTVDGQENPLPTIMAKKFYEVQSHVMLTGHITESLLTIVGTHVWGKLSDAEKKIFEEVLVQAASRVTDQTRASEQKLADELRRLGKTVVEVDREAFRKAAMPLHNDPAAGGGWSQAEYDALQKL

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
237 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
238 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
239 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
240 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
241 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
242 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
245 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
246 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
247 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
248 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
249 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
261 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
262 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
273 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
308 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
309 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
337 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
379 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
402 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
403 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
404 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
405 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
406 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
407 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
410 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
411 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
412 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
415 2643221651 Afipia sp. Root123D2 Isolate Unclassified
416 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
417 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.53
Nodule 0
Rhizoplane 6.34
Rhizosphere 85.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_157079_c1 3300050511 Bacteria 2363
2 2214884080 2209111006 Bacteria 7769
3 ARSoilYngRDRAFT_c00383 3300000042 Bacteria 5942
4 ARcpr5yngRDRAFT_c000053 3300000043 Bacteria 18314
5 ARSoilOldRDRAFT_c000064 3300000044 Bacteria 21027
6 ARCol0oldRDRAFT_c00196 3300000045 Bacteria 5558
7 ARCol0yngRDRAFT_1000047 3300000652 Bacteria 21004
8 JGI24032J14994_100011 3300001430 Bacteria 6783
9 JGI24739J22299_10000985 3300001989 Bacteria 10619
10 JGI24737J22298_10001495 3300001990 Bacteria 8328
11 JGI24743J22301_10004989 3300001991 Bacteria 2191
12 JGI24735J21928_10028651 3300002067 Bacteria 1662
13 JGI24750J21931_1000203 3300002070 Bacteria 10051
14 JGI24745J21846_1000637 3300002073 Bacteria 3153
15 JGI24748J21848_1001162 3300002074 Bacteria 2871
16 JGI24738J21930_10001441 3300002075 Bacteria 6608
17 JGI24749J21850_1002555 3300002076 Bacteria 2556
18 JGI24033J26618_1000758 3300002155 Bacteria 3087
19 JGI24034J26672_10004848 3300002239 Bacteria 1915
20 JGI24742J22300_10000487 3300002244 Bacteria 5902
21 JGI24751J29686_10007328 3300002459 Bacteria 2253
22 JGI24751J29686_10018362 3300002459 Bacteria 1447
23 JGI25406J46586_10000391 3300003203 Bacteria 20143
24 JGI25153J46596_10001262 3300003215 Bacteria 15224
25 JGI25153J46596_10004562 3300003215 Bacteria 7434
26 JGI25404J52841_10006537 3300003659 Bacteria 2445
27 JGI25405J52794_10007572 3300003911 Bacteria 2004
28 Ga0065716_1001797 3300005277 Bacteria 3365
29 Ga0065712_10083010 3300005290 Bacteria 2869
30 Ga0065712_10155545 3300005290 Bacteria 1338
31 Ga0065707_10168364 3300005295 Bacteria 1504
32 Ga0070658_10093373 3300005327 Bacteria 2482
33 Ga0070676_10001056 3300005328 Bacteria 13713
34 Ga0070683_100003491 3300005329 Bacteria 12781
35 Ga0070683_100286151 3300005329 Bacteria 1568
36 Ga0070690_100009732 3300005330 Bacteria 5574
37 Ga0070670_100007890 3300005331 Bacteria 9055
38 Ga0070670_100409661 3300005331 Bacteria 1198
39 Ga0070677_10000206 3300005333 Bacteria 20279
40 Ga0070677_10022398 3300005333 Bacteria 2326
41 Ga0068869_100062506 3300005334 Bacteria 2733
42 Ga0068869_100087929 3300005334 Bacteria 2331
43 Ga0070666_10007454 3300005335 Bacteria 6746
44 Ga0070666_10083170 3300005335 Bacteria 2190
45 Ga0070682_100001749 3300005337 Bacteria 12085
46 Ga0068868_100004491 3300005338 Bacteria 9791
47 Ga0068868_100093946 3300005338 Bacteria 2419
48 Ga0068868_100109593 3300005338 Bacteria 2242
49 Ga0070660_100002617 3300005339 Bacteria 12364
50 Ga0070660_100302041 3300005339 Bacteria 1312
51 Ga0070689_100006306 3300005340 Bacteria 8192
52 Ga0070689_100072358 3300005340 Bacteria 2695
53 Ga0070691_10087066 3300005341 Bacteria 1536
54 Ga0070687_100005432 3300005343 Bacteria 5159
55 Ga0070687_100047343 3300005343 Bacteria 2205
56 Ga0070661_100006928 3300005344 Bacteria 7823
57 Ga0070661_100307061 3300005344 Bacteria 1236
58 Ga0070661_100380362 3300005344 Bacteria 1113
59 Ga0070692_10221775 3300005345 Bacteria 1118
60 Ga0070668_100000882 3300005347 Bacteria 20845
61 Ga0070668_100049554 3300005347 Bacteria 3232
62 Ga0070668_100278863 3300005347 Bacteria 1395
63 Ga0070669_100002256 3300005353 Bacteria 13985
64 Ga0070675_100001384 3300005354 Bacteria 17776
65 Ga0070671_100001328 3300005355 Bacteria 18586
66 Ga0070674_100002239 3300005356 Bacteria 10647
67 Ga0070674_100005092 3300005356 Bacteria 7557
68 Ga0070674_100011327 3300005356 Bacteria 5427
69 Ga0070673_100002806 3300005364 Bacteria 10711
70 Ga0070673_100035386 3300005364 Bacteria 3786
71 Ga0070688_100001008 3300005365 Bacteria 14140
72 Ga0070688_100100550 3300005365 Bacteria 1906
73 Ga0070659_100007170 3300005366 Bacteria 8089
74 Ga0070667_100003216 3300005367 Bacteria 13985
75 Ga0070667_100022298 3300005367 Bacteria 5253
76 Ga0070667_100073127 3300005367 Bacteria 2922
77 Ga0070703_10000772 3300005406 Bacteria 10583
78 Ga0070703_10002909 3300005406 Bacteria 4903
79 Ga0070709_10004081 3300005434 Bacteria 7874
80 Ga0070709_10037229 3300005434 Bacteria 2970
81 Ga0070713_100004461 3300005436 Bacteria 9404
82 Ga0070713_100032677 3300005436 Bacteria 4159
83 Ga0070713_100078436 3300005436 Bacteria 2811
84 Ga0070710_10026679 3300005437 Bacteria 3072
85 Ga0070701_10015213 3300005438 Bacteria 3546
86 Ga0070701_10037246 3300005438 Bacteria 2455
87 Ga0070705_100000044 3300005440 Bacteria 63452
88 Ga0070705_100010190 3300005440 Bacteria 4696
89 Ga0070700_100000556 3300005441 Bacteria 18754
90 Ga0070700_100032746 3300005441 Bacteria 3126
91 Ga0070694_100001349 3300005444 Bacteria 14317
92 Ga0070694_100018131 3300005444 Bacteria 4463
93 Ga0070694_100026556 3300005444 Bacteria 3753
94 Ga0070708_100052624 3300005445 Bacteria 3611
95 Ga0070708_100126603 3300005445 Bacteria 2362
96 Ga0070663_100010106 3300005455 Bacteria 5870
97 Ga0070663_100032420 3300005455 Bacteria 3601
98 Ga0070663_100094202 3300005455 Bacteria 2223
99 Ga0070678_100018301 3300005456 Bacteria 4539
100 Ga0070678_100069997 3300005456 Bacteria 2621
101 Ga0070678_100328242 3300005456 Bacteria 1309
102 Ga0070662_100006933 3300005457 Bacteria 7336
103 Ga0070662_100167599 3300005457 Bacteria 1722
104 Ga0070681_10013387 3300005458 Bacteria 8150
105 Ga0070681_10133280 3300005458 Bacteria 2416
106 Ga0068867_100002573 3300005459 Bacteria 12785
107 Ga0070685_10001130 3300005466 Bacteria 14275
108 Ga0070706_100267015 3300005467 Bacteria 1597
109 Ga0070698_100136919 3300005471 Bacteria 2402
110 Ga0070698_100153140 3300005471 Bacteria 2252
111 Ga0070699_100009483 3300005518 Bacteria 8431
112 Ga0070679_100012382 3300005530 Bacteria 8150
113 Ga0070684_100059581 3300005535 Bacteria 3338
114 Ga0070684_100066301 3300005535 Bacteria 3169
115 Ga0070684_100211719 3300005535 Bacteria 1766
116 Ga0068853_100000906 3300005539 Bacteria 20662
117 Ga0068853_100297265 3300005539 Bacteria 1492
118 Ga0070672_100000679 3300005543 Bacteria 20002
119 Ga0070672_100189744 3300005543 Bacteria 1715
120 Ga0070686_100001681 3300005544 Bacteria 12352
121 Ga0070686_100280422 3300005544 Bacteria 1229
122 Ga0070695_100000050 3300005545 Bacteria 46498
123 Ga0070696_100003655 3300005546 Bacteria 10259
124 Ga0070693_100029320 3300005547 Bacteria 3001
125 Ga0070693_100269004 3300005547 Bacteria 1137
126 Ga0070665_100016320 3300005548 Bacteria 7448
127 Ga0070665_100161848 3300005548 Bacteria 2240
128 Ga0070665_100185753 3300005548 Bacteria 2079
129 Ga0070704_100003917 3300005549 Bacteria 8567
130 Ga0070704_100180318 3300005549 Bacteria 1688
131 Ga0068855_100005213 3300005563 Bacteria 15852
132 Ga0070664_100008267 3300005564 Bacteria 8418
133 Ga0070664_100180706 3300005564 Bacteria 1875
134 Ga0068857_100002095 3300005577 Bacteria 16205
135 Ga0068857_100051463 3300005577 Bacteria 3654
136 Ga0068857_100087953 3300005577 Bacteria 2779
137 Ga0068854_100001485 3300005578 Bacteria 14204
138 Ga0068856_100004080 3300005614 Bacteria 14604
139 Ga0070702_100073133 3300005615 Bacteria 2030
140 Ga0070702_100183437 3300005615 Bacteria 1371
141 Ga0068852_100009647 3300005616 Bacteria 7170
142 Ga0068859_100003498 3300005617 Bacteria 15989
143 Ga0068859_100026869 3300005617 Bacteria 5773
144 Ga0068859_100053671 3300005617 Bacteria 4054
145 Ga0068864_100006196 3300005618 Bacteria 9806
146 Ga0068864_100140196 3300005618 Bacteria 2180
147 Ga0068866_10002003 3300005718 Bacteria 8477
148 Ga0068866_10091077 3300005718 Bacteria 1661
149 Ga0068861_100041623 3300005719 Bacteria 3441
150 Ga0068861_100061720 3300005719 Bacteria 2877
151 Ga0068861_100207794 3300005719 Bacteria 1647
152 Ga0068861_100240076 3300005719 Bacteria 1541
153 Ga0068863_100002935 3300005841 Bacteria 16858
154 Ga0068863_100213419 3300005841 Bacteria 1859
155 Ga0068863_100224130 3300005841 Bacteria 1812
156 Ga0068863_100266609 3300005841 Bacteria 1657
157 Ga0068858_100013279 3300005842 Bacteria 7764
158 Ga0068858_100110580 3300005842 Bacteria 2566
159 Ga0068858_100161911 3300005842 Bacteria 2107
160 Ga0068858_100339461 3300005842 Bacteria 1438
161 Ga0068858_100350231 3300005842 Bacteria 1415
162 Ga0068860_100002542 3300005843 Bacteria 19093
163 Ga0068860_100006072 3300005843 Bacteria 12158
164 Ga0068860_100152142 3300005843 Bacteria 2228
165 Ga0068860_100330638 3300005843 Bacteria 1497
166 Ga0068860_100356738 3300005843 Bacteria 1440
167 Ga0068862_100004445 3300005844 Bacteria 11831
168 Ga0068862_100006476 3300005844 Bacteria 9725
169 Ga0068862_100087636 3300005844 Bacteria 2707
170 Ga0068862_100418871 3300005844 Bacteria 1256
171 Ga0081455_10001284 3300005937 Bacteria 31217
172 Ga0081455_10005708 3300005937 Bacteria 13580
173 Ga0081455_10037499 3300005937 Bacteria 4304
174 Ga0081455_10108322 3300005937 Bacteria 2213
175 Ga0081455_10159267 3300005937 Bacteria 1732
176 Ga0081538_10058680 3300005981 Bacteria 2229
177 Ga0081540_1000364 3300005983 Bacteria 45462
178 Ga0081540_1001523 3300005983 Bacteria 19916
179 Ga0081540_1004169 3300005983 Bacteria 11126
180 Ga0081540_1010332 3300005983 Bacteria 6330
181 Ga0081540_1019008 3300005983 Bacteria 4194
182 Ga0081540_1019993 3300005983 Bacteria 4045
183 Ga0081540_1021450 3300005983 Bacteria 3845
184 Ga0081539_10000283 3300005985 Bacteria 114603
185 Ga0081539_10000325 3300005985 Bacteria 106431
186 Ga0081539_10018798 3300005985 Bacteria 4768
187 Ga0081539_10043566 3300005985 Bacteria 2600
188 Ga0070717_10015334 3300006028 Bacteria 5918
189 Ga0070717_10057113 3300006028 Bacteria 3226
190 Ga0075365_10079446 3300006038 Bacteria 2220
191 Ga0075363_100003813 3300006048 Bacteria 6498
192 Ga0075363_100018753 3300006048 Bacteria 3451
193 Ga0075363_100023711 3300006048 Bacteria 3114
194 Ga0075363_100059192 3300006048 Bacteria 2059
195 Ga0075432_10017251 3300006058 Bacteria 2464
196 Ga0070715_10004286 3300006163 Bacteria 4658
197 Ga0070716_100086411 3300006173 Bacteria 1886
198 Ga0070712_100073428 3300006175 Bacteria 2454
199 Ga0070712_100115783 3300006175 Bacteria 2009
200 Ga0075367_10009576 3300006178 Bacteria 5069
201 Ga0075367_10044786 3300006178 Bacteria 2595
202 Ga0075367_10087547 3300006178 Bacteria 1892
203 Ga0075366_10020521 3300006195 Bacteria 3835
204 Ga0075366_10162270 3300006195 Bacteria 1354
205 Ga0097621_100073608 3300006237 Bacteria 2828
206 Ga0075370_10034944 3300006353 Bacteria 2819
207 Ga0075370_10057213 3300006353 Bacteria 2216
208 Ga0075370_10139661 3300006353 Bacteria 1416
209 Ga0068871_100006076 3300006358 Bacteria 8497
210 Ga0068871_100021960 3300006358 Bacteria 4915
211 Ga0068871_100080194 3300006358 Bacteria 2702
212 Ga0075428_100014512 3300006844 Bacteria 8751
213 Ga0075428_100079522 3300006844 Bacteria 3578
214 Ga0075428_100099953 3300006844 Bacteria 3163
215 Ga0075428_100105041 3300006844 Bacteria 3080
216 Ga0075430_100007837 3300006846 Bacteria 9025
217 Ga0075431_100029060 3300006847 Bacteria 5687
218 Ga0075431_100029691 3300006847 Bacteria 5629
219 Ga0075433_10001844 3300006852 Bacteria 15920
220 Ga0075433_10007719 3300006852 Bacteria 8547
221 Ga0075433_10012002 3300006852 Bacteria 6987
222 Ga0075434_100001333 3300006871 Bacteria 20677
223 Ga0075434_100003168 3300006871 Bacteria 14664
224 Ga0075434_100018802 3300006871 Bacteria 6678
225 Ga0075429_100001943 3300006880 Bacteria 17164
226 Ga0068865_100001418 3300006881 Bacteria 13966
227 Ga0068865_100206619 3300006881 Bacteria 1528
228 Ga0075436_100006832 3300006914 Bacteria 7805
229 Ga0097620_100003498 3300006931 Bacteria 15989
230 Ga0097620_100026871 3300006931 Bacteria 5773
231 Ga0097620_100053665 3300006931 Bacteria 4054
232 Ga0097620_100362501 3300006931 Bacteria 1544
233 Ga0075435_100009109 3300007076 Bacteria 7165
234 Ga0075435_100036209 3300007076 Bacteria 3920
235 Ga0075435_100037729 3300007076 Bacteria 3849
236 Ga0075435_100075657 3300007076 Bacteria 2758
237 Ga0099794_10005646 3300007265 Bacteria 5036
238 Ga0099795_10005063 3300007788 Bacteria 3469
239 Ga0105251_10085650 3300009011 Bacteria 1452
240 Ga0105250_10022422 3300009092 Bacteria 2547
241 Ga0105250_10035349 3300009092 Bacteria 2005
242 Ga0105240_10012832 3300009093 Bacteria 11542
243 Ga0105240_10074194 3300009093 Bacteria 4200
244 Ga0105240_10075310 3300009093 Bacteria 4163
245 Ga0111539_10002114 3300009094 Bacteria 26555
246 Ga0111539_10004772 3300009094 Bacteria 17695
247 Ga0111539_10005561 3300009094 Bacteria 16298
248 Ga0111539_10012283 3300009094 Bacteria 10736
249 Ga0111539_10083826 3300009094 Bacteria 3748
250 Ga0111539_10372661 3300009094 Bacteria 1662
251 Ga0111539_10571973 3300009094 Bacteria 1316
252 Ga0105245_10002739 3300009098 Bacteria 15848
253 Ga0105245_10050139 3300009098 Bacteria 3740
254 Ga0105245_10251230 3300009098 Bacteria 1718
255 Ga0105245_10439747 3300009098 Bacteria 1310
256 Ga0105247_10017968 3300009101 Bacteria 4242
257 Ga0105247_10051658 3300009101 Bacteria 2532
258 Ga0105247_10081069 3300009101 Bacteria 2045
259 Ga0105247_10236810 3300009101 Bacteria 1242
260 Ga0114129_10002620 3300009147 Bacteria 25037
261 Ga0114129_10013484 3300009147 Bacteria 11647
262 Ga0114129_10183468 3300009147 Bacteria 2846
263 Ga0114129_10199476 3300009147 Bacteria 2711
264 Ga0105243_10002166 3300009148 Bacteria 16594
265 Ga0105243_10096455 3300009148 Bacteria 2446
266 Ga0105243_10203316 3300009148 Bacteria 1739
267 Ga0105241_10004380 3300009174 Bacteria 10436
268 Ga0105241_10513751 3300009174 Bacteria 1070
269 Ga0105242_10004329 3300009176 Bacteria 11054
270 Ga0105242_10025775 3300009176 Bacteria 4656
271 Ga0105242_10123944 3300009176 Bacteria 2222
272 Ga0105248_10002844 3300009177 Bacteria 19207
273 Ga0105248_10061575 3300009177 Bacteria 4214
274 Ga0105248_10100128 3300009177 Bacteria 3265
275 Ga0105248_10210129 3300009177 Bacteria 2193
276 Ga0105248_10240943 3300009177 Bacteria 2036
277 Ga0105237_10013429 3300009545 Bacteria 8589
278 Ga0105237_10444086 3300009545 Bacteria 1303
279 Ga0105238_10028576 3300009551 Bacteria 5681
280 Ga0105238_10175229 3300009551 Bacteria 2121
281 Ga0105238_10255803 3300009551 Bacteria 1730
282 Ga0105238_10278387 3300009551 Bacteria 1654
283 Ga0105249_10003955 3300009553 Bacteria 12788
284 Ga0105249_10010187 3300009553 Bacteria 8255
285 Ga0105249_10527376 3300009553 Bacteria 1229
286 Ga0099796_10004240 3300010159 Bacteria 3445
287 Ga0105239_10005997 3300010375 Bacteria 14140
288 Ga0105239_10100777 3300010375 Bacteria 3195
289 Ga0105239_10328539 3300010375 Bacteria 1725
290 Ga0105239_10370330 3300010375 Bacteria 1619
291 Ga0105246_10004149 3300011119 Bacteria 8800
292 Ga0105246_10054996 3300011119 Bacteria 2745
293 Ga0105246_10097723 3300011119 Bacteria 2131
294 Ga0157347_1002173 3300012502 Bacteria 1648
295 Ga0157373_10055690 3300013100 Bacteria 2809
296 Ga0157374_10008496 3300013296 Bacteria 8784
297 Ga0157374_10046471 3300013296 Bacteria 4020
298 Ga0157374_10118253 3300013296 Bacteria 2556
299 Ga0157374_10218874 3300013296 Bacteria 1868
300 Ga0157378_10011772 3300013297 Bacteria 7659
301 Ga0157378_10143653 3300013297 Bacteria 2218
302 Ga0157378_10302196 3300013297 Bacteria 1549
303 Ga0163162_10004494 3300013306 Bacteria 13434
304 Ga0163162_10118974 3300013306 Bacteria 2744
305 Ga0163162_10193069 3300013306 Bacteria 2164
306 Ga0157372_10215875 3300013307 Bacteria 2223
307 Ga0157375_10211421 3300013308 Bacteria 2097
308 Ga0163163_10010926 3300014325 Bacteria 8202
309 Ga0163163_10076440 3300014325 Bacteria 3343
310 Ga0163163_10186952 3300014325 Bacteria 2119
311 Ga0157380_10009077 3300014326 Bacteria 7105
312 Ga0157380_10132024 3300014326 Bacteria 2132
313 Ga0157377_10002192 3300014745 Bacteria 8583
314 Ga0157377_10039772 3300014745 Bacteria 2602
315 Ga0157379_10002658 3300014968 Bacteria 15053
316 Ga0157379_10111717 3300014968 Bacteria 2455
317 Ga0157376_10003174 3300014969 Bacteria 11291
318 Ga0157376_10119065 3300014969 Bacteria 2337
319 Ga0163161_10001452 3300017792 Bacteria 17532
320 Ga0163161_10089545 3300017792 Bacteria 2276
321 Ga0213876_10040953 3300021384 Bacteria 2447
322 Ga0209233_1006425 3300025261 Bacteria 3789
323 Ga0207666_1000032 3300025271 Bacteria 28987
324 Ga0207673_1001082 3300025290 Bacteria 2936
325 Ga0209758_1000252 3300025297 Bacteria 108214
326 Ga0209758_1008620 3300025297 Bacteria 6550
327 Ga0209050_1006160 3300025298 Bacteria 7219
328 Ga0209051_1032503 3300025303 Bacteria 1989
329 Ga0209257_1000941 3300025304 Bacteria 40201
330 Ga0207697_10000192 3300025315 Bacteria 32162
331 Ga0207653_10001002 3300025885 Bacteria 9306
332 Ga0207653_10001840 3300025885 Bacteria 6770
333 Ga0207682_10000056 3300025893 Bacteria 48265
334 Ga0207682_10004100 3300025893 Bacteria 6184
335 Ga0207692_10084680 3300025898 Bacteria 1704
336 Ga0207710_10073821 3300025900 Bacteria 1569
337 Ga0207688_10000066 3300025901 Bacteria 38551
338 Ga0207688_10049757 3300025901 Bacteria 2343
339 Ga0207688_10262395 3300025901 Bacteria 1049
340 Ga0207680_10007602 3300025903 Bacteria 5292
341 Ga0207680_10036679 3300025903 Bacteria 2825
342 Ga0207647_10004193 3300025904 Bacteria 10694
343 Ga0207699_10006906 3300025906 Bacteria 5522
344 Ga0207645_10007149 3300025907 Bacteria 7919
345 Ga0207645_10042293 3300025907 Bacteria 2915
346 Ga0207643_10000187 3300025908 Bacteria 42567
347 Ga0207643_10016847 3300025908 Bacteria 3986
348 Ga0207684_10181654 3300025910 Bacteria 1814
349 Ga0207707_10009866 3300025912 Bacteria 8276
350 Ga0207707_10112739 3300025912 Bacteria 2377
351 Ga0207695_10040269 3300025913 Bacteria 5013
352 Ga0207695_10131206 3300025913 Bacteria 2463
353 Ga0207671_10022531 3300025914 Bacteria 4762
354 Ga0207693_10005802 3300025915 Bacteria 10238
355 Ga0207663_10011824 3300025916 Bacteria 4699
356 Ga0207663_10043311 3300025916 Bacteria 2755
357 Ga0207660_10006714 3300025917 Bacteria 7452
358 Ga0207662_10000292 3300025918 Bacteria 23122
359 Ga0207662_10016478 3300025918 Bacteria 4171
360 Ga0207662_10081188 3300025918 Bacteria 1979
361 Ga0207662_10083475 3300025918 Bacteria 1953
362 Ga0207662_10137866 3300025918 Bacteria 1543
363 Ga0207657_10001630 3300025919 Bacteria 24165
364 Ga0207657_10023545 3300025919 Bacteria 5732
365 Ga0207649_10001002 3300025920 Bacteria 17465
366 Ga0207649_10016082 3300025920 Bacteria 4213
367 Ga0207649_10267799 3300025920 Bacteria 1237
368 Ga0207652_10033990 3300025921 Bacteria 4295
369 Ga0207681_10006515 3300025923 Bacteria 7166
370 Ga0207694_10038725 3300025924 Bacteria 3666
371 Ga0207694_10250567 3300025924 Bacteria 1449
372 Ga0207694_10385749 3300025924 Bacteria 1163
373 Ga0207650_10053161 3300025925 Bacteria 3002
374 Ga0207659_10002407 3300025926 Bacteria 11134
375 Ga0207659_10076721 3300025926 Bacteria 2457
376 Ga0207687_10003001 3300025927 Bacteria 11444
377 Ga0207687_10018479 3300025927 Bacteria 4603
378 Ga0207687_10020051 3300025927 Bacteria 4434
379 Ga0207687_10313860 3300025927 Bacteria 1267
380 Ga0207700_10000624 3300025928 Bacteria 20699
381 Ga0207700_10222989 3300025928 Bacteria 1599
382 Ga0207664_10041310 3300025929 Bacteria 3592
383 Ga0207664_10049743 3300025929 Bacteria 3302
384 Ga0207664_10550580 3300025929 Bacteria 1035
385 Ga0207644_10003646 3300025931 Bacteria 9990
386 Ga0207644_10112694 3300025931 Bacteria 2059
387 Ga0207644_10180094 3300025931 Bacteria 1656
388 Ga0207690_10001213 3300025932 Bacteria 16283
389 Ga0207706_10087091 3300025933 Bacteria 2746
390 Ga0207706_10143608 3300025933 Bacteria 2100
391 Ga0207686_10007500 3300025934 Bacteria 5872
392 Ga0207686_10035971 3300025934 Bacteria 2976
393 Ga0207686_10098149 3300025934 Bacteria 1950
394 Ga0207709_10001124 3300025935 Bacteria 19613
395 Ga0207709_10010108 3300025935 Bacteria 5197
396 Ga0207709_10042886 3300025935 Bacteria 2724
397 Ga0207709_10069016 3300025935 Bacteria 2236
398 Ga0207670_10001034 3300025936 Bacteria 14694
399 Ga0207670_10084163 3300025936 Bacteria 2233
400 Ga0207669_10000578 3300025937 Bacteria 15956
401 Ga0207669_10001519 3300025937 Bacteria 9883
402 Ga0207669_10184383 3300025937 Bacteria 1499
403 Ga0207704_10001542 3300025938 Bacteria 10343
404 Ga0207704_10058651 3300025938 Bacteria 2371
405 Ga0207665_10051579 3300025939 Bacteria 2769
406 Ga0207691_10002805 3300025940 Bacteria 16985
407 Ga0207691_10059114 3300025940 Bacteria 3486
408 Ga0207691_10133601 3300025940 Bacteria 2190
409 Ga0207711_10009683 3300025941 Bacteria 8028
410 Ga0207711_10010975 3300025941 Bacteria 7525
411 Ga0207711_10075471 3300025941 Bacteria 2934
412 Ga0207711_10106186 3300025941 Bacteria 2491
413 Ga0207711_10238584 3300025941 Bacteria 1667
414 Ga0207689_10001239 3300025942 Bacteria 24599
415 Ga0207689_10013332 3300025942 Bacteria 7013
416 Ga0207689_10029721 3300025942 Bacteria 4559
417 Ga0207689_10105002 3300025942 Bacteria 2321
418 Ga0207689_10159826 3300025942 Bacteria 1857
419 Ga0207661_10002038 3300025944 Bacteria 13934
420 Ga0207661_10272959 3300025944 Bacteria 1509
421 Ga0207679_10000128 3300025945 Bacteria 61823
422 Ga0207679_10000187 3300025945 Bacteria 49895
423 Ga0207679_10000529 3300025945 Bacteria 25850
424 Ga0207679_10134514 3300025945 Bacteria 1989
425 Ga0207679_10215211 3300025945 Bacteria 1614
426 Ga0207651_10150857 3300025960 Bacteria 1809
427 Ga0207712_10000520 3300025961 Bacteria 31665
428 Ga0207712_10007002 3300025961 Bacteria 7111
429 Ga0207712_10059843 3300025961 Bacteria 2698
430 Ga0207712_10178523 3300025961 Bacteria 1666
431 Ga0207668_10000260 3300025972 Bacteria 35239
432 Ga0207668_10083707 3300025972 Bacteria 2322
433 Ga0207668_10287358 3300025972 Bacteria 1351
434 Ga0207640_10006747 3300025981 Bacteria 6313
435 Ga0207658_10005448 3300025986 Bacteria 8727
436 Ga0207658_10078585 3300025986 Bacteria 2522
437 Ga0207658_10079913 3300025986 Bacteria 2503
438 Ga0207677_10004565 3300026023 Bacteria 7447
439 Ga0207677_10034880 3300026023 Bacteria 3262
440 Ga0207677_10064464 3300026023 Bacteria 2552
441 Ga0207703_10048618 3300026035 Bacteria 3425
442 Ga0207703_10088216 3300026035 Bacteria 2603
443 Ga0207703_10099515 3300026035 Bacteria 2461
444 Ga0207703_10108334 3300026035 Bacteria 2366
445 Ga0207703_10375504 3300026035 Bacteria 1314
446 Ga0207703_10518761 3300026035 Bacteria 1121
447 Ga0207639_10008245 3300026041 Bacteria 7136
448 Ga0207678_10010709 3300026067 Bacteria 8055
449 Ga0207678_10022421 3300026067 Bacteria 5530
450 Ga0207678_10096359 3300026067 Bacteria 2528
451 Ga0207678_10177681 3300026067 Bacteria 1818
452 Ga0207708_10001080 3300026075 Bacteria 20427
453 Ga0207702_10023940 3300026078 Bacteria 5067
454 Ga0207702_10054560 3300026078 Bacteria 3387
455 Ga0207641_10006255 3300026088 Bacteria 10076
456 Ga0207641_10530597 3300026088 Bacteria 1146
457 Ga0207648_10001031 3300026089 Bacteria 31313
458 Ga0207648_10026064 3300026089 Bacteria 5198
459 Ga0207648_10109172 3300026089 Bacteria 2428
460 Ga0207648_10292744 3300026089 Bacteria 1458
461 Ga0207648_10326466 3300026089 Bacteria 1380
462 Ga0207676_10007274 3300026095 Bacteria 7843
463 Ga0207676_10030745 3300026095 Bacteria 4033
464 Ga0207674_10000686 3300026116 Bacteria 44016
465 Ga0207674_10002162 3300026116 Bacteria 24860
466 Ga0207674_10038995 3300026116 Bacteria 4927
467 Ga0207674_10332605 3300026116 Bacteria 1469
468 Ga0207675_100002806 3300026118 Bacteria 17123
469 Ga0207675_100053032 3300026118 Bacteria 3785
470 Ga0207675_100091682 3300026118 Bacteria 2857
471 Ga0207675_100093102 3300026118 Bacteria 2834
472 Ga0207675_100240610 3300026118 Bacteria 1749
473 Ga0207675_100334160 3300026118 Bacteria 1482
474 Ga0207683_10001401 3300026121 Bacteria 21763
475 Ga0207683_10001686 3300026121 Bacteria 19759
476 Ga0207683_10010853 3300026121 Bacteria 7769
477 Ga0207683_10016536 3300026121 Bacteria 6279
478 Ga0207683_10082213 3300026121 Bacteria 2861
479 Ga0207683_10233220 3300026121 Bacteria 1679
480 Ga0207698_10007006 3300026142 Bacteria 7060
481 Ga0210002_1001464 3300027617 Bacteria 3335
482 Ga0209974_10000101 3300027876 Bacteria 24130
483 Ga0207428_10000556 3300027907 Bacteria 44098
484 Ga0207428_10004410 3300027907 Bacteria 13398
485 Ga0207428_10006906 3300027907 Bacteria 10403
486 Ga0207428_10110819 3300027907 Bacteria 2113
487 Ga0207428_10307674 3300027907 Bacteria 1172
488 Ga0268266_10014609 3300028379 Bacteria 6747
489 Ga0268266_10087455 3300028379 Bacteria 2726
490 Ga0268266_10095164 3300028379 Bacteria 2615
491 Ga0268265_10000526 3300028380 Bacteria 39043
492 Ga0268265_10011478 3300028380 Bacteria 5989
493 Ga0268265_10017139 3300028380 Bacteria 4991
494 Ga0268265_10051913 3300028380 Bacteria 3098
495 Ga0268265_10251532 3300028380 Bacteria 1565
496 Ga0268264_10002582 3300028381 Bacteria 15846
497 Ga0268264_10011449 3300028381 Bacteria 7324
498 Ga0268264_10097368 3300028381 Bacteria 2550
499 Ga0268264_10188922 3300028381 Bacteria 1876
500 Ga0268264_10300602 3300028381 Bacteria 1511
501 Ga0307515_10017392 3300028794 Bacteria 13100
502 Ga0265325_10005264 3300031241 Bacteria 8028
503 Ga0265340_10063635 3300031247 Bacteria 1760
504 Ga0307513_10268655 3300031456 Bacteria 1490
505 Ga0307513_10396906 3300031456 Bacteria 1114
506 Ga0307509_10259540 3300031507 Bacteria 1514
507 Ga0307411_10359679 3300032005 Bacteria 1190
508 Ga0373930_0001149 3300034816 Bacteria 3863
509 Ga0373930_0020289 3300034816 Bacteria 1294
510 Ga0373948_0003693 3300034817 Bacteria 2374
511 Ga0373948_0004372 3300034817 Bacteria 2230
512 Ga0373958_0002098 3300034819 Bacteria 2759
513 Ga0373938_0000039 3300034957 Bacteria 17106
514 Ga0373938_0001739 3300034957 Bacteria 3478
515 Ga0373938_0001859 3300034957 Bacteria 3371
516 Ga0373926_0000271 3300035083 Bacteria 12550
517 Ga0373928_0000780 3300035084 Bacteria 6190
518 Ga0373928_0000840 3300035084 Bacteria 6012
519 Ga0373929_0000209 3300035085 Bacteria 10585
520 Ga0373929_0003474 3300035085 Bacteria 2839
521 Ga0373934_0035221 3300035086 Bacteria 1969
522 Ga0373940_0001653 3300035088 Bacteria 4110
523 Ga0373940_0002811 3300035088 Bacteria 3456
524 Ga0373944_0031092 3300035089 Bacteria 1605
525 Ga0373949_0002695 3300035090 Bacteria 4453
526 Ga0373951_0001984 3300035091 Bacteria 5243
527 Ga0373951_0004793 3300035091 Bacteria 3186
528 Ga0373952_0000127 3300035092 Bacteria 10765
529 Ga0373952_0003717 3300035092 Bacteria 2757
530 Ga0373932_0000284 3300035112 Bacteria 15261
531 Ga0373939_0000404 3300035114 Bacteria 10883
532 Ga0373939_0001563 3300035114 Bacteria 5560
533 Ga0373939_0001999 3300035114 Bacteria 4866
534 Ga0373941_0000331 3300035115 Bacteria 9261
535 Ga0373941_0002275 3300035115 Bacteria 4201
536 Ga0373945_0007272 3300035116 Bacteria 3584
537 Ga0373945_0065976 3300035116 Bacteria 1360
538 Ga0373953_0012983 3300035117 Bacteria 2964
539 Ga0373954_0015544 3300035118 Bacteria 3402
540 Ga0373956_0128954 3300035119 Bacteria 1183
541 Ga0373957_0008715 3300035120 Bacteria 3299
542 Ga0373960_0001425 3300035121 Bacteria 5290
543 Ga0373960_0005455 3300035121 Bacteria 2947
544 Ga0373943_0002708 3300035170 Bacteria 8046
545 Ga0373946_0005868 3300035171 Bacteria 4447
546 Ga0373946_0010205 3300035171 Bacteria 3473
547 Ga0373942_0000702 3300035207 Bacteria 9287
548 Ga0373942_0006804 3300035207 Bacteria 2642
549 Ga0373961_0001992 3300035241 Bacteria 5491
550 Ga0373961_0010626 3300035241 Bacteria 2271
551 Ga0373962_0000320 3300035242 Bacteria 10433
552 Ga0373962_0000506 3300035242 Bacteria 8687
553 Ga0373924_0121392 3300035410 Bacteria 1134
554 Ga0373931_0000560 3300035691 Bacteria 15333
555 Ga0373931_0040143 3300035691 Bacteria 2454
556 Ga0373935_0001308 3300035692 Bacteria 13756
557 Ga0373935_0018206 3300035692 Bacteria 4271
558 Ga0373935_0214290 3300035692 Bacteria 1335
559 Ga0373927_0000783 3300035695 Bacteria 24265
560 Ga0373927_0018861 3300035695 Bacteria 4526
561 Ga0373927_0023971 3300035695 Bacteria 3992
562 Ga0373927_0084943 3300035695 Bacteria 2053
563 Ga0373927_0091297 3300035695 Bacteria 1978
564 Ga0373947_0001653 3300035725 Bacteria 13648
565 Ga0373947_0012265 3300035725 Bacteria 4910
566 Ga0373947_0044230 3300035725 Bacteria 2660
567 Ga0373937_0006032 3300036401 Bacteria 10436
568 Ga0373937_0012619 3300036401 Bacteria 7436
569 Ga0373925_0018615 3300037068 Bacteria 5049
570 Ga0373925_0029250 3300037068 Bacteria 4042
571 Ga0436365_0932459 3300039437 Bacteria 27077
572 Ga0436362_1100180 3300039453 Bacteria 2449
573 Ga0439465_0021541 3300041413 Bacteria 2022
574 Ga0453684_0036597 3300044712 Bacteria 6761
575 Ga0453684_0145135 3300044712 Bacteria 2828
576 Ga0451576_0002032 3300045051 Bacteria 31949
577 Ga0495592_0002856 3300046454 Bacteria 12273
578 Ga0495603_0004790 3300046455 Bacteria 8083
579 Ga0495603_0022991 3300046455 Bacteria 3773
580 Ga0495629_0000062 3300046459 Bacteria 97169
581 Ga0495629_0000133 3300046459 Bacteria 64806
582 Ga0495629_0080159 3300046459 Bacteria 2279
583 Ga0495638_0007516 3300046460 Bacteria 7802
584 Ga0495638_0047629 3300046460 Bacteria 2687
585 Ga0495641_0003044 3300046461 Bacteria 12816
586 Ga0495641_0037306 3300046461 Bacteria 2279
587 Ga0495651_0034793 3300046462 Bacteria 3926
588 Ga0495651_0040741 3300046462 Bacteria 3610
589 Ga0495653_0005558 3300046463 Bacteria 10277
590 Ga0495580_0006148 3300046472 Bacteria 9817
591 Ga0495582_0000016 3300046473 Bacteria 100714
592 Ga0495582_0062785 3300046473 Bacteria 2052
593 Ga0495605_0031333 3300046474 Bacteria 2717
594 Ga0495639_0000014 3300046475 Bacteria 82866
595 Ga0495639_0092075 3300046475 Bacteria 1423
596 Ga0495662_0000086 3300046476 Bacteria 33465
597 Ga0495662_0018720 3300046476 Bacteria 3353
598 Ga0495664_0004321 3300046477 Bacteria 7764
599 Ga0495664_0007306 3300046477 Bacteria 6130
600 Ga0495585_0014998 3300046492 Bacteria 4506
601 Ga0495585_0125580 3300046492 Bacteria 1354
602 Ga0495594_0000051 3300046499 Bacteria 52030
603 Ga0495594_0017981 3300046499 Bacteria 3742
604 Ga0495594_0019890 3300046499 Bacteria 3571
605 Ga0495596_0022644 3300046500 Bacteria 2557
606 Ga0495607_0003759 3300046501 Bacteria 11476
607 Ga0495607_0066167 3300046501 Bacteria 2035
608 Ga0495606_0000196 3300046507 Bacteria 105765
609 Ga0495606_0151685 3300046507 Bacteria 1359
610 Ga0495608_0035779 3300046511 Bacteria 3347
611 Ga0495608_0048199 3300046511 Bacteria 2832
612 Ga0495620_0040702 3300046515 Bacteria 2043
613 Ga0495628_0066548 3300046516 Bacteria 2816
614 Ga0495628_0186659 3300046516 Bacteria 1566
615 Ga0495630_0168103 3300046517 Bacteria 1670
616 Ga0495630_0448203 3300046517 Bacteria 989
617 Ga0495631_0029011 3300046518 Bacteria 2520
618 Ga0495643_0154124 3300046522 Bacteria 1135
619 Ga0495644_0001526 3300046523 Bacteria 9445
620 Ga0495663_0016230 3300046525 Bacteria 2105
621 Ga0495663_0044029 3300046525 Bacteria 1365
622 Ga0495666_0020761 3300046526 Bacteria 3252
623 Ga0495652_0016308 3300046529 Bacteria 6645
624 Ga0495652_0019750 3300046529 Bacteria 5994
625 Ga0495652_0036434 3300046529 Bacteria 4278
626 Ga0495665_0000477 3300046531 Bacteria 20160
627 Ga0495665_0004060 3300046531 Bacteria 7900
628 Ga0495640_0001817 3300046533 Bacteria 16924
629 Ga0495640_0033985 3300046533 Bacteria 3620
630 Ga0495586_0051995 3300046535 Bacteria 2217
631 Ga0495587_0019433 3300046536 Bacteria 4203
632 Ga0495587_0026695 3300046536 Bacteria 3520
633 Ga0495598_0004841 3300046537 Bacteria 2944
634 Ga0495621_0031114 3300046539 Bacteria 1829
635 Ga0495621_0045064 3300046539 Bacteria 1561
636 Ga0495597_0078541 3300046542 Bacteria 1414
637 Ga0495645_0004437 3300046543 Bacteria 9581
638 Ga0495622_0004212 3300046557 Bacteria 6706
639 Ga0495622_0049656 3300046557 Bacteria 1948
640 Ga0495633_0011523 3300046558 Bacteria 4761
641 Ga0495667_0174753 3300046559 Bacteria 1379
642 Ga0495656_0013341 3300046615 Bacteria 3055
643 Ga0495656_0017206 3300046615 Bacteria 2756
644 Ga0495656_0053620 3300046615 Bacteria 1733
645 Ga0495634_0003306 3300046642 Bacteria 12988
646 Ga0495635_0000792 3300046663 Bacteria 20615
647 Ga0495635_0018235 3300046663 Bacteria 4899
648 Ga0495635_0021486 3300046663 Bacteria 4499
649 Ga0495635_0034721 3300046663 Bacteria 3498
650 Ga0495661_0125360 3300046665 Bacteria 1414
651 Ga0495588_0001039 3300046674 Bacteria 12085
652 Ga0495588_0010799 3300046674 Bacteria 4263
653 Ga0495657_0038362 3300046675 Bacteria 3297
654 Ga0495599_0004968 3300046678 Bacteria 7906
655 Ga0495623_0016192 3300046679 Bacteria 4816
656 Ga0495623_0026596 3300046679 Bacteria 3723
657 Ga0495646_0058613 3300046680 Bacteria 2302
658 Ga0495646_0186123 3300046680 Bacteria 1137
659 Ga0495647_0004293 3300046681 Bacteria 4616
660 Ga0495647_0022391 3300046681 Bacteria 2282
661 Ga0495658_0001354 3300046683 Bacteria 12855
662 Ga0495658_0001821 3300046683 Bacteria 10930
663 Ga0495669_0045204 3300046684 Bacteria 1963
664 Ga0495613_0004613 3300046689 Bacteria 10342
665 Ga0495613_0225514 3300046689 Bacteria 1314
666 Ga0495624_0000138 3300046690 Bacteria 52220
667 Ga0495624_0005912 3300046690 Bacteria 8745
668 Ga0495624_0094497 3300046690 Bacteria 1843
669 Ga0495670_0008127 3300046691 Bacteria 5156
670 Ga0495649_0103024 3300046694 Bacteria 1516
671 Ga0495589_0037947 3300046794 Bacteria 2413
672 Ga0495589_0043868 3300046794 Bacteria 2225
673 Ga0495600_0001540 3300046809 Bacteria 12811
674 Ga0495600_0018820 3300046809 Bacteria 4406
675 Ga0495600_0027533 3300046809 Bacteria 3673
676 Ga0495581_0000001 3300047315 Bacteria 104278
677 Ga0495674_0002545 3300047319 Bacteria 17760
678 Ga0495674_0043344 3300047319 Bacteria 4005
679 Ga0495674_0079422 3300047319 Bacteria 2817
680 Ga0495672_0007184 3300047320 Bacteria 8418
681 Ga0495672_0126542 3300047320 Bacteria 1350
682 Ga0495676_0003317 3300047321 Bacteria 14549
683 Ga0495676_0045286 3300047321 Bacteria 3582
684 Ga0495680_0012838 3300047322 Bacteria 7341
685 Ga0495680_0018631 3300047322 Bacteria 5884
686 Ga0495680_0050298 3300047322 Bacteria 3259
687 Ga0495684_0037806 3300047471 Bacteria 3702
688 Ga0495684_0129706 3300047471 Bacteria 1894
689 Ga0495686_0237239 3300047472 Bacteria 1030
690 Ga0495593_0009139 3300047673 Bacteria 5748
691 Ga0495593_0014248 3300047673 Bacteria 4521
692 Ga0495602_0014448 3300048088 Bacteria 8013
693 Ga0495614_0006055 3300048089 Bacteria 5438
694 Ga0495614_0009894 3300048089 Bacteria 4209
695 Ga0495614_0046833 3300048089 Bacteria 1854
696 Ga0496100_0002706 3300048903 Bacteria 9055
697 Ga0496100_0073170 3300048903 Bacteria 2293
698 Ga0496100_0101300 3300048903 Bacteria 1985
699 Ga0496101_0001628 3300048904 Bacteria 13504
700 Ga0496101_0010321 3300048904 Bacteria 6167
701 Ga0496102_0015481 3300048905 Bacteria 6644
702 Ga0496102_0030868 3300048905 Bacteria 4800
703 Ga0496102_0081388 3300048905 Bacteria 2985
704 Ga0496102_0134882 3300048905 Bacteria 2313
705 Ga0496102_0611925 3300048905 Bacteria 1012
706 Ga0496103_0005233 3300048906 Bacteria 7791
707 Ga0496103_0010092 3300048906 Bacteria 5584
708 Ga0496103_0216263 3300048906 Bacteria 1232
709 Ga0496104_0000708 3300048907 Bacteria 28659
710 Ga0496104_0000878 3300048907 Bacteria 25861
711 Ga0496104_0007168 3300048907 Bacteria 9828
712 Ga0496104_0162172 3300048907 Bacteria 2144
713 Ga0496104_0319531 3300048907 Bacteria 1465
714 Ga0496105_0000170 3300048908 Bacteria 43535
715 Ga0496105_0006994 3300048908 Bacteria 8690
716 Ga0496105_0050731 3300048908 Bacteria 3428
717 Ga0496105_0135747 3300048908 Bacteria 2027
718 Ga0496106_0002421 3300048909 Bacteria 13909
719 Ga0496106_0006026 3300048909 Bacteria 8969
720 Ga0496106_0025298 3300048909 Bacteria 4417
721 Ga0496107_0001176 3300048910 Bacteria 15887
722 Ga0496107_0010452 3300048910 Bacteria 6449
723 Ga0496107_0100388 3300048910 Bacteria 2121
724 Ga0496107_0159721 3300048910 Bacteria 1670
725 Ga0496108_0002952 3300048911 Bacteria 13673
726 Ga0496108_0009970 3300048911 Bacteria 7699
727 Ga0496108_0057164 3300048911 Bacteria 3278
728 Ga0496108_0119653 3300048911 Bacteria 2258
729 Ga0496108_0196555 3300048911 Bacteria 1749
730 Ga0496108_0387325 3300048911 Bacteria 1221
731 Ga0496109_0002262 3300048912 Bacteria 16001
732 Ga0496109_0017571 3300048912 Bacteria 6272
733 Ga0496110_0135653 3300048913 Bacteria 2224
734 Ga0496110_0194600 3300048913 Bacteria 1841
735 Ga0496110_0221107 3300048913 Bacteria 1722
736 Ga0496110_0322762 3300048913 Bacteria 1406
737 Ga0496110_0388349 3300048913 Bacteria 1272
738 Ga0496110_0454350 3300048913 Bacteria 1167
739 Ga0496111_0093417 3300048914 Bacteria 2205
740 Ga0496111_0256092 3300048914 Bacteria 1298
741 Ga0496112_0000044 3300048915 Bacteria 86865
742 Ga0496112_0004283 3300048915 Bacteria 12045
743 Ga0496112_0053758 3300048915 Bacteria 3956
744 Ga0496113_0074965 3300048916 Bacteria 2581
745 Ga0496114_0016162 3300048917 Bacteria 6007
746 Ga0496114_0116161 3300048917 Bacteria 2297
747 Ga0496115_0028382 3300048918 Bacteria 4385
748 Ga0496115_0031277 3300048918 Bacteria 4193
749 Ga0496115_0043136 3300048918 Bacteria 3596
750 Ga0496115_0128083 3300048918 Bacteria 2092
751 Ga0496118_0158970 3300048921 Bacteria 1401
752 Ga0496120_0184413 3300048923 Bacteria 1022
753 Ga0496121_0073333 3300048924 Bacteria 2744
754 Ga0496121_0107611 3300048924 Bacteria 2135
755 Ga0496121_0142920 3300048924 Bacteria 1772
756 Ga0496124_0144281 3300048927 Bacteria 1875
757 Ga0496125_0126011 3300048928 Bacteria 1815
758 Ga0496126_0002321 3300048929 Bacteria 26096
759 Ga0496126_0051884 3300048929 Bacteria 3732
760 Ga0496126_0099060 3300048929 Bacteria 2553
761 Ga0501031_0112848 3300049568 Bacteria 1775
762 Ga0501032_0191264 3300049569 Bacteria 1337
763 Ga0501034_0000439 3300049571 Bacteria 68932
764 Ga0501034_0009890 3300049571 Bacteria 9969
765 Ga0501034_0043559 3300049571 Bacteria 4542
766 Ga0501036_0003914 3300049572 Bacteria 11957
767 Ga0501036_0057739 3300049572 Bacteria 3287
768 Ga0501036_0279039 3300049572 Bacteria 1398
769 Ga0501037_0019460 3300049573 Bacteria 5008
770 Ga0501037_0025804 3300049573 Bacteria 4340
771 Ga0501039_0125358 3300049575 Bacteria 2014
772 Ga0501039_0222538 3300049575 Bacteria 1483
773 Ga0501043_0004742 3300049579 Bacteria 11027
774 Ga0501046_0026760 3300049580 Bacteria 4711
775 Ga0501046_0034566 3300049580 Bacteria 4078
776 Ga0501047_0000073 3300049581 Bacteria 125990
777 Ga0501047_0048704 3300049581 Bacteria 4092
778 Ga0501048_0000391 3300049582 Bacteria 30448
779 Ga0501048_0046611 3300049582 Bacteria 3094
780 Ga0501067_0123765 3300049583 Bacteria 1439
781 Ga0501067_0129562 3300049583 Bacteria 1404
782 Ga0501068_0001678 3300049584 Bacteria 11821
783 Ga0501070_0242188 3300049586 Bacteria 1476
784 Ga0501071_0017604 3300049587 Bacteria 4932
785 Ga0501071_0291845 3300049587 Bacteria 1235
786 Ga0501073_0023413 3300049589 Bacteria 4434
787 Ga0501073_0036444 3300049589 Bacteria 3495
788 Ga0501074_0003433 3300049590 Bacteria 11233
789 Ga0501074_0006078 3300049590 Bacteria 8719
790 Ga0501079_0030387 3300049741 Bacteria 4150
791 Ga0501079_0195923 3300049741 Bacteria 1577
792 Ga0501080_0001281 3300049742 Bacteria 20890
793 Ga0501080_0332718 3300049742 Bacteria 1373
794 Ga0501083_0000139 3300049744 Bacteria 49384
795 Ga0501035_0218848 3300049822 Bacteria 1626
796 Ga0501044_0017222 3300049823 Bacteria 7750
797 nmdc:mga03n38_43426_c1 3300050490 Bacteria 1970
798 nmdc:mga03n38_53476_c1 3300050490 Bacteria 1811
799 nmdc:mga03n38_93684_c1 3300050490 Bacteria 1435
800 nmdc:mga00v17_17327_c1 3300050491 Bacteria 4076
801 nmdc:mga0yw44_105578_c1 3300050492 Bacteria 1799
802 nmdc:mga0yw44_31714_c1 3300050492 Bacteria 3075
803 nmdc:mga0k408_20253_c1 3300050493 Bacteria 3725
804 nmdc:mga06z11_127319_c1 3300050494 Bacteria 1426
805 nmdc:mga06z11_15030_c1 3300050494 Bacteria 3446
806 nmdc:mga06z11_26462_c1 3300050494 Bacteria 2760
807 nmdc:mga06z11_31192_c1 3300050494 Bacteria 2587
808 nmdc:mga06z11_37195_c1 3300050494 Bacteria 2409
809 nmdc:mga07m45_126979_c1 3300050496 Bacteria 1475
810 nmdc:mga07m45_31239_c1 3300050496 Bacteria 2951
811 nmdc:mga05p37_130245_c1 3300050507 Bacteria 3086
812 nmdc:mga05p37_2004_c1 3300050507 Bacteria 23770
813 nmdc:mga05p37_415307_c1 3300050507 Bacteria 1567
814 nmdc:mga05p37_84058_c1 3300050507 Bacteria 3922
815 nmdc:mga09592_1420_c1 3300050508 Bacteria 19222
816 nmdc:mga0qj67_106662_c1 3300050509 Bacteria 2260
817 nmdc:mga0qj67_1926_c1 3300050509 Bacteria 14741
818 nmdc:mga06r32_306375_c1 3300050510 Bacteria 1574
819 nmdc:mga06r32_3887_c1 3300050510 Bacteria 13382
820 nmdc:mga08y16_12146_c1 3300050511 Bacteria 9052
821 nmdc:mga08y16_24134_c1 3300050511 Bacteria 6420
822 nmdc:mga08y16_309_c1 3300050511 Bacteria 44098
823 nmdc:mga08y16_67024_c1 3300050511 Bacteria 3745
824 nmdc:mga08y16_71712_c1 3300050511 Bacteria 3610
825 nmdc:mga0n895_104_c1 3300050512 Bacteria 49584
826 nmdc:mga0n895_214674_c1 3300050512 Bacteria 1954
827 nmdc:mga0n895_31703_c1 3300050512 Bacteria 5064
828 nmdc:mga0n895_3374_c1 3300050512 Bacteria 12846
829 nmdc:mga0rr50_19159_c1 3300050513 Bacteria 4613
830 nmdc:mga0rr50_19514_c1 3300050513 Bacteria 4578
831 nmdc:mga0rr50_49108_c1 3300050513 Bacteria 3123
832 nmdc:mga0rr50_63313_c1 3300050513 Bacteria 2793
833 nmdc:mga0rr50_95159_c1 3300050513 Bacteria 2327
834 nmdc:mga08x19_178295_c1 3300050514 Bacteria 1450
835 nmdc:mga0a205_13087_c1 3300050515 Bacteria 7706
836 nmdc:mga0a205_17590_c1 3300050515 Bacteria 6708
837 nmdc:mga0a205_223901_c1 3300050515 Bacteria 1766
838 nmdc:mga0a205_2257_c1 3300050515 Bacteria 16994
839 nmdc:mga0a205_2795_c1 3300050515 Bacteria 15434
840 nmdc:mga0a205_356716_c1 3300050515 Bacteria 1329
841 Ga0495601_0000398 3300053077 Bacteria 23035
842 Ga0495601_0000780 3300053077 Bacteria 17215
843 Ga0495601_0031266 3300053077 Bacteria 3308
844 Ga0495601_0096910 3300053077 Bacteria 1902
845 Ga0495612_0004115 3300053078 Bacteria 6024
846 Ga0495595_0005908 3300053084 Bacteria 4962
847 Ga0495619_0000086 3300053085 Bacteria 69774
848 Ga0495619_0000378 3300053085 Bacteria 30722
849 Ga0495619_0012264 3300053085 Bacteria 5392
850 Ga0500643_013361 3300053087 Bacteria 2902
851 Ga0500651_0015984 3300053093 Bacteria 4614
852 Ga0500651_0084515 3300053093 Bacteria 1962
853 Ga0500650_0094131 3300053098 Bacteria 1402
854 Ga0500555_008196 3300053103 Bacteria 2979
855 Ga0500569_012778 3300053109 Bacteria 2039
856 Ga0500595_000016 3300053119 Bacteria 211397
857 Ga0500595_024769 3300053119 Bacteria 2090
858 Ga0500642_0002249 3300053130 Bacteria 5634
859 Ga0500616_0000006 3300053153 Bacteria 944738
860 Ga0500616_0016114 3300053153 Bacteria 4262
861 Ga0500622_0123742 3300053156 Bacteria 1251
862 Ga0500645_000563 3300053730 Bacteria 24381
863 Ga0501082_0040310 3300060353 Bacteria 4029
864 2643757033 2643221547 Bacteria 4740017
865 2644291293 2643221651 Bacteria 4798932
866 2894776980 2894772417 Bacteria 5305674
867 8006984542 8006984368 Bacteria 9651211
868 nmdc:mga08y16_157079_c1
869 2214884080
870 ARSoilYngRDRAFT_c00383
871 ARcpr5yngRDRAFT_c000053
872 ARSoilOldRDRAFT_c000064
873 ARCol0oldRDRAFT_c00196
874 ARCol0yngRDRAFT_1000047
875 JGI24032J14994_100011
876 JGI24739J22299_10000985
877 JGI24737J22298_10001495
878 JGI24743J22301_10004989
879 JGI24735J21928_10028651
880 JGI24750J21931_1000203
881 JGI24745J21846_1000637
882 JGI24748J21848_1001162
883 JGI24738J21930_10001441
884 JGI24749J21850_1002555
885 JGI24033J26618_1000758
886 JGI24034J26672_10004848
887 JGI24742J22300_10000487
888 JGI24751J29686_10007328
889 JGI24751J29686_10018362
890 JGI25406J46586_10000391
891 JGI25153J46596_10001262
892 JGI25153J46596_10004562
893 JGI25404J52841_10006537
894 JGI25405J52794_10007572
895 Ga0065716_1001797
896 Ga0065712_10083010
897 Ga0065712_10155545
898 Ga0065707_10168364
899 Ga0070658_10093373
900 Ga0070676_10001056
901 Ga0070683_100003491
902 Ga0070683_100286151
903 Ga0070690_100009732
904 Ga0070670_100007890
905 Ga0070670_100409661
906 Ga0070677_10000206
907 Ga0070677_10022398
908 Ga0068869_100062506
909 Ga0068869_100087929
910 Ga0070666_10007454
911 Ga0070666_10083170
912 Ga0070682_100001749
913 Ga0068868_100004491
914 Ga0068868_100093946
915 Ga0068868_100109593
916 Ga0070660_100002617
917 Ga0070660_100302041
918 Ga0070689_100006306
919 Ga0070689_100072358
920 Ga0070691_10087066
921 Ga0070687_100005432
922 Ga0070687_100047343
923 Ga0070661_100006928
924 Ga0070661_100307061
925 Ga0070661_100380362
926 Ga0070692_10221775
927 Ga0070668_100000882
928 Ga0070668_100049554
929 Ga0070668_100278863
930 Ga0070669_100002256
931 Ga0070675_100001384
932 Ga0070671_100001328
933 Ga0070674_100002239
934 Ga0070674_100005092
935 Ga0070674_100011327
936 Ga0070673_100002806
937 Ga0070673_100035386
938 Ga0070688_100001008
939 Ga0070688_100100550
940 Ga0070659_100007170
941 Ga0070667_100003216
942 Ga0070667_100022298
943 Ga0070667_100073127
944 Ga0070703_10000772
945 Ga0070703_10002909
946 Ga0070709_10004081
947 Ga0070709_10037229
948 Ga0070713_100004461
949 Ga0070713_100032677
950 Ga0070713_100078436
951 Ga0070710_10026679
952 Ga0070701_10015213
953 Ga0070701_10037246
954 Ga0070705_100000044
955 Ga0070705_100010190
956 Ga0070700_100000556
957 Ga0070700_100032746
958 Ga0070694_100001349
959 Ga0070694_100018131
960 Ga0070694_100026556
961 Ga0070708_100052624
962 Ga0070708_100126603
963 Ga0070663_100010106
964 Ga0070663_100032420
965 Ga0070663_100094202
966 Ga0070678_100018301
967 Ga0070678_100069997
968 Ga0070678_100328242
969 Ga0070662_100006933
970 Ga0070662_100167599
971 Ga0070681_10013387
972 Ga0070681_10133280
973 Ga0068867_100002573
974 Ga0070685_10001130
975 Ga0070706_100267015
976 Ga0070698_100136919
977 Ga0070698_100153140
978 Ga0070699_100009483
979 Ga0070679_100012382
980 Ga0070684_100059581
981 Ga0070684_100066301
982 Ga0070684_100211719
983 Ga0068853_100000906
984 Ga0068853_100297265
985 Ga0070672_100000679
986 Ga0070672_100189744
987 Ga0070686_100001681
988 Ga0070686_100280422
989 Ga0070695_100000050
990 Ga0070696_100003655
991 Ga0070693_100029320
992 Ga0070693_100269004
993 Ga0070665_100016320
994 Ga0070665_100161848
995 Ga0070665_100185753
996 Ga0070704_100003917
997 Ga0070704_100180318
998 Ga0068855_100005213
999 Ga0070664_100008267
1000 Ga0070664_100180706
1001 Ga0068857_100002095
1002 Ga0068857_100051463
1003 Ga0068857_100087953
1004 Ga0068854_100001485
1005 Ga0068856_100004080
1006 Ga0070702_100073133
1007 Ga0070702_100183437
1008 Ga0068852_100009647
1009 Ga0068859_100003498
1010 Ga0068859_100026869
1011 Ga0068859_100053671
1012 Ga0068864_100006196
1013 Ga0068864_100140196
1014 Ga0068866_10002003
1015 Ga0068866_10091077
1016 Ga0068861_100041623
1017 Ga0068861_100061720
1018 Ga0068861_100207794
1019 Ga0068861_100240076
1020 Ga0068863_100002935
1021 Ga0068863_100213419
1022 Ga0068863_100224130
1023 Ga0068863_100266609
1024 Ga0068858_100013279
1025 Ga0068858_100110580
1026 Ga0068858_100161911
1027 Ga0068858_100339461
1028 Ga0068858_100350231
1029 Ga0068860_100002542
1030 Ga0068860_100006072
1031 Ga0068860_100152142
1032 Ga0068860_100330638
1033 Ga0068860_100356738
1034 Ga0068862_100004445
1035 Ga0068862_100006476
1036 Ga0068862_100087636
1037 Ga0068862_100418871
1038 Ga0081455_10001284
1039 Ga0081455_10005708
1040 Ga0081455_10037499
1041 Ga0081455_10108322
1042 Ga0081455_10159267
1043 Ga0081538_10058680
1044 Ga0081540_1000364
1045 Ga0081540_1001523
1046 Ga0081540_1004169
1047 Ga0081540_1010332
1048 Ga0081540_1019008
1049 Ga0081540_1019993
1050 Ga0081540_1021450
1051 Ga0081539_10000283
1052 Ga0081539_10000325
1053 Ga0081539_10018798
1054 Ga0081539_10043566
1055 Ga0070717_10015334
1056 Ga0070717_10057113
1057 Ga0075365_10079446
1058 Ga0075363_100003813
1059 Ga0075363_100018753
1060 Ga0075363_100023711
1061 Ga0075363_100059192
1062 Ga0075432_10017251
1063 Ga0070715_10004286
1064 Ga0070716_100086411
1065 Ga0070712_100073428
1066 Ga0070712_100115783
1067 Ga0075367_10009576
1068 Ga0075367_10044786
1069 Ga0075367_10087547
1070 Ga0075366_10020521
1071 Ga0075366_10162270
1072 Ga0097621_100073608
1073 Ga0075370_10034944
1074 Ga0075370_10057213
1075 Ga0075370_10139661
1076 Ga0068871_100006076
1077 Ga0068871_100021960
1078 Ga0068871_100080194
1079 Ga0075428_100014512
1080 Ga0075428_100079522
1081 Ga0075428_100099953
1082 Ga0075428_100105041
1083 Ga0075430_100007837
1084 Ga0075431_100029060
1085 Ga0075431_100029691
1086 Ga0075433_10001844
1087 Ga0075433_10007719
1088 Ga0075433_10012002
1089 Ga0075434_100001333
1090 Ga0075434_100003168
1091 Ga0075434_100018802
1092 Ga0075429_100001943
1093 Ga0068865_100001418
1094 Ga0068865_100206619
1095 Ga0075436_100006832
1096 Ga0097620_100003498
1097 Ga0097620_100026871
1098 Ga0097620_100053665
1099 Ga0097620_100362501
1100 Ga0075435_100009109
1101 Ga0075435_100036209
1102 Ga0075435_100037729
1103 Ga0075435_100075657
1104 Ga0099794_10005646
1105 Ga0099795_10005063
1106 Ga0105251_10085650
1107 Ga0105250_10022422
1108 Ga0105250_10035349
1109 Ga0105240_10012832
1110 Ga0105240_10074194
1111 Ga0105240_10075310
1112 Ga0111539_10002114
1113 Ga0111539_10004772
1114 Ga0111539_10005561
1115 Ga0111539_10012283
1116 Ga0111539_10083826
1117 Ga0111539_10372661
1118 Ga0111539_10571973
1119 Ga0105245_10002739
1120 Ga0105245_10050139
1121 Ga0105245_10251230
1122 Ga0105245_10439747
1123 Ga0105247_10017968
1124 Ga0105247_10051658
1125 Ga0105247_10081069
1126 Ga0105247_10236810
1127 Ga0114129_10002620
1128 Ga0114129_10013484
1129 Ga0114129_10183468
1130 Ga0114129_10199476
1131 Ga0105243_10002166
1132 Ga0105243_10096455
1133 Ga0105243_10203316
1134 Ga0105241_10004380
1135 Ga0105241_10513751
1136 Ga0105242_10004329
1137 Ga0105242_10025775
1138 Ga0105242_10123944
1139 Ga0105248_10002844
1140 Ga0105248_10061575
1141 Ga0105248_10100128
1142 Ga0105248_10210129
1143 Ga0105248_10240943
1144 Ga0105237_10013429
1145 Ga0105237_10444086
1146 Ga0105238_10028576
1147 Ga0105238_10175229
1148 Ga0105238_10255803
1149 Ga0105238_10278387
1150 Ga0105249_10003955
1151 Ga0105249_10010187
1152 Ga0105249_10527376
1153 Ga0099796_10004240
1154 Ga0105239_10005997
1155 Ga0105239_10100777
1156 Ga0105239_10328539
1157 Ga0105239_10370330
1158 Ga0105246_10004149
1159 Ga0105246_10054996
1160 Ga0105246_10097723
1161 Ga0157347_1002173
1162 Ga0157373_10055690
1163 Ga0157374_10008496
1164 Ga0157374_10046471
1165 Ga0157374_10118253
1166 Ga0157374_10218874
1167 Ga0157378_10011772
1168 Ga0157378_10143653
1169 Ga0157378_10302196
1170 Ga0163162_10004494
1171 Ga0163162_10118974
1172 Ga0163162_10193069
1173 Ga0157372_10215875
1174 Ga0157375_10211421
1175 Ga0163163_10010926
1176 Ga0163163_10076440
1177 Ga0163163_10186952
1178 Ga0157380_10009077
1179 Ga0157380_10132024
1180 Ga0157377_10002192
1181 Ga0157377_10039772
1182 Ga0157379_10002658
1183 Ga0157379_10111717
1184 Ga0157376_10003174
1185 Ga0157376_10119065
1186 Ga0163161_10001452
1187 Ga0163161_10089545
1188 Ga0213876_10040953
1189 Ga0209233_1006425
1190 Ga0207666_1000032
1191 Ga0207673_1001082
1192 Ga0209758_1000252
1193 Ga0209758_1008620
1194 Ga0209050_1006160
1195 Ga0209051_1032503
1196 Ga0209257_1000941
1197 Ga0207697_10000192
1198 Ga0207653_10001002
1199 Ga0207653_10001840
1200 Ga0207682_10000056
1201 Ga0207682_10004100
1202 Ga0207692_10084680
1203 Ga0207710_10073821
1204 Ga0207688_10000066
1205 Ga0207688_10049757
1206 Ga0207688_10262395
1207 Ga0207680_10007602
1208 Ga0207680_10036679
1209 Ga0207647_10004193
1210 Ga0207699_10006906
1211 Ga0207645_10007149
1212 Ga0207645_10042293
1213 Ga0207643_10000187
1214 Ga0207643_10016847
1215 Ga0207684_10181654
1216 Ga0207707_10009866
1217 Ga0207707_10112739
1218 Ga0207695_10040269
1219 Ga0207695_10131206
1220 Ga0207671_10022531
1221 Ga0207693_10005802
1222 Ga0207663_10011824
1223 Ga0207663_10043311
1224 Ga0207660_10006714
1225 Ga0207662_10000292
1226 Ga0207662_10016478
1227 Ga0207662_10081188
1228 Ga0207662_10083475
1229 Ga0207662_10137866
1230 Ga0207657_10001630
1231 Ga0207657_10023545
1232 Ga0207649_10001002
1233 Ga0207649_10016082
1234 Ga0207649_10267799
1235 Ga0207652_10033990
1236 Ga0207681_10006515
1237 Ga0207694_10038725
1238 Ga0207694_10250567
1239 Ga0207694_10385749
1240 Ga0207650_10053161
1241 Ga0207659_10002407
1242 Ga0207659_10076721
1243 Ga0207687_10003001
1244 Ga0207687_10018479
1245 Ga0207687_10020051
1246 Ga0207687_10313860
1247 Ga0207700_10000624
1248 Ga0207700_10222989
1249 Ga0207664_10041310
1250 Ga0207664_10049743
1251 Ga0207664_10550580
1252 Ga0207644_10003646
1253 Ga0207644_10112694
1254 Ga0207644_10180094
1255 Ga0207690_10001213
1256 Ga0207706_10087091
1257 Ga0207706_10143608
1258 Ga0207686_10007500
1259 Ga0207686_10035971
1260 Ga0207686_10098149
1261 Ga0207709_10001124
1262 Ga0207709_10010108
1263 Ga0207709_10042886
1264 Ga0207709_10069016
1265 Ga0207670_10001034
1266 Ga0207670_10084163
1267 Ga0207669_10000578
1268 Ga0207669_10001519
1269 Ga0207669_10184383
1270 Ga0207704_10001542
1271 Ga0207704_10058651
1272 Ga0207665_10051579
1273 Ga0207691_10002805
1274 Ga0207691_10059114
1275 Ga0207691_10133601
1276 Ga0207711_10009683
1277 Ga0207711_10010975
1278 Ga0207711_10075471
1279 Ga0207711_10106186
1280 Ga0207711_10238584
1281 Ga0207689_10001239
1282 Ga0207689_10013332
1283 Ga0207689_10029721
1284 Ga0207689_10105002
1285 Ga0207689_10159826
1286 Ga0207661_10002038
1287 Ga0207661_10272959
1288 Ga0207679_10000128
1289 Ga0207679_10000187
1290 Ga0207679_10000529
1291 Ga0207679_10134514
1292 Ga0207679_10215211
1293 Ga0207651_10150857
1294 Ga0207712_10000520
1295 Ga0207712_10007002
1296 Ga0207712_10059843
1297 Ga0207712_10178523
1298 Ga0207668_10000260
1299 Ga0207668_10083707
1300 Ga0207668_10287358
1301 Ga0207640_10006747
1302 Ga0207658_10005448
1303 Ga0207658_10078585
1304 Ga0207658_10079913
1305 Ga0207677_10004565
1306 Ga0207677_10034880
1307 Ga0207677_10064464
1308 Ga0207703_10048618
1309 Ga0207703_10088216
1310 Ga0207703_10099515
1311 Ga0207703_10108334
1312 Ga0207703_10375504
1313 Ga0207703_10518761
1314 Ga0207639_10008245
1315 Ga0207678_10010709
1316 Ga0207678_10022421
1317 Ga0207678_10096359
1318 Ga0207678_10177681
1319 Ga0207708_10001080
1320 Ga0207702_10023940
1321 Ga0207702_10054560
1322 Ga0207641_10006255
1323 Ga0207641_10530597
1324 Ga0207648_10001031
1325 Ga0207648_10026064
1326 Ga0207648_10109172
1327 Ga0207648_10292744
1328 Ga0207648_10326466
1329 Ga0207676_10007274
1330 Ga0207676_10030745
1331 Ga0207674_10000686
1332 Ga0207674_10002162
1333 Ga0207674_10038995
1334 Ga0207674_10332605
1335 Ga0207675_100002806
1336 Ga0207675_100053032
1337 Ga0207675_100091682
1338 Ga0207675_100093102
1339 Ga0207675_100240610
1340 Ga0207675_100334160
1341 Ga0207683_10001401
1342 Ga0207683_10001686
1343 Ga0207683_10010853
1344 Ga0207683_10016536
1345 Ga0207683_10082213
1346 Ga0207683_10233220
1347 Ga0207698_10007006
1348 Ga0210002_1001464
1349 Ga0209974_10000101
1350 Ga0207428_10000556
1351 Ga0207428_10004410
1352 Ga0207428_10006906
1353 Ga0207428_10110819
1354 Ga0207428_10307674
1355 Ga0268266_10014609
1356 Ga0268266_10087455
1357 Ga0268266_10095164
1358 Ga0268265_10000526
1359 Ga0268265_10011478
1360 Ga0268265_10017139
1361 Ga0268265_10051913
1362 Ga0268265_10251532
1363 Ga0268264_10002582
1364 Ga0268264_10011449
1365 Ga0268264_10097368
1366 Ga0268264_10188922
1367 Ga0268264_10300602
1368 Ga0307515_10017392
1369 Ga0265325_10005264
1370 Ga0265340_10063635
1371 Ga0307513_10268655
1372 Ga0307513_10396906
1373 Ga0307509_10259540
1374 Ga0307411_10359679
1375 Ga0373930_0001149
1376 Ga0373930_0020289
1377 Ga0373948_0003693
1378 Ga0373948_0004372
1379 Ga0373958_0002098
1380 Ga0373938_0000039
1381 Ga0373938_0001739
1382 Ga0373938_0001859
1383 Ga0373926_0000271
1384 Ga0373928_0000780
1385 Ga0373928_0000840
1386 Ga0373929_0000209
1387 Ga0373929_0003474
1388 Ga0373934_0035221
1389 Ga0373940_0001653
1390 Ga0373940_0002811
1391 Ga0373944_0031092
1392 Ga0373949_0002695
1393 Ga0373951_0001984
1394 Ga0373951_0004793
1395 Ga0373952_0000127
1396 Ga0373952_0003717
1397 Ga0373932_0000284
1398 Ga0373939_0000404
1399 Ga0373939_0001563
1400 Ga0373939_0001999
1401 Ga0373941_0000331
1402 Ga0373941_0002275
1403 Ga0373945_0007272
1404 Ga0373945_0065976
1405 Ga0373953_0012983
1406 Ga0373954_0015544
1407 Ga0373956_0128954
1408 Ga0373957_0008715
1409 Ga0373960_0001425
1410 Ga0373960_0005455
1411 Ga0373943_0002708
1412 Ga0373946_0005868
1413 Ga0373946_0010205
1414 Ga0373942_0000702
1415 Ga0373942_0006804
1416 Ga0373961_0001992
1417 Ga0373961_0010626
1418 Ga0373962_0000320
1419 Ga0373962_0000506
1420 Ga0373924_0121392
1421 Ga0373931_0000560
1422 Ga0373931_0040143
1423 Ga0373935_0001308
1424 Ga0373935_0018206
1425 Ga0373935_0214290
1426 Ga0373927_0000783
1427 Ga0373927_0018861
1428 Ga0373927_0023971
1429 Ga0373927_0084943
1430 Ga0373927_0091297
1431 Ga0373947_0001653
1432 Ga0373947_0012265
1433 Ga0373947_0044230
1434 Ga0373937_0006032
1435 Ga0373937_0012619
1436 Ga0373925_0018615
1437 Ga0373925_0029250
1438 Ga0436365_0932459
1439 Ga0436362_1100180
1440 Ga0439465_0021541
1441 Ga0453684_0036597
1442 Ga0453684_0145135
1443 Ga0451576_0002032
1444 Ga0495592_0002856
1445 Ga0495603_0004790
1446 Ga0495603_0022991
1447 Ga0495629_0000062
1448 Ga0495629_0000133
1449 Ga0495629_0080159
1450 Ga0495638_0007516
1451 Ga0495638_0047629
1452 Ga0495641_0003044
1453 Ga0495641_0037306
1454 Ga0495651_0034793
1455 Ga0495651_0040741
1456 Ga0495653_0005558
1457 Ga0495580_0006148
1458 Ga0495582_0000016
1459 Ga0495582_0062785
1460 Ga0495605_0031333
1461 Ga0495639_0000014
1462 Ga0495639_0092075
1463 Ga0495662_0000086
1464 Ga0495662_0018720
1465 Ga0495664_0004321
1466 Ga0495664_0007306
1467 Ga0495585_0014998
1468 Ga0495585_0125580
1469 Ga0495594_0000051
1470 Ga0495594_0017981
1471 Ga0495594_0019890
1472 Ga0495596_0022644
1473 Ga0495607_0003759
1474 Ga0495607_0066167
1475 Ga0495606_0000196
1476 Ga0495606_0151685
1477 Ga0495608_0035779
1478 Ga0495608_0048199
1479 Ga0495620_0040702
1480 Ga0495628_0066548
1481 Ga0495628_0186659
1482 Ga0495630_0168103
1483 Ga0495630_0448203
1484 Ga0495631_0029011
1485 Ga0495643_0154124
1486 Ga0495644_0001526
1487 Ga0495663_0016230
1488 Ga0495663_0044029
1489 Ga0495666_0020761
1490 Ga0495652_0016308
1491 Ga0495652_0019750
1492 Ga0495652_0036434
1493 Ga0495665_0000477
1494 Ga0495665_0004060
1495 Ga0495640_0001817
1496 Ga0495640_0033985
1497 Ga0495586_0051995
1498 Ga0495587_0019433
1499 Ga0495587_0026695
1500 Ga0495598_0004841
1501 Ga0495621_0031114
1502 Ga0495621_0045064
1503 Ga0495597_0078541
1504 Ga0495645_0004437
1505 Ga0495622_0004212
1506 Ga0495622_0049656
1507 Ga0495633_0011523
1508 Ga0495667_0174753
1509 Ga0495656_0013341
1510 Ga0495656_0017206
1511 Ga0495656_0053620
1512 Ga0495634_0003306
1513 Ga0495635_0000792
1514 Ga0495635_0018235
1515 Ga0495635_0021486
1516 Ga0495635_0034721
1517 Ga0495661_0125360
1518 Ga0495588_0001039
1519 Ga0495588_0010799
1520 Ga0495657_0038362
1521 Ga0495599_0004968
1522 Ga0495623_0016192
1523 Ga0495623_0026596
1524 Ga0495646_0058613
1525 Ga0495646_0186123
1526 Ga0495647_0004293
1527 Ga0495647_0022391
1528 Ga0495658_0001354
1529 Ga0495658_0001821
1530 Ga0495669_0045204
1531 Ga0495613_0004613
1532 Ga0495613_0225514
1533 Ga0495624_0000138
1534 Ga0495624_0005912
1535 Ga0495624_0094497
1536 Ga0495670_0008127
1537 Ga0495649_0103024
1538 Ga0495589_0037947
1539 Ga0495589_0043868
1540 Ga0495600_0001540
1541 Ga0495600_0018820
1542 Ga0495600_0027533
1543 Ga0495581_0000001
1544 Ga0495674_0002545
1545 Ga0495674_0043344
1546 Ga0495674_0079422
1547 Ga0495672_0007184
1548 Ga0495672_0126542
1549 Ga0495676_0003317
1550 Ga0495676_0045286
1551 Ga0495680_0012838
1552 Ga0495680_0018631
1553 Ga0495680_0050298
1554 Ga0495684_0037806
1555 Ga0495684_0129706
1556 Ga0495686_0237239
1557 Ga0495593_0009139
1558 Ga0495593_0014248
1559 Ga0495602_0014448
1560 Ga0495614_0006055
1561 Ga0495614_0009894
1562 Ga0495614_0046833
1563 Ga0496100_0002706
1564 Ga0496100_0073170
1565 Ga0496100_0101300
1566 Ga0496101_0001628
1567 Ga0496101_0010321
1568 Ga0496102_0015481
1569 Ga0496102_0030868
1570 Ga0496102_0081388
1571 Ga0496102_0134882
1572 Ga0496102_0611925
1573 Ga0496103_0005233
1574 Ga0496103_0010092
1575 Ga0496103_0216263
1576 Ga0496104_0000708
1577 Ga0496104_0000878
1578 Ga0496104_0007168
1579 Ga0496104_0162172
1580 Ga0496104_0319531
1581 Ga0496105_0000170
1582 Ga0496105_0006994
1583 Ga0496105_0050731
1584 Ga0496105_0135747
1585 Ga0496106_0002421
1586 Ga0496106_0006026
1587 Ga0496106_0025298
1588 Ga0496107_0001176
1589 Ga0496107_0010452
1590 Ga0496107_0100388
1591 Ga0496107_0159721
1592 Ga0496108_0002952
1593 Ga0496108_0009970
1594 Ga0496108_0057164
1595 Ga0496108_0119653
1596 Ga0496108_0196555
1597 Ga0496108_0387325
1598 Ga0496109_0002262
1599 Ga0496109_0017571
1600 Ga0496110_0135653
1601 Ga0496110_0194600
1602 Ga0496110_0221107
1603 Ga0496110_0322762
1604 Ga0496110_0388349
1605 Ga0496110_0454350
1606 Ga0496111_0093417
1607 Ga0496111_0256092
1608 Ga0496112_0000044
1609 Ga0496112_0004283
1610 Ga0496112_0053758
1611 Ga0496113_0074965
1612 Ga0496114_0016162
1613 Ga0496114_0116161
1614 Ga0496115_0028382
1615 Ga0496115_0031277
1616 Ga0496115_0043136
1617 Ga0496115_0128083
1618 Ga0496118_0158970
1619 Ga0496120_0184413
1620 Ga0496121_0073333
1621 Ga0496121_0107611
1622 Ga0496121_0142920
1623 Ga0496124_0144281
1624 Ga0496125_0126011
1625 Ga0496126_0002321
1626 Ga0496126_0051884
1627 Ga0496126_0099060
1628 Ga0501031_0112848
1629 Ga0501032_0191264
1630 Ga0501034_0000439
1631 Ga0501034_0009890
1632 Ga0501034_0043559
1633 Ga0501036_0003914
1634 Ga0501036_0057739
1635 Ga0501036_0279039
1636 Ga0501037_0019460
1637 Ga0501037_0025804
1638 Ga0501039_0125358
1639 Ga0501039_0222538
1640 Ga0501043_0004742
1641 Ga0501046_0026760
1642 Ga0501046_0034566
1643 Ga0501047_0000073
1644 Ga0501047_0048704
1645 Ga0501048_0000391
1646 Ga0501048_0046611
1647 Ga0501067_0123765
1648 Ga0501067_0129562
1649 Ga0501068_0001678
1650 Ga0501070_0242188
1651 Ga0501071_0017604
1652 Ga0501071_0291845
1653 Ga0501073_0023413
1654 Ga0501073_0036444
1655 Ga0501074_0003433
1656 Ga0501074_0006078
1657 Ga0501079_0030387
1658 Ga0501079_0195923
1659 Ga0501080_0001281
1660 Ga0501080_0332718
1661 Ga0501083_0000139
1662 Ga0501035_0218848
1663 Ga0501044_0017222
1664 nmdc:mga03n38_43426_c1
1665 nmdc:mga03n38_53476_c1
1666 nmdc:mga03n38_93684_c1
1667 nmdc:mga00v17_17327_c1
1668 nmdc:mga0yw44_105578_c1
1669 nmdc:mga0yw44_31714_c1
1670 nmdc:mga0k408_20253_c1
1671 nmdc:mga06z11_127319_c1
1672 nmdc:mga06z11_15030_c1
1673 nmdc:mga06z11_26462_c1
1674 nmdc:mga06z11_31192_c1
1675 nmdc:mga06z11_37195_c1
1676 nmdc:mga07m45_126979_c1
1677 nmdc:mga07m45_31239_c1
1678 nmdc:mga05p37_130245_c1
1679 nmdc:mga05p37_2004_c1
1680 nmdc:mga05p37_415307_c1
1681 nmdc:mga05p37_84058_c1
1682 nmdc:mga09592_1420_c1
1683 nmdc:mga0qj67_106662_c1
1684 nmdc:mga0qj67_1926_c1
1685 nmdc:mga06r32_306375_c1
1686 nmdc:mga06r32_3887_c1
1687 nmdc:mga08y16_12146_c1
1688 nmdc:mga08y16_24134_c1
1689 nmdc:mga08y16_309_c1
1690 nmdc:mga08y16_67024_c1
1691 nmdc:mga08y16_71712_c1
1692 nmdc:mga0n895_104_c1
1693 nmdc:mga0n895_214674_c1
1694 nmdc:mga0n895_31703_c1
1695 nmdc:mga0n895_3374_c1
1696 nmdc:mga0rr50_19159_c1
1697 nmdc:mga0rr50_19514_c1
1698 nmdc:mga0rr50_49108_c1
1699 nmdc:mga0rr50_63313_c1
1700 nmdc:mga0rr50_95159_c1
1701 nmdc:mga08x19_178295_c1
1702 nmdc:mga0a205_13087_c1
1703 nmdc:mga0a205_17590_c1
1704 nmdc:mga0a205_223901_c1
1705 nmdc:mga0a205_2257_c1
1706 nmdc:mga0a205_2795_c1
1707 nmdc:mga0a205_356716_c1
1708 Ga0495601_0000398
1709 Ga0495601_0000780
1710 Ga0495601_0031266
1711 Ga0495601_0096910
1712 Ga0495612_0004115
1713 Ga0495595_0005908
1714 Ga0495619_0000086
1715 Ga0495619_0000378
1716 Ga0495619_0012264
1717 Ga0500643_013361
1718 Ga0500651_0015984
1719 Ga0500651_0084515
1720 Ga0500650_0094131
1721 Ga0500555_008196
1722 Ga0500569_012778
1723 Ga0500595_000016
1724 Ga0500595_024769
1725 Ga0500642_0002249
1726 Ga0500616_0000006
1727 Ga0500616_0016114
1728 Ga0500622_0123742
1729 Ga0500645_000563
1730 Ga0501082_0040310
1731 2643757033
1732 2644291293
1733 2894776980
1734 8006984542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

34

300

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ng7-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899), target efi-510094, apo, open structure 0.9326 31 328
4p47-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket 0.9229 28 328
4ng7-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899), target efi-510094, apo, open structure 0.9142 31 328
4p1e-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from escherichia fergusonii (efer_1530), target efi-510119, apo open structure, phased with iodide 0.9132 30 329
4p1e-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from escherichia fergusonii (efer_1530), target efi-510119, apo open structure, phased with iodide 0.9045 30 329
ID Description Score Start End Superfamily
4ng7A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9326 31 328 3.40.190.170
4p47A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.923 28 328 3.40.190.170
4ng7A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9142 31 328 3.40.190.170
4p1eA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9132 30 329 3.40.190.170
4p1eA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9045 30 329 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A1C6HAA1-F1-model_v4 Extracytoplasmic solute receptor protein yiaO 0.9249 25 328 GO:0030288
GO:0055085
AF-A0A2I2A6W2-F1-model_v4 Leucine-binding protein domain-containing protein 0.9208 27 307 GO:0030288
GO:0055085
AF-A0A3D5VSW4-F1-model_v4 ABC transporter substrate-binding protein 0.9149 16 329 GO:0030288
GO:0055085
AF-A0A3P3EGW7-F1-model_v4 DctP family TRAP transporter solute-binding subunit 0.9133 65 329 GO:0030288
GO:0055085
AF-A0A6N9IYW7-F1-model_v4 DctP family TRAP transporter solute-binding subunit 0.9133 23 314 GO:0030288
GO:0055085

Map